(data stored in ACNUC7421 zone)

EMBL: CP000264

ID   CP000264; SV 1; circular; genomic DNA; STD; PRO; 4317977 BP.
XX
AC   CP000264; AAIG01000000-AAIG01000025;
XX
PR   Project:PRJNA12733;
XX
DT   02-MAR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Jannaschia sp. CCS1, complete genome.
XX
KW   .
XX
OS   Jannaschia sp. CCS1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Jannaschia; unclassified Jannaschia.
XX
RN   [1]
RP   1-4317977
RX   DOI; 10.1128/AEM.02580-06.
RX   PUBMED; 17526795.
RA   Moran M.A., Belas R., Schell M.A., Gonzalez J.M., Sun F., Sun S.,
RA   Binder B.J., Edmonds J., Ye W., Orcutt B., Howard E.C., Meile C.,
RA   Palefsky W., Goesmann A., Ren Q., Paulsen I., Ulrich L.E., Thompson L.S.,
RA   Saunders E., Buchan A.;
RT   "Ecological genomics of marine Roseobacters";
RL   Appl. Environ. Microbiol. 73(14):4559-4569(2007).
XX
RN   [2]
RP   1-4317977
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Brettin T., Bruce D.,
RA   Han C., Tapia R., Gilna P., Chertkov O., Saunders E., Schmutz J.,
RA   Larimer F., Land M., Kyrpides N., Lykidis A., Moran M.A., Belas R., Ye W.,
RA   Buchan A., Gonzalez J.M., Schell M.A., Richardson P.;
RT   "Complete sequence of chromosome of Jannaschia sp. CCS1";
RL   Unpublished.
XX
RN   [3]
RP   1-4317977
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Brettin T., Bruce D.,
RA   Han C., Tapia R., Gilna P., Chertkov O., Saunders E., Schmutz J.,
RA   Larimer F., Land M., Kyrpides N., Lykidis A., Moran M.A., Belas R., Ye W.,
RA   Buchan A., Gonzalez J.M., Schell M.A., Richardson P.;
RT   ;
RL   Submitted (23-FEB-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9eb1c1feaca1acb4f97e46932c4b32ea.
DR   BioSample; SAMN02598279.
DR   EnsemblGenomes-Gn; EBG00001096217.
DR   EnsemblGenomes-Gn; EBG00001096218.
DR   EnsemblGenomes-Gn; EBG00001096219.
DR   EnsemblGenomes-Gn; EBG00001096220.
DR   EnsemblGenomes-Gn; EBG00001096221.
DR   EnsemblGenomes-Gn; EBG00001096222.
DR   EnsemblGenomes-Gn; EBG00001096223.
DR   EnsemblGenomes-Gn; EBG00001096224.
DR   EnsemblGenomes-Gn; EBG00001096225.
DR   EnsemblGenomes-Gn; EBG00001096226.
DR   EnsemblGenomes-Gn; EBG00001096227.
DR   EnsemblGenomes-Gn; EBG00001096228.
DR   EnsemblGenomes-Gn; EBG00001096229.
DR   EnsemblGenomes-Gn; EBG00001096230.
DR   EnsemblGenomes-Gn; EBG00001096231.
DR   EnsemblGenomes-Gn; EBG00001096232.
DR   EnsemblGenomes-Gn; EBG00001096233.
DR   EnsemblGenomes-Gn; EBG00001096234.
DR   EnsemblGenomes-Gn; EBG00001096235.
DR   EnsemblGenomes-Gn; EBG00001096236.
DR   EnsemblGenomes-Gn; EBG00001096237.
DR   EnsemblGenomes-Gn; EBG00001096238.
DR   EnsemblGenomes-Gn; EBG00001096239.
DR   EnsemblGenomes-Gn; EBG00001096240.
DR   EnsemblGenomes-Gn; EBG00001096241.
DR   EnsemblGenomes-Gn; EBG00001096242.
DR   EnsemblGenomes-Gn; EBG00001096243.
DR   EnsemblGenomes-Gn; EBG00001096244.
DR   EnsemblGenomes-Gn; EBG00001096245.
DR   EnsemblGenomes-Gn; EBG00001096246.
DR   EnsemblGenomes-Gn; EBG00001096247.
DR   EnsemblGenomes-Gn; EBG00001096248.
DR   EnsemblGenomes-Gn; EBG00001096249.
DR   EnsemblGenomes-Gn; EBG00001096250.
DR   EnsemblGenomes-Gn; EBG00001096251.
DR   EnsemblGenomes-Gn; EBG00001096252.
DR   EnsemblGenomes-Gn; EBG00001096253.
DR   EnsemblGenomes-Gn; EBG00001096254.
DR   EnsemblGenomes-Gn; EBG00001096255.
DR   EnsemblGenomes-Gn; EBG00001096256.
DR   EnsemblGenomes-Gn; EBG00001096257.
DR   EnsemblGenomes-Gn; EBG00001096258.
DR   EnsemblGenomes-Gn; EBG00001096259.
DR   EnsemblGenomes-Gn; EBG00001096260.
DR   EnsemblGenomes-Gn; EBG00001096261.
DR   EnsemblGenomes-Gn; EBG00001096262.
DR   EnsemblGenomes-Gn; EBG00001096263.
DR   EnsemblGenomes-Gn; EBG00001096264.
DR   EnsemblGenomes-Gn; EBG00001096265.
DR   EnsemblGenomes-Gn; EBG00001096266.
DR   EnsemblGenomes-Gn; Jann_R0001.
DR   EnsemblGenomes-Gn; Jann_R0002.
DR   EnsemblGenomes-Gn; Jann_R0003.
DR   EnsemblGenomes-Gn; Jann_R0004.
DR   EnsemblGenomes-Gn; Jann_R0006.
DR   EnsemblGenomes-Gn; Jann_R0007.
DR   EnsemblGenomes-Gn; Jann_R0008.
DR   EnsemblGenomes-Gn; Jann_R0010.
DR   EnsemblGenomes-Gn; Jann_R0011.
DR   EnsemblGenomes-Gn; Jann_R0012.
DR   EnsemblGenomes-Gn; Jann_R0013.
DR   EnsemblGenomes-Gn; Jann_R0014.
DR   EnsemblGenomes-Gn; Jann_R0015.
DR   EnsemblGenomes-Gn; Jann_R0016.
DR   EnsemblGenomes-Gn; Jann_R0017.
DR   EnsemblGenomes-Gn; Jann_R0018.
DR   EnsemblGenomes-Gn; Jann_R0020.
DR   EnsemblGenomes-Gn; Jann_R0021.
DR   EnsemblGenomes-Gn; Jann_R0022.
DR   EnsemblGenomes-Gn; Jann_R0023.
DR   EnsemblGenomes-Gn; Jann_R0024.
DR   EnsemblGenomes-Gn; Jann_R0025.
DR   EnsemblGenomes-Gn; Jann_R0026.
DR   EnsemblGenomes-Gn; Jann_R0027.
DR   EnsemblGenomes-Gn; Jann_R0028.
DR   EnsemblGenomes-Gn; Jann_R0029.
DR   EnsemblGenomes-Gn; Jann_R0030.
DR   EnsemblGenomes-Gn; Jann_R0031.
DR   EnsemblGenomes-Gn; Jann_R0032.
DR   EnsemblGenomes-Gn; Jann_R0033.
DR   EnsemblGenomes-Gn; Jann_R0035.
DR   EnsemblGenomes-Gn; Jann_R0036.
DR   EnsemblGenomes-Gn; Jann_R0037.
DR   EnsemblGenomes-Gn; Jann_R0038.
DR   EnsemblGenomes-Gn; Jann_R0039.
DR   EnsemblGenomes-Gn; Jann_R0040.
DR   EnsemblGenomes-Gn; Jann_R0043.
DR   EnsemblGenomes-Gn; Jann_R0044.
DR   EnsemblGenomes-Gn; Jann_R0046.
DR   EnsemblGenomes-Gn; Jann_R0047.
DR   EnsemblGenomes-Gn; Jann_R0048.
DR   EnsemblGenomes-Gn; Jann_R0049.
DR   EnsemblGenomes-Gn; Jann_R0050.
DR   EnsemblGenomes-Gn; Jann_R0051.
DR   EnsemblGenomes-Gn; Jann_R0052.
DR   EnsemblGenomes-Gn; Jann_R0053.
DR   EnsemblGenomes-Tr; EBT00001550159.
DR   EnsemblGenomes-Tr; EBT00001550162.
DR   EnsemblGenomes-Tr; EBT00001550167.
DR   EnsemblGenomes-Tr; EBT00001550170.
DR   EnsemblGenomes-Tr; EBT00001550171.
DR   EnsemblGenomes-Tr; EBT00001550173.
DR   EnsemblGenomes-Tr; EBT00001550174.
DR   EnsemblGenomes-Tr; EBT00001550175.
DR   EnsemblGenomes-Tr; EBT00001550178.
DR   EnsemblGenomes-Tr; EBT00001550181.
DR   EnsemblGenomes-Tr; EBT00001550184.
DR   EnsemblGenomes-Tr; EBT00001550185.
DR   EnsemblGenomes-Tr; EBT00001550187.
DR   EnsemblGenomes-Tr; EBT00001550190.
DR   EnsemblGenomes-Tr; EBT00001550192.
DR   EnsemblGenomes-Tr; EBT00001550194.
DR   EnsemblGenomes-Tr; EBT00001550195.
DR   EnsemblGenomes-Tr; EBT00001550198.
DR   EnsemblGenomes-Tr; EBT00001550199.
DR   EnsemblGenomes-Tr; EBT00001550201.
DR   EnsemblGenomes-Tr; EBT00001550203.
DR   EnsemblGenomes-Tr; EBT00001550204.
DR   EnsemblGenomes-Tr; EBT00001550207.
DR   EnsemblGenomes-Tr; EBT00001550209.
DR   EnsemblGenomes-Tr; EBT00001550212.
DR   EnsemblGenomes-Tr; EBT00001550215.
DR   EnsemblGenomes-Tr; EBT00001550217.
DR   EnsemblGenomes-Tr; EBT00001550219.
DR   EnsemblGenomes-Tr; EBT00001550221.
DR   EnsemblGenomes-Tr; EBT00001550224.
DR   EnsemblGenomes-Tr; EBT00001550226.
DR   EnsemblGenomes-Tr; EBT00001550230.
DR   EnsemblGenomes-Tr; EBT00001550231.
DR   EnsemblGenomes-Tr; EBT00001550233.
DR   EnsemblGenomes-Tr; EBT00001550234.
DR   EnsemblGenomes-Tr; EBT00001550236.
DR   EnsemblGenomes-Tr; EBT00001550239.
DR   EnsemblGenomes-Tr; EBT00001550241.
DR   EnsemblGenomes-Tr; EBT00001550242.
DR   EnsemblGenomes-Tr; EBT00001550244.
DR   EnsemblGenomes-Tr; EBT00001550245.
DR   EnsemblGenomes-Tr; EBT00001550247.
DR   EnsemblGenomes-Tr; EBT00001550248.
DR   EnsemblGenomes-Tr; EBT00001550249.
DR   EnsemblGenomes-Tr; EBT00001550252.
DR   EnsemblGenomes-Tr; EBT00001550253.
DR   EnsemblGenomes-Tr; EBT00001550257.
DR   EnsemblGenomes-Tr; EBT00001550260.
DR   EnsemblGenomes-Tr; EBT00001550263.
DR   EnsemblGenomes-Tr; EBT00001550266.
DR   EnsemblGenomes-Tr; Jann_R0001-1.
DR   EnsemblGenomes-Tr; Jann_R0002-1.
DR   EnsemblGenomes-Tr; Jann_R0003-1.
DR   EnsemblGenomes-Tr; Jann_R0004-1.
DR   EnsemblGenomes-Tr; Jann_R0006-1.
DR   EnsemblGenomes-Tr; Jann_R0007-1.
DR   EnsemblGenomes-Tr; Jann_R0008-1.
DR   EnsemblGenomes-Tr; Jann_R0010-1.
DR   EnsemblGenomes-Tr; Jann_R0011-1.
DR   EnsemblGenomes-Tr; Jann_R0012-1.
DR   EnsemblGenomes-Tr; Jann_R0013-1.
DR   EnsemblGenomes-Tr; Jann_R0014-1.
DR   EnsemblGenomes-Tr; Jann_R0015-1.
DR   EnsemblGenomes-Tr; Jann_R0016-1.
DR   EnsemblGenomes-Tr; Jann_R0017-1.
DR   EnsemblGenomes-Tr; Jann_R0018-1.
DR   EnsemblGenomes-Tr; Jann_R0020-1.
DR   EnsemblGenomes-Tr; Jann_R0021-1.
DR   EnsemblGenomes-Tr; Jann_R0022-1.
DR   EnsemblGenomes-Tr; Jann_R0023-1.
DR   EnsemblGenomes-Tr; Jann_R0024-1.
DR   EnsemblGenomes-Tr; Jann_R0025-1.
DR   EnsemblGenomes-Tr; Jann_R0026-1.
DR   EnsemblGenomes-Tr; Jann_R0027-1.
DR   EnsemblGenomes-Tr; Jann_R0028-1.
DR   EnsemblGenomes-Tr; Jann_R0029-1.
DR   EnsemblGenomes-Tr; Jann_R0030-1.
DR   EnsemblGenomes-Tr; Jann_R0031-1.
DR   EnsemblGenomes-Tr; Jann_R0032-1.
DR   EnsemblGenomes-Tr; Jann_R0033-1.
DR   EnsemblGenomes-Tr; Jann_R0035-1.
DR   EnsemblGenomes-Tr; Jann_R0036-1.
DR   EnsemblGenomes-Tr; Jann_R0037-1.
DR   EnsemblGenomes-Tr; Jann_R0038-1.
DR   EnsemblGenomes-Tr; Jann_R0039-1.
DR   EnsemblGenomes-Tr; Jann_R0040-1.
DR   EnsemblGenomes-Tr; Jann_R0043-1.
DR   EnsemblGenomes-Tr; Jann_R0044-1.
DR   EnsemblGenomes-Tr; Jann_R0046-1.
DR   EnsemblGenomes-Tr; Jann_R0047-1.
DR   EnsemblGenomes-Tr; Jann_R0048-1.
DR   EnsemblGenomes-Tr; Jann_R0049-1.
DR   EnsemblGenomes-Tr; Jann_R0050-1.
DR   EnsemblGenomes-Tr; Jann_R0051-1.
DR   EnsemblGenomes-Tr; Jann_R0052-1.
DR   EnsemblGenomes-Tr; Jann_R0053-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01727; SAM-SAH.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000264.
DR   SILVA-SSU; CP000264.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Mary Ann Moran
CC   (mmoran@uga.edu)
CC   Contacts: Mary Ann Moran (mmoran@uga.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4317977
FT                   /organism="Jannaschia sp. CCS1"
FT                   /strain="CCS1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290400"
FT   gene            48..1475
FT                   /locus_tag="Jann_0001"
FT   CDS_pept        48..1475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52918"
FT                   /db_xref="GOA:Q28WI0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WI0"
FT                   /protein_id="ABD52918.1"
FT                   /translation="MTNDTWNEVRQDLLKVVGKNNFSAWIEPIDFDRIDERTAHFHVPT
FT                   NFIGSWVTNNFGDLILRQLSAHGAGADRVKFTVSPKAGAAVAAPANTSAPRPVPEMAAA
FT                   APAPAPVHHTAPAPAPVAAPAQPRELPGAKLNPNFTFANFVVGKPNELAHAAARRVAET
FT                   LDVTFNPLFLYGGVGLGKTHLMHAIAWDLQDRHPDAKILFLSAEQFMHRFVRALREQDT
FT                   FNFKETFRSVDILMVDDVQFIAGKTSTQQEFFHTFNALVEMGKQIVISGDRAPVDMEEL
FT                   DNRIASRLQCGLVVDIHPTDYELRLGVLQHKAELLGAKYPHITFATGVLEYLAQKISSN
FT                   VRVLEGALTRLFAFADLVRREVTVDLAKECLTDVLRATDKKVTMDEILKKTCEYYKIRQ
FT                   VDMISQNRQRVIARPRQMAMYLCKRLTTRSLPEIGKKFGGRDHTTILYGVRKIEELMQA
FT                   DSQIAEDAELLRRTLEA"
FT   gene            1603..2721
FT                   /locus_tag="Jann_0002"
FT   CDS_pept        1603..2721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52919"
FT                   /db_xref="GOA:Q28WH9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH9"
FT                   /protein_id="ABD52919.1"
FT                   /translation="MKLSIERATLLRAVSQAQSVVERRNTIPILANVLIEAEGETVSFR
FT                   ATDLDIEVVDKAPAQVERAGATTVSAVTLHEIVRKLPDGSLVSLTEDTTTSRLTIEAGR
FT                   SSFQLATLPREDFPVMASTDYAANFSAKAPELRRLFDKSKFAISTEETRYYLNGVYFHI
FT                   AEGDNGKALRAVATDGHRLARIDSALPDGAQEMPGVIVPRKTVGELRKLLDDDDAQIAV
FT                   SVSETKIRFATPDITLTSKVIDGTFPDYTRVIPAGNTRRMEVDAGDFAKAVDLVATVSS
FT                   ERSRAVKMALDEDRLMLSVNAPDSGNAEAELVVAYADEKLEIGFNAKYLLEIASQVDRE
FT                   NAVFMFSSPAEPTLMREGNDDSAIYVVMPMRV"
FT   gene            2749..3876
FT                   /locus_tag="Jann_0003"
FT   CDS_pept        2749..3876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52920"
FT                   /db_xref="GOA:Q28WH8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH8"
FT                   /protein_id="ABD52920.1"
FT                   /translation="MSRQNDEGCGVSKVFVSSLALSHFRSHRRARMELDGRPVALFGPN
FT                   GAGKTNLMEAVSLLSPGRGLRRAAAEEIIRRPEAIGWKVSAEISGPSINHDITLTAEPG
FT                   QPRTTQVDGKTAPQIALARLLRIVWLVPSQDRLWSEGAEGRRRFLDRITLSFLPDHADA
FT                   VLTYEKAMRERNRLLRDDARDPAWYRALEAQMADAAVRIVNGRDDALTRISAAQNGAAT
FT                   AFPAADLGIETEHPCQTVDDFIQAFEGSRPRDLAAGRTLIGPHRADMSAIYRDKGVPAK
FT                   QCSTGEQKALLISLILSNARALKAETGTAPLVLLDEVAAHLDAGRRAALFDEICALEAQ
FT                   AWMTGTGPELFAELGDRAQHFEITEVAGESQVAAP"
FT   gene            3950..6367
FT                   /locus_tag="Jann_0004"
FT   CDS_pept        3950..6367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52921"
FT                   /db_xref="GOA:Q28WH7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH7"
FT                   /protein_id="ABD52921.1"
FT                   /translation="MNDIPASGDDYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VYEVVDNGIDEALAGHADAVTVTLHADSSVSVSDNGRGIPVGIHEEEGVSAAEVIMTQL
FT                   HAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIWRDGKEHIARFEGGFTTKPLEVV
FT                   SECGDRTGTEVRFMASTETFSNLDYVFKTLENRLRELAFLNSGVRIILRDERPAEALES
FT                   DLFYEGGVREFVRYLDRSKTSAMEEPIFITGEKDDIGVEVAMWWNDSYHENVLPFTNNI
FT                   PQRDGGTHLAGFRGALTRTINLYAQSSGIAKKEKVSFTGDDAREGLTCVLSVKVPDPKF
FT                   SSQTKDKLVSSEVRPAVEGLVNEKLQEWFEEHPHEARVIVSKIVEAALAREAARKAREL
FT                   TRRKTAMDIASLPGKLADCQEKDPSKSELFLVEGDSAGGSAKQGRSRHNQAVLPLRGKI
FT                   LNVERARFDRMLGSQEIGTLITALGTGIGRDEFNIDKLRYHKIIIMTDADVDGAHIRTL
FT                   LLTFFFRQMPELIEGGYLYIAQPPLYKVSRGKSEVYLKDETALEDYLVAQGVEGASLRL
FT                   SSGEEIAGQDLARVVTGARNFKRILDAFPTHYPRRIVEQAALAGAFDAGKADADLQGVA
FT                   DDVAKRLDLVAVEYERGWNGRITQDHGIRLSRVLRGVEEIRTLDGAVLRSGEARKLAEV
FT                   SKDSRTVYQDPATLTRKDRVQLIHGPTELLKAILDEGAKGQQMQRYKGLGEMNPDQLWE
FT                   TTLDHEARTLLQVKIDDLADADDIFTKLMGDVVEPRREFIQNNALSVENLDF"
FT   gene            6479..7129
FT                   /locus_tag="Jann_0005"
FT   CDS_pept        6479..7129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52922"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH6"
FT                   /protein_id="ABD52922.1"
FT                   /translation="MSDGFDTLITRANAFFTDLRANNTRDFYEAHKAAYTTDIKKPAEL
FT                   LADLFAEDLAKRTGKAHKPKLFRIHRDVRFSKDKTPYNTHLHLMWSRPGLGPTWFFGSS
FT                   SDYLILGMGIMGLEKDGLTAYRQMVDRQGDNLSDAIEASGAQISDWGPDPLKRVPKPYD
FT                   QDHPQAELLRRKALALSTDLPAGWEGDGLLKTLNKMIPALLPTWKVLDETFPG"
FT   gene            7558..7992
FT                   /locus_tag="Jann_0006"
FT   CDS_pept        7558..7992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52923"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WJ4"
FT                   /protein_id="ABD52923.1"
FT                   /translation="MKLALIKTAAVSIALIATVGAASACNIATANQFGWDNSAGVQQFG
FT                   NCNNTAIGQNGWNNTAAGISNGFANTVVVGQDGAWNTGVVGQNGSFNAGAVQQSGALNY
FT                   GEVVQNGNFQTGAVIQSGVGNTGVLNQTGTGNTALIIQAN"
FT   gene            8097..8495
FT                   /locus_tag="Jann_0007"
FT   CDS_pept        8097..8495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52924"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WJ3"
FT                   /protein_id="ABD52924.1"
FT                   /translation="MTKFSKSSTALGVAAIAAAVLGATAISAETANLTREAHAQTAAPV
FT                   ACALNIGTASGLLQVEPVIQATEAVSGIYQLRVEGPGTRMNQGGPFSVRAGQTVELGRM
FT                   MTSGSASSLDAEFTLTIAGRTYRCPTSL"
FT   gene            8575..8931
FT                   /locus_tag="Jann_0008"
FT   CDS_pept        8575..8931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52925"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WJ2"
FT                   /protein_id="ABD52925.1"
FT                   /translation="MFKKTFTAAALVLATAAVPAAAQQISFGISAGNQQERDAITGALA
FT                   LYQIANGGDPVEVLTQAATGSVGVIHQEGNGHNGSLAQGGGGNAGGLFQFGNNTNAHLN
FT                   QTGGQGDLVFTYGW"
FT   gene            9144..10322
FT                   /locus_tag="Jann_0009"
FT   CDS_pept        9144..10322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0009"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52926"
FT                   /db_xref="GOA:Q28WJ1"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WJ1"
FT                   /protein_id="ABD52926.1"
FT                   /translation="MAPTSISRFAPFLLLLFIGTLSNSAIVPFMGFYLIDGLGHPPWML
FT                   SVYSFLAIVLTVLANRAFGRRIDAGAPVFPLIGVAASGYAVASLVMAVSPTLPVMLTIG
FT                   VLGYGISASAISTMFSLGGHMAERHGVERTRFNAIMRATTSTAWMIGPAISYVSAGQFG
FT                   NEIVFKGAAVLGLAWLAWWFLTLPRDVQAKAPEKPPATGPVPANTGLWLAAAFIFAMSV
FT                   AHGLTFTALPLFFVTEVGLPDFAPGFAFSVKTFVEVFAIFSTPFLMARFGLSGPLLATA
FT                   CIAVGAILFLSQVTTLSQMVIGSALEGLYYGLFASLGISYVQSFARDRPAQATAIYWNT
FT                   LMISGLLSGPAVGLIAQATSFQTVIQISSGGAAVAALVLLVGILHGRRLQAV"
FT   gene            10410..11687
FT                   /locus_tag="Jann_0010"
FT   CDS_pept        10410..11687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52927"
FT                   /db_xref="GOA:Q28WJ0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WJ0"
FT                   /protein_id="ABD52927.1"
FT                   /translation="MPVFLTLTNANILDPAFWAAQVVDGNSTINATAVSDTLQITLTGG
FT                   SITITDTTTSVSTTFTNADLSGGAFSNVVQFRGNDADNIIGGSVGLNGQGYRGGSGDDQ
FT                   LTDDGNLGGQMRGGRGDDTIIGGTGDNQIRGNGGDDLLIGGSGNNNLIGGSGDDTLIGD
FT                   QGSGNLIGGSGDDLIITSELTTFVDGGSGDNQMIIPENATFTPFSPGSTGGEVTVTFPD
FT                   MSTRTFTYLNIAAENITTICFAAGTRIATPRGQVAVEDLRVGDRVVTRDGGIQALRWIG
FT                   FRTVPADGPLAPIHITKGALGNTRALTVSPEHRMLVQGWRCQVLFGREEGLCAAKHLVD
FT                   GDSIYRDPRELVTYFHVMFDAHQIILAEGTWAESLYIGDYQTAHDPELYAELFTLFPEL
FT                   EDTAHPARLLAAEPLRAFEATALRDA"
FT   gene            complement(11684..12589)
FT                   /locus_tag="Jann_0011"
FT   CDS_pept        complement(11684..12589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0011"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52928"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WI9"
FT                   /protein_id="ABD52928.1"
FT                   /translation="MYVVAALYHFTRFADPDALRAPLRSIAEAGNVRGSLLLAPEGING
FT                   TIAGPRAGIDAVLAHIKGLPGCAGLEWKESTATAAPFGKLKVRLKTEIVSMGAPGLDPA
FT                   DVGTHVAPAEWNALISAPDVAVIDTRNAYEVEIGTFEGAVDPATESFRDFPAWWQANKH
FT                   RFANQRIAMFCTGGIRCEKSTAYLKEQGVEEVFHLKGGILKYLEDVPEDQSLWQGGCFV
FT                   FDERVAVGHGLAELPFDLCRACRHPISCEEKADLAFEEGVSCPRCMDVHSDADRARFRE
FT                   RQKQIALAKARGEAHLGAGD"
FT   gene            complement(12626..12997)
FT                   /locus_tag="Jann_0012"
FT   CDS_pept        complement(12626..12997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52929"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI8"
FT                   /protein_id="ABD52929.1"
FT                   /translation="MTYDDMLDLILQGQMPPEGFSHQHHLGTAHAALRRWEFFEAAYRF
FT                   ASGLRAVTKAAGAPEKYNATVTLAFLSLVAERMEGEDSETFVARNLDLKSAVLADLGYG
FT                   AARLGDPKARRIGLLPVSV"
FT   gene            complement(12994..13242)
FT                   /locus_tag="Jann_0013"
FT   CDS_pept        complement(12994..13242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52930"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI7"
FT                   /protein_id="ABD52930.1"
FT                   /translation="MKKIERMQTGLRLEKGMVKVLKGTAEYLDISMSELVEGIVLHAFD
FT                   AEPVFNDTTRAKIAALCDVYGFDLTSKDAHGLEEEFQ"
FT   gene            13339..13932
FT                   /locus_tag="Jann_0014"
FT   CDS_pept        13339..13932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0014"
FT                   /product="Nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52931"
FT                   /db_xref="GOA:Q28WI6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI6"
FT                   /protein_id="ABD52931.1"
FT                   /translation="MTQALLVIDVQNDFCPGGALAVTDGDTIVPGINALMAEFNAVILT
FT                   QDWHPAGHSSFASSHDAEPMSLMQMPYGPQVLWPDHCIQGSVGAQFHADLTTDRADLII
FT                   RKGYNPAIDSYSAFFENDHTTPTGLEGYLRTRGITDLTLVGLATDFCVNYSAVDAAKLG
FT                   FTVTIRTDLCRAIDFDGSLTNALTAMHAAGATIV"
FT   gene            complement(13929..14792)
FT                   /locus_tag="Jann_0015"
FT   CDS_pept        complement(13929..14792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0015"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52932"
FT                   /db_xref="GOA:Q28WI5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI5"
FT                   /protein_id="ABD52932.1"
FT                   /translation="MEPVTILFQQLREIARAGIELLPQIAVAIVVLLLTWAVAAGVKAV
FT                   IGRTLKRSKLRPSLKELFVLFSSIFVWVMGLMIAAVIVFPNLTPSSILAGLGIGSVAIG
FT                   FAFKDVFENFLAGILILSRRKMRIGDHVECEGIEGEVKKIAIRETHILQTDGQLVIVPN
FT                   ALLFKNPLTIRTDQDIRRVTVICGVAYGEDVDAARDVIHEAVAGCDTVRQSDKPIQIFA
FT                   QEFNSSSIDFEVTWWTGSTPLDVRRSRDQVVAGVKRALDDAGIEIPFPYRTLTFKEPLP
FT                   IAQPEG"
FT   gene            14918..16027
FT                   /locus_tag="Jann_0016"
FT   CDS_pept        14918..16027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0016"
FT                   /product="Glycine amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52933"
FT                   /db_xref="GOA:Q28WI4"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI4"
FT                   /protein_id="ABD52933.1"
FT                   /translation="MANTIVNSWNEWDPLRHVIVGRADDCHIPPEEPALDAKVPEDSDM
FT                   RGQWGRRPQETIDRANELLDTFAGQLEARGIRVDRPTPIDHSNPATTPDFHTDSQFGCM
FT                   PPRDVLLTVGSEILEATMSYRCRWFEYLNYRPLMQKYWDEDPNFRHEAAPKPRLTDADY
FT                   HPDYLSDKIGDAQRLKWAEDKHFVTTEEEPLFDAADVLRFGKDLVVQHGFTTNLKGIDW
FT                   LRRHFPDHRVHAVNFPGDPYPIHIDATFTPLRPGLILNNPQRRLPEDQRKMYHDNGWEI
FT                   VDAAQPAHNAPPPLCYSSTWLSMNVLVLDPKTVCVEASEVYQMEQMDKLGMEVVPVELR
FT                   DAYAFGGGLHCCTADVYREGGCEDYFPKQ"
FT   gene            complement(16039..16635)
FT                   /locus_tag="Jann_0017"
FT   CDS_pept        complement(16039..16635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0017"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52934"
FT                   /db_xref="GOA:Q28WI3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI3"
FT                   /protein_id="ABD52934.1"
FT                   /translation="MITLSLALIVFLFPLAYSPGPGNLFFAANGARFGVRATLPANLGY
FT                   HLATWVVTLAIGFGFATAMGRAPILFDIIKWVGSGYVLYLAWRFFRAGQSEGQTEARPA
FT                   GLLGGAVLLLTNPKAYLIITVMFSQFLGQSEEQRILAVFVIATVFTLNNMLAFTAWTIA
FT                   GDRIATRFRDERGARLMNRGFAAVLAAVAVWMVWP"
FT   gene            complement(16714..17826)
FT                   /locus_tag="Jann_0018"
FT   CDS_pept        complement(16714..17826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0018"
FT                   /product="putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52935"
FT                   /db_xref="GOA:Q28WI2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI2"
FT                   /protein_id="ABD52935.1"
FT                   /translation="MNDPGIFLVAVPGLEAPLEAEARALGLSGVQSVPGGVAADGGLVE
FT                   AARVNLFARCAVRVLLRVAEFRAMHLAQLDKRSKKVDWRAVLRTDVPVRVEAVCRRSKI
FT                   YVNKAAVQRVSGGLEAAGLSVAKEADLTVKVRIDDDLCTISVDTTGEALHRRGHKEFVG
FT                   KAPMRETMAAGFLAQMGFDGRQTVVDPMCGSGTFVLEAAEMALGLVPGRSRGFAFENMV
FT                   GGRDARQMSDSGYLENGELGDDARARRRFYGFDRNDGAIRGARANAERAGVADVVAFAQ
FT                   GAISDLAPPDGPPGIVIVNPPYGGRIGERKLLFGLYGALGAVLAERFGGWCVGIITSDG
FT                   GLAKATGLALEAGGPVDHSGTKINLWKGQL"
FT   gene            complement(17961..18653)
FT                   /locus_tag="Jann_0019"
FT   CDS_pept        complement(17961..18653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52936"
FT                   /db_xref="GOA:Q28WI1"
FT                   /db_xref="InterPro:IPR022472"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WI1"
FT                   /protein_id="ABD52936.1"
FT                   /translation="MNIFKNLGGAILALGFAAGVAHANVINFETDEAGFTAVNTGLNGG
FT                   APVGPYAGPGGSTFTIDADTFSGSVPGDITLNGERRINITQGVEGLGVNNRNCVWFVCD
FT                   GGQVDGFGSNDILIFTFDRMMSLSRIIFENVGRRDDFVLYVPGANPEAEQFDIVNPLPF
FT                   PDTNGDEGFFDFGGLRVTSFGIGAYGNNDSFRVSRIEIAPVPLPAGAVLLLTGLGALAL
FT                   RRRQKTDT"
FT   gene            complement(19046..20602)
FT                   /locus_tag="Jann_0020"
FT   CDS_pept        complement(19046..20602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0020"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52937"
FT                   /db_xref="GOA:Q28WH5"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH5"
FT                   /protein_id="ABD52937.1"
FT                   /translation="MRNLYSILFAIAAYVAVSLPAAAQEAAATLDERVNAAFANATGWF
FT                   VNFIFMSIPGTNFPWIVMWLVIGATVFTIYFAAVQFRFFGHAIGLVKGDYSDPNDAGEV
FT                   SHFQALATALSGTVGLGNIAGVAVAVGIGGPGATFWMILAGLLGMASKFTECTLGVKYR
FT                   NEYPDGTVSGGPMYYISKGFNELGLPGGKILAVLFSIFCILGALGGGNMFQANQAHAQI
FT                   TQITGDFPGWITGLIFAAVVFAVIVGGIKSIAKVTEKIVPFMGILYVGAAIIVLVVNYD
FT                   MIGWAFGQIFAGAFTGLGVAGGFVGALIQGFKRAAFSNEAGVGSAAIAHSAVKTKEPIT
FT                   EGFVSLLEPLIDTVVICTMTALVIIISQQLIIDEASGLYMLNEAGTAIATVDGNGGVAL
FT                   TSAAFGSAISWFPFVLAIAVILFAFSTMISWSYYGLKAWTYLFGEGKTTELIFKLIFCA
FT                   FIVIGAAASLGPVIDFSDAAIFAMAVVNIFCLYFLMKVVKAELSSYSARLKSGEIRKFS
FT                   H"
FT   gene            complement(20615..21046)
FT                   /locus_tag="Jann_0021"
FT   CDS_pept        complement(20615..21046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0021"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52938"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH4"
FT                   /protein_id="ABD52938.1"
FT                   /translation="MKLVIGLDGQSSGDKALEFAKSVASKSESCELIVVYVIEWSPFSF
FT                   QTAEENAQRHKRREEEISIAMERVVEPAVATLKEAGHQARAIVRHGDVADTIDDIAHAE
FT                   GATQIVVARSSAGGITSRLFGSSTANLVMNARVPVTVVA"
FT   gene            21276..22568
FT                   /locus_tag="Jann_0022"
FT   CDS_pept        21276..22568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0022"
FT                   /product="Nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52939"
FT                   /db_xref="GOA:Q28WH3"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH3"
FT                   /protein_id="ABD52939.1"
FT                   /translation="MVDIATRVWNHKWKIDPIVRSLIDTDFYKLLMCQSVFRNKPDTQV
FT                   RFSLINRTTRIPLADLIDEGELREQLDHIRTLRLTRGESTWMRGNTFYGQRQMFSPEFM
FT                   DWFEALQLPPYHLERVGDQYELTFEGAWPEVMLWEIPALSVLMELRGRAVLGTMGRFEL
FT                   QVLYARAMTKLWEKIERLKDIPDLRVADFGTRRRHSFLWQDWAVRAMDEGLGDNFTGTS
FT                   NCLIAKNRDLEAIGTNAHELPMVYAALADSDEALFTAPYDVLSDWHEEHSGNLRIILPD
FT                   TYGTQGFLDNAPDWLAGWTGIRIDSGDPATAAEVAIAWWKSRGEDPRSKLVIFSDGLDV
FT                   DKIETLHKQFSGRVRVSFGWGTLLTNDFRGLVTNDALAPFSLVCKAVSANGRPTVKLSD
FT                   NPEKAMGPADQIERYKRVFGVGEQERVEVVV"
FT   gene            complement(22565..23596)
FT                   /locus_tag="Jann_0023"
FT   CDS_pept        complement(22565..23596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52940"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH2"
FT                   /protein_id="ABD52940.1"
FT                   /translation="MQIIGLDPGGRPILSLPIYYDVPDSRIRLDTFIGVSKGYEELIND
FT                   LVAELFGVEVTIQIYVLPPEAGSLRQVLGVVLIAGMGGILGTGGWEMTRGFTEGLTGLP
FT                   PEEWSRQLGENLREVVESEENAGEVNDEELQQVTEVTSTIVEVSRHIVSTPTERLASQG
FT                   FEPSQYPETFNAKSDMFYQIEVDPQIRGVGFGHEREAPIRREDFGRYQLSARKEEDPEE
FT                   WRFELVRYRVSSPNWDRFDSQRKWKGRDQEGSIVYFTITDGNFWEMARHGELESNVIDE
FT                   LIAQVATKYVDGKRTDRVVISVIRFNDRPVSPELTRTQLGHILDLTVKDIGEGTNSLFD
FT                   DDL"
FT   gene            complement(23724..24008)
FT                   /locus_tag="Jann_0024"
FT   CDS_pept        complement(23724..24008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0024"
FT                   /product="plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52941"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH1"
FT                   /protein_id="ABD52941.1"
FT                   /translation="MKELVIAPRADADLIGIYDYTSDTWGLDQADKYLDELHGRISGLV
FT                   TGATVSRSAEEVGPGLRRALAGQHVVFFREDAETVKVVRVLHQRMDLGR"
FT   gene            complement(24005..24262)
FT                   /locus_tag="Jann_0025"
FT   CDS_pept        complement(24005..24262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0025"
FT                   /product="putative transcriptional regulators CopG/Arc/MetJ
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52942"
FT                   /db_xref="GOA:Q28WH0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WH0"
FT                   /protein_id="ABD52942.1"
FT                   /translation="MARNTSVSLGDHFGEFINEKVQEGRYGSASDVIRAGLRLLEEEEA
FT                   KLAHLRELIAQGDASGPGKPWNYEDWKAKRHADYAKRRAL"
FT   gene            complement(24321..24740)
FT                   /locus_tag="Jann_0026"
FT   CDS_pept        complement(24321..24740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0026"
FT                   /product="Class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52943"
FT                   /db_xref="GOA:Q28WG9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG9"
FT                   /protein_id="ABD52943.1"
FT                   /translation="MPLRITDQITLEDWELTEQFVRASGPGGQNVNKVSSAVELRFEAE
FT                   RSPALSDAVKRRLKRLAGRRWTKDGAVVLQVSEERSQARNRELARERLAELVRSATAVP
FT                   KRRVKTRVSQNQKRKRVEAKKRRGEVKALRGGVEE"
FT   gene            complement(25037..25663)
FT                   /locus_tag="Jann_0027"
FT   CDS_pept        complement(25037..25663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0027"
FT                   /product="protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52944"
FT                   /db_xref="GOA:Q28WG8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG8"
FT                   /protein_id="ABD52944.1"
FT                   /translation="MKSMTRLLPGVLAMATIVVASNILVQFLFGQWLTWGAFTYPLAFL
FT                   VTDVMNRVYGASVARKVVFSGFIVGVICSLIGTQIMGEFGPLVTLRIALGSGIAFLTAQ
FT                   LLGVAIFDRLRNGGWWQAPVISSIIGSSVDTALFFFIAFSGTLTSVLPGDVAWANDVLP
FT                   ILGTGPEAPLWVSLAIADWGVKLALALIALIPFRLLTRKIIAHPA"
FT   gene            complement(25771..26970)
FT                   /locus_tag="Jann_0028"
FT   CDS_pept        complement(25771..26970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0028"
FT                   /product="aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52945"
FT                   /db_xref="GOA:Q28WG7"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG7"
FT                   /protein_id="ABD52945.1"
FT                   /translation="MTGCLMFEHLLPPEPDKIFRLTGQFAADPRADKVDLLVGLYRNAH
FT                   GLTPVLGAVKEAERRILETQTTKSYLGFEGDRGFIAGMRSLLLADAVPEARVAGIATVG
FT                   GTSALRQIFELVRTLMPDAQVWISDPSWPIHAGMAEHLGLAHRSYRYLDRDSNGLDRDG
FT                   MMEDLRAARAGDIIVLHGCCHNPSGADLTLSDWEDVARVCLATGAIPLVDMAYQGFGTG
FT                   LDEDAAGTRLLAQRVPTLFVAASCSKNFGLYRDRAGVALAVTSQGAARDAAQGHLIAMN
FT                   RNNYSFPPDHGARTVDLILHDAELRQMWEAELTSMRETITRNRRALAESLRAETGSDRF
FT                   GALAAHQGMFSLIGATPAQVDALREDHAVYVVGDGRMNVAGLTEQTVPIVARAMAQVLG
FT                   "
FT   gene            complement(26948..27508)
FT                   /locus_tag="Jann_0029"
FT   CDS_pept        complement(26948..27508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0029"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52946"
FT                   /db_xref="GOA:Q28WG6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG6"
FT                   /protein_id="ABD52946.1"
FT                   /translation="MSVIPAGTQVPFTITYLEMTARPDFGPAQLPGDVRLERAIDPPVW
FT                   YFLALYDAVGREYEWQDRFEQAEDDPAALQAFVRSPEVVIWTAIKHGWPQGFFALDWRE
FT                   PGECDLAYFGLVPQAVGQGIGPLLVQTAIATGWARDGVEKMTVNTCTLDHPAALRLYQK
FT                   MGFKPVDREERTRVLAYDRLSDV"
FT   gene            complement(27505..28368)
FT                   /locus_tag="Jann_0030"
FT   CDS_pept        complement(27505..28368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0030"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52947"
FT                   /db_xref="GOA:Q28WG5"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG5"
FT                   /protein_id="ABD52947.1"
FT                   /translation="MAEVITGDDPQTLVSTDWLAAHFNDPDLRIIDASYYLAEMNRDAK
FT                   AEYDAGHIPGARFFDIDDISDARSELPHMVAPVEKFMSRMRAMGVGDGHQVVVYDGRGV
FT                   FSAARVWWNFRLMGKTDVAVLDGGLPKWVAEGRPVEDMPPIIRDRHMTVQRQAHLVKDV
FT                   TQVASASKLGDWQIVDARAPARFRGEEPETRPGLRAGRIPNSKNVHYASLFKPDGTMKE
FT                   GDALRAAFEAGGVDLDKRIITTCGSGVTAAILMLGLTRLGHQDVSLYDGSWSEWGQFEQ
FT                   LKVETG"
FT   gene            complement(28499..28975)
FT                   /locus_tag="Jann_0031"
FT   CDS_pept        complement(28499..28975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0031"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52948"
FT                   /db_xref="GOA:Q28WG4"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WG4"
FT                   /protein_id="ABD52948.1"
FT                   /translation="MAKKPDNPNYKVIAENRRARFDYAIESDLEVGIILEGSEVKSLRQ
FT                   GQSNIAESYAEVKEGELWLVNSYIAPYVQAKTFGHEEKRRRKMLVSRKELSKLWNATQR
FT                   EGMTLVPIVMYFNHKGLVKLKIGIAKGKKAQDKRETSAKRDWNRQKARLLKQNG"
FT   gene            complement(29017..30189)
FT                   /locus_tag="Jann_0032"
FT   CDS_pept        complement(29017..30189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0032"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52949"
FT                   /db_xref="GOA:Q28WG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG3"
FT                   /protein_id="ABD52949.1"
FT                   /translation="MTSPPDAPEGSVKRLIQILSVTNFVIGMGAFMVIGMLPPMAESLE
FT                   MSTAGSGWIMTIYAISYAIASPLLVSSTGGIGRRKVLFLGLAVFTLANLLAAIAPSGAV
FT                   VLIARAFAAAGAGMVTPVAAAVVAGVVAPERRAKSLAAVFFGLTLAQVIGVPAGSYIAY
FT                   SIGWRYAFILVTLLALPCLWLIWTRVPRGLRFQPVGLRDLSAVLADWRIMLAVLFTATF
FT                   LAAIYVPFTYIAPLMEAHMGFGRDGISSVLLTFGLAAVVGNLLGGWMSDRFGPTPTLML
FT                   LAITQVLLMPFLSFLPMAAWMVFALIFTWSIFGWSFTAPQQARVISLAPDRAPVVLSLN
FT                   AAAIYVGAAVGASVGGAAISQSGLLALGWVGGAMALVGVAHLLVSARISR"
FT   gene            complement(30186..31061)
FT                   /locus_tag="Jann_0033"
FT   CDS_pept        complement(30186..31061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0033"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52950"
FT                   /db_xref="GOA:Q28WG2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WG2"
FT                   /protein_id="ABD52950.1"
FT                   /translation="MMFQGSMPALVTPMTNGAVDFEVLKRLVDWHVEEGSNGLVPVGTT
FT                   GESPTLTHEEHEQVIETVVKAAGGRVPVIAGAGSNNTAEAMRHVQHAKDVGADATLVVT
FT                   PYYNKPTQRGLIAHYEALAEVGIPIFIYNIPGRSVVDMTPETMGELAKHPMIIGVKDAT
FT                   ADMARVSRQRETCGTDFVQMSAEDASALGFNAHGGVGCISVTANVAPKLCAEFQAAMGA
FT                   GDYTEALAYQDRLMPLHNAIFTEPGLCGVKYAMSVLGLCSDEVRLPLVGVDESTKAAIE
FT                   AALRHAGLLS"
FT   gene            31209..33158
FT                   /locus_tag="Jann_0034"
FT   CDS_pept        31209..33158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0034"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52951"
FT                   /db_xref="GOA:Q28WG1"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG1"
FT                   /protein_id="ABD52951.1"
FT                   /translation="MGLRRLITSIVLCSLLGTPAATAQSDADALAAALARYNVGDLAGG
FT                   SNAARDLTDPVALDILAWTRLRRGEGSFEEYISFLDRNPDWPGLAYLRRQGEPSIPEGG
FT                   DAASILDYFADVLPQTGAGSLALARALADTGNPVVAEAIVVRAWTSLVMTGTDAQALNR
FT                   AFGNLLTQDHHIARLDHLLWENAEDRARAMFSLVPEDYVPLAEARLALRDRRPGVNGLI
FT                   DAIPASLQDDPGLAYERFIWRVREGLWDTAGALMVERSTSPDTLGRPAEWGRRRADLAR
FT                   DVMREGDHDTCYDYASNHQIDPEDDYIRFADLEWVAGYCALQLNRADIAANHFQRFSEV
FT                   VFSPISVGRAGYWLGRAHEAAGNAAAAADGYALGAQYQSSFYGQLAQERGGLPVDPEFT
FT                   GTRDYGDWRNSSFADLDVFRAAILLYEAGEVNLAERFFTHITERLDETEAGMMGALMLE
FT                   LEEPHYALMVAKRAAQSGHEIYPAYYPLADLEDVDLPVPRAFALSIARRESEFDPVVVS
FT                   GAGAIGLMQVMPGTGRDSAGELGLDFSEARLRNDPAYNVLLGSNYIAGLLEDYDGNPVL
FT                   VTIGYNAGPGRVRQWRERFGDPRQADDVIDWIEDVPFSETRNYIMRVIESLPIYEAQLT
FT                   GELPTLGLSERLVQ"
FT   gene            33223..33693
FT                   /gene="tspO"
FT                   /locus_tag="Jann_0035"
FT   CDS_pept        33223..33693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tspO"
FT                   /locus_tag="Jann_0035"
FT                   /product="tryptophan-rich sensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52952"
FT                   /db_xref="GOA:Q28WG0"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WG0"
FT                   /protein_id="ABD52952.1"
FT                   /translation="MDWTVFILFFGACCAAAATGSMFPPGQWYRNLAKPDWTPPDWLFP
FT                   VAWTVLYIASAVAAARVAVLADNAHAMGFWALQIALNTLWTPVFFGLERIRSGAVVLAF
FT                   LWLAVAGTMISFFAVDALAGWLMVPYLVWVTVAGALNLSVWRLNPEEASKAA"
FT   gene            33958..34251
FT                   /locus_tag="Jann_0036"
FT   CDS_pept        33958..34251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52953"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF9"
FT                   /protein_id="ABD52953.1"
FT                   /translation="MKTKFLIAALTMALAAPAFAQVAPMQFAVQHYNQSTDGVLEQISM
FT                   PDLNEGVTVSTQGNTALADAMDIVGDDVLGVVTVFPSEPTYGADILNRLASE"
FT   gene            34695..35036
FT                   /locus_tag="Jann_0037"
FT   CDS_pept        34695..35036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52954"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF8"
FT                   /protein_id="ABD52954.1"
FT                   /translation="MKKIAIIAALAASIAAPAAAQSTSTAFAIAHFNMSAERQSDIIPQ
FT                   PSGNLTTSVVSTRGNGALAEAFQMFNQTADNPGELRGVNQATVVSSASSARAQDIFARL
FT                   RAESREDAE"
FT   gene            complement(35188..37662)
FT                   /locus_tag="Jann_0038"
FT   CDS_pept        complement(35188..37662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0038"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52955"
FT                   /db_xref="GOA:Q28WF7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WF7"
FT                   /protein_id="ABD52955.1"
FT                   /translation="MSDQDGKKPLGLSGGARSGRVNQSFSRGRTKSVVVETKRKRVMVP
FT                   KPGAPSAAAQNAEGGKRDKSVPDAEMDRRLKALQAAKARESQEAEERVKAEREREEERN
FT                   RRRADAEAKEREEREREEALKAKEEEDDRRKAEEEARRNAPPEAAAPAVDPAAAATPRG
FT                   GGKAAPARREPERDNKRENRSRGNDGGGRRAGKLTVNQAMSGGEGGRQRSMAAMKRKQE
FT                   RQRQKAMGGSVDREKVIRDVKVPETIIVAELANRMSERVGDVVKALMNNGMMITQNQPI
FT                   DADTAELIIEEFGHRVQRVSDADVEQVIDTVEDDEGKLLPRPPVITIMGHVDHGKTSLL
FT                   DRIRQANVVSGEAGGITQHIGAYQVTTESGAVLSFLDTPGHAAFTSMRARGAQVTDIVV
FT                   LVVAADDAVMPQTIEAIAHAKAAEVPMIVAINKIDRPAADPQKVRTDLLQHEVIVEAMS
FT                   GEVQDVEVSAMTGQGLPELLEAIALQAELLELKANPDRAAQGAVIEAQLDVGRGPVATV
FT                   LVEKGTLRQGDIFVVGEQWGKVRALVNDQGDRVKDAGPSVPVEVLGLNGTPEAGDVLNV
FT                   VETEAQAREIAEYREQAAKDKRAAAGAATTLDQLLANAKADENVRELQVVMKADVQGSA
FT                   EAIVQALEKIGNDEVRVRVLHYGVGAITESDIGLAEASGTPVIGFNVRANAPARNAANQ
FT                   KGVEIRYYSVIYDLVDDVKAAASGLLGAEIRENFIGYANIKEVFKVSGVGNVAGCLVTE
FT                   GVARRSAGVRLLRDDVVIHEGTLKTLKRFKDEVKEVQSGQECGMAFENYEDIRPDDVIE
FT                   IFEREEVERSLT"
FT   gene            complement(37659..38291)
FT                   /locus_tag="Jann_0039"
FT   CDS_pept        complement(37659..38291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0039"
FT                   /product="protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52956"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF6"
FT                   /protein_id="ABD52956.1"
FT                   /translation="MSRGGQHKDRSDGPTRKCIATGEVAPKRGFIRFVVGPDDQVVPDV
FT                   LGRLPGRGMWVSADRAALELAVKKNLFSRAAKQQVSVQDDLVDVVETLLTRRVTDLIAL
FT                   ARKGGKAVAGFEKVKDWLANADVGVLLQASDGSERGKSKLWTPEGARYFGILTAQELGL
FT                   AFGRQSVIHGALAAGGLSPRVIEDAMRLQGLRVADGGQTTEKDRRNA"
FT   gene            complement(38314..40086)
FT                   /locus_tag="Jann_0040"
FT   CDS_pept        complement(38314..40086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0040"
FT                   /product="NusA antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52957"
FT                   /db_xref="GOA:Q28WF5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF5"
FT                   /protein_id="ABD52957.1"
FT                   /translation="MAITSANQLELLQTAEAVAREKMIDPNLVVEAMEESLARAAKSRY
FT                   GSELDIRVSIDRKTGRATFTRVRTVADEDTLENDKAEMLLADADATVAAERPNVVVFNA
FT                   KSHVYDEEGEVVETRDVRRFVMRKPTENDKLLTEGVDQSTGPVIGDMIADEVPPVEMGR
FT                   IAAQSAKQVILQKVREAERDRQFAEFKDRVGEIINGVVKREEYGNVIVDVGSGEAQLRR
FT                   NEKIGREAYRNGDRIRCYIKDVRRENRGHQIFLSRTAPEFMRELFKMEVPEIYDGIIEI
FT                   KAVARDPGSRAKIAVISYDNGIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDAPT
FT                   FLVNALQPAEVSKVVLDEDAGKIEVVVPDEQLSLAIGRRGQNVRLASQLTNLDIDILTE
FT                   EEESKRRQAEFEERTKLFMDTLDLDEFFAQLLVSEGFTALEEVAYVEADELLVIDGVDE
FT                   GTAEELQARARDYLEAQNKLALEKAKEMGVEESLIAFEGLTPQMLVALGEDGVKTLEDF
FT                   ATCADWELAGGWTTEGGERIKDDGLLEPFEVSLEEAQNMVMTARLQLGWVTIEELEADA
FT                   AAEAEAAAQEGAEG"
FT   gene            complement(40091..40675)
FT                   /locus_tag="Jann_0041"
FT   CDS_pept        complement(40091..40675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0041"
FT                   /product="protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52958"
FT                   /db_xref="GOA:Q28WF4"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WF4"
FT                   /protein_id="ABD52958.1"
FT                   /translation="MSDLIAKTSMDRRMAEIVTPSIEALGFEVVRIRVMGGKTNTLQIM
FT                   AERPDGGIDVDECAQISNAISVLLDVEDPLEDAYALEVSSPGIDRPLTRLKDFETFEGY
FT                   EAKLETTEMIGGQRRFKGVLAGVEDDEVLVNLEQGSETVTVGLNFDWLSDAKLVLTDEL
FT                   IKEMLKQRKDAGLINETQFDDIEEDPSNPED"
FT   gene            complement(40821..41201)
FT                   /locus_tag="Jann_0042"
FT   CDS_pept        complement(40821..41201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52959"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF3"
FT                   /protein_id="ABD52959.1"
FT                   /translation="MSFSSKAIFTALTLSLLPVAASAQIFVSPAAPGAGGSYINGVAIP
FT                   GHLQGGVQVLPGQGPIGGPVQVQGCGAAQYQSLIGHHQSAVPMPSHAAIVHPGMIRTTQ
FT                   YIATRLNVSLTQNGYVDRVYCG"
FT   gene            complement(41286..41561)
FT                   /locus_tag="Jann_0043"
FT   CDS_pept        complement(41286..41561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52960"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF2"
FT                   /protein_id="ABD52960.1"
FT                   /translation="MRFTLLITGALVCAGCTPAAAPSGRAAVPETCEAARLQTLVGQNV
FT                   RTMGALPNVHPLQLIGPGAEPVQALRPDRTHAYFDADGVVVSVACG"
FT   gene            41642..42754
FT                   /locus_tag="Jann_0044"
FT   CDS_pept        41642..42754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0044"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52961"
FT                   /db_xref="GOA:Q28WF1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF1"
FT                   /protein_id="ABD52961.1"
FT                   /translation="MRTRAAVALEAGKPLEVMDVNLDGPREGEVLVEIKATGICHTDEF
FT                   TLSGADPEGLFPAILGHEGAGVVLEVGPGVTSLKPGDHVIPLYTAECRECEYCLNPKTN
FT                   LCQKVRATQGQGLMPDGSSRFSMLDGTPILHYMGCSTFANHTVVPEVSLAKVRNDAPFD
FT                   KICYIGCGVTTGIGAVIYTAKVEIGSRAIVFGLGGIGLNVIQGLRLAGADQIVGVDLNP
FT                   GKVEMAKRFGMTDFVNPSEVTGDLVGHLVELTGGGADYTFDATGNVDVMRTALEACHKG
FT                   WGESIIIGVAPAGAEISTRPFQLVTGRSWRGTAFGGARGRTDVPQIVDWYMDGKIEIDP
FT                   MITHTLALDNINEGFDLMHRGESIRSVVIY"
FT   gene            42761..43360
FT                   /locus_tag="Jann_0045"
FT   CDS_pept        42761..43360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52962"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WF0"
FT                   /protein_id="ABD52962.1"
FT                   /translation="MSDHYLFHLTFDVRHDAPPQLMAALAKRAGGDVPSTEDMGDLPPI
FT                   VQDYLRGGGVPGDGVYCFYNRGPRSKFIDGTLVEIGWEPHEGSHTLRMAQTFHDDEYWN
FT                   GGLYYIHWLYQFVADDGPIGTMQQTNGNEPASILTKVGDDIIETKLAYNPGKYWPGPGQ
FT                   PKPDPDTPMIIEKSTAFPLSEMMEGLAMFADGHSYE"
FT   gene            43417..43854
FT                   /locus_tag="Jann_0046"
FT   CDS_pept        43417..43854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52963"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE9"
FT                   /protein_id="ABD52963.1"
FT                   /translation="MKLFSLLTGLGLAATLTVSAQAEGWTVTDFSSLPDRDTCMNYAET
FT                   TFNTYRTRFGSDGFTGRSTWTIGGYDLRGEVVDGLFICADESGQVAPFLVVYNVDDDSD
FT                   ARETIADRLGDIWDEIVEGNGVPGGIPQPTPVPGGGGGGTK"
FT   gene            43858..44355
FT                   /locus_tag="Jann_0047"
FT   CDS_pept        43858..44355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0047"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52964"
FT                   /db_xref="GOA:Q28WE8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE8"
FT                   /protein_id="ABD52964.1"
FT                   /translation="METGLAIRQAGVTDAPALSSLLMPVFRAGDTYTIDPDISPDDAVA
FT                   YWTSPEKTTYLAQRNGQVLGTYYIRPNQGGGGAHVCNCGYITAPEARGQGIARHMLDHS
FT                   LNEAVLQGYRAMQFNFVASTNTRAIETWKRADFSVVGRLPGAFHHPTEGYVDALVMYRN
FT                   LR"
FT   gene            44407..45126
FT                   /locus_tag="Jann_0048"
FT   CDS_pept        44407..45126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0048"
FT                   /product="protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52965"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE7"
FT                   /protein_id="ABD52965.1"
FT                   /translation="MANDTPLLAVLIDADNTSHKHAQAIFEEIARFGEASVRRIYGDFS
FT                   STHMKGWSGVQAEYGIVPFHQPANTVGKNASDIALVIDAMDVLHSGRFDGFVLVSSDSD
FT                   FTRLASRIREQGLDVYGIGQQKTPEAFRKACKRFIFIENILPDQPKGTPAAKADPKPDA
FT                   APLNEARDLIFRAMEAIEQEDDWYSLGQLGQYMTAANPDFDTRTYGKKKLSDLVESLKM
FT                   LEVKRGQGNQLLVRRLD"
FT   gene            45126..45581
FT                   /locus_tag="Jann_0049"
FT   CDS_pept        45126..45581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52966"
FT                   /db_xref="GOA:Q28WE6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE6"
FT                   /protein_id="ABD52966.1"
FT                   /translation="MAMRLWLVSAQDKPALAQAYSAYMAELVPHEVQITPDPYFDLYWQ
FT                   EPSDRFPYVFGDGKPEGFAFIRRPDEPDLEFEMAEFCIYTAGRRSGIGTHILRDISKRH
FT                   PGRWEVSVLMTNAAGLAFWPKALRATKVQDLRMQEDDISRDYRFTAT"
FT   gene            complement(45578..46210)
FT                   /locus_tag="Jann_0050"
FT   CDS_pept        complement(45578..46210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0050"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52967"
FT                   /db_xref="GOA:Q28WE5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE5"
FT                   /protein_id="ABD52967.1"
FT                   /translation="MNAEMQIKKGRKFDQVIAGARAVFMREGFEGASVDEIARDAGVSK
FT                   ATLYSYFPDKQHLFLEVLRQECDAQSEVEVLFQQTGLSVEEKLCVICKKLITFFVSDFG
FT                   QDMFRVCVAEAKRFPELGETFYASGPKHWGEKIAGFLCSDKARAVLDIEDPLLAADQLA
FT                   QLCRTDLMLKVMFGIEKDPAEEELDRIVDEAVRTFLARYRRVPRAMG"
FT   gene            46326..47267
FT                   /locus_tag="Jann_0051"
FT   CDS_pept        46326..47267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0051"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52968"
FT                   /db_xref="GOA:Q28WE4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE4"
FT                   /protein_id="ABD52968.1"
FT                   /translation="MMLEIFLKTLPFFALIALGFQACRTGFFTSEAAAYLTKFVFYFAL
FT                   SAMLFRFAANLSLTEIFDWQFVGAYLTACFVVYFLATAVAMIRKRPVTEAAFEAQCAVI
FT                   GNVGFLGVPMLVVLLGEAAAGPILLVLALDLIVFSSLIVIIVTGSRDGRMSLGVLRTVG
FT                   VGLLKNPMIVSISLGLAWSTTGLAVPGPVNEFLAILGAAATPGALFAIGASLAGKSAER
FT                   MSVAGWLTFCKLILHPLAVAICALWLFDVPDFEAAVMIAAASLPVAGNVYILAQHYGVA
FT                   PQRVSATILISTAVSILTVSAVIAWLAPLSGM"
FT   gene            47376..48209
FT                   /locus_tag="Jann_0052"
FT   CDS_pept        47376..48209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0052"
FT                   /product="Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52969"
FT                   /db_xref="GOA:Q28WE3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE3"
FT                   /protein_id="ABD52969.1"
FT                   /translation="METISENKAFGGTQGVYTHASDATDCDMTFGLFLPGEAADGPVPV
FT                   LWYLSGLTCTHENAMSKAGAQGWAAEQGIALIFPDTSPRGEGVADDPSYDLGQGAGFYV
FT                   NATQNPWAPHFRMWDYIVDDLPALVFEHFTLDRDRQAITGHSMGGHGALTIAMHHPDRF
FT                   TSVSAFAPICNPCDSDWGRKQMTSYLGMDEDTWAAHDATLLMHAAGFDGPMLIDTGTDD
FT                   QFGDLLKTEAFAHAAALRRQQLTLRMQPGYDHSYFFVSSFMEDHVAFHADALYAV"
FT   gene            48209..48832
FT                   /locus_tag="Jann_0053"
FT   CDS_pept        48209..48832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0053"
FT                   /product="HAD-superfamily hydrolase subfamily IA variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52970"
FT                   /db_xref="GOA:Q28WE2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE2"
FT                   /protein_id="ABD52970.1"
FT                   /translation="MAVSAVIFDIGNVLIEWQPERHYDRVIGEAQRREMFAAVDLHGMN
FT                   DRVDRGEDFRTTVQDCAAAHPEFHDEIMLWHDDWIHMATPAIPRSAVLLRNLRHRGVPV
FT                   FALSNFGIQTFEIAKPTYPVLAEFDRAYISGHMGVTKPDADIYAQVEADCGLAPESLLF
FT                   TDDRDDNIKAAQRRGWQTHLFDGPEGLAKRLVQDGLLSEKDAGL"
FT   gene            48864..49769
FT                   /locus_tag="Jann_0054"
FT   CDS_pept        48864..49769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0054"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52971"
FT                   /db_xref="GOA:Q28WE1"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE1"
FT                   /protein_id="ABD52971.1"
FT                   /translation="MMIIGPEAEEHLDWIALCAAIEAGHKLPRADIDDTFLYRGNDTLL
FT                   SRAAWIDGLGQLVKTATIFPGNKAMRKPAINGGVCLFSDTDGSLEAIIDFHLLTKWKTA
FT                   GDSLLAARKLARTDATNILLVGSGNVAKSMRQAYAAAFPDATFTVWNRTLANIASMRAA
FT                   YPDIAIAHDLREAVANAHIIATTTMATTPVVRGKWLEPGTHLDLIGAYRPDMREVDDDA
FT                   LRRSRVFVDSRATTVGHIGEMKIPIEEGVFFESDIVGDFYDMGTLQRTTDTEITLCKNG
FT                   GGAHLDLMVARYILDAVRGG"
FT   gene            complement(49859..51106)
FT                   /locus_tag="Jann_0055"
FT   CDS_pept        complement(49859..51106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0055"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52972"
FT                   /db_xref="GOA:Q28WE0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WE0"
FT                   /protein_id="ABD52972.1"
FT                   /translation="MDRQAPLMTPVLIGGCAIILICFAIRASFGVFQIPIAEEFGWLRA
FT                   EFSLAIAIQNLAWGIGQPFFGAIAEKFGDRKAIVLGVAFYVVGLSVSAFAVTPGQHQVL
FT                   EFLVGLGIAGTGFGVILAMVARAASDENRSMTLGIVTAVGSGGQIIGPPLAEALLASFP
FT                   WQTVFLIFAGIVFASLVFLPLLRAPERPSSPALEETMSQILGKALRDPSFTLIFVGFFS
FT                   CGYQLGFITAHFPAFITEFCGPIAPGGVLHSIGVTTTSALGALAIAVIGAANIGGTLLA
FT                   AYLGKTYSKKNLLAAIYTGRTIVATIFILLPITPTSVIVFSAAMGSLWLATVPLTSGLV
FT                   GYIYGLRYMGTLYGIVFFSHQLGSFMGVWLGGALFDAYGDYTAVWWVGIGVGVLSAIIH
FT                   LPIKETPLGLRAPTPA"
FT   gene            51266..52342
FT                   /locus_tag="Jann_0056"
FT   CDS_pept        51266..52342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0056"
FT                   /product="AFG1-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52973"
FT                   /db_xref="GOA:Q28WD9"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD9"
FT                   /protein_id="ABD52973.1"
FT                   /translation="MTSLYDTRVSEGLLRPDPAQRAVMEQLEEVRAALVAPQPKGLLAR
FT                   FRKAEPLDQQGLYLWGGVGRGKSMLMDMFFQHTGITGKRRVHFHAFMQEVQAALHEARK
FT                   TGVDDAIKPVAEDIARDLKLLCFDEMQITDIADAMIVGRLFERLFEAGVMVVTTSNRPP
FT                   KDLYKDGLNRQLFLPFIALLEERMDVHNLDAQTDYRQDRLAGEPVWFTPADADAKRAID
FT                   LIWRDLTGGKDEPLTLEVKGRDVVIPRFWAGQARASFAQLCGTALGPGDYLALVDATSV
FT                   LVLEDIPQMSPVNANEAKRFVTLIDTLYEGGVRLIASAETEPEDLYVSGSGAFEFERTA
FT                   SRLREMQSAGWSAAEAEG"
FT   gene            complement(52350..53039)
FT                   /locus_tag="Jann_0057"
FT   CDS_pept        complement(52350..53039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0057"
FT                   /product="chloramphenicol acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52974"
FT                   /db_xref="GOA:Q28WD8"
FT                   /db_xref="InterPro:IPR001707"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD8"
FT                   /protein_id="ABD52974.1"
FT                   /translation="MALERACRYGVCQICVEEDPPVEHPVDLAAWPRAAQFYFFRTFDR
FT                   PHFAVTSRIDVTDLMERLKPQGMSPYRASLYAIGAGIHAVPELLMRFRGDTVVRHDAVE
FT                   LSMTVPTKAGSFNYAYVPFDPDFSQFNHVANALIQAASEMVALAANSGTRDDLCYMSCL
FT                   PWLDYSSINNAMPGPEDCIPRVSWGKIVKTADGWSMPMTLEVHHALVDGAHVGAYFAAV
FT                   QGALDGL"
FT   gene            complement(53043..53549)
FT                   /locus_tag="Jann_0058"
FT   CDS_pept        complement(53043..53549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52975"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD7"
FT                   /protein_id="ABD52975.1"
FT                   /translation="MKYALLASLLAAMPAHAAQFQFCWVGANGYTMEGRITFPDALLDT
FT                   GLITEADVTGFQIIGLIDGVAIGSWNMASATAQTSWTLRFDTNALRFPTGGLRSENSYQ
FT                   EWNANGQVNDCGAEGGFGWNGGNYAQDVCIDNTWIEDSSIDPDTPLFAQPMDVALRCEA
FT                   TIPIS"
FT   gene            complement(53649..54914)
FT                   /locus_tag="Jann_0059"
FT   CDS_pept        complement(53649..54914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0059"
FT                   /product="FolC bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52976"
FT                   /db_xref="GOA:Q28WD6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD6"
FT                   /protein_id="ABD52976.1"
FT                   /translation="MTSHSDQLLARMMALHPKIIDLTLDRMWRILYALGDPQTRIPPVI
FT                   HVAGTNGKGSTQAMIRAGLEGAGLTTHAYTSPHLARFHERIRLAGELIDEDHLSRILDT
FT                   CLAANGPDPITYFEITTAAALHAFAQMPADYTLLEVGLGGRLDATNVIDAPALSVITPI
FT                   DLDHQQFLGDTLEAIAGEKAGIIKRGIPVVVGPQQDEALEVIEARAARLGAPVIAHGQH
FT                   WHVTTERERLIFQDETGLLDLPLPSLAGPHQIQNAGTALAALRTLGVGDADAAMTDTIW
FT                   PARMQKLRHGPLTEVAPSVELWLDGGHNPHAARAIAATLETLPKRPTYLICGMLNTKDV
FT                   TGYMAPLVPWVESLTAVSIPGQTATLSAEETAEAARSVGLTTRIAPGVDAALTEIAVDD
FT                   PRARVLICGSLYLAGEILKTNG"
FT   gene            complement(55003..55959)
FT                   /locus_tag="Jann_0060"
FT   CDS_pept        complement(55003..55959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0060"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52977"
FT                   /db_xref="GOA:Q28WD5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WD5"
FT                   /protein_id="ABD52977.1"
FT                   /translation="MNWISNYVRPRINSIFSRRETPENLWSKCSECGTMLFHRELSDNL
FT                   NVCTNCDHHMALTPRDRFTALFDNGIFTQITVPEPLTDPLKFRDQKKYPDRMKAARTAT
FT                   SEAEAMLVAEGEMGRTPIVAAAQDFSFMGGSMGMFVGNAIIAAAERAVALKRPLILFSA
FT                   AGGARMQEGILSLMQMPRTTVAVQMLKEANLPYIVVLTHPTTGGVTASYAMLGDVHIAE
FT                   PNALICFAGPRVIEQTIREKLPEGFQRAEYLLDHGMLDRVTHRARMRDELITITRMLMG
FT                   QTPAVKGELPAPAPLESDAETALASDTDPNGAPPSKD"
FT   gene            complement(56031..56912)
FT                   /locus_tag="Jann_0061"
FT   CDS_pept        complement(56031..56912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0061"
FT                   /product="Abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52978"
FT                   /db_xref="GOA:Q28WD4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD4"
FT                   /protein_id="ABD52978.1"
FT                   /translation="MQYSAHAPFVAPARAYPQIWRILLGLVLSMLIYGIGIAVVFGGIF
FT                   LVSGPAGVQAWASEMVEASGPTGTLLILATFIGMAVGPMVAVMLLHRRRVGSLFGPLPR
FT                   TVRHFLVATGVCVFAYGLSFLLPNDIRIEPAMERALWLSFLPMALVGIFIQTGAEELLF
FT                   RGYLQQQLAARFASPLIWMVLPSLLFASLHYQPEVMGDNAIYVVAATGLFGLLAADLTA
FT                   KTGSIGAAWGFHFANNVVAILIVALDGPLSGLALYTAPLSAASAEIRPLIFLDMGTTLA
FT                   TWVLIRLAVTRL"
FT   gene            57092..58855
FT                   /locus_tag="Jann_0062"
FT   CDS_pept        57092..58855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0062"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52979"
FT                   /db_xref="GOA:Q28WD3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD3"
FT                   /protein_id="ABD52979.1"
FT                   /translation="MTANRPDKSRLPSRHVTEGPERAPHRSYFYAMDLTQEQIDQPFVG
FT                   VATCWNEAAPCNIALNWQAQSVKRGVGEANGTPREFTTITVTDGIAMGHEGMRSSLASR
FT                   DAITDTVELTMRGHCYDALVGLAGCDKSLPGMMMAMVRLNVPSVFIYGGTILPGKAPEV
FT                   ADIPAEFANRDLTVQDMFEAVGKYQSGQLSEAALEVLERVACPSAGACGGQFTANTMAC
FT                   VSEAIGLAMLNSSGMPAPYEGRKEFGEASGRAVMNLLEKNIRARDVVTRKALENAARVV
FT                   ACTGGSTNAGLHLPAIAHEAGIDFDLFDVCDIFKDTPYFVDMKPGGQYVAKDLYEVGGV
FT                   PVVMKELLKEGLLHGDCLTASGETMEEALDKIQGTPDGRVVHTVQNPITSTGGVVGLRG
FT                   NLAEEGAIVKVAGMDEASQVFTGPARVFECEEDAFAAVKARGYEEGEVIVIRNEGPKGG
FT                   PGMREMLATTAALSGQGMGKKVALITDGRFSGATRGFCVGHVGPEAAVGGPIGLLENSD
FT                   MITINALTGELSVALTEAELAERRKAWAGPRETMYASGALWKYAQLVGEARYGAVTHPG
FT                   GAKEKHVYADI"
FT   gene            58842..59555
FT                   /locus_tag="Jann_0063"
FT   CDS_pept        58842..59555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52980"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD2"
FT                   /protein_id="ABD52980.1"
FT                   /translation="MRTSRRLRRGALLLGPAALLAACVGLGGGDDAPREVQVTADAVTI
FT                   TGPRGFCVDPTAVRNTDDTGFVLLGNCAAISGSARAGQPDVPAVLTAAVSAPSSGGGLT
FT                   ANLDALETFFQSDDGRALLSRSGDASTVQILDTRRQAGMFLLHARDSSAGEVVGVASDY
FT                   WRAYLDVGTRLATLSVLALEDAEVSNAQVLSTLTQFATAVQAANPVVGAAELPQGTAEE
FT                   VTPPFREGLFARIFQ"
FT   gene            59621..60394
FT                   /locus_tag="Jann_0064"
FT   CDS_pept        59621..60394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52981"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD1"
FT                   /protein_id="ABD52981.1"
FT                   /translation="MGQEFPGIFGGFGLGQTLKRWQRALRAPTDLSSADLKRMNDDIRG
FT                   MRDRLDVMAAQSRSELLSRRAGSDGIDRPDQCDWADRPAPWCEEMRPHGIVGLNSPQPL
FT                   TGGAKVFHDATHAEMSLRQDPAPHWVDGAQFGLVLEVYRFDGSFVSFVQDLAPEALVGL
FT                   TRNHFITVALVADREQPVEIYARLNIQHGPNVEQIVRQLEFDDVNGRAEFDLAYTKINE
FT                   KRLERAWLDLIVEGPKMTRIALWDMVILRAPRADF"
FT   gene            60421..60792
FT                   /locus_tag="Jann_0065"
FT   CDS_pept        60421..60792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52982"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WD0"
FT                   /protein_id="ABD52982.1"
FT                   /translation="MAEALVRTVLQAGRYEGVLTGAGQTEIEALHKGRIVGVAQVTAHP
FT                   SEQGALHVALDLPPDVLSDGVQVVGLRSTATGEVLDRVTLMAGSALDEDIRGELVLLRE
FT                   ELEMLKRAFRRHCADTGQD"
FT   gene            61089..61268
FT                   /locus_tag="Jann_0066"
FT   CDS_pept        61089..61268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52983"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC9"
FT                   /protein_id="ABD52983.1"
FT                   /translation="MFYFLYKDVNRHWRWTLFAANHQKIANSGEGYYNKADCLSAINLV
FT                   KSSTLAPVREQQQA"
FT   gene            complement(61301..62524)
FT                   /locus_tag="Jann_0067"
FT   CDS_pept        complement(61301..62524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0067"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52984"
FT                   /db_xref="GOA:Q28WC8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WC8"
FT                   /protein_id="ABD52984.1"
FT                   /translation="MSAPKKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEEL
FT                   EPARKKAEMMGAAGIYVEDLREEFVRDFVFPMFRANALYEGLYLLGTSIARPLISKRLV
FT                   EIAEETGADAVSHGATGKGNDQVRFELCAYSLNPEIEVIAPWRKWELGSRTKLIEFAEK
FT                   HQIPIAKDKRGEAPFSVDANLLHTSSEGKMLEDPAEEAPDHILQRITRPEDAPDTPEMV
FT                   EITFEKGDAVAINGEPMSPATILTELNRLGGKHGIGILDLVENRFVGMKSRGIYETPGG
FT                   TVLLEAHRGIEQITLDGASGHLKDSIMPRYAELIYNGFWFSPEREMLQALIDKSQEHVT
FT                   GTVRLKLYKGAARCVARWSDHSLYSEAHVTFEEDMGAYDQSDAQGFIQLNALRLKLLSA
FT                   RNRKFNGS"
FT   gene            62605..63411
FT                   /locus_tag="Jann_0068"
FT   CDS_pept        62605..63411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52985"
FT                   /db_xref="GOA:Q28WC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC7"
FT                   /protein_id="ABD52985.1"
FT                   /translation="MDYGYQLLRHVIAQVFGNLGAAARITVIPILLAYAICGVILYSIV
FT                   GAFLFEMASQGPILPGQPQPIPFSSEAEAATFAGRFFLAILLCLPIFLVFYAWAAVGWH
FT                   RYVLLEELPSGVTARWSWPIIKGYVGAVLRLILMSLLIAFAAAIVIGILLSVIPSPGLA
FT                   VFLQVGTTIGFTWIFTRLGLVLPSAALGIYMKMGDSWSATAPVSSAILLPIIVIPLAFF
FT                   LLSAASGLLGIIGLVLTLVLIWIQLLVNLALMTTLYGNLIEGRQLN"
FT   gene            63420..64697
FT                   /locus_tag="Jann_0069"
FT   CDS_pept        63420..64697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0069"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52986"
FT                   /db_xref="GOA:Q28WC6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC6"
FT                   /protein_id="ABD52986.1"
FT                   /translation="MTAGTGQAVGMTDFAIAAKATTAALRDLFPATPLLKNAYLSERFG
FT                   ADIWLKREDLSPVRSYKLRGAFNAMRKVRAERPELVDFVCASAGNHAQGVAYVCAHFGV
FT                   RGRVYMPVTTPDQKILKTRTFGGDAVEIVLEGDFFDETQAAAKAYCAEVGAHFLSPFDD
FT                   PDVIEGQASVAVEMLEQLGRAPDHLVLPVGGGGLSSGMLSYLRDVGADTHATLVEPDGG
FT                   PSLTAALKIGAPQTIEITDTFVDGAAVARIGNRNFEVLRNVPPRDVHLVSENRICVTIQ
FT                   EMLNLEGIVLEPAGALSVTVLDELRGQIAGKTVVCVTSGGNFDFERLPEVKERAQKWQG
FT                   LKKYFILRLPQRPGALRDFLDLLGEDDNITRFEYLKKNSRNFGSVLIGIESHRAASFPE
FT                   LEDRVASRGFGFRDITDDQILADFLI"
FT   gene            complement(64694..65017)
FT                   /locus_tag="Jann_0070"
FT   CDS_pept        complement(64694..65017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0070"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52987"
FT                   /db_xref="GOA:Q28WC5"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC5"
FT                   /protein_id="ABD52987.1"
FT                   /translation="MNHVDWARLNELRADIGEEDFADVAMLFVAELQEHLDGLAPDKAT
FT                   TADFHFLRGSAANLGFVTLVSACSMAEAACNTSQPPDVEAVRTAFAAALSEVAPHVPEL
FT                   AAA"
FT   gene            65165..66445
FT                   /locus_tag="Jann_0071"
FT   CDS_pept        65165..66445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0071"
FT                   /product="response regulator receiver (CheY-like) modulated
FT                   serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52988"
FT                   /db_xref="GOA:Q28WC4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC4"
FT                   /protein_id="ABD52988.1"
FT                   /translation="MGASLPKVAAGRPAAVDPEPDALTVLVLDDSPAQRNMVCALLRRW
FT                   GHTAISTGDPVEALARAREPDISLILCDWMMPEMTGPEFCHRLRSEVTDTYPYVLLLTS
FT                   NTDRGAVAEGLAAGADDFLNKPVRPPELQARMNAGARIVAMQQELRAKNGLLETTLDEL
FT                   QLLYDAIDRDLDEARRLQMASLQDTHRPFKGGDVSLLLEASGHVGGDMVGYFNVTDDTI
FT                   GLFSLDVSGHGVASAMLAARTAGMLSEASPDQNIAMERGPDGQFFDLPPDIAVGRMNDL
FT                   LLKEVQTDRYFTICIAFANLKTGLLRIVQAGHPHPMVLRATGQVDMVGDGGPPVGLLPN
FT                   MPFTSFELQLNPGDRVLMYSDGLTECPNVQGDMLDDDGLIDLMKKNKSEENVAFLSALR
FT                   DGLVDFAGTTDFPDDLSALLFSFRGAP"
FT   gene            complement(66479..66922)
FT                   /locus_tag="Jann_0072"
FT   CDS_pept        complement(66479..66922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0072"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52989"
FT                   /db_xref="GOA:Q28WC3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC3"
FT                   /protein_id="ABD52989.1"
FT                   /translation="MNRRFGRWPEHGRKYPPRPGIYVIIDAGDGLLASFQEAPYPELQL
FT                   PGGGIDPGEQPLAALHREVMEETGYRIHSLRRLGMCHRYTFMPDYDRYAHKQCHIYAAR
FT                   LGRRWSAPTEPGHTAVFLPWDVALDKLAVAGDRHFVARYLAGA"
FT   gene            67004..67969
FT                   /locus_tag="Jann_0073"
FT   CDS_pept        67004..67969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0073"
FT                   /product="KpsF/GutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52990"
FT                   /db_xref="GOA:Q28WC2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC2"
FT                   /protein_id="ABD52990.1"
FT                   /translation="MSNEHPQSLRDTGARVLHMEARAVATLADALPQDFEPAAQAILGT
FT                   KGRVILCGIGKSGHICRKISATFASTGTPSAFVHAAEASHGDLGMMMPGDLVIAISNSG
FT                   ETAELNDIIAHVTRFAIPLIGISKKPDSTLMRAADFRLTLPAAAEACSLGMAPTTSTTL
FT                   ALALGDALAVAVMEQRGFLPEQFRTFHPGGKLGAQLSTVAQLMHGPDALPLVHASTPMA
FT                   ETLVVMSEKSFGIAGVVEGGRLTGVISDGDLRRNIAHLTDRTATEVATHQPRTIAPDVL
FT                   AAEAMGMMAANKITALFVVDDTARPLGLIHLHDLLRAGLA"
FT   gene            complement(68038..68373)
FT                   /locus_tag="Jann_0074"
FT   CDS_pept        complement(68038..68373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52991"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC1"
FT                   /protein_id="ABD52991.1"
FT                   /translation="MKRFALAATLAATAFAAPAFADGHATNFAIMHFNMDADNADQFVM
FT                   LPQGDTVQVDLEMGTTLAEVFAHLNMSAETMGDLVGQSGTVTILASDPAHAAEIFSRLM
FT                   EEGRGEE"
FT   gene            complement(68763..69062)
FT                   /locus_tag="Jann_0075"
FT   CDS_pept        complement(68763..69062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52992"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WC0"
FT                   /protein_id="ABD52992.1"
FT                   /translation="MNRFALIAAATALMAAPTFAQTANETAEEILNADADTPSEVIDGT
FT                   LVQGAEDCDNPAAEVENESTDATLEEIDCVTGVEADGTHEELELDDDEGVSSDG"
FT   gene            complement(69258..70562)
FT                   /locus_tag="Jann_0076"
FT   CDS_pept        complement(69258..70562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0076"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52993"
FT                   /db_xref="GOA:Q28WB9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB9"
FT                   /protein_id="ABD52993.1"
FT                   /translation="MRITMIGTGYVGLVSGVCFSDFGHDVICVDKDPSKIEMLQAGQVP
FT                   IYEPGLDTLMEKNVEAGRLSFTTDLASAVDGAEAVFIAVGTPTRRGDGHADLTYVMAAA
FT                   EEVARAMTGYGVIVTKSTVPVGTNRKVKQVVHKAAPELEFDVASNPEFLREGAAIDDFM
FT                   RPDRVVVGVQSERAGDVMAEIYRPLFLRDFPVVTTDLESAEMIKYAANAFLATKITFIN
FT                   EIAALCEKVGADVKEVSKGIGMDGRIGNKFLHAGPGYGGSCFPKDTSALARIGQEHAVP
FT                   QSIVETVIRVNDSVKARMIEKLRDLCDGSFNGKVISVLGVTFKPNTDDMRDAPSLTIVP
FT                   ALVGGGAKVRVVDPQGLREGEALLPGVNWMDDPYKSVQNADLVVLLTEWNEFRALDLER
FT                   IAKKMATPRLADLRNVYSPQDAKRAGFEAYDGVGR"
FT   gene            complement(70578..71576)
FT                   /locus_tag="Jann_0077"
FT   CDS_pept        complement(70578..71576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0077"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52994"
FT                   /db_xref="GOA:Q28WB8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB8"
FT                   /protein_id="ABD52994.1"
FT                   /translation="MRTALVTGSAGFIGYHLCARLLADGWRVIGLDAMTDYYDVSLKEA
FT                   RLAMLTDHDAFTGVEARIEAPGVLHDLFDEHRPDAIIHLAAQAGVRYSIENPESYVEAN
FT                   LIGTFRLLEAMRAFPPRHSLLASTSSAYGANTEMPYAETMQADHQMSFYAATKKSNEVM
FT                   AHSYAHLYDLPTTMFRFFTVYGPWGRPDMALFKFTKAILNGDPIDVYNHGDMKRDFTYV
FT                   TDLVDGIIRLIEAVPGTEPVESDSLSPVAPHRIVNIGNSNSVQLMDYIEAIETATGRTA
FT                   EKNMMPMQAGDVPATWADASLLQHLTQYTPRTDMAEGVANFVAWYRDYYKI"
FT   gene            complement(71852..73150)
FT                   /locus_tag="Jann_0078"
FT   CDS_pept        complement(71852..73150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0078"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52995"
FT                   /db_xref="GOA:Q28WB7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB7"
FT                   /protein_id="ABD52995.1"
FT                   /translation="MGLGHQIDTKSQYGVAMKILFVHQNFPGQYRELFSWLRAQAGHEL
FT                   VFLTQRKDMPAIDGARVITYTPHHKPAKDAYALTQYWEECAGNGFGCAQAAGKLRGEGF
FT                   RPDIILGHVGWGELTFLKEIWPNTPIIGYFEYYFLAQGGSVGFDPEFPASPHAPFTMHA
FT                   RNAVNFANIQTVDQGHSPTAWQRDTFPDSFKQKIYVKHDGIRTDQLRPDPTAEVALGRL
FT                   GRAVTKEDEIFTYMARNMEPTRGFHSFMRALPHILDARPNARALIIGGSDVSYGKKSGS
FT                   EGGYRAEMEREVGDAVDWSRVHFLGRVPYGDYQKIIQVSRCHIYLTVPFVLSWSCLEAM
FT                   SMGATIVASDVAPVREVIEHGKTGLLADFFDPKDIARNVVDVLERPGTYSHLGPAARNH
FT                   VVQHYDFQTICLPEHLRQINALVPPAKRIPLPA"
FT   gene            73266..74267
FT                   /locus_tag="Jann_0079"
FT   CDS_pept        73266..74267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0079"
FT                   /product="Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52996"
FT                   /db_xref="GOA:Q28WB6"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB6"
FT                   /protein_id="ABD52996.1"
FT                   /translation="MTTTTKLAWDDTVLPFQLDRSDIRGRVARLDSTLDQILSQHDYPA
FT                   PVEAMVAEMALLTALIGQTIKLRWKLSLQVRSDGPIRLIATDFLAPEAEGEPARIRAYA
FT                   SYDEDRLDVAADAFPQIGAGYFAILIDQGNDMTPYQGITPIAGGSLRSCAEAYFAQSEQ
FT                   LPTSFMLSYGQAQEPGKDASWRAGGVMLQVMPEAALEVRDAPSGEDGLLSAEDLMEEDK
FT                   AEDWTRANVLLQTTEAMELIGPHVAPTDLLVRLFHEEHPRVFDALPVAFGCTCSEDRVR
FT                   QSLSIYSAKDIAHMTTDTGRVTADCQFCGSHYDFDPLTLGFEAEKAPDGSPA"
FT   gene            74251..74838
FT                   /locus_tag="Jann_0080"
FT   CDS_pept        74251..74838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0080"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52997"
FT                   /db_xref="GOA:Q28WB5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB5"
FT                   /protein_id="ABD52997.1"
FT                   /translation="MGRLLKLGDMVAALDAVPARPSSDYDLNPGVVLPEGRKLRPASVL
FT                   IGVLDGDVILTKRASTLKHHPGQIAFPGGKVDDGETAEQAAVREAREEIGLAPENVTIL
FT                   RHLPPHETVTGYTVTPFLARIDADFSPTPEPGEVAEVFRVPLHVLMDPANYAIEGRRWR
FT                   GMRREYYVVPFGPYYIWGATARILKSLADRVV"
FT   gene            74838..75977
FT                   /locus_tag="Jann_0081"
FT   CDS_pept        74838..75977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0081"
FT                   /product="Polynucleotide adenylyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52998"
FT                   /db_xref="GOA:Q28WB4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB4"
FT                   /protein_id="ABD52998.1"
FT                   /translation="MRLDADWLRRPETGAVFDALDGHGVWFVGGCVRNGLLGLDVADID
FT                   ICTNLRPERVMALAEAAGLKAVPTGIDHGTVTVVSGGLPYEITTLRRDVETDGRHASVA
FT                   FTDVLAEDAARRDFTMNALYATRGGEVLDPNGDGLSDLHARRVRFIGDADARIAEDYLR
FT                   ILRFFRFHAWYADPSGGLDAESLAACAAGLDGIAQLSRERVGAEIKTLLRAPDPAPAVA
FT                   AMDQTGVLAAVLPGASSRMLTLLTGLETGLTPDAVRRLAALGGDDVAERLRLSRSDSKR
FT                   LTLYRTEMGAMTTPGALGYHHGLDAARDILVLRGLLSEQPVTASALHTAKLGATATFPI
FT                   RAADLPDLHGKPLGDRLKLLEARWIDSTFTLTKSELLNR"
FT   gene            76030..77874
FT                   /locus_tag="Jann_0082"
FT   CDS_pept        76030..77874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0082"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD52999"
FT                   /db_xref="GOA:Q28WB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB3"
FT                   /protein_id="ABD52999.1"
FT                   /translation="MFRKFENLVDPYVAHAQQDRPPRRLWPFLWDYSQPFKGLFALTAF
FT                   MSVVVATIEIGLIWYMGRVVDLMTQGEPAQVLADYGLELTLAAVFILTIRPILQGLDVA
FT                   LLNNAILPQFGALVRWRAHKQVLRQSVGFFENDFAGRIANRIMQTPGSAGDAIFQVFDA
FT                   ITFSLAYLVGAAILLMGSDPRLALPLIVWFTLYALLLRWTMRRVGPASQAASDARSMTT
FT                   GRVVDSYTNIHSVKLFAHNETELAYAKEAIEFTRQTFAKEMRIFTTMDVMLVTLNGFLI
FT                   VAVVGWGILLWSQGAASVGVVAAATALALRLSAMTGWIMWAVSTFFRSLGIVAEGMETI
FT                   TEPIDLVDTPNAPALRLTEGEIVLDSLSHHYGRAAGGLDQISLTVKSGEKIGLVGRSGA
FT                   GKSSLVKLLLRFYDAEQGRILIDGQDIATVQQDSLRRVIGMVQQDSSLLHRSVRDNILY
FT                   GAPDATEEAMIEAAKRAEAHDFILDLQDPQGRTGYDAHVGERGVKLSGGQRQRVTLARV
FT                   ILKNAPILVLDEATSALDSEVEAQIQDTLYGVMEGKTVIAIAHRLSTIAQMDRIIVLDA
FT                   GHIVEDGTHDALLAQGGLYASFWARQSGGFIGTEEAAE"
FT   gene            77871..79730
FT                   /locus_tag="Jann_0083"
FT   CDS_pept        77871..79730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0083"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53000"
FT                   /db_xref="GOA:Q28WB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB2"
FT                   /protein_id="ABD53000.1"
FT                   /translation="MNRLMRIVDWLAGLVPPFAAADGPPPQVLWPFMKWCLSGSWPILF
FT                   IAALMSGLAGLMEVAAAWFLGALIDTATGPSADYLGTHGLLIAAYILFYLALRPLFFGT
FT                   SAAFTGIVLPPNIAPLVQSRLHRWTLGHDITFFDNDFAGRIAQKQMQAATAMVNIVTEV
FT                   INAAAYAIITLMGTIVLLVAIDWRIGLALLVWCGLYAMLIRWYLPRIRVRSKARAATRA
FT                   NVTGQVVDTITNIKTVKLFGHTDHEDAAATGAMDSYRSAALRFGVLSTGFRFVLMATAG
FT                   LLPVILVLGGVALWQAGQATPGDIAAIGAISMRISQMTGWVSFTLMGIYANLGELEDGM
FT                   RTLTPAHGLTDEVTAQPLPRLTGEIRFDAVSFAYGQRTGGIDTIDLTVQPGEKLGVVGA
FT                   SGAGKSTLVALLMRLYDAEQGRVLVDGTDVRTVTQDSLRQQIAMVTQDTAMFNRTARDN
FT                   ILYGRPDASEAEVIEAAKRAEAHDFIQDLRDHRGRQGYDAFLGERGVKLSGGQRQRVAL
FT                   ARAFLKDAPVLVLDEATSALDSEVEAAIQDTLHSVMEGKTVIAIAHRLSTLSAMDRIIV
FT                   LDQGRIAEDGTHAELLASDGLYARYWNRQSGGFIGLEDATAAE"
FT   gene            79774..80277
FT                   /locus_tag="Jann_0084"
FT   CDS_pept        79774..80277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0084"
FT                   /product="DNA topology modulation kinase FlaR putative"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53001"
FT                   /db_xref="GOA:Q28WB1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB1"
FT                   /protein_id="ABD53001.1"
FT                   /translation="MKRVMIIGQPGSGKSTLARVIGSKTGLPVVHIDQIHWMPGWVERD
FT                   KPEKIRLAMIEQEKDAWVFEGGLGATKEHRLSRCDTLINLDFPLWLRAWRIVKRTLRHF
FT                   GKTRPDLPDGCPEQISFEFYKWIWDTRHKNKQANLRWMAKAGANVSVHHLRSPREVRAY
FT                   IDSL"
FT   gene            80321..80737
FT                   /locus_tag="Jann_0085"
FT   CDS_pept        80321..80737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53002"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WB0"
FT                   /protein_id="ABD53002.1"
FT                   /translation="MDYDTISAEDFGRSLTGIGVNLLTRDVRALAAFLQDVFGLKAHRL
FT                   SDDFAIITHGDAVFQLHADGTYHSNPLPQLIPENPPRGGGAQFYLFGIDPDAAVARAGN
FT                   QMVIEPPADKPHGLREATILSPEGYAFSPAVPRA"
FT   gene            80706..81965
FT                   /locus_tag="Jann_0086"
FT   CDS_pept        80706..81965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0086"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53003"
FT                   /db_xref="GOA:Q28WA9"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA9"
FT                   /protein_id="ABD53003.1"
FT                   /translation="MRSLRQCPVPEVTITRLGHLGDGIATDDHGGPIFVPLTLPGEVVS
FT                   GEIYGDRIAAPSVITPSSDRVKAPCPHYKSCGGCSLMHASDPFVATWKENVITTALQAH
FT                   DLPTPLRPIVTSARKSRRRATLAGTRTKKGAMIGFHARKSGTIVPTRDCFLLEPALLET
FT                   LPALERIVKLGASRSATLGLALTLTDTGIDLHVTGAKPLDGPLRAALPQVRGSFSRLTW
FT                   GDEPVYTETPPRLTLGTARVTPPPGAFLQATQDGEAALQAAVAEATQGATHIADLFCGI
FT                   GTFTLPLAQAAPVHAVEAAPDLLDALDHATRFATGLKPITTEARDLYRRPLLPDELAKF
FT                   DAIVIDPPRAGAEAQTEQIAKAHVPVIAAVSCNPVTFARDAAILTKAGYALDWVQPVDQ
FT                   FRWSPHVELAARFTLAHISD"
FT   gene            81982..82758
FT                   /locus_tag="Jann_0087"
FT   CDS_pept        81982..82758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0087"
FT                   /product="Ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53004"
FT                   /db_xref="GOA:Q28WA8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA8"
FT                   /protein_id="ABD53004.1"
FT                   /translation="MNDFRTRLADWLARPVVSNFIIGVIIFNAVILGLETSDGIMAAYG
FT                   PLILMLDTLCLAIFVVEIVLKLIAHGFRFFRNGWNLFDFVIVGIALVPAAQGLSVLRAL
FT                   RILRVLRVVSAVPSLRRVVEGLLTALPGMGSVFLLMSIIFYIGAVMATKLFSDQFPDWF
FT                   GTIGLSLYTLFQIMTLESWSMGIVRPVLEIYPYAWLFFVPFIMVTTFAVVNLIVGLVVN
FT                   SMQDAHSEESNAATDAYRDEVMEKLRAIEARLDKRN"
FT   gene            complement(82789..84708)
FT                   /locus_tag="Jann_0088"
FT   CDS_pept        complement(82789..84708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0088"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53005"
FT                   /db_xref="GOA:Q28WA7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28WA7"
FT                   /protein_id="ABD53005.1"
FT                   /translation="MSDRPSTPLLDNVQSPNDLKGLSDFDLKRLADELRAEMIWTVSKT
FT                   GGHFGAGLGVVELTVALHSVFDTPRDKLVWDVSHQCYPHKILTGRRDQMLTIRQKDGLS
FT                   GFTKRSESPFDPFGAAHSSTSISAALGFAVARDLGGDSDTGHGDAIAVIGDGAMSGGMA
FT                   FEAMNNAGHLGKRLIVILNDNEMSIAPPTGALSSYLSRLYAGAPFQEFKAAAKGAVSLL
FT                   PEPFQEGARRAKELLKSATVGGTLFEELGFSYVGPIDGHDMESLLSVLRTVKARADGPI
FT                   LIHAITKKGKGYSEHRADRGHATAKFNIATGEQVKAPSNAPSYTKVFAQSLIAEAEDDP
FT                   KVVAVTAAMPDGTGLDLFAERFPSRCFDVGIAEQHGVTFAAGMAAGGLKPFAAIYSTFL
FT                   QRGYDQVVHDVAIQRLPVRFAIDRAGLVGADGCTHAGSYDISYLANLPGFVVMAAADEA
FT                   ELRHMVRTALEIDDRPSAFRFPRGEGMGVDMPDRGTALEIGKGRMISEGNRVAILNFGT
FT                   RLKEVQEAAETLSQRGITPTIADARFAKPLDEALILQLARHHEALITVEEGAVGGFGSH
FT                   VAHLLAENAVFDTGIKYRSMVLPDIFIDQASPKDMYAVAGMNAEDIVAKVLTTLGVEVL
FT                   SQRA"
FT   gene            complement(84769..85635)
FT                   /locus_tag="Jann_0089"
FT   CDS_pept        complement(84769..85635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0089"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53006"
FT                   /db_xref="GOA:Q28WA6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA6"
FT                   /protein_id="ABD53006.1"
FT                   /translation="MFKTALRDAQTRIGDFLTRQLADLGDDTIAQGMRYATGGGKRLRG
FT                   FLALESAALFDVPPGQALYAAGAVECLHAYSLVHDDLPCMDDDDLRRGQPTVHKKWDDA
FT                   TAVLVGDALQTFAFELISREDAGTAEERVALTASLAKASGAQGMVLGQAQDIAAETAGR
FT                   ALTLQEITGLQANKTGRLIEWPAHAGAVLGGADPAPLQRYARAIGLAFQIADDILDVEG
FT                   DAAKAGKALRKDADAGKATFVSLLGMEAAKARSAALVADATAALAPYGDKAQTLRDLAQ
FT                   YIVTRDK"
FT   gene            complement(85639..85881)
FT                   /locus_tag="Jann_0090"
FT   CDS_pept        complement(85639..85881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0090"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53007"
FT                   /db_xref="GOA:Q28WA5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA5"
FT                   /protein_id="ABD53007.1"
FT                   /translation="MTDKPIDEMSFEDAIRELEQVVTQLDRGDVALEDSIKLYERGAAL
FT                   KARCEAKLKEAEEKVAQITLDANGQPTGAKTVEGL"
FT   gene            complement(85871..86794)
FT                   /locus_tag="Jann_0091"
FT   CDS_pept        complement(85871..86794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0091"
FT                   /product="histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53008"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA4"
FT                   /protein_id="ABD53008.1"
FT                   /translation="MLIINNPSGLRHEMPQGHPERIARLETVFAVLADVNAERVEAPLG
FT                   TEDDVALCHPQDYIDAMREAQPAQGMVQIDADTSASPGTWEAAMRGVGGCLLAVDRVLS
FT                   GAHKRAFVATRPPGHHAEKTRAMGFCLFGNIAIAARHALERHGLSRVAIVDFDVHHGNG
FT                   TQDLLWDEPRALFVSSHQMPLYPGSGAVHERGASDNVLNLPLPPGSDGQAMRSRYTSHV
FT                   FPRLRDWQPDLILISAGFDAHTRDPLANLLWEAEDFAWVTRELVALAEEVCEGRIVSTL
FT                   EGGYDLQGLGDGVLAHVRELEDRDDG"
FT   gene            complement(86924..87643)
FT                   /locus_tag="Jann_0092"
FT   CDS_pept        complement(86924..87643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0092"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53009"
FT                   /db_xref="GOA:Q28WA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA3"
FT                   /protein_id="ABD53009.1"
FT                   /translation="MNMSMDIGAHLLIVDDDERIRSLLQKFLMRNGFMASGARDAGQAR
FT                   VLLAGLSFDMIVLDVMMPGEDGLSLCRDIRATSSTPILLLTANGEPDDRIEGLEAGADD
FT                   YLSKPFEPKELLLRINAILRRMPAPTEDATVPQVIHLGPVRYDIERGEMWQGQDPVRLT
FT                   ATEAALMRIFAHQPAEALSRGELVSLLNRDKVGGEPVQERAVDVQITRLRRKIEMNPKQ
FT                   PRYLQTVRGAGYMLSPD"
FT   gene            complement(87640..88149)
FT                   /locus_tag="Jann_0093"
FT   CDS_pept        complement(87640..88149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0093"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53010"
FT                   /db_xref="GOA:Q28WA2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA2"
FT                   /protein_id="ABD53010.1"
FT                   /translation="MGERATGMGRGDTLLFLTDEQLRRGIEAMFFAYRGFTADPDLILS
FT                   DRGYGRAHHRAVHFISRTPGTTVNNLLSILGVTKQSLNRVLRTLVEDGLVEARVGTRDK
FT                   RERHLHLTPDGVALERALSEAQRNRMRTAFRNAGPDAVSGFRAVLEEMMDPDMRRHYLE
FT                   GVEQNQ"
FT   gene            88325..89191
FT                   /locus_tag="Jann_0094"
FT   CDS_pept        88325..89191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0094"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53011"
FT                   /db_xref="GOA:Q28WA1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA1"
FT                   /protein_id="ABD53011.1"
FT                   /translation="MAGYDDRDGMIWMDGKLVDWRAANVHLLSHAMHYASSVFEGERAY
FT                   NGKIFESRKHSERLHYSASCIDFEIPFTVDEIEAAKYEVMKANGLTDAYIRAVAWRGAG
FT                   EDMGVSSARNPVRLAVAAWEWGSYYGDAKMKGAKLDISKWKRPSPETIPVHAKAAGLYM
FT                   ICTTSKHAAEAKGCSDALFMDYRNYVAEATGANIFFVKDGEVHTPTPDCFLNGITRQTV
FT                   VGMLKDKQIKVHERHIMPEELESFEQCWLTGTAAEVTPVGHIGDYNFEVGALTRDIAES
FT                   YEALVRA"
FT   gene            complement(90081..90956)
FT                   /locus_tag="Jann_0095"
FT   CDS_pept        complement(90081..90956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53012"
FT                   /db_xref="GOA:Q28WA0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28WA0"
FT                   /protein_id="ABD53012.1"
FT                   /translation="MLPPLDSDLMRGFLAVVETGSLTRAGHRLGRTQSAISMQIRKLED
FT                   SLGQSVFVREPRGVRLTERGKQLLPYAQRVVGLLDEAAIALREKPLSGPVRVGVPDEYI
FT                   QGVLPAVLSAFSQRHPETQVTLRCDFSAPQLEALNSDKIDLAVIYEGYSTDEVEVLAVD
FT                   PTVWVTSISHAQHLHRPLPISIYFSSDWCRDFALHSLEQIGIPYFAAFECDTSGGMRSA
FT                   VSNGIAVAPLARSSIPPGCRELTAEDGFMGVDNARVVLRRNPAGSSTAIEAMVATLREA
FT                   FWPLTKNGGL"
FT   gene            complement(90977..91342)
FT                   /locus_tag="Jann_0096"
FT   CDS_pept        complement(90977..91342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53013"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W99"
FT                   /protein_id="ABD53013.1"
FT                   /translation="MGGHDGLEDLSAITNSTYDLDLCWESIFPERTFAKMSSYSLVLLV
FT                   QQDPQVVSCEPDIIEPLVVVSHQHPSHGTPPIQQGPSAFPAFPDTPSHVQPAFQFRRAG
FT                   FDELLTSIKRIVIMSHI"
FT   gene            91593..92159
FT                   /locus_tag="Jann_0097"
FT   CDS_pept        91593..92159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0097"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53014"
FT                   /db_xref="GOA:Q28W98"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W98"
FT                   /protein_id="ABD53014.1"
FT                   /translation="MPRPRLFDPDTALDALVGVFWAKGYSDASYDDIVSASGVSRKSLY
FT                   AAFGDKQALFTKALQRYRTDHATRFLADLDNEDISLDGIASMFRRLGELATSDAGSMGC
FT                   LMANTATSPAIKTPEVKDQLDRHLEITTKRFSTALARAGCPAKRIKAKALYLTGALQGL
FT                   FLLAHARAQPDLIEAYVNGVVDQIA"
FT   gene            92239..92544
FT                   /locus_tag="Jann_0098"
FT   CDS_pept        92239..92544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53015"
FT                   /db_xref="GOA:Q28W97"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W97"
FT                   /protein_id="ABD53015.1"
FT                   /translation="MMATVSARPLLLTAQAGFLGLMLIRAFNRDTMVAAATIATSLGAR
FT                   AVATPLMGRSGFYQSDRFLMLMSRLWLPVVPFVMVGITLIFAPVRSGLSQPLTSRT"
FT   gene            92541..92876
FT                   /locus_tag="Jann_0099"
FT   CDS_pept        92541..92876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53016"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W96"
FT                   /protein_id="ABD53016.1"
FT                   /translation="MMAGAVGKQASFNRTIEAGGPEFLTWEQVAGLLSKKAGRNVQIIK
FT                   LPAWFARAGQEAMAPFSQSASNVLGLVKLVASFQPRWEAPSIVEEFDLPAQTTMAEYLD
FT                   QNWSGAA"
FT   gene            92904..93320
FT                   /locus_tag="Jann_0100"
FT   CDS_pept        92904..93320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53017"
FT                   /db_xref="GOA:Q28W95"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W95"
FT                   /protein_id="ABD53017.1"
FT                   /translation="MDSLISVTLWNVVLLGVLLLLQPLVRDIVVGFKYTISNFDNRVDE
FT                   GVFARRLAMVRSNQIEALALWVPVILIAGIAVPDLTHPHLALIATVFLIARIAYAIMSL
FT                   AGIPLLRSGAWTVGFAAWACLTWIIRSAMGGIGA"
FT   gene            93426..93887
FT                   /locus_tag="Jann_0101"
FT   CDS_pept        93426..93887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53018"
FT                   /db_xref="GOA:Q28W94"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W94"
FT                   /protein_id="ABD53018.1"
FT                   /translation="MCAALLPSRILSRRQGSRHHVRRARVPRNSRCKARMSRALFILAL
FT                   VVSVLGEFSTGAYIPLTRLTGQMLSLDPDMLQPSIASFILTFGSAQILLGPLSDSIRCR
FT                   PVVIGGLIVFVAGSIGGMRVDTRPGPSLARGVQGVGAASGYVVRRAMLR"
FT   gene            93959..94387
FT                   /locus_tag="Jann_0102"
FT   CDS_pept        93959..94387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53019"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W93"
FT                   /protein_id="ABD53019.1"
FT                   /translation="MTHNIQATREIPATANDLWKTVSQMIGMETSCPGLIRESDVLDAD
FT                   GTQPRRSCVMRNGGALTERILLRDDATRTFIYAIDSHPMPAKIVVGTIRIDDLGDGKSQ
FT                   VSWAADMVLGPASADHFAGMVQGMYEGGLASLEAHHTT"
FT   gene            94384..95217
FT                   /locus_tag="Jann_0103"
FT   CDS_pept        94384..95217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0103"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53020"
FT                   /db_xref="GOA:Q28W92"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W92"
FT                   /protein_id="ABD53020.1"
FT                   /translation="MNIQTFMLPSQKVSPELEILHADLQTEGQHPPILFLHGYTSGAWQ
FT                   FAQHWMPTLQANGWQSFALNLRGHGGSAGRETVTTARFLDYADDVARAIAYVRGQTDQT
FT                   PILIGHSLGSVLARHYAAEHSVPGLGLLITIGMQGFMGWMMKRYPLQGMAGMMTGRPSA
FT                   MFAKFGPQYDVMYAGHNKETVRGNVERLMAQPDSDKVFMDLSKLKLGLPAKSTPTFVMA
FT                   GTRDPIASVESVEALGRSYAVEPVMLQDKAHDIVAGPDWNDGLQHLQAWLETAKF"
FT   gene            95386..95727
FT                   /locus_tag="Jann_0104"
FT   CDS_pept        95386..95727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53021"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W91"
FT                   /protein_id="ABD53021.1"
FT                   /translation="MAIQFQPTGPTVTHNQVAFHRTELGPILGLYGRMVAAGEWRDYGI
FT                   SHLSDVAVFSIFKRTAENPIYRIEKRPKLRDKQGQYAVIGIDGRILKRGHDLKTVLRVL
FT                   ERKLIRVVD"
FT   gene            complement(95737..96573)
FT                   /locus_tag="Jann_0105"
FT   CDS_pept        complement(95737..96573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0105"
FT                   /product="NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53022"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W90"
FT                   /protein_id="ABD53022.1"
FT                   /translation="MTDPRTTAFNGRVAHASLKGEIEAERYSEGRWMMVQQPIANILDK
FT                   PRGARTSQLVFGERFLVLDTEDGFSFGQAERDGYVGYILSGALTGAEPATHWVISPATH
FT                   LYPKAELKVPPDVCLYFGSQVKVTGEKDDFKRIHTGHFMPSQHLMPIKARFRDSVGIAD
FT                   LFLGTPYLWGGTSRWGIDCSGLVQACLLACGVECPRDTDQQEAALGEEIPSDEALKRGD
FT                   LIFWKGHVGMMASDRMLLHANAHHMSTAYEPLKDAAARIEAKEYGPITSRKRIAMG"
FT   gene            complement(96570..97940)
FT                   /locus_tag="Jann_0106"
FT   CDS_pept        complement(96570..97940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0106"
FT                   /product="Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53023"
FT                   /db_xref="GOA:Q28W89"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W89"
FT                   /protein_id="ABD53023.1"
FT                   /translation="MPMQFAGAEQDALPIFLVRAGDDVGALAPSHAAWAEANGFTGRLG
FT                   QALVLPGDGLAGALVGMGQPSDRRRKRFAVGAAIAGLPEATYEITNMPDAGPEADEIAL
FT                   GYLLSTYRFERYRKQSGPKARLLAPLGVNAEQLERIAKAEGLIRDLINTPAEDMGPDAL
FT                   EAVVRTLGAEFGADVSVIAGDALLEQNFPLIHTVGRAAAKAPRLIEMTWGASGPALTLV
FT                   GKGVCFDTGGLNLKPGAPMGIMKKDMGGSANVLGLARMIMASAMDVQLRVLIPAVENNV
FT                   AGNSFRPGDIFTARNGMTVEINNTDAEGRLVLADALALASETPPDLLICMATLTGAARV
FT                   AVGPDLAPFFTDDDGFATALSAASARVADPVWRLPFHDAYEPMIEPGIADLDNAPAGGM
FT                   AGSITAALFLRRFAPVPRFAHFDIYGWQRTTAPARPKGGVGQGIRAIFDALPEVLSR"
FT   gene            complement(97999..98403)
FT                   /locus_tag="Jann_0107"
FT   CDS_pept        complement(97999..98403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53024"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W88"
FT                   /protein_id="ABD53024.1"
FT                   /translation="MLLMARADLCPTITELAPEEPARFNPDCLEELCLKIGEVRAEAEV
FT                   AQALHRLSEALPTLEGLLREDERGFLVAVEKLSKDAELIGMATLARVARSVLDCFATAN
FT                   HVGLAATMARLERVGDRSIHAVWDLEDLSV"
FT   gene            98574..99224
FT                   /locus_tag="Jann_0108"
FT   CDS_pept        98574..99224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0108"
FT                   /product="Carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53025"
FT                   /db_xref="GOA:Q28W87"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W87"
FT                   /protein_id="ABD53025.1"
FT                   /translation="MHRVNSLPDYLLDRYKDWKDQSFPENRDWFRKLADEGQHPRAMVI
FT                   ACCDSRVAINSVFGQRTGELFVHRNIANLVPPYTPDGNHHGTGAAVEFAVKHLKVEHIL
FT                   VMGHSNCGGVAGCISMCEGTAPEFDQEESLIGRWLDVLRPGYQTVSDIEDPKGRQTALE
FT                   KEGIHVSLENLLGYPFVKSAVDAETLSLHGLWADIADMDLEMFDGRVRHFTPA"
FT   gene            99291..100271
FT                   /locus_tag="Jann_0109"
FT   CDS_pept        99291..100271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0109"
FT                   /product="protein of unknown function DUF897"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53026"
FT                   /db_xref="GOA:Q28W86"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W86"
FT                   /protein_id="ABD53026.1"
FT                   /translation="MDGMLALAADNLLSPIILFFALGLLAAFARSDLSIPEAIAKGMSI
FT                   YLLFAIGFKGGAAVAANGIDATLILSLLAGIVLSFLIPMVAFALLRVMTGLSVTDAAAV
FT                   AGHYGSISIVTFVAATSVITSSGLESEGYMVAVAAVMEAPAILSALWLIARFDKGAAQM
FT                   DAGLMREILLNGSIVLLVGSFIIGVITGAEGLDLIAPFIVTPFQGMLCLFLLDMGLVAG
FT                   RGLREARGVLKPGLFLFGMVMPLVGSVFGLATGVLLGLSSGGVVLFMTLSASASYIAVP
FT                   AAMRVALPEANPSIYLTLSLGVTFPFNLTIGIPLYLAVATLVTGG"
FT   gene            100276..100587
FT                   /locus_tag="Jann_0110"
FT   CDS_pept        100276..100587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0110"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53027"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W85"
FT                   /protein_id="ABD53027.1"
FT                   /translation="MQTHKAKRVEITIEAVMESRLTQALIGAGVTGFTVLPVLGGSGRS
FT                   GQWSREGQVTRAGGMVSVVCIIREERLDDLLDAAFAVVERHIGVVAITDCEVLRAERF"
FT   gene            100670..101200
FT                   /locus_tag="Jann_0111"
FT   CDS_pept        100670..101200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53028"
FT                   /db_xref="GOA:Q28W84"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W84"
FT                   /protein_id="ABD53028.1"
FT                   /translation="MRLLRNILIGLVSLVVVLAIIGMFLPRYVSVERDIMVNAAPEDVY
FT                   PHVNSLQAFSEWSPWGDIDPDMVVTYSGPEEGVGNVMEWTSDHPNVGNGRQEILEVVEN
FT                   ESVRSALDFGDMGTAEAWWRLTPDGDSTRVVWGLTADMGGGPVGRWFGLMMDSWVGPDY
FT                   ERGLDRLQASVEG"
FT   gene            101247..101792
FT                   /locus_tag="Jann_0112"
FT   CDS_pept        101247..101792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53029"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W83"
FT                   /protein_id="ABD53029.1"
FT                   /translation="MSAPLVLDLPPETLAALRLSARAAGVSPSQHAIGLLSKTLISHAA
FT                   RTPCRAEERPHDLEYLLAPLRALLAADLSRATDWADLQDRLAKHGYTFRERGGGLALFS
FT                   TTTAARICKASDLGWTYADLIRRFDAPFPGHSHTHVADRVLKRALPKSQNHPSLFPDPG
FT                   DLFSVEDDDDDLILFEDE"
FT   gene            complement(101793..103454)
FT                   /locus_tag="Jann_0113"
FT   CDS_pept        complement(101793..103454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53030"
FT                   /db_xref="InterPro:IPR011935"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W82"
FT                   /protein_id="ABD53030.1"
FT                   /translation="MKRILLTTALCAAFPMAALADDIVIRADLSDATLFGQGADVTRAG
FT                   EAVIPAGRHRLLIAVPDLDAISLPQIAGVDNVRFGPPQSLYNHPIAEGALDDAAQDAAR
FT                   ADVETTEAALMEAQDALSRADAALRAIETQQGYIAAILRGGENGVAVPEDPAQVAQFLS
FT                   TLGAETARLAEEGLAARVARRDLAEAVTDAQRVYSDATRALQALSPFEQQINAIAVDVV
FT                   AGEETSMDVLLSYFTPEASWHPSYELDLDTETGALAIDRFVTLATYGAARWQDVDVTFS
FT                   TAAPGRVREPSIPSPRPARIRDAAQGGVLSRTLDLAPPAPAPATAGYAAAEAVVVVEDI
FT                   AVVADFDGLSVSYAYPEPISVSATGEVLLAFDTLELDTELENRAVPRWDETAFLIAMTD
FT                   NDSGEPILPGDARFYRDGALMGEGFLPLIPMGADAEMAFGALDHLQLTWIDRSLAEGDR
FT                   GLFVSSNTQARQIAFGVENTSAEAADVRILYATPFAEQEDLELDLTLSPRPSEQDLDGQ
FT                   RGVHAWDLDVAPGEEQMIEMTVEFEFPDGQILDWQP"
FT   gene            complement(103739..104761)
FT                   /locus_tag="Jann_0114"
FT   CDS_pept        complement(103739..104761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0114"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53031"
FT                   /db_xref="GOA:Q28W81"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W81"
FT                   /protein_id="ABD53031.1"
FT                   /translation="MGYKVVVVGATGNVGREMLNILDERQFPVDAIEALASRKSLGTEV
FT                   SFGDKTLTTKDLDTFDFTGWDIALFAVGSDATKKYAPVAAKVGCIVIDNSSLYRYDPDV
FT                   PLVVPEVNPDAVHGYAKKNIIANPNCSTAQMVVALKPLHDRAKIKRVVVSTYQSVSGSG
FT                   KDAIDELWKQTKGIYVPGQEVAPSVYPRQIAFNVIPHIDAFMDSGDTKEEWKMVAETKK
FT                   IVDPAIKVTATCVRVPVFVGHSESINIEFEEFLDEDEARDILREAPGIMVVDKREDGGY
FT                   ITPIECVGDFATYVSRIRQDVTIENGLNLWCVSDNLRKGAALNAVQIAETLGNRVLKKG
FT                   "
FT   gene            105076..106431
FT                   /locus_tag="Jann_0115"
FT   CDS_pept        105076..106431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0115"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53032"
FT                   /db_xref="GOA:Q28W80"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W80"
FT                   /protein_id="ABD53032.1"
FT                   /translation="MWRIFGLRNGAGAKGYELFDFDMLGLKPILAKTLKTAGFSEPTPI
FT                   QNQAIPLALDGHDIMGLAQTGTGKTLAFGLPLLEHLLSLHGKPEPKTARALILAPTREL
FT                   VNQIADSLRVFTQNTPVKIATVVGGQSIGRQISTLSRGTDILVATPGRLMDLMDRRAID
FT                   LSTVKHLVLDEADQMLDLGFIHALRKIAPALGTPRQTMLFSATMPKQMEELASAYLSNP
FT                   KKVQVSPPGKAADKVTQVVHFMPKPAKPAKLREVLNEDPDALVLVFGRTKHGCEKLMKG
FT                   LVADGYNAASIHGNKSQGQRDRAIKAFRDGTIKILVATDVAARGIDIPGVAYVINYELP
FT                   DTPDNYVHRIGRTARAGREGEAIAFCSAEEVDLLVQIEKVMKMSIPVASGTRPEAVKAE
FT                   KPQRGGRRRGGGGGGRPGGGGGGNRKPQGKGGGGGGNGQPRKPRRPRRSKAA"
FT   gene            complement(106435..106848)
FT                   /locus_tag="Jann_0116"
FT   CDS_pept        complement(106435..106848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53033"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W79"
FT                   /protein_id="ABD53033.1"
FT                   /translation="MTRLIALPLLALALPAQAELPPCVSDDLMRQASLVVQITDPSVET
FT                   FANNICRISGTIVQVHRGAANVGQSLTATFDCLIDPSQAVIGGTVYSDPDALARAGAVE
FT                   VHIGSDGYVAANGAGLIALNAPTQRIAWEPYCS"
FT   gene            complement(106918..108087)
FT                   /locus_tag="Jann_0117"
FT   CDS_pept        complement(106918..108087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0117"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53034"
FT                   /db_xref="GOA:Q28W78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W78"
FT                   /protein_id="ABD53034.1"
FT                   /translation="MRAGLGFLIIAYCLSQFFRAFLAVLAPVLATEIGTTTSDLATASG
FT                   LWFCAFALMQLPVGWALDTVGPRITASVLFSLGAVGGCIVFAMAQGPGAISLAMVLIGI
FT                   GCAPILMSSYYIFARVFSAAVFGTLAGVTVGFSSLGNLLSAAPLAWAVDTYGWRETLWA
FT                   TAGFTAIIALGIIIFVRSPAKPEGEGKGSFTELLRIRALWPIYVGMFICYAPTAGIRGL
FT                   WISPYIGETFGVSLAQVGVATLAMGLAMVAGNFLYGPIDKIVGSRKWGIIGGNAIVAGL
FT                   CLSFFVLPPGSFLIAVALFVAIGVFGASFPAVMAHGRGFLPQHLTGRGVSLLNLFGMGG
FT                   AGVMQFASGPTYAGLSAGMGAQAAYGALFAIFAGVILLGLAVYAFAQEA"
FT   gene            108304..109323
FT                   /locus_tag="Jann_0118"
FT   CDS_pept        108304..109323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0118"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53035"
FT                   /db_xref="GOA:Q28W77"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W77"
FT                   /protein_id="ABD53035.1"
FT                   /translation="MTRTLTALLGTTIFMSTALAAQAQELNLYSSRHYETDERLYSDFT
FT                   DLTGITINRIEGNADELIARMEAEGANSPADVFLTVDTSRLQRAADAGLLQTVDSEVLA
FT                   ERIPANLRDDDGLWFGFSQRARIIFYDTADVETPPQTYVDLADPAYEGMVCHRSSTNVY
FT                   SQTLLSAVIENYGEEAAREWAAGFVNNFARDPQGGDTDQLRGLVSGECDISISNTYYFA
FT                   RAIRRDVEGLSAEQRENIGWVFPDQGGNGAHVNLSGGGMAAHAPNVDAAVAFLEYLASD
FT                   QAQQYFSAGNDEYPVVAGVDIAPSVQELGEWEADDVDLAAVTGNVPLAQQIFNDVGWE"
FT   gene            complement(109380..110618)
FT                   /locus_tag="Jann_0119"
FT   CDS_pept        complement(109380..110618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0119"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53036"
FT                   /db_xref="GOA:Q28W76"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W76"
FT                   /protein_id="ABD53036.1"
FT                   /translation="MNFVVANARWLATGLLLSVGSSFGQTYFISIFAGEIRDAYALTDG
FT                   QWGGIYTIATVSSACLLILFGGRADTVRLSRLAVIVASVFAAACGLMAVGSSVWTLLLS
FT                   VFLLRFCGQGMMTHMKATAMARWFVATRGRAMAITNLGYPVGEACLPLITILFIASVGW
FT                   RATWGVAAGVILLVLIPLLMWLLAQDRAPKGSNGGQGAPGLFGKHWTRGEVLSYPLFYA
FT                   FVPLLLTPGFIGTVIFFHAVHVAEVKGWTLTAMAASYATYATASVTMGLVAGWAADRFG
FT                   PARLVPIVLIPMGLGMFLIGPSETPLGWAVALALVGVTQGMAAALGGTLLPTLFGTNHL
FT                   GSVRSIATAIMVFATAIGPGITGWFIDRGVTYPEQGAAQGLWCLALSAALVPVMLWTVR
FT                   LQTQKAPGDGRFS"
FT   gene            complement(110615..111742)
FT                   /locus_tag="Jann_0120"
FT   CDS_pept        complement(110615..111742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53037"
FT                   /db_xref="GOA:Q28W75"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W75"
FT                   /protein_id="ABD53037.1"
FT                   /translation="MVGITMLRGALLSMALIFTTVPATAHEIRPTIGDIEVGESTVTMS
FT                   LRIALEALLSGVDLSSVTDTDESPEAAIYDRLRAMEPAELEAELRAAWDRIALGFILEV
FT                   EGERLEPEIIAVQIPGAGDVELPRDSILTVGAALPDGDAGVRVGLSPQFGTFIPRQVGG
FT                   GDDAYEGFLNGGELTPELPRTAILTEGGMDVFVRYVISGFDHIIPKGLDHILFVLGLFF
FT                   FATQFRPLLWQVSAFTLAHTITLALAATGVVSVPGSVVEPLIAASIVYLAVENILGIGN
FT                   TKWRTIFVFGFGLLHGLGFASVLGDFGIAQGAFLQALIGFNVGVELGQLAVIAIAFALV
FT                   GWFMKKDWYRNAIVIPASLVIAGIGAWWVVERTLL"
FT   gene            111761..112567
FT                   /locus_tag="Jann_0121"
FT   CDS_pept        111761..112567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53038"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W74"
FT                   /protein_id="ABD53038.1"
FT                   /translation="MKPVYLALTIAALAVTDKATAHEFWIDPVDFTVAVGETLEADLRV
FT                   GQDFSGSPQSFLPRSFALSVVLNDGEVYRADGRLGDIPALSQDGLADGLAIIVHQTNST
FT                   ELVWSEWERFLNFAEHKDLGDVTAMHEARNLSQENVTEDYIRYAKSLVAIGSGAGADGR
FT                   VGMRAELVALVNPYTDSIAGGMPMQLWYDDALQPDYQVELFAQSASGAVTVTYHRTNVD
FT                   GVVVLPIQPGMTYMADAVFLEAVEPTRPDDASWVTHWANMTFSTAP"
FT   gene            112619..113419
FT                   /locus_tag="Jann_0122"
FT   CDS_pept        112619..113419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53039"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W73"
FT                   /protein_id="ABD53039.1"
FT                   /translation="MTTPALPPIAMFWTGAPVDWMQRLSMHSFVNHGYRVTLFSPKDAP
FT                   IDPQCDGVEVAAMEEIYVPSRRMGKHAAPACLADVFRLYLMQKTDYVWMDSDMLSISPM
FT                   TLNQGYAMSWSSPGGQINNAALRVPQDSKALRYLLDHIEDPELIPEWMNRDHRAKLKEL
FT                   PPERRLLAQGKMLRIVYGPRGLNHALQKTGEADFASPMEAYSPVPWWLTDLFYSPKGGV
FT                   EPYLTGDTRVVHLFNDQIRKYNKNRPPPEGCFLDQYIKESGFKV"
FT   gene            113445..114050
FT                   /locus_tag="Jann_0123"
FT   CDS_pept        113445..114050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0123"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53040"
FT                   /db_xref="GOA:Q28W72"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W72"
FT                   /protein_id="ABD53040.1"
FT                   /translation="MDKFTTLTGIAAPMPLINVDTDMIIPKQFLKTIKRSGLGANLFDE
FT                   MRFDDDGNEIPDFVLNKPAYRDAQILVAGDNFGCGSSREHAPWALLDFGIRCVIATSFA
FT                   DIFYNNCFKNGILPIVLLQEQVDMLMDDAERGANAVVSVDLESQTITGPDGGTISFEVD
FT                   AFRKHCLLNGLDDIGLTLEKAPSIKAFEAEAAQARPWV"
FT   gene            114305..115162
FT                   /locus_tag="Jann_0124"
FT   CDS_pept        114305..115162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53041"
FT                   /db_xref="GOA:Q28W71"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W71"
FT                   /protein_id="ABD53041.1"
FT                   /translation="MFTRLVGALVRAIMIVVVILTPSLLIPGTSSESAKMIMLVALAFA
FT                   MVAVFEYGAKFPGLIEFRDAPPFNRLRVIALFLTLFGLSVISRSGHDGSTLTIVVTALG
FT                   FLVGQALDFPYSPLRLVVDQLPQGIDSQVAGQLQAMAGLSMLVTLLSLFLFSALVRLEH
FT                   WPNRGSAFNVWINLPTFDPTAGGDVVKRLNRDGRVNVIFGIFAPFVIPAVLVMGANQLQ
FT                   VPIFEAPQTMVWAVTIWMFLPLSLIMRGLAMLRIARMIRLRRARLVAGVDVDGPSSALS
FT                   SSAA"
FT   gene            115261..116100
FT                   /locus_tag="Jann_0125"
FT   CDS_pept        115261..116100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0125"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53042"
FT                   /db_xref="GOA:Q28W70"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W70"
FT                   /protein_id="ABD53042.1"
FT                   /translation="MEDEVAATVAVIEAANPDILALQDMDYDGNQVALAALAEALGYAH
FT                   YTTLRPNTGRLTGVDLDGDGRTDGPRDAHGYGRFNGEGGMALLSRFPLGDVQDFSDMLW
FT                   RDLPGTAAAGVTPEAALPVLRLHTVGAWDVEVVTPDGSLHILMSHATTPVFDGPEDRNG
FT                   LRNADEVRFWSLYLDDTPPAHFAYMGTLNVDPQRGEGLRDPLVELLSHPTLQDPVPGGP
FT                   TADWDDPTPGDLRVDYLLPSRSLTVRDAGVLWPTEGELAEAVEQASDHRLVWVDVNF"
FT   gene            complement(116097..116960)
FT                   /locus_tag="Jann_0126"
FT   CDS_pept        complement(116097..116960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0126"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53043"
FT                   /db_xref="GOA:Q28W69"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W69"
FT                   /protein_id="ABD53043.1"
FT                   /translation="MTRTALILGSSGRFGRHISDALSRHGWTLRKFDRAHDTLPDAAMG
FT                   ASLIVNAWNPPYSQWATLVPDLTRQVIGAAKASGAAVMIPGNIYVYGEDLPPVLSPDTP
FT                   HRSAHPLGQIRRTMESAYRDAGVKTVILRAGDYIDTEQGGNWFDRIIAARIGQGKVSYP
FT                   GPLNAPHAWAFLPDVAEAGARLADQMDTLPPFSDFTFDGFTLTGAEMTQALERATGRPV
FT                   RAKQMSWLPIQIARPFWREAKHLLEMRYLWRRPHGVDGSALQARIKGYRPTPLEDALRR
FT                   AVTPLI"
FT   gene            117053..117940
FT                   /locus_tag="Jann_0127"
FT   CDS_pept        117053..117940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0127"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53044"
FT                   /db_xref="GOA:Q28W68"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W68"
FT                   /protein_id="ABD53044.1"
FT                   /translation="MDQDLDWTLLRAVLAVADTGSLSGAAAQLTRTQPTLGRQIKAAEQ
FT                   ALGQPLFTRHARGLTPTPFCETLLPAAQQMNDAAKAVSVLAAGQSPDTSGRVRLTASVF
FT                   VTAHILPGILADIREAHPNIALDIVASDTTENLLFHEADIALRMYRPTQLDMIAKHLGD
FT                   LPLGLYASETYIARHGTPHSADDLKHHQMVGYDRSDLILRGMREMGMEVTRAFFTTCTD
FT                   DQVAYWNFVAAGCGIGIGQTLVAERTPGMRRILPDLRLPVLPVWLTAHPGLRHQPRVHA
FT                   VWTALDTAITPLLS"
FT   gene            117998..119098
FT                   /locus_tag="Jann_0128"
FT   CDS_pept        117998..119098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0128"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53045"
FT                   /db_xref="GOA:Q28W67"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W67"
FT                   /protein_id="ABD53045.1"
FT                   /translation="MTDRSLLILPGDGIGPEVMAEVRKIIDWFGSARGISFDVSEDLVG
FT                   GAAYDAHGVPLTDATMEKAQSVDAVLLGAVGGPAYDDLDFSVKPERGLLRLRKEMDLYA
FT                   NLRPAQCFDALADFSSLKREIVSGLDIMILRELTSGVYFGEPRGIHTEGNERVGINTQR
FT                   YTETEIARAAHSAFELARRRNNKVCSMEKANVMESGILWRDVVNEVHAADYGDVQLSHM
FT                   YADNGAMQLVRAPKQFDVILTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMANGRPKA
FT                   MYEPVHGSAPDITGQGKANPIACILSFAMALRYSFDLGDEATRLEGAVESVLADGARTA
FT                   DLMGPDGGTPISTSQMGDAIVAKLAA"
FT   gene            119095..119556
FT                   /locus_tag="Jann_0129"
FT   CDS_pept        119095..119556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0129"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53046"
FT                   /db_xref="GOA:Q28W66"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W66"
FT                   /protein_id="ABD53046.1"
FT                   /translation="MTLSVRAFAAEDEAAFLSLYRDCLAHYGVGPSRPEIEAEIIADLT
FT                   APRGMSASIAWNGPHPLGFATWVRVYPAMDGIAIYLKELYVTADARGLGAGKALMQDLA
FT                   QTASDIGAVRLEWGSFQPDALRFYDALGAPRVDKTHFSVAANALHTFAR"
FT   gene            119593..119955
FT                   /locus_tag="Jann_0130"
FT   CDS_pept        119593..119955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53047"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W65"
FT                   /protein_id="ABD53047.1"
FT                   /translation="MLTRLSLCFALLTSTAHADGFAVGDTFMDPMEIAQSAFADFNYYG
FT                   EGRPAITVDASVDFFNQMTILVAETGFADDSVDGVRNQYVLQQGDGEVWTIIFTRTDYR
FT                   CGRGANTVTWQTNLCP"
FT   gene            120005..120970
FT                   /locus_tag="Jann_0131"
FT   CDS_pept        120005..120970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0131"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53048"
FT                   /db_xref="GOA:Q28W64"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W64"
FT                   /protein_id="ABD53048.1"
FT                   /translation="MTPNIRGALLGLLAFGIFSTHDIIVKYLGGTYAPFQIVFFSVLFG
FT                   FPIVTFLLLRDATEANLRPKHPWWIAARSLASVTVGICAFYAFTVLPLAQVYAIIFAAP
FT                   LLITVLAIPMLGETVGWRRGLAVVVGLVGVVVVLQPGSTTLSLGHGAALLAAVGGAIAS
FT                   LIMRKVGREERSVVMLLYPMSANFVLMGAALPFYYQPMPGQDLAALAVISALALTASAC
FT                   LIFAYRAAPAVLVAPMQYSQILWAAVFGFLLFDEGLDAPILIGSAIIIASGIYIVLRED
FT                   RGGTSSTTPVLRTRTRVGTPSGLRIAPFLKNERRGPPPST"
FT   gene            121018..121094
FT                   /locus_tag="Jann_R0001"
FT                   /note="tRNA-Pro1"
FT   tRNA            121018..121094
FT                   /locus_tag="Jann_R0001"
FT                   /product="tRNA-Pro"
FT   gene            121202..121792
FT                   /locus_tag="Jann_0132"
FT   CDS_pept        121202..121792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0132"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53049"
FT                   /db_xref="GOA:Q28W63"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W63"
FT                   /protein_id="ABD53049.1"
FT                   /translation="MNTFGHLQSVPDGPFRFIAVDVETANNAQGSICQIGLCCVGSDDS
FT                   LNTVSTLIDPEQSFSPFNTDLHGISAETVNGAPTFPQAYASLYPVLNAHRLVQHSRFDE
FT                   AAFTAACARYDVPMVTSHWTDSVKIARQAWPELKGAGGHGLASLKKALGLSFHHHDAGE
FT                   DARASATVILRAEARISKAVAHLRFDPQLAFEF"
FT   gene            121806..122600
FT                   /locus_tag="Jann_0133"
FT   CDS_pept        121806..122600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0133"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53050"
FT                   /db_xref="GOA:Q28W62"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W62"
FT                   /protein_id="ABD53050.1"
FT                   /translation="MHPLLTEPLITEFQTKGVTVIRGLFAGHVDAIRAGIQRNMDDPGP
FT                   YAAENLKDGDTGRFFDDYCNWQRIPEFEEVIRQSPAAEVAADLMRSDATQLFHDHVLVK
FT                   EPGTSKPTPWHQDGPYYFVGGKQNVSFWAPVDPVTTASLRCVAGSHMWEKPVVPTRWLN
FT                   EDTFYPDSDAYIPVPDPDAEGMEVVEWALEPGDAVAFNYWILHGARGNEASARRRAFSL
FT                   RFLGDDAYYVDRPGPTSPPFPDHGMKAGDPLRRDWFPTVFTR"
FT   gene            122708..124384
FT                   /locus_tag="Jann_0134"
FT   CDS_pept        122708..124384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0134"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53051"
FT                   /db_xref="GOA:Q28W61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W61"
FT                   /protein_id="ABD53051.1"
FT                   /translation="MAQRSRIPSPLRLGTLAWLAAGVCLLPMAAVAIAALTGGFETFQR
FT                   LSTTVLPRYAGTTALLIILVGIGTATIGTGAAWLVTATRFPGRRVLEIALALPLAFPAY
FT                   VLAYAYTDFLDHPGWVQTSLRDLMGWGPRDYWFPEIRSLGGAAAMLTLVLYPYVYLLTR
FT                   AAFLQQSATAYIAARTLGHGPWSAFFRVSLPIARPAIAGGTLLALMETLADFGTVSYFG
FT                   VQTFATGIYQAWYSFFDRGGAAQLALCLLIVALVIAALERRQRRDQRQHGAGRRFEAMQ
FT                   AVTLTGWRAGGAFVFCALPVALGFALPVFLLLSLGWDHFDNMLTDRYLRFLRNSLILAS
FT                   IAAVITVAAAVVLGFNARLHPTRAARTAIRVAGLGYAVPGGVIAVGLIVPFAAFDNALD
FT                   AFMEARFGIDTGLLITGSIWLLVAAYGVRFMAAALSAYDAGLSTINPNVDAVARTLGRS
FT                   PSRMLSGVHLPILRPSILTGLLIVFVDVMKELPATLIMRPFNFDTLAVQAHRLAADERL
FT                   GEAAGPSLVIAGVGLLPVVILCLSLGRDRTARRFVPEPVET"
FT   gene            complement(124403..125809)
FT                   /locus_tag="Jann_0135"
FT   CDS_pept        complement(124403..125809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0135"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53052"
FT                   /db_xref="GOA:Q28W60"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W60"
FT                   /protein_id="ABD53052.1"
FT                   /translation="MTGKTLYDKIWDAHLAHEAEDGTSLLYIDRHLVHEVTSPQAFEGL
FT                   RMAGRSVHAPDKTIAVPDHNVPTTEGRDDPKNMTEDSAIQVAALDKNAKDFGIHYYPVS
FT                   DVRQGIVHIVGPEQGWTLPGMTVVCGDSHTATHGAFGALAHGIGTSEVEHVLATQTLIQ
FT                   KKSKNMKVEITGKLAPGVTAKDITLTVIGRTGTAGGTGYVIEYCGEAIRDLSMEGRMTV
FT                   CNMAIEGGARAGIIAPDEKTFEYCMGRPHAPKGAQWEAALAWWKTLYSDDDAHWDEVVT
FT                   IRGEDIAPVVTWGTSPEDVLPITAEVPAADSFEGGKVGAAQRSLDYMGLTAGTPLDQIE
FT                   IDTVFIGSCTNGRIEDLRAAASILKGKKVKDGLRAMIVPGSGLVRAQAEEEGLADIFKD
FT                   AGFEWRLAGCSMCLAMNPDQLSPGERCAATSNRNFEGRQGRGGRTHLMSPAMAAAAAIT
FT                   GRLTDVRELM"
FT   gene            126057..127412
FT                   /locus_tag="Jann_0136"
FT   CDS_pept        126057..127412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0136"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53053"
FT                   /db_xref="GOA:Q28W59"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W59"
FT                   /protein_id="ABD53053.1"
FT                   /translation="MDPEVAPEDIPEDIVDAEAEAFDAALTEITGLMGQIETFLASLLR
FT                   TWNAYQIGIVIALLAAAWLMKRAFGPRIRTWMASREGWPKWRMRVLAIIHRRLFIIFFV
FT                   LLIWTFVLIMREVTWPSRSFLLTIVAELATAWLFVVFVTRLIRSAFLRGIIRYGAWIFV
FT                   TLVILDLTDEAAALLDSVGFNLGDARLSLLTLVQAILVVAALVVIARFLTSTATGRIQK
FT                   NEEISPSMQVLAVKFLQVAFYGIAIYMGLRLTGVDLTGLAVLSGAIGVGLGFGLQKVVS
FT                   NLVSGVIILLDKSIKPGDVISLGETFGWINSLGARYVSVVTRDGKEYLIPNEDLITSQV
FT                   VNWSHSNEFVRLDIYFGTAYGDDPHIVRKLAIEAAQGVERVLSHRAPVCHIVGFGDSSV
FT                   DYILRFWIKDPTGGLTNIRGNVYLALWDTFSANNISIPFPQREIKMLDKQED"
FT   gene            complement(127409..129025)
FT                   /locus_tag="Jann_0137"
FT   CDS_pept        complement(127409..129025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0137"
FT                   /product="thiamine pyrophosphate enzyme-like TPP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53054"
FT                   /db_xref="GOA:Q28W58"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W58"
FT                   /protein_id="ABD53054.1"
FT                   /translation="MTKHHGGKILADRLALHGVERVFSVPGESFLAALDGLYDHDIPNI
FT                   VCRQEGGAAMMAEAHGKMTGTPGVLFVTRGPGATNASAGLHIAMHDATPLVCFVGQIPL
FT                   KHRDRGVFQEVDYRAFFGPLVKWSAEVERTDRLAEYIDRAFAVAQAGRPGPVVLALPED
FT                   ILCAMAEPPKQRPGARAMGRVHPDDIAPMVEAFKLAKRPLILCGGPHWGDVEKQTAQAL
FT                   AERTGAPIAVTFRRQDYIDNDHPNYAGDLGVGANPALQKRLGDADCVLLLGAELNDITT
FT                   ADFTLIDPADPPTILQVAPTPEATSKTYPATLAVAAPPISMLYQFLDATPQSPDRGANA
FT                   ARGEFEKWQVPQLTPGAVQMESIICWLRDNASSDTIITNGAGNYAAFLHRYYRFRQYGT
FT                   QVAPTSGSMGYGLPAAVSAKLHNPDQPVICLAGDGCLQMTIQELSTARQHGADIIVIVA
FT                   NNGRYGTIRMHQENHYPGRVSGTDLFNPDYAALAEAYGGTGHLVTENAQFADAYRQALT
FT                   GGLHIIELALDPKMLATTKSL"
FT   gene            129097..129618
FT                   /locus_tag="Jann_0138"
FT   CDS_pept        129097..129618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0138"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53055"
FT                   /db_xref="GOA:Q28W57"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W57"
FT                   /protein_id="ABD53055.1"
FT                   /translation="MGLCGSLRAASFNAMLMRDAAAAFDAETFREANLRFPLYDGDLEE
FT                   AEGIPAEVQTLSDQIAEADAVIIVGPEYNKAISGVLKNALDWVSRTEGQPWLQKPVAIL
FT                   SATAGRSGGECAQVSMRECLAAFRPRLVLGPAVLVGSAFSAFEDGHLTNEMNRKALNGL
FT                   MEELRRAAGL"
FT   gene            complement(129615..130661)
FT                   /locus_tag="Jann_0139"
FT   CDS_pept        complement(129615..130661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0139"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53056"
FT                   /db_xref="GOA:Q28W56"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W56"
FT                   /protein_id="ABD53056.1"
FT                   /translation="MTDITGPDIIVRGAGITGLMCAWMLVRRGAKVQVVDPKGVGAGAS
FT                   GGIVGALAPHVPENWNAKKAMQFKALHEAGALWAEVADAGGQEPGYARTGRVQPLSDAA
FT                   AVALARQRTETAKDLWETRYQWRVIPADDVDVAVESPTGLVIHDTLTARIHPRRACAAL
FT                   ASALRALGVEIRPEATCAGVEVWATGADDLIQMSKARGKLVGAPIKGQAALLRADLREA
FT                   PQVFVDGLHIVPHGDGTVAIGSTTEREFEDATSTDAQLDPLIKAARQAVPALRDAPVTQ
FT                   RWAGLRPRAKSRAPMVGPHPMRKGAYIANGGFKIGLAMAPVMAEMLAALILDETDTIPQ
FT                   DFRPEASF"
FT   gene            130716..131372
FT                   /locus_tag="Jann_0140"
FT   CDS_pept        130716..131372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0140"
FT                   /product="protein of unknown function DUF752"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53057"
FT                   /db_xref="GOA:Q28W55"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W55"
FT                   /protein_id="ABD53057.1"
FT                   /translation="MSKDQTKIDWRGGVPISVRFGDPYYSLKDGLAETRYVFLGGNALP
FT                   ARFRDGFHVAELGFGTGLNFLATLQAFRDAGTPGTLCFTSFEAHPMSHEDMLRALAPFP
FT                   DLPVSTLLDNDLTRMLDGPDFRLEIIHGDARETVPNWQDRADCWFLDGFAPAQNPELWE
FT                   DDLLHAVAAHTNPGGTFATYTAVGRIRRTLAAAGFTVERIKGFNAKPHMTRGVMP"
FT   gene            131369..132238
FT                   /locus_tag="Jann_0141"
FT   CDS_pept        131369..132238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0141"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53058"
FT                   /db_xref="GOA:Q28W54"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W54"
FT                   /protein_id="ABD53058.1"
FT                   /translation="MTDNPRLGIYLMIATTFVFAMQDGISRHLAGEYNIFMVVMIRYWF
FT                   FAAFVITIASRQAGGVRAAAKTEQPVLQAFRGVLLAAEICVMVGAFVLLGLVEAHAIFT
FT                   CYPLLVAALSGPVLGEKVGWRRWTAIGIGFVGVLVILQPGFGVFSIYALVPLAAAFMFA
FT                   LYNLLTRYAARKDRAATSFFWTGTAGALVMTCVGIWFWEPMSGPDWAWMALLCVTGATG
FT                   HFLLIKTYDVAEASAVQPFAYLQLVFASALGLLVFGEVLATNVAIGAAIVICAGLFTLW
FT                   RTRTVTGG"
FT   gene            complement(132239..133252)
FT                   /gene="crtB"
FT                   /locus_tag="Jann_0142"
FT   CDS_pept        complement(132239..133252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtB"
FT                   /locus_tag="Jann_0142"
FT                   /product="phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53059"
FT                   /db_xref="GOA:Q28W53"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W53"
FT                   /protein_id="ABD53059.1"
FT                   /translation="MIDPDDMDHCRHAIREGSYSFHAASKLLPSSVRDPALALYAFCRL
FT                   ADDEVDFGADKPAAVLALSERLEHAYQGRPRNHPTDRAFTAMIEEFDMPRALPEALLEG
FT                   LAWDGMERRYATLSDLRSYSARVASAVGAMMCVLMRVRDEQALARACDLGVAMQLTNIA
FT                   RDVGEDAAERRLYLPTDWLEEEGIDIERLFTSPVSSPRLKRLTKRLLAEAHKLYLKSEP
FT                   GIGRLPLAARPGIFAARHCYDAIGRNLAQHGYDNVNRRATTTGGHKMRLLGLSIVRAGL
FT                   ASILPESPVIFARPLPETAFLVEAAAHPAPNKDAWSDPLLSVLSQLKAQDRPHAAE"
FT   gene            complement(133255..134814)
FT                   /gene="crtI"
FT                   /locus_tag="Jann_0143"
FT   CDS_pept        complement(133255..134814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtI"
FT                   /locus_tag="Jann_0143"
FT                   /product="phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53060"
FT                   /db_xref="GOA:Q28W52"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR008150"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W52"
FT                   /protein_id="ABD53060.1"
FT                   /translation="MDSCKAEHPVINPSKAIVIGAGLGGLSAAMRLGAKGYQVTVLDRL
FT                   DRAGGRGSSITQNGHRFDLGPTIVTVPQVFEQLWADCGRSFRDDVDLRPVDPYYEIRWR
FT                   DGSKFRVNGDDTTMEAEVAKLSPSDVAGYRKFLNDSERRYEFGFEGLGRRPMNKLMDLV
FT                   REIPGFVKLRADRSVYAHASARVKDERLRMALSFHPLFIGGDPTRVTSMYSLVSHLEKE
FT                   FGVHYAMGGVQAMADAMVRVIDDQGGEVRLGEDVTEITVEQGRTTGVVTETGESLASDI
FT                   VVSNADPGTTYEHLLSKQTKRRWTPKRLNKSRWSMGLFVWYFGTKGTRDKWGDVGHHTI
FT                   LNGPRYNGLLDDIFIRRKLADDMSIYLHRPSITDPSAAPAGDDTFYALSPVPNLHGKSV
FT                   DWTEMTERYRANMASVLNDQLLPGFENHLSASHIFTPQTFVDRYRSPHGAGFSLEPRIF
FT                   QSAWFRPHNISEEIAGLYLVGAGTHPGAGIPSVVTSSEVLNKLVPAAETPVIPPIQRVA
FT                   AE"
FT   gene            134918..135643
FT                   /gene="crtA"
FT                   /locus_tag="Jann_0144"
FT   CDS_pept        134918..135643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtA"
FT                   /locus_tag="Jann_0144"
FT                   /product="spheroidene monooxygenase"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53061"
FT                   /db_xref="GOA:Q28W51"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W51"
FT                   /protein_id="ABD53061.1"
FT                   /translation="MQSTTLSLYRFGSTSARLWAFAQMGLARPAMRDVRGIGTWKLCGS
FT                   GTGEGFTPLPNTSVYAILATWPDHDTARRALFGAGVFRRYAARSSEAMTLFLTSTSARG
FT                   TWAGTEPFATSGDPGGPIAALTRATIKPRIAAKFWGRVPGISTAIGNDPNVLFKIGIGE
FT                   VPMLHQVTFSIWPDATSMADFARKDGPHAKAIHAVRSEGWFKEELYARFNVDAVDGTWD
FT                   GATPDFASRPVADTRIAAE"
FT   gene            135640..136659
FT                   /gene="bchI"
FT                   /locus_tag="Jann_0145"
FT   CDS_pept        135640..136659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchI"
FT                   /locus_tag="Jann_0145"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53062"
FT                   /db_xref="GOA:Q28W50"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W50"
FT                   /protein_id="ABD53062.1"
FT                   /translation="MKDIMEPGPFPFSAIVGQEEMKRAMILTAIDAGIGGVLVFGDRGT
FT                   GKSTAVRGLAALLPSIDAVAGCPVNSRAVSDVPDWVVLKDQAIVTKQTPVIDLPLGATE
FT                   DRVVGALDIEKALTKGEKAFEPGLLARANRGYLYIDEVNLLDDHLVDLLLDVAQSGQNV
FT                   VEREGLSIRHAAKFVLVGSGNPEEGELRPQLLDRFGLSVEVASPTDIDVRIDVIRRRDA
FT                   YDRDPVAFGADWASEDADLRMRVVDARARLESVEAGDDVLRDCAALCVALGSDGLRGEL
FT                   TLLRAARALAAFEGDTSVNRAHLKAVAPSALRHRLRRDPLDDAGSTTRVTRVVDEVLG"
FT   gene            136656..138347
FT                   /gene="bchD"
FT                   /locus_tag="Jann_0146"
FT   CDS_pept        136656..138347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchD"
FT                   /locus_tag="Jann_0146"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53063"
FT                   /db_xref="GOA:Q28W49"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W49"
FT                   /protein_id="ABD53063.1"
FT                   /translation="MSDAEGRWQGVNLAVACLALDPAALGGFWVRARVGPVRDQLENGL
FT                   KTALQGLSLRRIAPTMPDDALFGGIDLAATLDTGVLTETRGLLADPGVLLLPMAERVEP
FT                   GLAGRLAGALDAGRGLSIIAFDEGAEPGERAPDALLDRLAIHIDLTDHALSDAPGLAID
FT                   LDALTEARARLPLISTPDTAIAELAEVAARLGILSLRAPLQALAVARASAALSGADEIE
FT                   DADLLTAVELVLAPRATRMPEAPEDTQDDPPPPPDDTTPDRPEDEIEEQLDLPPADILL
FT                   EAARAMLPPDLLARLAPGKAARAAKATGSGAAKTGNRRGRPLPPRVGRMGGNARVDLVA
FT                   TLRAAAPWQKIRQDITGVTDRVHVRMSDIRIRRFKEASDRAIIFVVDASGSSAMARLAE
FT                   AKGAVELLLAEAYSRRDHVALVAFRGDGAEVLLPPTRSLVQTKRRLASLPGGGGSPLAA
FT                   GLRAALHLAALAKGKGMTPSVALLTDGRANVDLTGTANRTTAAEDASNMARAIRSEGYP
FT                   GLVIDTGQRPTRGLDALAREMGAPYLPLPRADSRNLSRAVDAALTP"
FT   gene            138344..139192
FT                   /gene="bchO"
FT                   /locus_tag="Jann_0147"
FT   CDS_pept        138344..139192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchO"
FT                   /locus_tag="Jann_0147"
FT                   /product="Mg-protoporphyrin IX chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53064"
FT                   /db_xref="GOA:Q28W48"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W48"
FT                   /protein_id="ABD53064.1"
FT                   /translation="MNALPPDWPNRDASRIVSLAPHRWHVQQMGTGPDALLLHGAGASA
FT                   HSWAPIAPELQDLNRIFVPDLTGHGFTQSPKGRARLPDVAKDLAALLRDQTIEPRLVIA
FT                   HSAGGAIALEMARRGLITPERLVIINGALEDFKGAAGVIFPVMAKILVMNPLTGMFLSS
FT                   GPQGLSQARSVIKTTGSELSEDLLKHYAHLIGRKPHVDGTLGMMSQWSLAELTRALPAI
FT                   GTPTLFIHGANDKAVDVSVAKRASKAMPNAELIVVDGVGHLAHEEAPERVATHIRAFTQ
FT                   T"
FT   gene            complement(139246..139692)
FT                   /gene="cycA"
FT                   /locus_tag="Jann_0148"
FT   CDS_pept        complement(139246..139692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycA"
FT                   /locus_tag="Jann_0148"
FT                   /product="Cytochrome c2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53065"
FT                   /db_xref="GOA:Q28W47"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W47"
FT                   /protein_id="ABD53065.1"
FT                   /translation="MQRLTVLATAATLLAAPVLADGHATGDAEAGERAFRQCISCHVVV
FT                   DADGETLAGRNARTGPNLYGIHGRPIGSVEDFRYSNGLTALMEAGMEWDEAAFVGYVQD
FT                   PTGWIREAADDDSLRGAMSFRVRSEEDALNLYAYLVSLGGPEAE"
FT   gene            complement(139789..141003)
FT                   /gene="hemA"
FT                   /locus_tag="Jann_0149"
FT   CDS_pept        complement(139789..141003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="Jann_0149"
FT                   /product="5-aminolevulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53066"
FT                   /db_xref="GOA:Q28W46"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W46"
FT                   /protein_id="ABD53066.1"
FT                   /translation="MNFDQLFQTQLDALKDEGNYRVFAELERACGEFPRVKSHGDHGPD
FT                   EVTVWCSNDYLGMGNNPKVMQVMMDTVATCGTGAGGTRNISGNAHHHKLLEAELADLHG
FT                   KEAALLFTSGYVSNWASLSTLGSRLPNAVILSDSLNHASMIEGIRHAKCDKVIWKHNDP
FT                   EDLDRKLAALPANATPIVAFESVYSMDGDIAPIAAILDVCEKHGAMSYIDEVHAVGMYG
FT                   PRGGGVAEQDGLMDRITLIEGTLGKAFGCVGGYITGSHALIDFIRSFASGFIFTTALPP
FT                   AVAAAATASVKHLKESQWERAMQKRQVARLRARLDAEGIPHEHNPSHIIPVMVKDPVKC
FT                   KMLSDILMDQFGIYVQPINYPTVPKGTERLRFTPGPLHSDADIEYLVMALKTLWKQCAI
FT                   AHAVA"
FT   gene            complement(141000..141812)
FT                   /locus_tag="Jann_0150"
FT   CDS_pept        complement(141000..141812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53067"
FT                   /db_xref="GOA:Q28W45"
FT                   /db_xref="InterPro:IPR017496"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W45"
FT                   /protein_id="ABD53067.1"
FT                   /translation="MLSSPWIAALVALFVWWFSTGAILFAVRRADQGGPHARLWACLMT
FT                   LPFLVLGAAGFIDTLYNPTIAAVYVAFLSALALWGWIELTFLTGTITGPVTSHSVPNVS
FT                   EGERFIRAWGTVAYHEMLLAAVMVAMIILAWGVENQFGMWTFAVLFAARISAKLNLYLG
FT                   VRKVNVEFIPEPLTHLPSHFGTARMNWLFPLSITGLSFAAACWLERLWTSDTTADTVGF
FT                   ALLSALTALALLEHWFMVLPLPDEKLWRWMLPARPQPAQATRLSEETL"
FT   gene            complement(141812..142933)
FT                   /gene="acsF"
FT                   /locus_tag="Jann_0151"
FT   CDS_pept        complement(141812..142933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsF"
FT                   /locus_tag="Jann_0151"
FT                   /product="Mg-protoporphyrin IX monomethyl ester (oxidative)
FT                   cyclase"
FT                   /EC_number="1.14.13.81"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53068"
FT                   /db_xref="GOA:Q28W44"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR008434"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W44"
FT                   /protein_id="ABD53068.1"
FT                   /translation="MKDTNRTHSADAATVEEALAADNHQGIVDSEGATALAMQNTLLTP
FT                   RFYTTDFDEMDSLDVSSVREDWDTLIAQMKSDPNKGHFKKNEDWDSVDWDGMEPALKRE
FT                   FIDFLVSSCTAEFSGCVLYKEMKRRGNNEDIVTLFQLMARDEARHAGFINDALREAGIA
FT                   VNLGFLTQKKKYTYFRPKFIYYATYLSEKIGYARYITIFRHLEANPEHRFHPIFKWFRE
FT                   WCNDEFSHGEAFALIMKSDPKFTQKWQNKLWIKFFLTAVYSTMYVRDHQRPVFHAALGV
FT                   DPDWYAHEVFTKTSEITKQIFPITLDIENPRWQRGLEAMQRANVDLADAKANGKLFKRI
FT                   GASIRAGAAFVNLFTIPANKHDAPASVRLEPAY"
FT   gene            complement(142930..143226)
FT                   /locus_tag="Jann_0152"
FT   CDS_pept        complement(142930..143226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53069"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W43"
FT                   /protein_id="ABD53069.1"
FT                   /translation="MGLLTRDFEMAPCEVEVSHCFDSLHAHVKFLNGATINPGDEVQVK
FT                   GPPVMAPYGEVVREERMARITRASKLEQLWTRMTGDFEFMELCEFSFSEEVSV"
FT   gene            complement(143230..143736)
FT                   /locus_tag="Jann_0153"
FT   CDS_pept        complement(143230..143736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53070"
FT                   /db_xref="GOA:Q28W42"
FT                   /db_xref="InterPro:IPR017495"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W42"
FT                   /protein_id="ABD53070.1"
FT                   /translation="MTLTPAKTRFYNRTPAEQKLVARDKEMVPVVLVRAMFILCVCVLI
FT                   IVSYARLTDRPLSATAPTVEEVPIVTERLVRIYGELNGSARVLGVDGNVIATFGADEGG
FT                   FVAGVYRVLERERGAVGAMASDPIRVVRFADGRIGLRDPLTDFRAELVGFGADNEAAFA
FT                   RLLEE"
FT   gene            complement(143753..144403)
FT                   /locus_tag="Jann_0154"
FT   CDS_pept        complement(143753..144403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53071"
FT                   /db_xref="GOA:Q28W41"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W41"
FT                   /protein_id="ABD53071.1"
FT                   /translation="MSHDHDDFQTEPVRGLPAHLPEGEEILWQGQPSWWVLAQESLSLW
FT                   WVAGYFVFLFAWRTVGGAATDSWTGSATAASFFLVLGLIVCILLILVSLIQAKAAVYTI
FT                   TNKRVAMRIGAALTMTLNLPFKQVLNAELALRKSGHGNISLEMNPEGGMGFSYVLTWPH
FT                   VRPWKMKQPQPALRCIPDAKAVAAILSEAAQTAVSEPDIQITRVPEMAAQPAE"
FT   gene            complement(144466..145248)
FT                   /gene="puhA"
FT                   /locus_tag="Jann_0155"
FT   CDS_pept        complement(144466..145248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puhA"
FT                   /locus_tag="Jann_0155"
FT                   /product="Reaction center protein H chain"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53072"
FT                   /db_xref="GOA:Q28W40"
FT                   /db_xref="InterPro:IPR005652"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014747"
FT                   /db_xref="InterPro:IPR015810"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR037097"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W40"
FT                   /protein_id="ABD53072.1"
FT                   /translation="MENAFFGNFDLASLSIWLFWIFFALLIYYLQTENMREGYPLENDD
FT                   GTAAPNQGPFPVPDPKTFLMPHGRADVTVPSVENEQAHYRHNLDDVMEAGAVSHGFPYD
FT                   PKGDPMLAGIGSGAWTPRRDEPELDGHGHVKIEPLKARDDMHVSAGKNPLGMRVVAGDG
FT                   VEVGTISDMWIDVPEQLVRYLEIELDADHGGGTRLVPIHFCQIWRRVTINAIHGTHFAA
FT                   VPQTKSNVQITKLEEEKISAYYGGGILYADEKRAEPLL"
FT   gene            complement(145261..146697)
FT                   /gene="lhaA"
FT                   /locus_tag="Jann_0156"
FT   CDS_pept        complement(145261..146697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhaA"
FT                   /locus_tag="Jann_0156"
FT                   /product="Photosynthetic complex (LH1) assembly protein
FT                   LhaA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53073"
FT                   /db_xref="GOA:Q28W39"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W39"
FT                   /protein_id="ABD53073.1"
FT                   /translation="MSMLKRISIRYLPFADAASEELPLGQLLRLSLFQISVGMAAVLLL
FT                   GTLNRVMIVELQVPAFLVACMVALPVLIAPFRALLGFKSDTYKSAIGWKRIPYLWFGTL
FT                   WQFGGLAIMPACLLVLGGEVTQVRYDIPYAGEILAALAFVMTGIGMHMTQTAGLALAAD
FT                   RATDETRPRVVALLYVMFLVGMGVSAVVIGWFLYEFTPLELIQVIQSCAVLTLILNVTA
FT                   LWKQERIVPTTKAQRAEPSPTFKEAWSDYASGGTAGRLLAVVFLGTMAFNMQDVLLEPY
FT                   GGEILGLSVSATTLLTATWAAGALAGFALAAKWLSGGIDPMRMGARGLLAGLVAFCAVI
FT                   FSNPLGSSELFFVGAFMIGFGGGLFAISTLTAAMTMPTSNKAGRGLALGAWGAAQATAA
FT                   GLSIAIGGAVHDGVNHLAMSGQLGVALGNEATGYSVVYHLEILLIFATLVALGPLVRTR
FT                   PRMTTTTNGGAKIGLADLPT"
FT   gene            complement(146694..147383)
FT                   /gene="bchM"
FT                   /locus_tag="Jann_0157"
FT   CDS_pept        complement(146694..147383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchM"
FT                   /locus_tag="Jann_0157"
FT                   /product="Mg-protoporphyrin IX methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53074"
FT                   /db_xref="GOA:Q28W38"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W38"
FT                   /protein_id="ABD53074.1"
FT                   /translation="MVATPTYDATRDRVEAYFDRTATKTWERLTSDAPVSGVRRTVRAG
FT                   RDRMRALMLSRLPKDLSGRRVLDAGCGTGAMTEVLAARGAEVVAIDISPQLIDIAAKRL
FT                   PEDLVPRVTFQSGDMLSANLGAFDHVMAMDSMIYYTAPDLGRALAGLSERCPHIVFTVA
FT                   PRTPFLMAFFGLGKLFPRADRSPVMIPHAPKRISEKLLINQCDRTLLKLEQVTSGFYIS
FT                   SCLEMRA"
FT   gene            complement(147384..148343)
FT                   /gene="bchL"
FT                   /locus_tag="Jann_0158"
FT   CDS_pept        complement(147384..148343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchL"
FT                   /locus_tag="Jann_0158"
FT                   /product="protochlorophyllide reductase iron-sulfur
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53075"
FT                   /db_xref="GOA:Q28W37"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W37"
FT                   /protein_id="ABD53075.1"
FT                   /translation="MLDDKTPPAARAAMREAAGLEARGLKSPPILKGQDGEGSLQVHQS
FT                   DDMKIEGAKVFAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTGMLQ
FT                   PTVIDILKSVDFHAEELRPEDFVTQGYNGVQCIEAGGPPAGTGCGGYVVGQTVKLLKQH
FT                   HLLEDTDVVLFDVLGDVVCGGFAAPLQHADRALIVTANDFDSIYAMNRIIAAVQAKSKN
FT                   YNVRLAGCVANRSKDTDEVDRYCDVVGFKRIGHMPDVDAIRRSRLKKKTLFEMPDEEDI
FT                   VQCRAEYIRLAEKLYAGTDPLAPAPLEDRDIFELLGFD"
FT   gene            complement(148366..151887)
FT                   /gene="bchH"
FT                   /locus_tag="Jann_0159"
FT   CDS_pept        complement(148366..151887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchH"
FT                   /locus_tag="Jann_0159"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53076"
FT                   /db_xref="GOA:Q28W36"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W36"
FT                   /protein_id="ABD53076.1"
FT                   /translation="MRGDGDHIPGYRFVILTMDSHVAGPAARVSERLATEFPGLNISIH
FT                   AAAEWGENPDALEEAKLAVKHGDIIVSTLLFIDEHITAIRPALEARRDACDAMIGIISA
FT                   KEVVQLTRMGDLDMMAPTSGAMKLMKKLRGTKEPSASSGEKQMKMLRRLPKILKFIPGK
FT                   AQDLRAWFLTMQYWLGGSDDNVEQMIRFLIGSYASDAAMKGAKAAAPIDYPDVGLYHPD
FT                   LPGHHITTDASDLPNPANPVATVGLLMMRSYVLASDAAHYDGVIRAMQAKGIAVIPAFA
FT                   GGLDGRPAISAYFSDDRIDALVSLTGFSLVGGPAYNDSDAAVEVLKDLDVPYIAAHPIE
FT                   FQTIEQWEASDQGLGPVETTILVALPEIDGATGPIVFGGRHGGGNRTMAPCPERIDALV
FT                   GRTLNRARLRRMGNADKNVGIVLFGFPPNAGAIGTAAYLSVFESLHNTLRQMQTDGYDV
FT                   DVPETVDDLRRAILQGNAKSMGQQANVAEKLDADWLVRETPWLNEIEAVWGPAPGRIQA
FT                   DGTGAFVLGANFGKVFVGVQPTFGYEGDPMRLLFEKGFAPTHAFSGFYLWLNRVFKADV
FT                   VLHFGMHGALEFMPGKQAGLCGQDWPDRLIGALPNVYLYASNNPSEATLAKRRSSAVTI
FT                   THMTPPLAASGLYKGLSDLKDSLSRWRTMAPDASDRDDMAALIATQADAVDLDETDPEK
FT                   LWLTLLETEDALIPDGLHVVGRPMGEAELQEHMRVIDVADTEKRAEIEHLLRQQSELKG
FT                   LMNALSAHYIEPVPGGDLIRSPEVLPTGRNIHAFDPYRMPTAFALQDGAKQADKLIEAA
FT                   DGFPRSVALVLWGSDNIKSDGGPISQALALMGATPRFDSYGRLCGAELIPLETLGRPRV
FT                   DVVMTLSGIFRDLLPLQTRMLAEAAYKAATANEPRDQNFVRAHALDYAARMNVPMEEAA
FT                   LRVFSNAEGAYGSNVNHLIDSGAWDQEDELADAYEARKSFAYGLDGKAHKNAGMLQNAL
FT                   KDVDLAYQNLESVELGVTTVDHYFDTLGGISRAVKRAKGGHETPVFIGDQTRGDGKVRT
FT                   LQEQVALETRSRSLNPKWFEGLLKHGHEGVRQIEAQVTNTLGWSATTGQVDPWVYQRLS
FT                   ETFVLDDDMRRRLADLNPQASARMANRLLEAHERNYWQPDDATLAALQAGADELEDTLE
FT                   GLNVAAE"
FT   gene            complement(151877..153436)
FT                   /gene="bchB"
FT                   /locus_tag="Jann_0160"
FT   CDS_pept        complement(151877..153436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchB"
FT                   /locus_tag="Jann_0160"
FT                   /product="light-independent protochlorophyllide reductase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53077"
FT                   /db_xref="GOA:Q28W35"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W35"
FT                   /protein_id="ABD53077.1"
FT                   /translation="MKLTVWTYEGPPHVGAMRVATAMKGLHYVLHAPQGDTYADLLFTM
FT                   IERRDHRPPVTYTTFEGRDLGEDTAGIFKVTCQEAYDRFKPQAIIVGASCTAELIQDDP
FT                   GGLAETMQIPVPVIPLELPSYQRKENFGSDETFYQIVKSLARPMDRTPEVTVNIIGPLA
FT                   LGFRHRDDIEEVKGLLYEMGIGVNVVAPFDATPEDITRLGAAHANVLMYPEHAESAARH
FT                   LERICGQPYTKTIPIGVAATHEFVAEVAQLCGVEPRKDLSRLRQPWWSKSVDSTYLTGK
FT                   RVFLFGDATHVKAAARIARDEMGFEVVGLGCYNREFARSIRELAREFDVPALITDDYLE
FT                   VEKAIEDASPEMILGTQMERHIGKRLGIPCAVISAPVHVQDFPARYSPQMGWEGANVIF
FT                   DTWIHPLVMGLEEHLLSMFREDFEFHDEAGPSHHGGHSPKPSEAARTPDKVEERADPAP
FT                   EAPQTGSDVMVWLSEAEKELKKIPFFVRGKARRNTEKFAADQGLQEISLDTLYEAKAHY
FT                   AR"
FT   gene            complement(153507..154790)
FT                   /gene="bchN"
FT                   /locus_tag="Jann_0161"
FT   CDS_pept        complement(153507..154790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchN"
FT                   /locus_tag="Jann_0161"
FT                   /product="light-independent protochlorophyllide reductase
FT                   subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53078"
FT                   /db_xref="GOA:Q28W34"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W34"
FT                   /protein_id="ABD53078.1"
FT                   /translation="MNTPKSIPSGTCRDTPVLKERGQREVFCGLTGIIWLHRKMQDAFF
FT                   LVIGSRTCAHLLQSAAGVMIFAEPRFGTAILEETDLAGMADAHEELDREVERLLSRRPD
FT                   IKQLFLVGSCPSEVIKLDLARAAERLTQVHAPHVRVLNYSGSGIETTFTQGEDACLTSM
FT                   VPVLPTTDQKELMLVGALPDVVEDQAVSLLSQMGIGPIRVLPAPRTAETPGVGPNTVFA
FT                   CLQPFLGDTAAALTRRGAHHIQAPFPFGEEGTTLWLRAIADEFGVDDDTFDRVTAAPRA
FT                   RARKAIANASEHLNGKSVFFMPDSQLEIPLARFLTRECGMEAIEIGQPFIHKGLVGPDL
FT                   DLMPAGPTISEGQDVDKQLDRVRAAQPDLTVCGLGLANPLEAEGLTTKWAIELVFTPVH
FT                   FYEQAGDLAGLFSRPVRRRAVLKLEAAE"
FT   gene            complement(154787..155266)
FT                   /gene="bchF"
FT                   /locus_tag="Jann_0162"
FT   CDS_pept        complement(154787..155266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchF"
FT                   /locus_tag="Jann_0162"
FT                   /product="2-vinyl bacteriochlorophyllide hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53079"
FT                   /db_xref="GOA:Q28W33"
FT                   /db_xref="InterPro:IPR009905"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W33"
FT                   /protein_id="ABD53079.1"
FT                   /translation="MTTDTMTGLPASQLYTPEERARRDATVWTLVQGVLAPVQFLVFLI
FT                   SLVLVTRYLLTGSGYEAATLSIITKTLLLLTIMVTGAIWEKVVFGQWLFAPAFFWEDVF
FT                   SFLVIALHLTYVWALLSGWSAPTQMWIALAAYAAYVINAGQFLWKLRQARLGAPA"
FT   gene            155584..156453
FT                   /gene="ppaA"
FT                   /locus_tag="Jann_0163"
FT   CDS_pept        155584..156453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppaA"
FT                   /locus_tag="Jann_0163"
FT                   /product="Regulatory protein ppaA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53080"
FT                   /db_xref="GOA:Q28W32"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W32"
FT                   /protein_id="ABD53080.1"
FT                   /translation="MANDSKPFTHDPAKPVAEPAVLVDGDVRELARIALQRLTQPNGLR
FT                   VNRSCGLTDRLDDLCEAFLSDSNEDRHIVIHQMRLDGISANEIIDHVIPAVAAVLGQRW
FT                   ADDTLSFVEVTIGSARLQEAVRALIAHELSRDASNIHRDTLSAGPDRVHTPKVLLLVPR
FT                   PEHHTLGAFVAADQFRRFGYDVDIAVDQHPKQVAATLRDRRYCMIGISIAGRRTLASTR
FT                   ELVDIIRATVTRVTPIVLGGSLLETDQDLKKATGVDYVARTVRDALELCGLNIVELDPP
FT                   RELMADHV"
FT   gene            156490..157938
FT                   /gene="ppsR"
FT                   /locus_tag="Jann_0164"
FT   CDS_pept        156490..157938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsR"
FT                   /locus_tag="Jann_0164"
FT                   /product="Transcriptional regulator PpsR"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53081"
FT                   /db_xref="GOA:Q28W31"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011785"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W31"
FT                   /protein_id="ABD53081.1"
FT                   /translation="MNTRGTDFWDKPSSPPIGPEQFSEIVTTAADLAIVLDTGGKVHSV
FT                   VTNPLNPTLGQLDHWKDRDIREFLTIESLPKIDAQLSAYRDGVPAKVDAIEVNHSDNAD
FT                   WEFPIRYTLHKTSRDDIILMLGRDLRPIAELQHRLVKAQLALEKDYESHRDYETRYRVI
FT                   MEAARDAMALVDVASGRIVDVNGLGAQILGTDAEALTGAAFTQEFEGRRRGEFIEGLVN
FT                   AASDEASQVVTVKTRRTQADVVLHPLVFRAAGDRTLLCRIETAGTAETVAAELAQVLSA
FT                   LYRDGADAIVFTDAVGIIRSANDAFLSLCDAGQIGDVRGKSIAEFLSRGSVDLKVLIDN
FT                   ATRNKKMRLYSTRLDGAFGSQLSVEMSATLLNSGGTTGFAFVVRDISRIEVVREPASAT
FT                   PSAMSDDAMRNVMDLVGSAPLKDIVSATTDVVEKMCIETAVELTDNNRVAAAEMLGLSR
FT                   QSLYVKLRKYGLLAKNDSGTSGKA"
FT   gene            157990..158901
FT                   /gene="bchG"
FT                   /locus_tag="Jann_0165"
FT   CDS_pept        157990..158901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchG"
FT                   /locus_tag="Jann_0165"
FT                   /product="chlorophyll synthase"
FT                   /EC_number="2.5.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53082"
FT                   /db_xref="GOA:Q28W30"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W30"
FT                   /protein_id="ABD53082.1"
FT                   /translation="MSVTTDLTQPSALRRVPEPRAVLTLLKPITWFPPMWAYACGVVSA
FT                   GVPLSGNWMLLVLGVILAGPIVCGMSQAANDWCDRHVDAINEPDRPIPSGRIPGRWGLW
FT                   IALAMSVFAGFVGLALGPWGFGATLVAIAAAWAYSVEPIRLKRSGWWGPGLVGLSYESL
FT                   PWFTGAAVLSAGAPSWPIVIVALLYGIGAHGIMTLNDFKALEGDRQMGVNSLPVTLGPE
FT                   RAAKLACVVMALPQIAVIGVLIYWGVPFYALAIGVSLALQLAAMRVLLRDPKGKAPWYN
FT                   GTGVMLYVLGMMVTAIAIRGLA"
FT   gene            158898..160151
FT                   /locus_tag="Jann_0166"
FT   CDS_pept        158898..160151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0166"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53083"
FT                   /db_xref="GOA:Q28W29"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W29"
FT                   /protein_id="ABD53083.1"
FT                   /translation="MTLGWGSIARLCLCNMAIGGLAALPVNLFNRLMTVELAWPAILPG
FT                   LLVALHYGVQMTRPYWGHRSDAKGGRTPFILGGIVVVGAGLVGVAYGIAYVENTSAALA
FT                   IWIISYAAIGLGIGAAGTSFLALLATAAADERKGAAATIAWLMLIFGAIVASIGTGIAL
FT                   EPYSAARLMAVVPVVALIAALLAMVATWGMEAKLGAVPAPTEPALGPALRATWADPAAR
FT                   AFTGFVFLSILAFYLSELVLEPFAGHVHGLPPEDSTKLSGAKDGASLVGMLAAGALSTF
FT                   RIGSLRAWAVIGCIISAAGLIGLGAGFALIPFTVVLGLGNGLFVIGAIGSMMRLAAADK
FT                   GAAGTRMGVFGAAQAIAAGLAGLLATGILDIARLILPMEAAYGTVFGLEAILFLAAALV
FT                   AGRLLHTRAYQPTLQPGE"
FT   gene            160154..161335
FT                   /gene="bchP"
FT                   /locus_tag="Jann_0167"
FT   CDS_pept        160154..161335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchP"
FT                   /locus_tag="Jann_0167"
FT                   /product="Geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53084"
FT                   /db_xref="GOA:Q28W28"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W28"
FT                   /protein_id="ABD53084.1"
FT                   /translation="MKYDVVVVGGGPSGATAAEDLARSGHLVALIDRDGRIKPCGGAIP
FT                   PRLIADFNIPDSQIVAKITTARMISPTKRRVDIPIENGFVGMVDREHFDEFLRVRACDA
FT                   GAERFTGTYTRISRDADGTHVHFRDKASGEDRVLDTKMVIGADGARSKVAASEVKGGDK
FT                   IPYVIAYHEIIESPDATDVYDPKRCDVIYDGAISPDFYGWVFPHGKSASVGMGSMIKDV
FT                   DLKEATAALREASGLTDCKTIRREGAPIPLKPLDQWDNGRDVVLAGDAAGVVAPSSGEG
FT                   IYYAMVGGRVAATAAAAKLQSGMIKDLQLARKLFMKEHKSVFKVLGAMQNAYYKSDERR
FT                   ERFVSLCHDIDVQRLTFEAYMNKSLVKARPMAHLKIGIKNVSHLLGLVQPTRV"
FT   gene            161332..161862
FT                   /gene="idi"
FT                   /locus_tag="Jann_0168"
FT   CDS_pept        161332..161862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idi"
FT                   /locus_tag="Jann_0168"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53085"
FT                   /db_xref="GOA:Q28W27"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W27"
FT                   /protein_id="ABD53085.1"
FT                   /translation="MTIHIPTWVNGTLQPVEKLEAHLRGLRHKAISVFILRDGDVLLQR
FT                   RAMGKYHTPGLWANTCCTHPQWDEAGVDCAMRRLDEELGVKDVPLRYRDTVEYRADVGG
FT                   GLIEHEVVDIFVGEMPSGMEPVMNPEEVMEVEWTPLATLAQRVEASPETFTPWLHIYLR
FT                   KYADIIFESATDA"
FT   gene            161925..162314
FT                   /locus_tag="Jann_0169"
FT   CDS_pept        161925..162314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53086"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W26"
FT                   /protein_id="ABD53086.1"
FT                   /translation="MRVVFISLVLSFTIPFAAHAQQLIASYYTTLGPNDHYNSSGTRLG
FT                   DFGAILQQDRANVHRFGIYDSGDQSDPIFGSLQNRSLIPSIWRFGPSAQGIPNRVVQGH
FT                   QAYIFVEIFGFGGTPQIIVVHQGAG"
FT   gene            complement(162315..164225)
FT                   /gene="dxs"
FT                   /locus_tag="Jann_0170"
FT   CDS_pept        complement(162315..164225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="Jann_0170"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53087"
FT                   /db_xref="GOA:Q28W25"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W25"
FT                   /protein_id="ABD53087.1"
FT                   /translation="MDRPHTPILDQVNYPSDLRRMSNADLAQCADELRAEVISAVSETG
FT                   GHLGSSLGVVELSVAIHAVFNTPYDKLVWDVGHQCYPHKVLTGRRDRIRTLRQKDGLSG
FT                   FTKRSESEYDPFGAAHSSTSISAALGFAAAQDLGEATGDGIAVIGDGSISAGMAYEALN
FT                   NAGDLGKRLFVILNDNEMSIAPPVGAMSKYLTDLSAKSPLATLKDIADGVASHLPEPIR
FT                   QGAERARELVTGHQPSATLFEHLGFTYIGPVDGHDMEELLTTLRAAKARATGPVLIHAV
FT                   TVKGKGYSPAELSDDCYHGVAKFDVATGQQKKSAPNAPSYTSVFGQTLLNMAEADSRIV
FT                   GVTAAMPGGTGISTLQKAKPNRVFDVGIAEQHAVTFSAGMAAGGLKPFCAIYSSFLQRG
FT                   YDQIVHDVALQSLPVRFMIDRAGLVGADGPTHAGAFDIGYLSALPNMTVMACADEAELV
FT                   HMMATAAAHNDGPIALRYPRGEGTGVALPDQGDVLEIGKGRVIQDGHDVAILSFGAHLE
FT                   EAKDAATALEARGLSVTVADARFAKPLDTTLIDDLMTKHSALITVEQGAVLGFGGLVLH
FT                   HLAATGQLDGRCAVRTLHLPDRFIDQASPAEMYADAGLTADDIAQAALEAMGVEVLAAR
FT                   A"
FT   gene            complement(164358..165602)
FT                   /gene="pufC"
FT                   /locus_tag="Jann_0171"
FT   CDS_pept        complement(164358..165602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufC"
FT                   /locus_tag="Jann_0171"
FT                   /product="Photosynthetic reaction center cytochrome c
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53088"
FT                   /db_xref="GOA:Q28W24"
FT                   /db_xref="InterPro:IPR003158"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023119"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W24"
FT                   /protein_id="ABD53088.1"
FT                   /translation="MFPKWFDKWNDDNPTNIFGPAIAVGALGGAVFVAALIVGFGQPYA
FT                   TASMQTGPRGTGMHVAEFEASLAAGDPTVIDFYTDEPFVPEEGEELAGDIYENVQVLGD
FT                   LTDANFNRLMGAITQWVAPEEGCTYCHANAADGEYADDDLYTKVVARSMLTMTRNINVN
FT                   WDAHVNANYEVGVTCYTCHRGQPVPNNVWFRISPVNENAEGWSANQNRATMASNFTSLP
FT                   SDYLEHYLLESDDGGYNMIAVHDLDSRVQQQPGDPLIQQTERTYAFMNYISNSLGVNCT
FT                   FCHNSRAFYDGAQNTPQWGTASLGIIMVQEMIAEHLLPLQDVYPENRLGPVYGDAPLAA
FT                   CRTCHQGYQQPMQGLNVIANWPELNVLEGPPDYSAWEVAEADPEPEAAEAEDMDPEADA
FT                   PEADEDPEAEEEVSE"
FT   gene            complement(165606..166604)
FT                   /gene="pufM"
FT                   /locus_tag="Jann_0172"
FT   CDS_pept        complement(165606..166604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufM"
FT                   /locus_tag="Jann_0172"
FT                   /product="Reaction center protein M chain"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53089"
FT                   /db_xref="GOA:Q28W23"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005781"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W23"
FT                   /protein_id="ABD53089.1"
FT                   /translation="MAYFEYQNIFTQVQVQGEPEMGMDDQGTLMRERTGASFSTLIGWI
FT                   GNAQLGPIYLGYAGLISLATGAAWFMIVGFNMLSHVDWSLPEFIRQLFWLSLEPPGPEW
FT                   GLRMPPLNDGGWYIISSFFLLVSVMFWWLRTYMLAVEHQMGKHIAWAFLAAIWLFLVLG
FT                   LFRPILMGSWSEAVPYGIFPHLDWTTAFSIRYGNLYYNPFHCLSIVFLYGSVLLFAMHG
FT                   ATILAVSRYGGDRELEQIVDRGTASERAGLFWRWTMGFNATMEGIHRWAWWFAVLTPIT
FT                   GGIGILLTGTVVDNWFIWAQEHNFAPDYLGAYGYEAYGSYEDFGGVTRGEE"
FT   gene            complement(166604..167512)
FT                   /gene="pufL"
FT                   /locus_tag="Jann_0173"
FT   CDS_pept        complement(166604..167512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufL"
FT                   /locus_tag="Jann_0173"
FT                   /product="Reaction center protein L chain"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53090"
FT                   /db_xref="GOA:Q28W22"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005871"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W22"
FT                   /protein_id="ABD53090.1"
FT                   /translation="MALLSFEKKYRVRGGTLVGGDLFDFWVGPFYVGFFGVTTAFFALL
FT                   GTILIFWGAAMEGNFNPWTINIAPPDLSYGLGFAPLMEGGLWQIITFCATGAFISWALR
FT                   EVEIARKLGMGYHVPFAFAFAIFAYVTLVIIRPLLMGAWGHGFPYGIFSHLDWVSNVGY
FT                   SYLHFHYNPAHMIAVSLFFATTFALALHGGLILSAANPEKGTLMKTPDHEDSFFRDFIG
FT                   YSIGTLGIHRVGMLLAIAAVFWSAVCIVISGPVWTAGWPEWWNWWLDLPIWPDQGVAYD
FT                   TTGMATYGTEAGYADVTGGTE"
FT   gene            complement(167654..167821)
FT                   /gene="pufA"
FT                   /locus_tag="Jann_0174"
FT   CDS_pept        complement(167654..167821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufA"
FT                   /locus_tag="Jann_0174"
FT                   /product="Light-harvesting protein B-870 alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53091"
FT                   /db_xref="GOA:Q28W21"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002361"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W21"
FT                   /protein_id="ABD53091.1"
FT                   /translation="MAKFYKVWLIFDPRRVFVAQGVFLFLLAAMIHLVVLSSGLNWFEN
FT                   AAMTMGFGGE"
FT   gene            complement(167836..168018)
FT                   /gene="pufB"
FT                   /locus_tag="Jann_0175"
FT   CDS_pept        complement(167836..168018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufB"
FT                   /locus_tag="Jann_0175"
FT                   /product="Light-harvesting protein B-800-850 beta chain B"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53092"
FT                   /db_xref="GOA:Q28W20"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002362"
FT                   /db_xref="InterPro:IPR023623"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W20"
FT                   /protein_id="ABD53092.1"
FT                   /translation="MRRQSDVPEENMADNSDLSFTGLTDEQAQELHAVYMSGLWLFSAV
FT                   ALVAHIATYFWAPWF"
FT   gene            complement(168198..168437)
FT                   /gene="pufQ"
FT                   /locus_tag="Jann_0176"
FT   CDS_pept        complement(168198..168437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufQ"
FT                   /locus_tag="Jann_0176"
FT                   /product="Protein pufQ"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53093"
FT                   /db_xref="GOA:Q28W19"
FT                   /db_xref="InterPro:IPR008800"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W19"
FT                   /protein_id="ABD53093.1"
FT                   /translation="MRRRNQMSDMTSMTPVSRTTKPPKTEFMIYFAIIFVATLPLATLT
FT                   WAIAAIRSGSMTDKGPIKRAYRQAGIITPMIFAA"
FT   gene            complement(168412..169896)
FT                   /gene="bchZ"
FT                   /locus_tag="Jann_0177"
FT   CDS_pept        complement(168412..169896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchZ"
FT                   /locus_tag="Jann_0177"
FT                   /product="chlorophyllide reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53094"
FT                   /db_xref="GOA:Q28W18"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010244"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W18"
FT                   /protein_id="ABD53094.1"
FT                   /translation="MLVQDHDRAGGYWGSVYAFTAVKGLQVIIDGPVGCENLPVTSILH
FT                   YTDGLPPHELPIVTTGLGEEELGRDGTEGAMKRAWETLDPALPSVVVTGSIAEMIGGGV
FT                   TPMGTNIQRFLPRTIDEDQWESADRAMTWIFTEFGMTKGRMPREKKREDGAAPRVNILG
FT                   PMYGTFNMPSDLAEIRRLVEGIGCEVNMVMPLGAHVAEMRDLVNADVNICMYREFGRGL
FT                   CEVLGKPYLQAPIGVDSTTKFLRTLAEMTGLDAEPFIEQEKHSTIKPVWDLWRSVTQDF
FT                   FATASFGIVANETYARGVRKYLEDDLGLPCAFAVARTAGKKTDNDAVRAMVSEKRPLVL
FT                   MGSINEKMYLAEMAAGFGPKPTFIAASFPGAAIRRATGTPFMGYAGATYMLQEVCNGLF
FT                   DALFHILPLGSEMDSAAATPATLRRDFPWEPEAQRLLDRIVAEHPILTRISAAKTLRDA
FT                   AEKAALEGGAERVMEDTVKRLAPAGFDFDEEEKSDE"
FT   gene            complement(169897..171462)
FT                   /gene="bchY"
FT                   /locus_tag="Jann_0178"
FT   CDS_pept        complement(169897..171462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchY"
FT                   /locus_tag="Jann_0178"
FT                   /product="chlorophyllide reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53095"
FT                   /db_xref="GOA:Q28W17"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010245"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W17"
FT                   /protein_id="ABD53095.1"
FT                   /translation="MSRETTYDTAGEVDVIEGEAVADREAPVGTDGMGCHAGAATMEAA
FT                   ARSAGKSDVLDQFAKDYPTGPHDRPQSMCPAFGSLRVGLRMRRVATVLSGSACCVYGLT
FT                   FVSHFYGARRSVGYVPFNSETLVTGKLFEDIRESVHEMADPERYDAIVVTNLCVPTASG
FT                   VPLRLLPDEINGVRIVGIDVPGFGVPTHAEAKDVLAGAMLNYARQEVEAGPVMAPVSGV
FT                   SDRPTVTLLGEMFPADPLGIAGMLAPLGLAAGPVVPCREWRELYSALDSKVVAAIHPFY
FT                   TAAIREFEAAGRTIVGSAPVGHDGTAAWLEAIGNAYDVGADKIAEAQNAFLPAIKSALA
FT                   STPIDGTITLSGYEGSELLVARLLIESGANIPYVGTACAKSKWSEPDVEWLEARGVKVK
FT                   FRASLEDDCAAMEAIRPDLAIGTTPVVQKGKELGIPSLYFTNLISARPLMGPMGAGSLQ
FT                   QVVNAAMGNKDRMSSMKAFFEGVGTGDTAGIWEGAPNLRPDFRAAHQKKLDKQARVAKA
FT                   EQMI"
FT   gene            complement(171459..172457)
FT                   /gene="bchX"
FT                   /locus_tag="Jann_0179"
FT   CDS_pept        complement(171459..172457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchX"
FT                   /locus_tag="Jann_0179"
FT                   /product="Chlorophyllide reductase iron protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53096"
FT                   /db_xref="GOA:Q28W16"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR010246"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W16"
FT                   /protein_id="ABD53096.1"
FT                   /translation="MKDIPNLKDYDANLRDEAAEPSLEVPQGEPTKKTQIIAIYGKGGI
FT                   GKSFTLANLSHMMAEQGKRVLLIGCDPKSDTTSLLFGGKACPTIIETSSAKKLAGEEVQ
FT                   IGDVCFKRGGVFAMELGGPEVGRGCGGRGIIHGFELLEKLGFHDWDFDYVLLDFLGDVV
FT                   CGGFGLPIARDMAQKVILVASNDLQSLYVANNVCSAVEYFRKMGGNVGVAGLVINKDDG
FT                   SGEAQAFAEAVDIPVLASIPQNDDLRKKSANYQIVGTGESEWGALFAELGDNVATAPPM
FT                   RPTALNQDGLLALFDGSDTGAGVVLEPATDQDMRGKNAAAKDSLEVVYDDA"
FT   gene            complement(172454..173431)
FT                   /gene="bchC"
FT                   /locus_tag="Jann_0180"
FT   CDS_pept        complement(172454..173431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchC"
FT                   /locus_tag="Jann_0180"
FT                   /product="2-desacetyl-2-hydroxyethyl bacteriochlorophyllide
FT                   A dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53097"
FT                   /db_xref="GOA:Q28W15"
FT                   /db_xref="InterPro:IPR005903"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W15"
FT                   /protein_id="ABD53097.1"
FT                   /translation="MHTTAVILEGPKALGLGQVDLCAPSDGDLVIDVSHSGISTGTEKL
FT                   FWSGQMPPFPGMGYPLVPGYEAAGEVVEAAANTGFKPGDRVFVPGANCYGDVKGLFGGA
FT                   SARLVSAADRVVRIDPALKAEGALLALAATARHAMAGMDKQLPELIVGHGVFGRLLARL
FT                   TIAAGGKAPTVWEIDADRAQGATGYEVLHPDADDRKDYSCIYDASGQSDLLNTLIARLK
FT                   KGGEIVLAGFYPEPLTFAFPPAFMREARMRIAAEWTRDDLIATRDLIDHGALSLDDLIT
FT                   HTRNSDQAAEAYQTAFEDAACLKMILNWAPSSREATGRNGETVQ"
FT   gene            complement(173582..174718)
FT                   /gene="crtF"
FT                   /locus_tag="Jann_0181"
FT   CDS_pept        complement(173582..174718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtF"
FT                   /locus_tag="Jann_0181"
FT                   /product="hydroxyneurosporene-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53098"
FT                   /db_xref="GOA:Q28W14"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W14"
FT                   /protein_id="ABD53098.1"
FT                   /translation="MALADPQDTKTSLKDRFYAWRTALIGSRRFQQRAARLPIAATLAR
FT                   KDGEALFDLVAGFAHSQILMAFVEFDLPDHLRLQPRTLADLSRRTGVSEPRMKVLAQGA
FT                   SALGLMARQSDGRYALGRLGAALPGIPGLQQMIRHHDVLYRDLADPVAFFKDGSDTELA
FT                   GFWPYVFGASGNVDPQVAATYSELMADSQALVAEEALAHLDLSGVKTLLDVGGGTGVFL
FT                   SAAGHAYPDLNLHLFDLPAVIAPATARFERDGVSSRADITGGSFRTDVLPNCADAISLV
FT                   RVLYDHADETVSMLLAKAHAALPSGGRIIVAEPMSGGDTPNRPGDAYFGPYCMAMRTGK
FT                   ARSAAEISGHLAHAGFHDVTIVRTGRPFVTGMVCAAKA"
FT   gene            complement(174719..175591)
FT                   /gene="crtE"
FT                   /locus_tag="Jann_0182"
FT   CDS_pept        complement(174719..175591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtE"
FT                   /locus_tag="Jann_0182"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53099"
FT                   /db_xref="GOA:Q28W13"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W13"
FT                   /protein_id="ABD53099.1"
FT                   /translation="MPLKPRIEHAISAAITQAQGNVAPTKLASALEYSVTPGGARIRPT
FT                   ICLSVALACGDPQPAMADAAATAIELIHCASLVHDDMPCFDDADVRRGKPSVHKAYSEP
FT                   LALLAGDSLIIASFEVLTRVAHHDPLRAIELMKILGQSTGMPGGICAGQGWESEDKIDL
FT                   SAYHRAKTGALFTAATRMGAAAAGEDPEPWTELGARIGEAFQVADDLRDALYDEATLGK
FT                   PAHQDEIHDRPNAVTEFGVRGAIRRLEDILSGAISSIPACPGEAMLAEMVRKTAERLTP
FT                   VMPPVQAAE"
FT   gene            175691..177262
FT                   /gene="crtD"
FT                   /locus_tag="Jann_0183"
FT   CDS_pept        175691..177262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtD"
FT                   /locus_tag="Jann_0183"
FT                   /product="methoxyneurosporene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53100"
FT                   /db_xref="GOA:Q28W12"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR008150"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W12"
FT                   /protein_id="ABD53100.1"
FT                   /translation="MEGYLLGDSAHNAVVIGAGIGGLSAALRLAARGVRVTVVEMADAP
FT                   GGKIRTAPSAAGPVDIGPTVLTMRPVFEALFADVGERLADHVTLHKDPLLARHFWRDGS
FT                   TLDLYDDPDASIAAVHAFAGSKAARQFQRFASSAKQLYEAFDGPIMQSAAPALLPLTAH
FT                   VLKNPKLIPAMMPGLSLARRLRLSFDDPRLRQLFGRYATYVGGSPYQSPAVLGLIWHSE
FT                   AQGVWSVEGGMHALARALHDLAVAKGVQFQFGVAVDQITQHGGSVSGVHLADGTHLAAG
FT                   TVVFNGDPRALSKGLLEASAIPHAGTEPRSLSAFVWGFAAEPSGVELAHHNVFFCDDPK
FT                   LEFGDLAKDQMPRDATLYVCAQDRGITQPNGPERFEIIMNGPPGHKTSEEAEKTCQTRT
FT                   FETLQQMGLTFSPRPERHALTTPKDFNQAFPASDGSLYGRSPHGMMATFQRPTARTTVK
FT                   GLYLAGGGAHPGAGVPMACLSGKHAAEAILTDLALTSTSPRTATPGGTSMGSATMANRP
FT                   SPSSAS"
FT   gene            177364..178086
FT                   /gene="crtC"
FT                   /locus_tag="Jann_0184"
FT   CDS_pept        177364..178086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtC"
FT                   /locus_tag="Jann_0184"
FT                   /product="hydroxyneurosporene synthase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53101"
FT                   /db_xref="GOA:Q28W11"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W11"
FT                   /protein_id="ABD53101.1"
FT                   /translation="MTDRGEEALSLSRDTLQIGPSAMVWKGDQLEVHIDEISTPHAQRV
FT                   KGTVTIHPTAVTDQELLLNPDGAHVWRPFAPTARIEVALNRPGWTWSGHGYFDANFGTR
FT                   ALEADFSYWTWGRFPLRDGSACFYDLERRDGTSLATGVGFAADGTPHTIQMPPKQRLKR
FT                   PFWMVRRDTRADAGYTPRQVKPMLDAPFYNRSAIRTQINGEETVGVYEALDLDRFRGPW
FT                   LMPMLAMRVPRRKGWPGT"
FT   gene            178141..178698
FT                   /locus_tag="Jann_0185"
FT   CDS_pept        178141..178698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0185"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53102"
FT                   /db_xref="GOA:Q28W10"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W10"
FT                   /protein_id="ABD53102.1"
FT                   /translation="MAKEEFPGWHGTTIIGVRKGGKVVVAGDGQVSLGPTVIKGSARKV
FT                   RRLSPGGYDVVCGFAGSTADAFTLLERLEAKLEATPGQLQRASVELAKDWRTDKYLQKL
FT                   EAMLIVTDGSELYIITGAGDVLEPEHDIAAIGSGGNFALAAARGMMDSDKDAEAVARDA
FT                   MAIASDICVYTNGNLTVETISA"
FT   gene            178695..179783
FT                   /locus_tag="Jann_0186"
FT   CDS_pept        178695..179783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53103"
FT                   /db_xref="GOA:Q28W09"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W09"
FT                   /protein_id="ABD53103.1"
FT                   /translation="MSDVTRDDLRAAIGAGLMTEAQAASLISLAEEREGVRARRSGLDE
FT                   PFELFKGFNEIFIVVGLSILFAGWVGVTGLSVFGSNNGYVLGMLFSLVAAGVVILLARY
FT                   FTITRRMVAPSIALAVMFGLSALQFGLSFAAMLDLVFQSSWTVAAGISGLFLCLYYFLF
FT                   RVPFTVALIAASVVILCFGLVTMGGTVPDEMQDIFLLSADGPFAIITIVLGVIGLVIAM
FT                   AFDMNDPHRVTRRAASGFWLHVMAAPAIVNTVALTLFQSPDAGIRLLLLLFIAVMALFA
FT                   IIIDRRSFLVSGVGYVVALSISVVEGEGAFFVILLLGAGMVLLGAQWERLRGVIMRALP
FT                   RFPGKTRLPPWSDPGAAKETLA"
FT   gene            179780..181096
FT                   /locus_tag="Jann_0187"
FT   CDS_pept        179780..181096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0187"
FT                   /product="heat shock protein HslVU ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53104"
FT                   /db_xref="GOA:Q28W08"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W08"
FT                   /protein_id="ABD53104.1"
FT                   /translation="MSDLTPREIVSELDRFIIGQSDAKRAVAVALRNRWRRKQLGDDLR
FT                   DEVYPKNILMIGPTGVGKTEISRRLAKLAKAPFIKVEATKFTEVGYVGRDVEQIIRDLV
FT                   DAAQVMIRENMREEVKAKAHDAAEERVIEALAGKDAREQTRDMFRKKLRAGELDDTVIE
FT                   LEVADNSNPLGGFEIPSQPGGMGGMGPGMMNLGDLFKGMGGRTVKRRLTVAASYDLLIE
FT                   DEADKLLDAETVTKEALSAVEQSGIVFIDEIDKVCAKSDARGADVSREGVQRDLLPLIE
FT                   GTTVSTKHGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVNLRALTEDDFVRILT
FT                   ETDNALTRQYTALMATEEVAVEFTDGGIRALAHIAAEVNESVENIGARRLYTVLERVFE
FT                   ELSFTAPDRSGDAVTVDEAFVEQNLGELTRSTDLSRYVL"
FT   gene            181118..182239
FT                   /locus_tag="Jann_0188"
FT   CDS_pept        181118..182239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0188"
FT                   /product="protein of unknown function DUF900 hydrolase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53105"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W07"
FT                   /protein_id="ABD53105.1"
FT                   /translation="MTRAKINRRSLLATASALSLTACVRVPTLMIVPEAAQSGVAETVF
FT                   VASNRVFANGQFQSARQDDVTYTRFTVQIPQDRDAGAVRPGRARRTGPNLRTDFVASDG
FT                   VHLGGEGRFQSELLAEARRRGTSEVMVFIHGFASSIGTGIYRTAQIRYDFEVPGVAVHY
FT                   AWPSSGSYIGYAYDRDSALFARDGLEELITGIMQTDLDVVLVAHSLGSSVVMEVLRQLR
FT                   IAGRNALIDRIHGVILFSPDLDVDVFRSQASRIGDLPQPFVIFTSQRDQALTFSSIMAG
FT                   RTARVGNLATADQVAEFDVTLIDVSAFEGGVRDRLNHFAGATSQSAVQILRDAAQINSA
FT                   FEDGPDARPGLLPGTILTIQNATLVLLDPEHAR"
FT   gene            complement(182236..182847)
FT                   /locus_tag="Jann_0189"
FT   CDS_pept        complement(182236..182847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0189"
FT                   /product="Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53106"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W06"
FT                   /protein_id="ABD53106.1"
FT                   /translation="MARRGKRGLSADDKAIWEKVAATATPMDRSGVPKITEETLPKKTP
FT                   PLRPQPSTTADRLPAFRVGEKSSFNKGAVNHAPSLSVQLAHAPVRMDHGTHKRMTRGKL
FT                   KPEGRIDLHGMTLSEAHPALISFIFHAHEAERRLVLVITGKGKDRDSGGPIPIRRGILK
FT                   HQIPNWLTSPPLGAMILDIREAHQRHGGGGAYYVYLKRRR"
FT   gene            complement(182851..183867)
FT                   /locus_tag="Jann_0190"
FT   CDS_pept        complement(182851..183867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0190"
FT                   /product="MltA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53107"
FT                   /db_xref="GOA:Q28W05"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W05"
FT                   /protein_id="ABD53107.1"
FT                   /translation="MGRLAVVFALLMTASVAVADEPVQLLGFDDLDGWAADDHSAALSV
FT                   FRNTCMDLDGSDWAALCEVADTARDARTFFELFFQPVLIGGENPALFTGYYEPELTGSR
FT                   TRTSRYRFPVYRMPPEVSGRWLSREEIEETRVLEGRGLEIAWVDDPVELFFLQIQGSGR
FT                   IRMMDGSFIRVGYGGRNGHEYRSVGQELVRRGVYHAHQVSAQVIQSWVRRNPSAGRDLL
FT                   HHNPSYVFFREVEITDPDLGPLGAMNRNITPHRTIAVDPDHTPLGAPVWIEKDGNGPIR
FT                   RLMIAQDTGGAIQGAQRADIFFGFGDDAGEAAGVIRDPGRMIVLLPIERAHQLIPDA"
FT   gene            complement(183871..184578)
FT                   /locus_tag="Jann_0191"
FT   CDS_pept        complement(183871..184578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0191"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53108"
FT                   /db_xref="GOA:Q28W04"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W04"
FT                   /protein_id="ABD53108.1"
FT                   /translation="MCLTKTFLTHTPRRGAMNSSLLSLLVLAGIAIFLILRLRSVLGTR
FT                   DGFEKPPVAPGSSRRDVRRDFEVIEGGPDDDILDHVDDGSDSAKALAAMKMAEPGFRVG
FT                   EFLGGARQAYEMILMAFERGDVDGLRPFLADDVLETFETVIDQRNEQGLSIEAEFVGVR
FT                   EITLQEATFDRSAGVGEVTVRFIGELTSVVRNADGEIIEGDATEIKRQRDVWTFARKMG
FT                   ADDPNWALVATDG"
FT   gene            184641..185162
FT                   /locus_tag="Jann_0192"
FT   CDS_pept        184641..185162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0192"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53109"
FT                   /db_xref="GOA:Q28W03"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W03"
FT                   /protein_id="ABD53109.1"
FT                   /translation="MAHPDCGNGAAQRLKGTITMWLFILFIAIPLIEIGLFIQVGGWLG
FT                   LWPTLLIVVLTAIAGTALVKSQGKQAIAQLRSSFDDLRDPTEPLAHGAMILFSGALLLT
FT                   PGFFTDFVGFALLIPAVRRAVLKEVKKRVKVETVRTDRGWQPQDETIIEGTFTAEEGER
FT                   PSGPSGWRRD"
FT   gene            185217..185732
FT                   /locus_tag="Jann_0193"
FT   CDS_pept        185217..185732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0193"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53110"
FT                   /db_xref="GOA:Q28W02"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W02"
FT                   /protein_id="ABD53110.1"
FT                   /translation="MSDASANGDATEGAAPAAAQLPKMQILGQFIRDLSFENAAVQYGT
FT                   ATQGQPDIQVQVALDARKRTVDNQYDVIMKLKIESKTKDEDAPKSIFLIELEYGGVFLI
FT                   ENIAEQQLHPFLMIECPRMLFPFVRRIISDMTRDGGYPPLNLDQIDFVALYRQQIAARQ
FT                   AQQPVGTA"
FT   gene            complement(185734..186429)
FT                   /locus_tag="Jann_0194"
FT   CDS_pept        complement(185734..186429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0194"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53111"
FT                   /db_xref="GOA:Q28W01"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q28W01"
FT                   /protein_id="ABD53111.1"
FT                   /translation="MREIVLDTETTGLNPYDMPRHRIVEIGAVEIFNQVPTGKTYHQYI
FT                   QPERDMPKEAFDVHGIGEDFLADKPIFADIAQDFLDFVGGDQMVIHNAEFDMRFLNAEL
FT                   EWAGKHALPNDQALDTLKIARQKFPGSPASLDALCRRFGIDNSAREKHGALLDSEILAE
FT                   VYLELTGGKQPDFGLSQSKSTPTQQQDENWRPRPRPSALPTRLSDVEKAAHAAFVDALG
FT                   DQTVWSKFR"
FT   gene            complement(186433..187017)
FT                   /locus_tag="Jann_0195"
FT   CDS_pept        complement(186433..187017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0195"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53112"
FT                   /db_xref="GOA:Q28W00"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28W00"
FT                   /protein_id="ABD53112.1"
FT                   /translation="MSFALGLTGSIGMGKSTTAAMFRDLDVPVWDADATVHKLYARGGA
FT                   AVAPIDALVPGAMKDGAIDRAVLRAAIADDASLLKQIEAIVHPLVAKDRAMFRDIHSTA
FT                   PLIILDIPLLFETGGDAACDATLVVTTSPEEQRRRVLARGTSEDTLHDLLSRQMPDAEK
FT                   RARATYVIETDTLDGTRQDVAHLVSKLTEGT"
FT   gene            complement(187014..187850)
FT                   /locus_tag="Jann_0196"
FT   CDS_pept        complement(187014..187850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0196"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53113"
FT                   /db_xref="GOA:Q28VZ9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VZ9"
FT                   /protein_id="ABD53113.1"
FT                   /translation="MTRDTIPLAGVIGDPISHSLSPRLHGHWLRRYGLQGHYVPLHVNH
FT                   ANLETVLRTLPLMGFVGVNVTLPHKEHVLSIADSVTDRAALIGAANTLTFTANEQIQAD
FT                   NTDGMGFLSNIRQALPGWSASAGPALVLGSGGAAKAIVSALVSDGAPVVHVANRTRARA
FT                   DGLKEQFGARVSPSDWTHIPDLIGDAALIVNTTSLGMAGQSPLSLDLSRLSPPTVVTDI
FT                   VYAPLQTNLLRDASIRGCETVDGLGMLLHQAVPGFERWFNYTPTVDEDLREAVLAG"
FT   gene            complement(187847..188443)
FT                   /locus_tag="Jann_0197"
FT   CDS_pept        complement(187847..188443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0197"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53114"
FT                   /db_xref="GOA:Q28VZ8"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VZ8"
FT                   /protein_id="ABD53114.1"
FT                   /translation="MSRLILASASAARRSLLQNAGLAFESLPVRIDEDAIRQSLITEGA
FT                   TPRDIADALAEFKARKATERAPGHLILASDQILALRGEIFAKPRDREDAARDLHRLSGH
FT                   THHLYSAAVIYEDAKPVWRGVGTARLSMHTHSEAQINAYLDQAWPDVSSSVGAYHAEGL
FT                   GAQLFSRIEGDWFSVLGLPLLQVLSYLRMRGMVAP"
FT   gene            189047..190255
FT                   /locus_tag="Jann_0198"
FT   CDS_pept        189047..190255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0198"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53115"
FT                   /db_xref="GOA:Q28VZ7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VZ7"
FT                   /protein_id="ABD53115.1"
FT                   /translation="MAEELEIENASTMRKGDMMFEILRERADEGWEISGDGVLEVLQDG
FT                   FGFLRSPEANYLAGPDDIYVSPDMIRQHSLRTGDTVEGVMSAPKENERYFCLVNVTQIN
FT                   FEEPEKAKHKVAFDNLTPLYPDQRMNMEIEDPTIKDRSARIIDLVSPIGKGQRSLIVAP
FT                   PRTGKTVLLQNIAHSIETNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPATR
FT                   HVAVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRP
FT                   KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVYP
FT                   AMDILKSGTRKEDLLVDKGDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSEFFDS
FT                   MNT"
FT   gene            190266..191546
FT                   /locus_tag="Jann_0199"
FT   CDS_pept        190266..191546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0199"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53116"
FT                   /db_xref="GOA:Q28VZ6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VZ6"
FT                   /protein_id="ABD53116.1"
FT                   /translation="MQTIFAQATARGKAGVAIIRISGPDAFEVGRCLLGSLPDAGRFAL
FT                   RDVRTPLGELLDRGLVLVFKAPASFTGEDTVELQLHGSVAVVRAVEGAIRSTGLARLAD
FT                   AGEFTQRALLNDMLDLTQVEGLGRLIDSETEAQRKVAQASFEGGLSDKAERWRHLMIRA
FT                   AALLEASIDFVDEDVPVDVVPEVQSILMGLDTDLAKEVTGAVVAERLHDGFEVAILGAP
FT                   NAGKSTLLNVLADREIAITSDVPGTTRDVIEARLDVSGLPVTFLDTAGIRDTVDVIEKI
FT                   GVQRAIDRALAADVRILLEIDDWILPDVLSDTIDFRYRAKADLSDGEGISGRTGVGIDR
FT                   LLTDIEGVLSEKMSAVRSAVTDRQRGGIEAARVSLDAGVTVLSGTAELELAAEHIRHAQ
FT                   RSLDSVIGRVDVENLLGEIFSRFCIGK"
FT   gene            191549..193423
FT                   /locus_tag="Jann_0200"
FT   CDS_pept        191549..193423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0200"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53117"
FT                   /db_xref="GOA:Q28VZ5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VZ5"
FT                   /protein_id="ABD53117.1"
FT                   /translation="MFHVKHRHFDVIVVGGGHAGVEAADAACRAGARTALVTLRKDDLG
FT                   VMSCNPAIGGLGKGHLVREIDAMGGVMGCAADASGIQYRLLNRKKGAAVQGPRTQSDRA
FT                   LYKSAIQDHMRNVTELTVIEGEVADVIVESETVCGVSFTDGQSISARSVVLTTGTFLRG
FT                   VIHIGHETRSGGRFGANRAIKLAERLSAMNLPVGRLKTGTPPRLAAKSINWEALDHQPS
FT                   DDDPTFFSFLTKRVRARQIACGITHTNPHTHDIIEQNLGRSAMYGGNIDSVGPRYCPSI
FT                   EDKVVRFADKVSHQIFLEPEGLTSETVYPNGISTSLPIDVQLDYVHSIKGLEHADILQP
FT                   GYAIEYDYIDPTCLNNRLELQDHPGLFLAGQINGTTGYEEAAAQGLVAGLNAAFHAQDR
FT                   DPLTFSRRESYIGVLVDDLVTRGVSEPYRMFTSRAEYRLSLRADNADQRLTPIAADLDL
FT                   LTEERTSEFTAKMERLSRGYDILNDLVVTSKQAAAAGMSVNADGKKRTGAELLAFPSVE
FT                   LSDIAQLEPAVGQIDPATAKQLKIEAIYAVYIERQNQDAFALKRDEAKSIPADFPYSSV
FT                   VGLSNELRMKLIKTRPSTLAQASRIDGMTPAALALILTKIRQTQRLSA"
FT   gene            193420..194055
FT                   /locus_tag="Jann_0201"
FT   CDS_pept        193420..194055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0201"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53118"
FT                   /db_xref="GOA:Q28VZ4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VZ4"
FT                   /protein_id="ABD53118.1"
FT                   /translation="MNESDAKHWLSDRVSRETMDRLELYHTLLTRWQKTINLIAPSTID
FT                   SVWVRHIMDSAQLFDLASKPAHRWLDLGSGGGFPGLVVAAMAKDVCPNLTVTLVESDIR
FT                   KCGFLREAARQMDLSVKILSRRIGDVPAQTADVISARALSSLSNLIGHARPHMTPKTCL
FT                   LFPKGMSYVAELETLPDDWQVNAEVIESVTDSDAVILRFRGAHLEGEG"
FT   gene            194057..194836
FT                   /locus_tag="Jann_0202"
FT   CDS_pept        194057..194836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0202"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53119"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VZ3"
FT                   /protein_id="ABD53119.1"
FT                   /translation="MRVLSITNQKGGVGKTTTAINLGAALAATGKFVLIVDLDPQGNAS
FT                   TGLGIEARSRSKTTYDLLIDGAALEDVSIPTEIANLSIAPATTDLSSTDVELGQRDNRI
FT                   FLLKEALSESIDTYDYVLIDCPPSLSLLTLNALVASDALLVPLQAEFFALEGLSQLMLT
FT                   VREVRETANPSLRIEGVVLTMHDARNRLSRQVEDDARSNLGELVFNTMIPRNVRLSEAP
FT                   SFALPAIVYDPMSKGSQAYLDLAEELIDRETPRQEAS"
FT   gene            194836..195741
FT                   /locus_tag="Jann_0203"
FT   CDS_pept        194836..195741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0203"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53120"
FT                   /db_xref="GOA:Q28VZ2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VZ2"
FT                   /protein_id="ABD53120.1"
FT                   /translation="MARGTEKRGLGRGLSALMADIEPTASTHPDDAQTSATTSRGNRFI
FT                   PVEQIVPNPDQPRRQFSQDSLNELAASIREKGVIQPLILRPDPKDQQRFQIVAGERRWR
FT                   AAQIAQLHELPAIVREFNDTEVLEVAIIENIQRADLNPVEEAQGYRQLMEKFGHTQDQL
FT                   ATAMGKSRSHLANTMRLLQLPDEILTFVQDGKLSAGHARALITAEDPLGLALRAVKEGL
FT                   SVREVERAAKSTKNTRKNKAQSKSSNKDADTRIIESDLSRILGMSVVIDHDTDAGGGKL
FT                   SIKYKDLAQLDDLLRLLNTN"
FT   gene            complement(195745..196902)
FT                   /locus_tag="Jann_0204"
FT   CDS_pept        complement(195745..196902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0204"
FT                   /product="Putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53121"
FT                   /db_xref="GOA:Q28VZ1"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VZ1"
FT                   /protein_id="ABD53121.1"
FT                   /translation="MTADWQAGGFGLYVHWPFCEAKCPYCDFNSHVSARIDQGAWLKAY
FT                   LSELDRVAAELPNRTLGSVFFGGGTPSLMAPDSVASIIEAVRRLWPVSNDLEVTLEANP
FT                   SSVEAGRFAGYKDAGVNRVSVGVQALDDVDLKRLGRLHSVKEAYAAIDVARAHFERMSF
FT                   DLIYARQDQSLAAWRTELTQALNLAADHLSLYQLTIEPGTAFGTRHAKGGLRGLPEEDL
FT                   SADMYDLTQDLCGAAGLPAYEVSNHAADFAQSRHNLVYWHAGDYAGIGPGAHGRVTLAG
FT                   RRYGTETYLQPQAWLDAVGKSGSGESDRTALSAREQAEEYLMMSLRLTEGSDPARYEAL
FT                   NGQPLDPVKIRDLVDLGLIESTPERIKATACGRPVLNGILRDLLA"
FT   gene            complement(196892..197503)
FT                   /locus_tag="Jann_0205"
FT   CDS_pept        complement(196892..197503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0205"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53122"
FT                   /db_xref="GOA:Q28VZ0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VZ0"
FT                   /protein_id="ABD53122.1"
FT                   /translation="MRRFTGDQLLIATHNQGKLDEMRHLLQPFGIRVSGAADHDLPEPD
FT                   ETETTFVGNARIKAHAAAKATGLPALSDDSGIEIDALGGAPGVYTADWAETPDGRDFVM
FT                   AMERAHRELEAVGASHPRTARFCCTLVLAWPDGHDEVFPGVMEGQVVWPMRGEQGHGYD
FT                   PVFQPNGYDLTFGEMDRWEKNKISHRARAVEQLVEIFSDG"
FT   gene            complement(197503..198132)
FT                   /locus_tag="Jann_0206"
FT   CDS_pept        complement(197503..198132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0206"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53123"
FT                   /db_xref="GOA:Q28VY9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VY9"
FT                   /protein_id="ABD53123.1"
FT                   /translation="MIRCGDTHVLCTATLEARVPPFLKNSGLGWVTAEYGMLPRATHTR
FT                   MRREAAAGKQSGRTQEIQRLIGRSLRAGIDRSALGERQITVDCDVIQADGGTRCASITG
FT                   GWVALRLAVNKLLKSGEIVTDPIVDHIAAVSCGIYAGQPVLDLDYPEDSEAGTDGNFIM
FT                   TGAGQVVELQASAEGATFSRDEFNELYSLAEKGVAELVQAQAAATA"
FT   gene            198317..199381
FT                   /locus_tag="Jann_0207"
FT   CDS_pept        198317..199381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0207"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53124"
FT                   /db_xref="GOA:Q28VY8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VY8"
FT                   /protein_id="ABD53124.1"
FT                   /translation="MTDQGKILDDLNDRSREVFRRVVEGYLETGAPVGSRTLTRTLSEN
FT                   VSAATVRNTMQDLEHMGLLDSPHSSAGRMPTQQGLRMFVDGFLEVGDLSRDDKRALDDT
FT                   MGDNATDVSGLLDRVGSALSSATHGASLVLTPKHEAPIQHIEFVTLSATQCLVVLVFSD
FT                   GHVENRLFTPPAGMTQSAMREAANFLNARIEGQTVSTIRAQLEVDIETRRREIDDLASG
FT                   LIDSGLAVWDGTGDNTARLIVRGRSNLLSDSQESEDLDRIRQLFDDLERKRDITEFLEL
FT                   TEDGDGVRIFIGSENKLFSLSGSSLVVSPYMNSDRKIVGAVGVIGPTRLNYGRIVPIVD
FT                   YTAQLVGRLISDRS"
FT   gene            199400..199966
FT                   /locus_tag="Jann_0208"
FT   CDS_pept        199400..199966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0208"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53125"
FT                   /db_xref="GOA:Q28VY7"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VY7"
FT                   /protein_id="ABD53125.1"
FT                   /translation="MGERDDEFYEDQTADAQDKADVSLAPEDMSGTDAVIEALEAERDE
FT                   LRDRMLRAMAEAENMRKRADRDRREAEQYGGSKLSRDLLPVYDNMRRALDAADDATREA
FT                   ASGLVEGVELTMRELISIFGKHGIVPVVPEVGERFNAQEHEAMFEAPVPGTKAGDIIQV
FT                   MSEGFLLHDRLLRPAQVGVSSTPAS"
FT   gene            complement(199959..202592)
FT                   /locus_tag="Jann_0209"
FT   CDS_pept        complement(199959..202592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0209"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53126"
FT                   /db_xref="GOA:Q28VY6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VY6"
FT                   /protein_id="ABD53126.1"
FT                   /translation="MNAQVTPMMAQYLEIKAAHPDALLFYRMGDFYEMFFDDAVAAAEA
FT                   LDIALTKRGKHNGEDIAMCGVPAHSAESYLLTLIRKGFRVGICEQMEDPATAKKRGGSK
FT                   AVVRREVVRLVTPGTLTEDTLLEARRHNYLASYADVRGEGALAWCDISTGDFRVMRCPA
FT                   VRLGPELARLSPKEVLVSDGLDIARQDAIIELGAAVTPLSPGSFDSASAEQRLAGLFSV
FT                   STLEGFGNFARAEVSAMGALIDYLELTQKGALPLLRAPRQQSADRLLQLDTATRRNLEL
FT                   TQALSGGRANSLLSVLDRTQTAGGARLLQRRLTGPSTDLDVIRARHESVSFFFSDTLIR
FT                   DDLEAELRRIPDLDRALSRLALDRGGPRDLSAIRDGLSGAARLSDKLKIVDLPPLLEGA
FT                   VQDLQGHDELSALLDEALVAEPPVQLRDGGLIAPGYHAELDEARTLRDEGRSVIATMQA
FT                   DYVEATGVNALKIKHNNVLGYFIETTATHAEKMLNPPLSERFIHRQTTANQVRFTTVEL
FT                   SELETKILNAGNRALEIERVLFQSLRDAILNCQDQIGQAARGLAELDLSAALARRAREG
FT                   DWTQPEMTEDRAFMIEGARHPVVEAALAKDGTSFVANDCDLSAEGGAAITLLTGPNMAG
FT                   KSTYLRQNALLVIMAQTGSFVPAKCAKIGLVSQVFSRVGASDDLARGRSTFMVEMVETA
FT                   TILNQADDRALVILDEIGRGTATYDGLSIAWATLEHLHETNQCRALFATHYHEMTSLAS
FT                   KLDGLTNATVAVKEWEGEVIFLHEVREGAADRSYGVQVAKLAGLPDAVIARAQVVLDAL
FT                   EKGEREGGERKAVIDDLPLFAMMPAPAPAPSAPSLVEEKLRAVHPDEMTAREALNLLYE
FT                   LKAELS"
FT   gene            202704..204968
FT                   /locus_tag="Jann_0210"
FT   CDS_pept        202704..204968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0210"
FT                   /product="Malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+) Phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53127"
FT                   /db_xref="GOA:Q28VY5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VY5"
FT                   /protein_id="ABD53127.1"
FT                   /translation="MADKQKITREEALAYHLDPRPGKIDINASTAMATQRDLSLAYSPG
FT                   VAVPCEVIADNPETAYDYTTKGNMVAVISNGTAVLGLGNLGALASKPVMEGKAVLFKRF
FT                   ADVNSIDIELDTEDVDEFVNAVKLMGPSFGGINLEDIKAPECFMIEQQLKELMDIPVFH
FT                   DDQHGTAVICAAGLINALHISGKKIEDCRIVLNGAGAAGIACIELLKSMGARHENCIVC
FT                   DTKGVIYQGRTEGMNQWKSAHAVSTKLRSLEEAMDGADVFLGVSVKGAVTPEMVKSMND
FT                   NPVIFAMANPDPEITPEEAHAVRADAIVATGRSDYPNQVNNVLGFPYLFRGALDVHARA
FT                   INDEMKIACAKALAELAREDVPDEVAMAYGRKLSFGRDYIIPTPFDPRLIYMIPPAVAQ
FT                   AGMDTGAARRPIIDLDGYAKDLQARMDPTSSILQGVYARARNAQARMIFAEGDDPRVLR
FT                   AAVAYQRQGLGRALVIGRDADVREKLDAVGLGDAARELDIVNAANTRHLETYKEFLYTR
FT                   LQRKGFDRTDIHRLAARDRHVFASLMLAHGHGDGMLTGATRKSAQVLEMVGKVFDARAE
FT                   DGAVGVTALLHKGRIVLIGDTLVHEWPSDTDMALIAERGAQVARGLGIEPRVAFVSFST
FT                   FGYPVSERAEKMHRAPAVLDAKGVDFEYDGEMTVDVALNPAVMANYPFTRLSGPANVLV
FT                   VPARHSASISVKLMQEMAGATVIGPILTGLDRPVQIASTVSTSNDILNMAVMAACEIGR
FT                   T"
FT   gene            complement(205138..206295)
FT                   /locus_tag="Jann_0211"
FT   CDS_pept        complement(205138..206295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0211"
FT                   /product="Chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53128"
FT                   /db_xref="GOA:Q28VY4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VY4"
FT                   /protein_id="ABD53128.1"
FT                   /translation="MAKRDYYEVLGVSKGASADEIKKGFRTKAKELHPDRNADNPEAES
FT                   QFKEANEAYDVLKDADKKAAYDRFGHAAFDGGMAGGPRGGGGQGQGDFASAFSDVFEDL
FT                   FGDFMGGQRGRPGGARTQATRGSDLRYNLSITLEDAYNGLSKQITVPSSVACSSCDGTG
FT                   SEAGAEPTSCPTCSGMGKVRAQQGFFTVERTCPTCNGMGQIVKNPCRTCGGAGRQEKDR
FT                   ALSVNIPAGVETGTRIRLSGEGEAGLRGGPAGDLYIFVEVQDHALFQRDGMDLFCRVPV
FT                   SMVSAALGGEIEVPSIDGGRSRVRVPEGSQSGRQMRLRGKGMPALRGPGLGEMYIELMV
FT                   ETPVNLTGDQAELLRQFEESCKKTNNPNASGFFDKVKSFWDKVRD"
FT   gene            complement(206366..208285)
FT                   /locus_tag="Jann_0212"
FT   CDS_pept        complement(206366..208285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0212"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53129"
FT                   /db_xref="GOA:Q28VY3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VY3"
FT                   /protein_id="ABD53129.1"
FT                   /translation="MAKVIGIDLGTTNSCVAIMDGSQPRVIENAEGARTTPSIVAFTDD
FT                   ERLAGQSAKRQAVTNPENTIFGVKRLIGRRINDEHLEKDKKNLPFEIVDGGNGDAWVKA
FT                   KGETYSPSQISAFILQKMKETAESYLGEDVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGLDKKETRTIAVYDLGGGTFDVTILEIDDGLFEVKSTNGDTFLG
FT                   GEDFDMRIVNYLAEEFKKENSVDLTQDKMALQRLKEAAEKAKIELSSASQTEINQPFIS
FT                   MGSNGQPLHMVMKLTRAKLESLVGDLIKASIKPCAAALKDAGLSKGDIDEVVLVGGMTR
FT                   MPKVIDEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSMGIETL
FT                   GGVFTRLIDRNTTIPTKKSQIFSTADDNQSAVTLRVFQGEREMAADNKILGQFNLEGIP
FT                   PAPRGVPQIEVTFDIDANGIVSVGAKDKGTGKEQQITIQASGGLSDDDIEAMVREAEEN
FT                   AEADKDRKDLVETRNQAESLVHGTEKSLEEHGEKVDPSTVEAIELALGALKETLETDDT
FT                   AKIKGGIQNVTEAAMRLGEAIYKAEADKAEAAQDGAPEEEERGVDEDIVDADFEDLDDD
FT                   RKRG"
FT   gene            208414..209064
FT                   /locus_tag="Jann_0213"
FT   CDS_pept        208414..209064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0213"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /EC_number="1.14.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53130"
FT                   /db_xref="GOA:Q28VY2"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VY2"
FT                   /protein_id="ABD53130.1"
FT                   /translation="MIWGCKRQHAMESEEFALSVDVGGIVVHPEHLDGPDQAELVEQVR
FT                   RVVRSAPLYRPETRTGRKMSVRMTSAGTYGWISDRRGYRYDRCHPDGQDWPPIPPMALE
FT                   IWRAVSGVAQDPQSCLINYYDAGAKMGMHQDRDEGDFDMPVVSVSLGDEALFRVGGPKR
FT                   GGKTQSVWLKSGDVAVMGGEARLNFHGIDRIRAGSSTLLPNGGRINLTMRVVT"
FT   gene            complement(209068..209889)
FT                   /locus_tag="Jann_0214"
FT   CDS_pept        complement(209068..209889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0214"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53131"
FT                   /db_xref="GOA:Q28VY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VY1"
FT                   /protein_id="ABD53131.1"
FT                   /translation="MFETRTSTSMLALIFNFLEVTYHAAARKVRKNHGNAVLSIVLSIL
FT                   QSVMFIAAFYFMFTFLGGRSAALRGNFMVYLMSGIFLYLTHIQTVRAVMGADGPTSAMM
FT                   QHGPMNTLVSILSEALAVLYTQTIALLCILLLIHTVILPVHIEDWPGAMRMFLLAWGSG
FT                   VALGIILMAWKPWMPDVVQILSMVYIRANMIFSGKMFLANSMPAMMLPAFQWNPLFHII
FT                   DQTRGYVFVNYFPHNTNVAYPFYFTLGAILFGMMFEAYTRKHASSSWDAKR"
FT   gene            210040..210837
FT                   /locus_tag="Jann_0215"
FT   CDS_pept        210040..210837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0215"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53132"
FT                   /db_xref="GOA:Q28VY0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VY0"
FT                   /protein_id="ABD53132.1"
FT                   /translation="MDHEKIVAVMRTAALEAGDAIMEVYGAEDFDVKVKSDDSPVTEAD
FT                   EAADAIISRHLRAAFPDVTLITEEQADSHGLSADQFLIVDPLDGTKEFIKRRGDFTVNI
FT                   ALVEHGVPVRGIVYAPAKGRLFYTNADGVSIEEAGPFEPNAPGRLDPITVSRPDNSALR
FT                   VVASKSHRDQATDHYINKYDHADMKSAGSSLKFCLVATGEADLYPRLGRTMEWDTAAGD
FT                   AVLRGAGGKMVRFEDHAPFEYGKDGFANGFFIAYAPGLELQLP"
FT   gene            210834..211631
FT                   /locus_tag="Jann_0216"
FT   CDS_pept        210834..211631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0216"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53133"
FT                   /db_xref="GOA:Q28VX9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX9"
FT                   /protein_id="ABD53133.1"
FT                   /translation="MSVACVIPARYASARFPGKPLAMLTGATGEKVSLIERSWRAAQNV
FT                   SGLDAVYVATDDERIADAAREFGAEVLMTSSEARNGTERCAEALEILGDVEMVVNLQGD
FT                   APLTPPWFLEQLVDGLRNDAQAAIATPILRCDGETLAALKADRAAGRVGGTTAVADSKM
FT                   RGLYFSKEVVPFTSETYAPDAPTPVFHHVGVYAYRPWALRAYPHWSIGPLEMLEGLEQL
FT                   RFLEAGHPVLCVEVEAHGAKFWELNNPEDIPRIEAMLRDMGAP"
FT   gene            211628..212857
FT                   /locus_tag="Jann_0217"
FT   CDS_pept        211628..212857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0217"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53134"
FT                   /db_xref="GOA:Q28VX8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX8"
FT                   /protein_id="ABD53134.1"
FT                   /translation="MSALRLSVVVVSVGRPEALRRCLISLSQQAKAGCEVIVVADTVGQ
FT                   AAVRTLPVAGALRLLPQRQPNISAARNAGIAAAGGDVIAFIDDDAVAEPIWSHAILTAF
FT                   DDPDIAAVTGPVLGRNGISLQWGPMAANGLAQDAEVDPDTPVRDGFVRKLQGTNMAVRR
FT                   PVLEDIGGFDEALHFYLDDTDMALRLGRAGLRSAWVPRAVVHHGFDASVRRSPTRVPLS
FT                   LFDIGASSAVFLRKHAPDDRYAEALHALEAAQSTRLMRLVQRRKIDPDQMRTLLESLRE
FT                   GIKDGQSRDSHQPEIGSVAQYFEPFQTIDPPAHQVLSGRSFQLARLRAQVEQLVAQGQP
FT                   VSLFALEPTPRKHKVRFTDGGWWEQTGGLFGPSDRSGPRLQITSFRARIAAEVSRISAT
FT                   RCIEPDRKKY"
FT   gene            212950..213843
FT                   /locus_tag="Jann_0218"
FT   CDS_pept        212950..213843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0218"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53135"
FT                   /db_xref="GOA:Q28VX7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX7"
FT                   /protein_id="ABD53135.1"
FT                   /translation="MKKKVTKAIFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDE
FT                   ARAAGIKEFIFVTSRGKSALEDYFDHTPELENTLRKKGKTDMLEMLKSTNMDSGAIAYM
FT                   RQHKALGLGHAVWCARRLLGNEPFAVILPDDVIAADTPCLQQMVEAHAELGGNMVAAME
FT                   VPDDKTSSYGILDVKEDMGSVVSVKGMVEKPPQDKAPSNLAVIGRYILSPDVMGHLNKI
FT                   KSGAGGEIQLTDAIAQEIVSADNVYGYRFKGQRFDCGSKAGFLQATVAFGLARDDLRDE
FT                   FQDYLADMMSARSAAQ"
FT   gene            213853..215100
FT                   /locus_tag="Jann_0219"
FT   CDS_pept        213853..215100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0219"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53136"
FT                   /db_xref="GOA:Q28VX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX6"
FT                   /protein_id="ABD53136.1"
FT                   /translation="MSGLRDIPGLWLDITRLLTRVGRGALTGIDRVEAAYLAEALAGDA
FT                   KFLCRTTRGYLLLDQTGGRALFDLCNGAVMGRADWISRLTLRGHKPRHRAEAVLRRHAV
FT                   ARCRPAALPKFLQNHAAPGSTYVNVGHSNLSEATLSAVSGQFSNCAVLIHDLIPLTHPA
FT                   YVADDMPARFAGRMDRVRRYADLVICNSSATQFDLIAHWGDGQTVKPKYIVAHPGVTPR
FT                   PRSDDLDRDAGHFVMLGTIEARKNHDLMLDVWELLAQDMPRDQMPTLHIIGAVGWKVDA
FT                   LMERLRSHPLYGDKILLNGPYGVLDDHAVQDHLARATALLFPSLAEGYGFPPLEAAMAG
FT                   AVPICSNLAVFRETLGDCAVYVDNNDAYSWVETIKQHFYGTAVKPELTMLKGPTWAEHF
FT                   DKVAQAIQPPGRKGRQ"
FT   gene            215097..216107
FT                   /locus_tag="Jann_0220"
FT   CDS_pept        215097..216107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53137"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX5"
FT                   /protein_id="ABD53137.1"
FT                   /translation="MKAIKRYGLRLERKRFLVRAWRKSRGVEPIADRTDAIKEGDILCF
FT                   CTLRNERVRLTYFLNYYRERGVNHFLFVDNDSGDGTREYLADQPDCSVWWTDDSYKRSR
FT                   FGMDWINRLLRLHGHKHWCLTVDPDEFLVYPFSDTRPIPALTDWLDASSIKSFGAMLLD
FT                   MYPKGPIDAQPYREGQNPFDIACWFDAGNYSVTRNWDYGNLWIQGGPRARSFFADNPKR
FT                   APALNKTPLVNWQKHYTYASSTHMLLPRGLNRVYDEWGGEKASGVLLHAKFLDTFSVKA
FT                   KEELDRREHYAASAEYKAYANGMKENPEFWTKWSEKYINWRQLEILGLMSKGNWA"
FT   gene            216104..217804
FT                   /locus_tag="Jann_0221"
FT   CDS_pept        216104..217804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0221"
FT                   /product="glycosyl transferase family 14"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53138"
FT                   /db_xref="GOA:Q28VX4"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX4"
FT                   /protein_id="ABD53138.1"
FT                   /translation="MSTLGFVMMCHTALDRAAEVARHWAERDCPVVIHLDKRVAKERDV
FT                   WLKRELSDLDNVKFCKRHKCEWGTWSLVQASQTGAEMMLEEFPGVRHVYLASGSCLPLR
FT                   QVDELRAYLAARPMTDFIESVTIRDVDWTVDGLNTERFQFRFPFSWKRHRFLFDRYVEL
FT                   QRSTGFKRKLPDGLQPHLGSQWWCLSRQTLSAILQDPARREFDRYFKLVWIPDESYYQT
FT                   LVRNYSRNIESRSLTLSKFDFQGKPHVFYDDHLHLLRRSDCFVARKIWPRADRLYRTFL
FT                   NDDAADARKAEPTPGKIDRVFAKALERRTRGRPGLYMQSRFPNNDWENGKTAAPYSVLH
FT                   GFNELFLDFEPWLSRRLGTSVHGNIFSPKRVRFAGDADTFAGCLSAAPELRDYNPERFL
FT                   TSLIWNTRGERQVFMFGPEDNQRPGAFMAADSNAQISVITGAWAVRLFTANRNFGDIRT
FT                   EAARLQRREVEFVNTLRHVRSRAEIRIWSLAEFLEEPMENLQRILDAMEGAQASRLTEA
FT                   PKMANLAGLPKFLQNLKNQGMNPFAVGDFPQEGVAPLPAGADNRPYLVR"
FT   gene            217808..219241
FT                   /locus_tag="Jann_0222"
FT   CDS_pept        217808..219241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53139"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX3"
FT                   /protein_id="ABD53139.1"
FT                   /translation="MAGRFDAFVLFAEMRTGSNYLEDSLNTFADINCLGEVFNPTFIGH
FT                   DNNFEMLGYDMDRREHDPLGLLDAIIDTVDGLPGFRLFHDHDTRVVDRVLPDPRIAKVI
FT                   LTRNPLDSYVSRKIATATGQWKLTDMKHAKTAQIRFDADEFGALLDAVLPFQEYVRQGL
FT                   LKSGQVAFQVRYEDINDPEMLNGLAAFLGSDERVERASKTLKRQNPAPLRDKVENYEEM
FT                   VAALSDLDRFGLDKLPELEPDRGAQVPNFVAHPTLGLLFCPIKGAPEKSVLNWMGALGD
FT                   VGKDALIRKMTQKQLRQWMKDNPGFRSFTVLRHPVVRAYTVFNRFILPDDRPAYADPRK
FT                   TLRQRYKVPIPENAPGDGWTEAEQKAAFQGFIFFLKGNLAGQTSVRVDQAWATQTAILQ
FT                   GTSSVMVPQAVIHEDHMTEALPALAHQVGAEDVPQVVEEAMPGLHKLKSIYDGKIEQAL
FT                   IDTYRRDYVGFGFPRWNKR"
FT   gene            complement(219238..219702)
FT                   /locus_tag="Jann_0223"
FT   CDS_pept        complement(219238..219702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0223"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53140"
FT                   /db_xref="GOA:Q28VX2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX2"
FT                   /protein_id="ABD53140.1"
FT                   /translation="MDLSTLLTPQSVKVVSDVSSKKRLIQSISEIAETLVNIPAARIFE
FT                   ALQERESLGPTSVGHGIALPHARLSEINRVTGAFIRLERAIDFGAADRQPVDLVFILLA
FT                   PLDSGVDHLKALALVSRTLRDPALCTKLRANSDASTLYTLLTEGEATKAA"
FT   gene            complement(219780..220487)
FT                   /locus_tag="Jann_0224"
FT   CDS_pept        complement(219780..220487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0224"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53141"
FT                   /db_xref="GOA:Q28VX1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX1"
FT                   /protein_id="ABD53141.1"
FT                   /translation="MLHLPVPRTVCRPFDCPSALSLTSKIIKLTDTAPASCTLKTGGYM
FT                   RYQISGKQIEIGQALQTHVQDNLGGIAQKYAERPTDATVVFSKSGPEFACETTVHLSTG
FT                   LTASAKAHAHEIYAAFEATADKLEKQLRRYKRRLKDHHKDRATPIDVYGGASYILASSE
FT                   AAVDDAEPETLQPIIVAEMETSIPSLSVGEAVMQMEIAGAPLLVFREQGNDRVNVVYRR
FT                   DDGNVGWIDPKTT"
FT   gene            complement(220554..221303)
FT                   /locus_tag="Jann_0225"
FT   CDS_pept        complement(220554..221303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0225"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53142"
FT                   /db_xref="GOA:Q28VX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VX0"
FT                   /protein_id="ABD53142.1"
FT                   /translation="MALSVTEGSAGLRVHKLRKSYRKRPVIRDVTLELNRGEVVALLGP
FT                   NGSGKTTSFYCIAGLITPDGGRVTIDGQDVTLFPMYRRARAGVGYLPQEMSIFRGLTVE
FT                   DNIKAILEIVEPKRKKRRDRLEELLSEFSIEHLRRAPALSLSGGERRRAEIARCLASDP
FT                   RYVLLDEPFAGVDPIAVGDIRALVAELKTRGIGVLITDHNVQETLAIVDRAYILHDGVI
FT                   IMSGTADEVVEDENVRRVYLGQSFKIT"
FT   gene            complement(221303..221785)
FT                   /locus_tag="Jann_0226"
FT   CDS_pept        complement(221303..221785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0226"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53143"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW9"
FT                   /protein_id="ABD53143.1"
FT                   /translation="MHRILALLGVILCLTTPLSAQVNIGFGGVAYDSSQPVEVTSDALT
FT                   VDQTTGEAVFTGNVIVVQGDLRMAASAVRVLYTTDGNQDISEVIATGGVLITRGTEAAE
FT                   GNSAVFNVASSLLTLRGNVLVTQGQTAIAGDNMVVDMTTGSGTVDGRVRTVLGGSE"
FT   gene            complement(221796..222392)
FT                   /locus_tag="Jann_0227"
FT   CDS_pept        complement(221796..222392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53144"
FT                   /db_xref="GOA:Q28VW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW8"
FT                   /protein_id="ABD53144.1"
FT                   /translation="MARDNLYSKAVMWVKIILPLVALGLLSSIFLLANAPDPDDALPYA
FT                   DVDIEQITRRQTVTEPRFAGILGDGQEIVLIADTVTADVDQTDQFLARMVDGRMDMGLT
FT                   EELMIRADLGDIDMAAQLATLTDDVVLHTTDGYRMVSEVVIMALDVVNMRSPVPVHVTG
FT                   PGIDVTADTMELTGPDGETILHFNGSVRVLYDPQS"
FT   gene            complement(222405..223016)
FT                   /locus_tag="Jann_0228"
FT   CDS_pept        complement(222405..223016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0228"
FT                   /product="3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53145"
FT                   /db_xref="GOA:Q28VW7"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW7"
FT                   /protein_id="ABD53145.1"
FT                   /translation="MTNTLYQTDLPDDLELGPIVAIDCETMGLHPHRDRLCVIQLSDGD
FT                   GNAHLVQVAKGQTAAPNLCALLEDPNTLKLFHFGRFDIAAMYHAFGALTAPVYCTKIAS
FT                   KLVRTYTDRHGLKNLLQELLGIDISKQQQSSDWGADSLTEAQVDYAASDVLYLHGVKDK
FT                   LDVMLAREGRTELAQACFDFLPMRAKLDLAGWPEMDIFSH"
FT   gene            223268..224473
FT                   /locus_tag="Jann_0229"
FT   CDS_pept        223268..224473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0229"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53146"
FT                   /db_xref="GOA:Q28VW6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW6"
FT                   /protein_id="ABD53146.1"
FT                   /translation="MAHVLNRLKATQISALPKGKYADGAGLWLYKSTDESGQWVFRYTL
FT                   YTRRHEMGLGSASTVALKAARARAAGLREQVQQGVDPIKARRDAEQAALRNMNTLHDVT
FT                   LDAFESRKADLRDDGKAGRWLSPLELHVLPKLGRMPISEIDQRDIRDTLAPIWHAKADT
FT                   ARKAMGRLGIVFKHAAALGLDVDLQATEKAKALLGRSRHVSEHIPSMDWREVPAFFAKL
FT                   SDGSTTHLALRLLILTGLRSKPIRFAHVDEIDGNVWTVPGEKMKARKHQSEDFRVPLSS
FT                   LALEVIEAAKPMARDGYLFPGVRKGVISDATMSSLMTRMELTARPHGFRSSFREWAAKA
FT                   GGVEFDTAEMSISHKVRNSTQKAYLRDDQLEQRSVLMERWADHVSGGTGQVVSLAIEGR
FT                   RS"
FT   gene            224470..225291
FT                   /locus_tag="Jann_0230"
FT   CDS_pept        224470..225291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53147"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW5"
FT                   /protein_id="ABD53147.1"
FT                   /translation="MNVFGDPFFRDEFRLEGEVGYSTIFGAIKVTSRTQKTWGLTAHPL
FT                   KREYVLEVARESARNLEHHPAPTGYIPYGAFFRASALAVAGDIGFRKARHLTASDVDHL
FT                   RRATAMSVLRNLMEGELSLCVGYSTKTGLEDLDRKVWQVDGAAQLVEYGGMRLEGKLCR
FT                   FVLADPTATANKRGGVRKVEPSARTAAYHYFALYPSGCQREDPPITWGEATASVADITG
FT                   QRDLKTGALRTASGWSEKNPQQAIDLWLEAKLINSADEAPPYILRLSSESG"
FT   gene            225859..226209
FT                   /locus_tag="Jann_0231"
FT   CDS_pept        225859..226209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53148"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW4"
FT                   /protein_id="ABD53148.1"
FT                   /translation="MKTSDGIPPKDTRRIYGWHNLPNTYKAARYRITDPGQEPRVITVS
FT                   RKKRQVLEGLMRSPLHSASYCRLSDTVMPLRRDHGVDIECTLYKSDTDTGRDKFGVYTL
FT                   SSKVERIDGEGE"
FT   gene            226403..227281
FT                   /locus_tag="Jann_0232"
FT   CDS_pept        226403..227281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0232"
FT                   /product="virulence-associated protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53149"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW3"
FT                   /protein_id="ABD53149.1"
FT                   /translation="MTNVPIDPRQLTQDLGGKWAQAYGTAPCPICQDRRKGQNALTIRV
FT                   KGDRLLMHCKKSNCSFIDLLRAAGIAPGTVEIDPTAQREADAARAEYEAYQLHRARKAW
FT                   DYGKLITGTKGEAYLRGRCITCPLPETLRWIADTYHSPSGQYGAAIVADVQPTGGVHRT
FT                   FFDKRGNRLAKNAKMMLGPCSGGAVRMSEAVGPLVVCEGIETGLSLLSGLLDGPANVWA
FT                   ALSTSGLRALDLPPRPPSGSLIIATDGDAPGREAGAALADRAHTLGWPVSIMAAPDGQD
FT                   FNDVLMERRAA"
FT   gene            227278..228801
FT                   /locus_tag="Jann_0233"
FT   CDS_pept        227278..228801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53150"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW2"
FT                   /protein_id="ABD53150.1"
FT                   /translation="MTAIKPETYTPEGPQPLLREVSPGAEYPVASLGPLREAAQAAQAT
FT                   TQAPMALAAQSALSVASLAVQAHGDVETLGGFAPISLYCLTIARSGERKSATDKLLMAG
FT                   LREFEREAAAEYQQAVGVWENTAEIHKNDRAQIMHGFKKATGSERVASKADLEALGAEP
FT                   PAPLLPNLTATEPTLEGLHKLFLAGQPSLGMFSDEGGGFLGGHGMSQDHRLKTVAGLSA
FT                   LWGGDPLTRVRAGDGTSSLFGRRLAVHLMVQPVAARPLLADPVASGQGFLARFLIAEPQ
FT                   TAIGLRLASEPPAGASAQLAAFNVRLRAILDAPKPFAGDTQQQLEPPHLTLTPDARKVL
FT                   WDYYVETETAQQAGGSLEGLTAYASKTAEQAARIAGVLTLWENLQAREIQIGMMKSGVR
FT                   LARFYLGEAKRLAESAEISIETEKAERLRLWLRDSWPTIASANGRNPQYVLPRDVVQHG
FT                   PGSLRETKTAKQTLTILSGHGWIMPLERGAVVDGASRRDAFHIVKDGPP"
FT   gene            228933..229499
FT                   /locus_tag="Jann_0234"
FT   CDS_pept        228933..229499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53151"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW1"
FT                   /protein_id="ABD53151.1"
FT                   /translation="MTELTTTPGIKSPETTNGIAAQLGIGFEASDDGEINVKLSEPDAI
FT                   PKVFGTENKLYADTLLLHALTMLSVDEAKDAAVAGGNCSFMVGAIADMAPQDGFERLLI
FT                   TQMAATHMAVVRAGRRMANAQQVKQFEAYSNNFNKLTRTYAAQMEALRKHRNGGKQIVQ
FT                   VQHVNVEDGGQAIVGTVQTGAGVQS"
FT   gene            229906..230286
FT                   /locus_tag="Jann_0235"
FT   CDS_pept        229906..230286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53152"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VW0"
FT                   /protein_id="ABD53152.1"
FT                   /translation="MKSKVEKLSDNGKGELANAGTAQCYDFNSEAAKTMGLFDAFWLRT
FT                   HPKEERFFREAMEGESPLLDHLAQVGKADCLWIIVSRGPDGGTTVNPMFEMAGVKITLS
FT                   VATEVINETPFANQSDALCVRQ"
FT   gene            230305..231984
FT                   /locus_tag="Jann_0236"
FT   CDS_pept        230305..231984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53153"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV9"
FT                   /protein_id="ABD53153.1"
FT                   /translation="MTTEAQRRAIEQAEQRLAQSGTTPTQGSGLPQWPITVDIGGHTVE
FT                   FPDPASLQQYLAQQSPNPTGQMSPNASEALTGAGSGPVDMDRQALIDEARRRRLDLSTG
FT                   SASALGGISGAATDGALMGFGDEYLAGLSTVLGVQPDGEGGANWFDYSQPMGDRYDTAL
FT                   DQIRREQAQFSEDRPGLSLAGEVGGSLLVPGMGARGAMAASSGAGRVAQGGLLGGGASF
FT                   TYGFGEGEGGIMNRLQSGAVAAPVGLLAGGSLALAGEGFSAAINRLRGQSDGAAATPSV
FT                   EDLRGTANRLYSEAREIGGVIPAQHMAQMSTRMREVMREEGFDADLHPRVAVALERVTR
FT                   QAGDTPFSEMEILRRVINGAGNSLEPDERRLAGELVDLLDGEIDNLPVSGAIREARDAW
FT                   GRVRRMEAVEGAIERASLTDNFTQGLRSQFRQILRNPRRLRGFSEQEIAALRRVANGTA
FT                   TENGLRHLSRLMSPTGIAGPVLTGGAFAGGAGLGSLAIPATGLMAGRGASSMTRRNVEA
FT                   ARAAVGRTPEQQSVIEALLRRPTPALQPSVGMAPVIEALIGR"
FT   gene            complement(232001..232294)
FT                   /locus_tag="Jann_0237"
FT   CDS_pept        complement(232001..232294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53154"
FT                   /db_xref="GOA:Q28VV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV8"
FT                   /protein_id="ABD53154.1"
FT                   /translation="MREQHDMAIESIIARARDQHPERAAQLDAIAHIRRNKSRAGWVCM
FT                   IAMGLAVGIFSLSPLAAFAVLAGLGAALYVYHAECNAAIREISRDRCNHLMG"
FT   gene            complement(232484..233116)
FT                   /locus_tag="Jann_0238"
FT   CDS_pept        complement(232484..233116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0238"
FT                   /product="protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53155"
FT                   /db_xref="GOA:Q28VV7"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV7"
FT                   /protein_id="ABD53155.1"
FT                   /translation="MCNLYSMTSGQDAIRDLVKVWDDQTGNLPPLPGIYPDYQAPVISN
FT                   GAGGRVLSMMRWGLPSPAFALKGKKTDRGVTNVRNTNSPHWRRWLGVQHRCVVPFTAFA
FT                   EPHNQPGQPSENVWFALNEDQPLAFFPGIWTQWTSVRKLKDGETTDNLFGFLTTDANGV
FT                   VGPIHSKAMPVVLRTEAEVDTWLNADQNKALQLQQPLPDDALQVIEP"
FT   gene            233800..234648
FT                   /locus_tag="Jann_0239"
FT   CDS_pept        233800..234648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53156"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV6"
FT                   /protein_id="ABD53156.1"
FT                   /translation="MTVCVAVKVQDCIVFAADSTTSLQAVGANGEHVTMNTYDHANKLF
FT                   NLRKGCPVAAMTAGIGNFGGSSISTVSKDFRSLIDRRAEGYALNWENYTIEEIVGLARK
FT                   YFFEERFSSLSEKPQGSFQYWVGGYSSGEQMGEVWQFQIHNGECLEPQCSISRNVASGL
FT                   AWGGAPEAINRLILGYGQRIGDALVEGGLDASLVPQAIDGIARYTQCSLVHAAMPTGDA
FT                   IDLAKFLAETTKQFVRFMPGSNSVGGDLDIATITKHENFKWIARKHFYNTRINPLETNH
FT                   A"
FT   gene            complement(234842..235324)
FT                   /locus_tag="Jann_0240"
FT   CDS_pept        complement(234842..235324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0240"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53157"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV5"
FT                   /protein_id="ABD53157.1"
FT                   /translation="MMCLVASAFPSASKQMTKVVAALGLLLLALAAYGWVSSPASAIPG
FT                   TSLPPCGSGERVSCVVDGDTIWLEGINYRLEGYDTPEEYNNVCGGFAEIDLARAATARL
FT                   VELLNQEDWEMKPVGRSDAHGRVLANLIVDGVDVGDILIREGLARAYPGGDEFWCS"
FT   gene            235625..235927
FT                   /locus_tag="Jann_0241"
FT   CDS_pept        235625..235927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53158"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV4"
FT                   /protein_id="ABD53158.1"
FT                   /translation="MTKAIAPSAIDRRALMLAAWANTRRIMVALGYAAHQMRTVFAAEL
FT                   RKAWAAAKAAAKAATTPVKDHSVKLAIVALNNKDRWTQADYARMDALRLELREAA"
FT   gene            235927..236292
FT                   /locus_tag="Jann_0242"
FT   CDS_pept        235927..236292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0242"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53159"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV3"
FT                   /protein_id="ABD53159.1"
FT                   /translation="MDRRKFIATSAALPSAALVSTVAAASVEEPHQGWLDEWREITDYI
FT                   NSYPDDDAYTELSPRLSELERLLVETPANTPQGILAKIDYTIEDYGEYFFGCIANDMDR
FT                   KMLASIRDAVSLMVAAV"
FT   gene            236390..236908
FT                   /locus_tag="Jann_0243"
FT   CDS_pept        236390..236908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53160"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV2"
FT                   /protein_id="ABD53160.1"
FT                   /translation="MGSPMNTYHRNRNWSDQFLPDIKRIVGSHLLETAPDALDWHEATD
FT                   LVMMDARDIRVAARVRRPGFAQRYPNQFTVRASTRNGGPSELQKIVNGHGDWMFYGHAA
FT                   PTGGIALWQLIDLRAFRAALIRHGNGGPQVLWGDKTNPDGTSFRWFDARSFPAYPPLVV
FT                   ARSTRMAAQ"
FT   gene            complement(236994..237080)
FT                   /locus_tag="Jann_R0002"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(236994..237080)
FT                   /locus_tag="Jann_R0002"
FT                   /product="tRNA-Leu"
FT   gene            complement(237122..240742)
FT                   /locus_tag="Jann_0244"
FT   CDS_pept        complement(237122..240742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0244"
FT                   /product="protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53161"
FT                   /db_xref="GOA:Q28VV1"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV1"
FT                   /protein_id="ABD53161.1"
FT                   /translation="MIRFLLILALSLCPIAAAAQDDGTTLSRLLEDQLSDGDDRQVSIT
FT                   GFRGALSSEATLERMTISDADGVWLVLEDAVLDWTRSALLRGELRVDELTAARLEVIRP
FT                   PLPVEGVDLADTEAQPFSLPDLPVRVEIGRIAVEEVVLGEPIIGLPASLSVEGSVRLAG
FT                   GAGEALITLDRLDGPAGQFVLDATYDNATRNLDLSLLLEEADGGLAAELLGLPGRPDVR
FT                   LAVAGSGPVSEFTTEITLATGGQDRLAGQVITSVSDAGDQLVTVDIGGDITPLLLPDYR
FT                   AFFGDDVQLQAQVRQTPAGETSLEALRLASAALTLNGNVTLDARGLPMQVSLEGAITPP
FT                   GADASVQLPAGGVEARLARAGLNVTFDRAEGDAYRLSLDLEQLAIDDLTVAETTLDLQG
FT                   AVAITSAGVDAATAEISGQMSGLEHTDPALAQALGQRLNLGAMMSWVNGAPVILSDLSV
FT                   EAGDVTLTGGASAQSGEGALNVVLDLAARAGDLTRFATLAGQPLDGSVDLAISGTAEAL
FT                   SGAFDLSIDGLGRNLRVADAVPDQIFAGQTELSAQVTRDTEGLRLQDLRLENAELNFTA
FT                   DAALSSGDTSATTRFQLQNVGLFTDILSGPVTISADVARTGTAPFDITANLTGPNAIRA
FT                   DINGVFDAETAGFDLDLDASAEDLNLGDAVPRPLLAGRTTISATAAREGEVLTLTDLSV
FT                   SNRELNLTGNASVGPETSSADISARLANVGLFTDALSGPVSIDANATRDGDDPWQISAG
FT                   LGGPGGMTAAVNGRVGLPDGSLDVTATGRAPLALANRYIAPRSIRGTLGFNLALRGQPG
FT                   LGALSGTLNTTDARVSAPTIATAIENLGISGQLSGGRLSINANGNLSSGGDLSANGSIN
FT                   LASPGMDGQIAIGLRNARLVDPTLYEAQITTADLTISGALARGPQISGTINLGESEIRV
FT                   PEASLSGSAAIPNIRYVNETREERLTRQFAGLLGRNTGGGGGSATTGLDITINAPGRIY
FT                   LRGRGIDAEFGGSVRLFGTTANMIPTGQFNLVRGRLSILGTRLDFTEGSATLQGSFDPF
FT                   LRLEATSRASGYVITIAVEGAASDPEVRFSSSPPLPEDEVLAQLLFGRSVSGLSPLQLL
FT                   QLADAATSLAGGSTNSGFIAGLRDGLGLDDLDLSTDAEGNAAVTAGRYLSENIYTDVTI
FT                   NAEGDADLSLNIDLTPNITARGSVGSDGGSSIGIFFEQDY"
FT   gene            complement(240739..242535)
FT                   /locus_tag="Jann_0245"
FT   CDS_pept        complement(240739..242535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0245"
FT                   /product="surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53162"
FT                   /db_xref="GOA:Q28VV0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VV0"
FT                   /protein_id="ABD53162.1"
FT                   /translation="MGGRQIIASALVACALAGAGQAQDIQLSAPGVDEDLTDRLRASSL
FT                   LLQETEEVRTAQDLIAAARADYGRLVAALYDAGHFSPVVRIDVDGREAARIPPFGGPRS
FT                   VNQITIRVEPGPVFQLGTAEIAPLAPDTELPGEFRPGGAVTTGLLRDTASAAIGAWRDN
FT                   GYATAEVSDQQITARNGDAVLDVRVRVEPGQIVQFGTLVPRGQERMRVERILAIAGLPQ
FT                   GETFSPDTLDRVEGRLQDTGVFSAIALQEGDVGPDGVMNIEATLVESEPRRFGFGAEVS
FT                   TDDGASLSAYWLHRNLFGGAERLRIEGEISGIGSEGLNVEDVEGIDASVGLRYSRPATF
FT                   TPDTTAYLELGLNYFDDPAFTFTNVGAEVGVEHRFDRRLTGTLGLAVDYYDIQTPFGND
FT                   QIIVLSTPLGMTWDRRDDPLDARELFYLNGTATPFITDQGGAGSRVYVDGRVYLGFGET
FT                   RASRIAVRGQLGSVFGGELSDIPPDFLFFSGGVGTVRGQEYQSLGAIQNGIDDGGRSFA
FT                   GLSTEFRQDIGETNFGLVAFADAGFIGTDATGGEGDWHAGAGLGVRYDTPFGPIRVDLA
FT                   TPVRGEGVGEDVYIYIGIGHAF"
FT   gene            242686..243669
FT                   /locus_tag="Jann_0246"
FT   CDS_pept        242686..243669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0246"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53163"
FT                   /db_xref="GOA:Q28VU9"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU9"
FT                   /protein_id="ABD53163.1"
FT                   /translation="MAKLVTIFGGSGFVGRYIARRMAKDGWRVRVAVRRPNEALFVKPY
FT                   GVVGQVEPILANIRDDDSVRAAIRASDAVVNCVGTFDVAGKNNFQAVQNEGAARIARIA
FT                   AEEGVGRFVHMSAIGADVEGRSLYAKSKGQGEAAVLDAFPTAMILRPSVIFGPEDNFFN
FT                   RFAGMTRLSPVLPVAGADTRFQPVYVDDVAQAAQLGVKGEAHGIYELGGPDAETFRQLM
FT                   QRMLGVIRRRRLIVNIPFVVANIMGFSFDLLSKLTGGLFHNGILTRDQVRSLRSDNVVS
FT                   DDAQTLADLGIQATAMEAVLEDYLWPYRPSGQFSNIKESAKNLRES"
FT   gene            complement(243673..244476)
FT                   /locus_tag="Jann_0247"
FT   CDS_pept        complement(243673..244476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0247"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53164"
FT                   /db_xref="GOA:Q28VU8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VU8"
FT                   /protein_id="ABD53164.1"
FT                   /translation="MSLFTLFLLALVQGITEFLPISSSGHLILLPNLLGIEDQGQAIDV
FT                   AVHVGTLGAVILYFWRDVKAAIAGTPRLLTGRIDTPGAKLAFLLIIATIPVIIFGLFLE
FT                   VTGIYDSLRSIAVIGWTMLIFGLVLYWADQRGGTEKQSDDWSLRDAVTMGLWQAVALIP
FT                   GTSRSGITITAARFLGYDRESAARVAMLMSIPTIIATGVFAGAEVIATADAQTARDGAI
FT                   AAALSFLAALAALTLMFRLLKSVSFTPYVIYRVILGVILLVIAYA"
FT   gene            244681..246117
FT                   /locus_tag="Jann_0248"
FT   CDS_pept        244681..246117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0248"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53165"
FT                   /db_xref="GOA:Q28VU7"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU7"
FT                   /protein_id="ABD53165.1"
FT                   /translation="MAKQPMLKFVTVGKEMPQKREADQRKEDFAEIYGEYVTAKAEEQA
FT                   GRCSQCGVPYCQSHCPLHNNIPDWLKLTAEGRLREAYDLSQATNTFPEICGRICPQDRL
FT                   CEGNCVIEQSGHGTVTIGSVEKYITDTAWDNGWVMPIAPHTERPESVGIIGAGPGGLAA
FT                   ADMLRRAGLQVTVYDRYDRAGGLMVYGIPGFKLEKDVVMRRNKQLEDGGVEFVLNCNVG
FT                   EDISLTDIREKHDFVVIATGVYKSRELDGPGSGSDGIIRAIDYLTASNRKSFGDDVPEF
FT                   DSGELDAKGKRIVVIGGGDTAMDCVRTATRQGATSVKCLYRRDEVNMPGSMREVQNAKE
FT                   EGVEFVWLSAPKGFSDAKGAVDGVMVQKMRLGAPDATGRQSPEVIENADYVEGADMVIK
FT                   ALGFSPEDLPMLWDTPELEITRWGTVKANRTHETALPNVFAVGDIVRGASLVVWAIRDG
FT                   REAAEAILERVYATGTVAAE"
FT   gene            246271..247005
FT                   /locus_tag="Jann_0249"
FT   CDS_pept        246271..247005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53166"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU6"
FT                   /protein_id="ABD53166.1"
FT                   /translation="MCVIRKQLVTAVLGSAILCNTPVSVLAQNVNVFPVPDGCTAFLTV
FT                   QSRSCTVSHLWRCDADPAGTHWRVALDQEGAFYLSYTDSEYRWLRSFNLRNGATNTLME
FT                   PEDDPASLSELLETGRDTMVFSIRDVRPEGAFRRDYTGYDSLTGASVTVDGEELLVTDF
FT                   AYQWQTEAGPRVTEGSQFVSRRLGVFFSGLETVTTPSGETLEFNGSPMEFAEPGEPGFL
FT                   TTQPQYDCGDMMSGLPIMEDAG"
FT   gene            247002..247460
FT                   /locus_tag="Jann_0250"
FT   CDS_pept        247002..247460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0250"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53167"
FT                   /db_xref="GOA:Q28VU5"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU5"
FT                   /protein_id="ABD53167.1"
FT                   /translation="MSIADPYRTSGVLHGQCLCKAVQITVDGDYIAAIGICHCLMCQRS
FT                   NGVVFGAFEAAPGTVTATGPVQTYASSSFAERTFCGTCGSALWLRDTGPEPAGYELMPG
FT                   LFPDAHDFPLISEIYHDKAPAYLPFSGDHRRGTQAQYESKNAHIEGDI"
FT   gene            247460..251995
FT                   /locus_tag="Jann_0251"
FT   CDS_pept        247460..251995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0251"
FT                   /product="glutamate synthase (NADPH) large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53168"
FT                   /db_xref="GOA:Q28VU4"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU4"
FT                   /protein_id="ABD53168.1"
FT                   /translation="MTQFDTAWAKAEQAKREWMEQNGMFREEDEHSSCGVGLVVAVDGK
FT                   PQRSVVEAGIAALKAIWHRGAVDADGKTGDGAGIHVQIPYKFFGEQVKRTGHEMRDELL
FT                   AVGQVFLPRSDFGAQEVCRTIVESEVLRMGHYIYGWRHVPVEVACLGEKANATRPEIEQ
FT                   IIISNAKGVDEETFERELYVIRRRIEKAALSAGVRELYLCSLSCRSIVYKGMMLAEQVA
FT                   EFYPDLQDERFESAFAIYHQRYSTNTFPQWWLAQPFRMLAHNGEINTLKGNLNWMKSHE
FT                   IRMASGFFGEMAEDIKPIVAGGSSDSAALDAVFEVMVRAGRSAPMAKTMLVPEAWSQTA
FT                   TELPKPWLDMYSYCNSVMEPWDGPAALAMTDGRWVCAGLDRSGLRPMRYVVTGDGLLIA
FT                   GSETGMVPVDEASVVEKGALGPGQMIAVDMQEQALFHDAEIKDALAASRDFGDWVGKIT
FT                   DLEAETRGETEKALFSAGELRKRQVAAGYSIEELEQILAPMAEDAKEALASMGDDTPSA
FT                   VLSSQYRPLSHYFRQNFSQVTNPPIDSLREYRVMSLKTRFGNLKNVLDEDSSQTEILVL
FT                   NSPFVANAQFDKMVSYFHDSVVEIDCTFEAGGEKASLRGGLERIRDEAEDAVRSGAGHI
FT                   VLTDQGQGEGRVAMPMILATSAVHSGLTAKGLRTFCSLNVRSAECIDPHYFAVLVGCGA
FT                   TTVNAYLAQDSIADRIDRGLIEGTLTEAMTRYRNAIDAGLLKIMAKMGISVISSYRGGL
FT                   NFEAVGLSRAMVAEYFPGMLSRISGIGVSGLQQQVEEVHAKGWLRGESVLPIGGFYKAR
FT                   RSGETHAWQATTMHMMQEACNRASFGLWKQYSAAMRKNPPIHIRDLMDIKPMGAPVPID
FT                   EVESVTAIRKRFVTPGMSLGALSPEAHKTLNVAMNRIGARSDSGEGGEDPAHFVPEPNG
FT                   DNPSAKIKQVASGRFGVTAEYLNQCEELEIKVAQGAKPGEGGQLPGMKVTDLIARLRHS
FT                   TPGVMLISPPPHHDIYSIEDLAQLIYDLKQINPRCKVTVKLVASSGVGTIAAGVAKAKA
FT                   DVILISGHNGGTGASPATSIKYAGLPWEMGLTEAHQVLAMNNLRERITLRTDGGLRTGR
FT                   DIVMAAMMGAEEYGIGTAALIAMGCIMVRQCQSNTCPVGVCTQDEELRDKFTGNADKVV
FT                   NLITFYAEEVREILASIGARSLDEVIGRADLLSQVSRGAAHLDDLDLNPMLITVDGADR
FT                   IVYDRNKPRNEVPDTLDAQIVQDARRFLEDGEKMQLSYAVQNTLRTIGTRTSSHIVKNF
FT                   GMRNDLQPDHLTVKLKGSAGQSLGAFAAPGLKLEVSGDSNDYVGKGLSGGTIVVRPPMA
FT                   SPLEASDNVIIGNTVLYGATDGYLFAAGRAGERFAVRNSGAKTVIEGCGSNGCEYMTGG
FT                   VVVILGGISANFGAGMTGGMAYLYDPDGEAQANMNMETLVTCPVTIEHWEAQLRGLIER
FT                   HFEETGSMRARDILQHWDVERANFVQICPKEMLDKIPVGLGNEETAVPAE"
FT   gene            complement(252225..253100)
FT                   /locus_tag="Jann_0252"
FT   CDS_pept        complement(252225..253100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0252"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53169"
FT                   /db_xref="GOA:Q28VU3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU3"
FT                   /protein_id="ABD53169.1"
FT                   /translation="MFTVTLMTNHAMYLDGSLVTNLVKAMNAEAPRWLDPNHCAEFDTP
FT                   KIPKNIQTVWESLSAEGVDLVWQKAGDRKKRMLLADMDSTMIQQECIDELADEAGVGKR
FT                   VADITARAMNGELEFEDALLERVGLLKGLSEATIATVLEKRITLMPGGDVLLATMKANG
FT                   AHCALVSGGFTAFTSAIAAKLGFDEHHANTLLAENGALTGDVARPILGRDAKVDALTRI
FT                   TKTLGIKPKDVLAVGDGANDLGMLHLAGTGVALHAKPAVQEQAKHRVNHANLTALLFIQ
FT                   GYAKADFVTP"
FT   gene            253176..254657
FT                   /locus_tag="Jann_0253"
FT   CDS_pept        253176..254657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53170"
FT                   /db_xref="GOA:Q28VU2"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU2"
FT                   /protein_id="ABD53170.1"
FT                   /translation="MWRVMKQWIFASVAMLALVLGIVVQERARLGVEVRHDHVGTTPVT
FT                   VTQTPGAEGPVVVIVHGFAGSRQMMSAWSLSFARAGYIAVALDLEGHGRNPVPMSGDLT
FT                   SLDGTTRILLEEISRVTDWALDLPGADGRVALVGHSMSSDLVVRAGINDPRVEAVVGLS
FT                   VFSRAVTPDEPANLLILNGAWEGALRAEAQRVMAELGAVEGETVGAPGEDFARRAVAVP
FT                   LAEHVSILFAVGGLQEAVDWLGATFDRNGAQVPRLGWALLVMLAGAVMLARPFAGVLPT
FT                   GAPPEALPRRVFWALALVPALVVPPVAVMMDVGALPVLVADYLAVHLALYGTLVIGGAL
FT                   VAGWRPEARGWIWGLALAVFGIGLFGMLLDRYAASFIPHPGRVVIILAIVPGAILAMWA
FT                   DAVLTQATRAKLWQRAVVRGAFLGSLAFAVALDFERLFFLVLIFPVILLFYGTFGMMGR
FT                   WVGRRTGSTLAVGVGLGALLGWALGVSFPMYVMGG"
FT   gene            complement(254752..255276)
FT                   /locus_tag="Jann_0254"
FT   CDS_pept        complement(254752..255276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0254"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53171"
FT                   /db_xref="GOA:Q28VU1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024624"
FT                   /db_xref="PDB:2OU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU1"
FT                   /protein_id="ABD53171.1"
FT                   /translation="MSDTVLTGLLDTVWQQFGRGTKDRHHPARHPTLATIGTDGPDLRT
FT                   LVLRAASHAEATLEFHTDAASPKVAHIRRDARVAIHIWIPKASLQVRAKAIAKILPGDP
FT                   NLFAQLPEAARMNYQGPVPGTPLPAEPDATPNRFTRLICHLSEIDVLHLTTPHQRAVYT
FT                   APDWRGIWVSP"
FT   gene            complement(255269..256321)
FT                   /locus_tag="Jann_0255"
FT   CDS_pept        complement(255269..256321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53172"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VU0"
FT                   /protein_id="ABD53172.1"
FT                   /translation="MIRLLFASLLAASPIHAQGFAGLGTVADGFAVPAPNPTFSFPDDH
FT                   GPHPDYRIEWWYLTATLTGADGIDYGIQWTLFRSALAPTTSTDWTAPQIFMGHAGLTTP
FT                   DAHFSAERLARGGIGQAGVTPVPFRAFIDDWEMTSTTAEGDAYDALSLTARGVDFAYDL
FT                   ALQANGPLIFHGQNGFSVKSAEGQASYYYSQPFYTVTGTLTLPTGAVEVSGNAWLDREW
FT                   SSQPLSDDQSGWDWFSLQLPDGARLMAFALRDTSDQPFTSATYIAPDGTTQAYGDGAIT
FT                   LTPLVTTDVGGRDVPTEWRLQFPDRGIDITTQPLNPQSWMDTSFPYWEGPITFTGTHDG
FT                   RGYLEMTGYE"
FT   gene            complement(256321..258702)
FT                   /locus_tag="Jann_0256"
FT   CDS_pept        complement(256321..258702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0256"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53173"
FT                   /db_xref="GOA:Q28VT9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT9"
FT                   /protein_id="ABD53173.1"
FT                   /translation="MLYTALSSLMSHWRRHPGQGAMLALGLALATALWSGVQAINAEAR
FT                   AAYDRAAATLGQDQVSRLERADGQPIDVAEYLALRAAGYLVSPVISGEVRDENGRLRIL
FT                   GIDPLTTPAEAAGPALDGDLDLAAFFTDPGLLLVTEETANGPLPTDLPPLQIAETVPPA
FT                   AAITDISTAARLLGQEGPSYLLVANTQPMGLPPISEATSLSLRAPETANDIARLTDSFH
FT                   LNLTAFGLLSFGVGLFIVHAAIGLAFEQRRAIVRTLRALGTPLRVILLALSLELAVIAL
FT                   IAGIIGVAMGYVIAASLMPGVAGTLRGLYGAEIEGVLRFSPYWALSGLCITFVGTGAAA
FT                   VQAMIRTARMPLLAPAMPRAWAQASGRMIRLQAFVALGLFALSGVLAVAGQGLIAAFGC
FT                   LACLLVGAALALPAVMSGVLSLIRPKGAFAEWVVADTRQQIPGLSLALMALLLALSANI
FT                   GVSTMVGSFRTTFLGWLDQRLASELYVTAATPDDAAMLMEVLQPDVDAILPIVSTQIRL
FT                   FGQPADLFGVVDHATYRDAWPFLSSAPDPWGQIAQGDAILINEQLARREGLSIGDRAND
FT                   LPIVGIYSDYGNPNGQAIVSLTRLSETYPDVRPRRFAIRIAPDDAPALATRLRQNFGLP
FT                   TEAVTNQAQVKAFSIEVFDQTFRVTGALNILTLGVAGIALLTSLLTLANLRLPQLAPIW
FT                   AIGASRARLAWVEMARSLALAAITFLAALPVGLALAWILLALVNVEAFGWRLPMQVFPG
FT                   DWLILGLLALLAAGLAALGPTLRLARIPPARLTQVFAQER"
FT   gene            complement(258706..259374)
FT                   /locus_tag="Jann_0257"
FT   CDS_pept        complement(258706..259374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0257"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53174"
FT                   /db_xref="GOA:Q28VT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT8"
FT                   /protein_id="ABD53174.1"
FT                   /translation="MTAPLLSLRDIRKTYPSDSGPLRVLDGVSVTLDAGETLALTGESG
FT                   SGKSTLLHLSGGLDQPDGGEVVLDGQDIGRLDDAGRAAVRRTRIGLIFQQFNLVPSLSV
FT                   GANIALQARLAGQHDEGFALRLADRLGLSDLRNRYPEQLSGGQQQRVAIARALASKPAL
FT                   ILADEPTGNLDEETGDAVLRLLLELVEETGAGLLMVTHSPRLAERLSRRVHLSRGQLDG
FT                   "
FT   gene            259478..260248
FT                   /locus_tag="Jann_0258"
FT   CDS_pept        259478..260248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53175"
FT                   /db_xref="GOA:Q28VT7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT7"
FT                   /protein_id="ABD53175.1"
FT                   /translation="MQITDWDDAYANGAYIDGADEIVAGWAERAGEMVPDEVLPGVDLY
FT                   VPDGAVKGLTIVVHGGYWMAFSARDFAHLAKGPRAMGQAVAMINYTLAPHARIAEITQE
FT                   VARAVAVAAARIDGPIRLTGHSAGGHLVTRMVCAAVLPDEIAGRIVHVLSISGVHDLRP
FT                   LLRTQMNETLRLTQNEANAESPALLMPRINTRITCVVGAEERPEFRRQSALLASIWQGL
FT                   GADMRAVELPHVNHFTIIEGLERPDGALTQLLLS"
FT   gene            complement(260245..260679)
FT                   /locus_tag="Jann_0259"
FT   CDS_pept        complement(260245..260679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0259"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53176"
FT                   /db_xref="GOA:Q28VT6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT6"
FT                   /protein_id="ABD53176.1"
FT                   /translation="MKDQGHSFTFDLSEYLPFQMSVISAQMFGDVIEDAGLQMPEWRIM
FT                   MALPSNQPCSSHDLCILTAMDAARVSRAQRRLEDLNMISVIRDKADRRRLVVRLSDKGS
FT                   VEVSRLKSEAQAAESKMLDTLGPEDRAQLKTAIGSLFDNL"
FT   gene            261005..262174
FT                   /locus_tag="Jann_0260"
FT   CDS_pept        261005..262174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0260"
FT                   /product="phosphoserine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53177"
FT                   /db_xref="GOA:Q28VT5"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT5"
FT                   /protein_id="ABD53177.1"
FT                   /translation="MVTTPTATRPTLKPVATPANPRFSSGPCAKPPTWTPGVLADALLG
FT                   RSHRAAEGKAKLKLAIDKTAEILGVPDGYRVGIVPASDTGAVEMAMWSLLGARPCTMLA
FT                   WESFGAGWVTDAVKQLSLDATVTTADYGDLPDLTAVDWNTDVVFTWNGTTSGVRVPNGD
FT                   VIPADREGLTICDATSAAFAQDLPWDKLDVTTFSWQKVMGGEAAHGMIVLSPRAIERLE
FT                   SYTPAWPLPKIFRLTKGGKLIEGIFTGATINTPSMLCVEDYLFALDWAESIGGLPALHA
FT                   RADANANAIHTFCEARDWITNLANDPATRSNTSVCLKFTDARIHDGAAFAKAVAKRLAD
FT                   ENIALDIGAYRDAPAGLRIWCGATVETSDIDAMLPWLDWAFHLEIEAQA"
FT   gene            262262..263857
FT                   /locus_tag="Jann_0261"
FT   CDS_pept        262262..263857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0261"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53178"
FT                   /db_xref="GOA:Q28VT4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT4"
FT                   /protein_id="ABD53178.1"
FT                   /translation="MAPKVLVSDKLSETAVQIFRDRGIDVTFDPTIGKDKEKLLSVIDQ
FT                   YDGLAIRSATKVTEKIIAAATNLKVVGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITT
FT                   AEHAIAMMFAVARQIPEASTSTHDGKWEKSKFMGVELTAKTLGVIGAGNIGSIVISRAL
FT                   GLKMKVIAYDPFLSEERAKEIGCQKVELDELLKRADFITMHVPFTEKTANILSAENLAK
FT                   TKKGVRIVNCARGGLVDEAALAELLKSGHVAGAAFDVFAQEPATENPLFHLPNVVVTPH
FT                   LGAATTEAQENVALQVAEQMSDFLLSGAVSNALNMPSVTAEEAAIMGPWVKLAEHLGAF
FT                   VGQLTEEPIQSIDVVYNGVVTGMNLKALDCAAIAGVMKATNPDVNMVSAPVIAKERGID
FT                   LSQTTQDKTGVFDGYIRLVVKTDKRERSIAGTVFSDGKPRFIQIKGINIDAEIGEHMLY
FT                   TTNHDIPGIIGTLGQTMGENGVNIANFTLGRSGRDGEAIALLYLDEQPPADVLGKLMET
FT                   GLFESVKPLQFAAA"
FT   gene            263930..265105
FT                   /locus_tag="Jann_0262"
FT   CDS_pept        263930..265105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0262"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53179"
FT                   /db_xref="GOA:Q28VT3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT3"
FT                   /protein_id="ABD53179.1"
FT                   /translation="MDDIVILSGARTAIGTFGGSLAGTAPIETGTIVAKAALERAEVEG
FT                   GQIGHVVFGHVINTEPRDMYLSRVAAMQAGVPETVPAMNVNRLCGSGAQAIVSVIQSLA
FT                   MGDADFGLAGGAESMSRSPYISSATRFGQKMGDVKTLDMMLGALNCPFGTGHMGVTAEN
FT                   VAVEHDVTRAQMDAFAMASQERAAHAIEQGYFAEQIVPVDVRVKRDMMPFEVDEHPKAT
FT                   SVDALGGLRAVFKKDGRVTAGNASGINDGAAALVLARADAAEAAGLPPRARILGYAHAG
FT                   VRPEVMGIGPVPAVENLLSKTGLSVRDFDVIESNEAFAAQALAVNKGLGLDSAKVNPNG
FT                   GAIALGHPVGATGAIITVKALYELERTGGKRALITMCIGGGQGIALAIERL"
FT   gene            complement(265121..267160)
FT                   /locus_tag="Jann_0263"
FT   CDS_pept        complement(265121..267160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0263"
FT                   /product="Penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53180"
FT                   /db_xref="GOA:Q28VT2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT2"
FT                   /protein_id="ABD53180.1"
FT                   /translation="MIRRIAATLGLLVTALLFGAALWLNTWINETELPPLTLETGVEVL
FT                   DRDGDLLRAYTVENGRWRLPVSYDAVDPGYIEMLVAYEDRRFWTHPGVDLRAFARAAWQ
FT                   RVTTGRVISGGSTLTMQVARLLEDSGTGEWGGKIRQIRLALALERQLSKQEILTLYLHL
FT                   APFGGNIEGVRAATLTWFGTEPHRLTAAQSALLVALPQAPNSRRPDRFPDAAEIARNRV
FT                   LSRAVTFTELTEEQIAWAREEPIPTTRRDFPALAPHLADRAIVERPTQGTHHLTLDVDL
FT                   QRQMERLTSRAISQLGPQMSAAIMVMDHETGALLASVGSPDYTDTTREGFVDMTQAVRS
FT                   PGSTLKPLIYGLAFDAGVLHPQTLIQDRPISISGYAPQNFDSVFRGEVTAAQALQLSLN
FT                   IPAVTLLNDVGPHHMLAAMGRAGMEVSLPEGEEPGLAIALGGLGTTMEDLLGLYAGIAR
FT                   GGIATPPHWRQGEGAEGQRILSETAAWYLGDILGDVAPPPNAPRIGLSYKTGTSYGHRD
FT                   AWAFGFDGQHVVGIWMGRADGASVPGAFGAALSAPLLFEAFSRIDEHTTPRAAPPPGAL
FT                   TLATAQLPGPLQHFDPGADLADAGGPAITFPPEGAVLAYQPGLPIMARVAEGTPPFTWL
FT                   WNGAPVATGWHDREIALEADLGFGELTVIDATGLAESRAVEVSN"
FT   gene            complement(267157..272568)
FT                   /locus_tag="Jann_0264"
FT   CDS_pept        complement(267157..272568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0264"
FT                   /product="alpha-2-macroglobulin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53181"
FT                   /db_xref="GOA:Q28VT1"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT1"
FT                   /protein_id="ABD53181.1"
FT                   /translation="MTRVLAFSIGVFICLGLPLSAQNLLPDRTTQIIRDTDLPGGDLRP
FT                   IFETTLTACNAACQADPDCNAFTFNGVNNTCFPKTASGDPVPYSGALSGLVRTTPDAAH
FT                   ALAENRRQQLPFLNDADFAEALDQARTLGLVHYAGLFPVDDWRLSARNAFDEDNVVGAM
FT                   RRMGAAITVDDDGDDWRAYASYLLAIETDNSGERRQFERRALSAAINAALRATDSADLA
FT                   NALDLIADALERRGRGRDTIPALRLALAESPLQARDDALDRVLGLYGFRVTDTRVDVEA
FT                   DFPRICAEFSEPLAAGGVIYDDFLQTTLSDLAVEADGRQLCLSGVRHGERYEFTLRAGL
FT                   PAASGEVLHAPITLRQYVRDRAPSVRFAGRAYILPASEGGTIPVVGVNTDLIDLALFHV
FT                   ADRNILRTLQEDYFGRPLAEWQVDRFAEEIGEAVWQGEAEIAVAQNQSVTTRVPVGEVL
FT                   EGRAPGLYALEARVGGAGTSEGGATQWFLVSDLGLTAMSGADGVHVFVRSLATTEAHAG
FT                   TSVDLISESNRVLATLETDSEGYAHFPAAIAAGEQGAAPALLTARQGDMDLAFLSLRDA
FT                   EFDLSDRGVEGRAPAGPIDVFLTTDRGIYRAGNTIHLTALARDPQAHAITDLPLTAILT
FT                   RPDGVEFTRLLLDESGAGGFVASLPLGVDVPRGTWRLGIHADPDAPPLREVRLLVEDFL
FT                   PERLDLEIELNADAEMASFQADYLFGAPAADLPITGRLALRPLSTLPDYPGFRFGRHDA
FT                   PPEPAFESMETLMTDADGAASVGLRLPTFDGVSHPGQLTLTAQITEGSGRPVERAATAT
FT                   ILPDAPLIGIRPLFDGTLPEGVEAPFHLITIGTDPMPVRWTLNRVERRYQWYRQSGNWT
FT                   WEPVTTRQQIAIGEATLTDEPTSLDLPIEWGTFELRVESDAGGFAVSSVGFSAGWYGAS
FT                   DGTDTPDALEVSLDADAYRPGDTATLRIVPRTGGLALVQVVTDRLIDQQIVQLGDDPQD
FT                   ITLPVTDEWGAGAYVTATLIRPLETASGPVPTRAIGLAHAAVAPGLRALEAALEVPDTM
FT                   RPRGPMDVALRVDGALPGETVYATIAAVDLGILNLTGFDSPDPQGHYFGQRRLGMAFRD
FT                   IYGRLIDSRDGAEGRVRQGGDAGAGLRMQADPTSEDLVALFSGPLTVGADGYARTSFDM
FT                   PAFNGTIRVMATAWSDTGIGQAEADVIVRDPVVIAASAPRFLAPGDTSSLLLEITHTEG
FT                   PTGEMALAIGTTPEISMFGQIVPSVTLAEGESTRLRIPFVTADRTGLADITVTLTTPDG
FT                   IDIIQTLTIPVQSNDPEVAETTRLTLAPGESFTIDATAFTGFHPQGTRAILSAGPLARY
FT                   DVAGLLQRLDRYPYGCTEQTASRALPLLYLSSVAEALDLGTAEDLNIRIEGAIASVLTN
FT                   QSANGGFGLWRASSGDLWLDAYVTDFLSRARAEGHSVPDIPFQNALDNLANAVASHPDF
FT                   ENGGQGLAYALMVLAREGQASMGDLRYYADVKAPEFATALALGQLGAALAMYGDQQRAD
FT                   AMFIAGFARLTLAGLSEEPRSWRVDYGSHTRDAAGLIALAANAGSQTINLPAYVADITP
FT                   NVADASTQEAVWALLAAHALIDNPSADGLMLDGAPVTGPYVRVLDDAQSQARVLENTGD
FT                   RDEVVTLTRFGRPDGPTDAFGNGYRIDREYLTLDGDPVDPTQVTQGTRLVTVLTIRNTG
FT                   APEGRLMIDDPLPAGFEIDNPNLLQSGDIRALDGVDLRTSPEMSEFRAERFLSAVNMRG
FT                   AADQIRMAYIVRAVSPGEFHHPAAMVEDMYRPTYRAQTASGRISVVE"
FT   gene            272732..274882
FT                   /locus_tag="Jann_0265"
FT   CDS_pept        272732..274882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0265"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53182"
FT                   /db_xref="GOA:Q28VT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VT0"
FT                   /protein_id="ABD53182.1"
FT                   /translation="MAAINLNDRMAQERRARLQAEQLLALRSEELYSANRKLAEHATAL
FT                   STQVIEQREENELLKGKTQKTEVELEVVTERALMAQRRLWDALTATEDGFAIFDRDWRL
FT                   VAANPAFFLIFDGISDVTEGATYEAILRVATEEGIVDLQGQNADDWVEEMVARWEKVPI
FT                   PNVDVKLWNGAYIRLNDKQTPQGDFVSLSVDITPNIRRERELSEARDAAEAANRAKSHF
FT                   LANMSHEIRTPMNGVVSMAELLRDTALDEEQQMYADTIRSSGEALLVIINDILDFSKIE
FT                   AGKLELHEETFDLNAMVGEIFRLIQPGIASKDLELRLDYDIFLPPLLIGDRGRMRQILT
FT                   NLIGNAVKFTEKGHVTVRVLSVPPMDQPDALGISIVVEDSGVGIAPDQQEHVFGEFNQV
FT                   EDEANRRHDGTGLGLAITKRLISLMGGKMWLESEVGRGSAFGFTISMKVDPDCGSGPVA
FT                   GLPAGQSRVLLIGHGEGRSEPLFDALGRLHAETTQIRRVPNPQDLAETVGVILCDPAMD
FT                   VAGIAASLTEADFNGARLAWLGRSELPDGFEVCALDQGLAALRAQLLMPAPDTLHPAEL
FT                   ASPPPPEPEEEPAALPRLLAAEDNKTNQMVFKAMLKGLRLNLEITNNGLELVEAYKREV
FT                   PDLVMTDISMPEMDGLEAAAKIRAYEEEQGLPRVTIIAMTAHAVEGDRERILAAGLDDY
FT                   VTKPLKKALIHEKIADGLPSDS"
FT   gene            complement(274871..275878)
FT                   /locus_tag="Jann_0266"
FT   CDS_pept        complement(274871..275878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0266"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53183"
FT                   /db_xref="GOA:Q28VS9"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS9"
FT                   /protein_id="ABD53183.1"
FT                   /translation="MNTAEVLVEVHRGPILECKHRGHVAIWRHGEGLIAGLGATEDRIL
FT                   PRSSSKMIQALPLVESGAADAVSLTPEHLALACASHQGAAIHTDRVTGWLEHIGLGEAD
FT                   FRCGSQWPNDIPARDALICSHCGPDQRHNNCSGKHTGFLTYGKHVGAGPDYVDPAHPLQ
FT                   AAIMEAWDDVTEEPNPEYAIDGCSAPNFATRLSGLARAMAAFAAASPDGGSREAAMVRL
FT                   REAMMAHPDLVAGEGRACTRLMRTMGHRAAVKTGAEGVFIAIVPELKIGVALKIADGAT
FT                   RGSEAAIAHILGRLGVLDPNHPEAQAFTHGPIRNWNGIETGHYRIADALSGLRI"
FT   gene            276049..276576
FT                   /locus_tag="Jann_0267"
FT   CDS_pept        276049..276576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53184"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS8"
FT                   /protein_id="ABD53184.1"
FT                   /translation="MKTYLAGILAGAMALTATVALAQDESTNRVNAETDWSVFIEDDPT
FT                   QCWVVSTPSETVNTRDGRVVSVRRGEILMFVSFWPGQERLGEVSFTGGYPFADGSTVSM
FT                   EIGDSSFELFTEGEMAWAASPQDDDRIITAMKRGAEAVLTARSSRGTQTQDTFSLLGFT
FT                   AAVEDAEARCGN"
FT   gene            276582..277088
FT                   /locus_tag="Jann_0268"
FT   CDS_pept        276582..277088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53185"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS7"
FT                   /protein_id="ABD53185.1"
FT                   /translation="MGLKSRLLALCLCLAAPAVAQAQDALWPVYVQDNPTRCWIVSTPT
FT                   DTVASRDGQDVSDNISRDEVLLFVSFWPEDGRVGEISYTGGYQFAVGSTVSLVVGSLAV
FT                   EMFTEGPMSWAGSPEDDARIIAAMRDGSEVVVTATSTRGTEVADTFNPQGFALAMDDAQ
FT                   VRCAP"
FT   gene            277098..278330
FT                   /locus_tag="Jann_0269"
FT   CDS_pept        277098..278330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0269"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53186"
FT                   /db_xref="GOA:Q28VS6"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VS6"
FT                   /protein_id="ABD53186.1"
FT                   /translation="MDAWPPIWEANPRKSIVVMTATAPITQDVRTFPRKLPDGPVNLIG
FT                   LTRDGLRAALIEAGTPEKQAKMRTGQIWQWLYQKGVRDFASMTNLSKDYRAMLAETFVA
FT                   DVPEVVSRQVSADGTRKYLVRIAGGHEVEVVYIPEVDRGTLCISSQVGCTLTCSFCHTG
FT                   TQKLVRNLTAGEIIGQVMLARDDLDEWVPTGEGSDAKPRLVSNIVLMGMGEPLYNFENV
FT                   RDAMKIAMDPEGISLSRRRITLSTSGVVPEIAKTAQEIGCQLAVSFHATTDDVRDKLVP
FT                   INKRWPIADLLDALRDYPRVSNSERITFEYVMLKDVNDSDADARRLVQLIKGIPAKINL
FT                   IPFNEWPGAPYERSDWARIEAFADIIYKAGYASPIRTPRGEDIMAACGQLKSATERARK
FT                   SRKQIEAEAGL"
FT   gene            complement(278407..278592)
FT                   /locus_tag="Jann_0270"
FT   CDS_pept        complement(278407..278592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53187"
FT                   /db_xref="GOA:Q28VS5"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS5"
FT                   /protein_id="ABD53187.1"
FT                   /translation="MKKLALAAALSVVATGAFAGGYVAPTHVEPVVIVEDTGSSAGGIL
FT                   VPAIAVLLLVLALHHN"
FT   gene            complement(278797..279135)
FT                   /locus_tag="Jann_0271"
FT   CDS_pept        complement(278797..279135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53188"
FT                   /db_xref="GOA:Q28VS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS4"
FT                   /protein_id="ABD53188.1"
FT                   /translation="MTTYAVSNVRGIFRAIAIKPGCCLKKCTRYSLGCPNLRMMRERGV
FT                   SYEDITMKKLALAAALSVVATGAFAGGYVAPTHVEPVVIVEDTGSSAGGILVPAIAVLL
FT                   LVLALHHN"
FT   gene            complement(279277..279759)
FT                   /locus_tag="Jann_0272"
FT   CDS_pept        complement(279277..279759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0272"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53189"
FT                   /db_xref="GOA:Q28VS3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS3"
FT                   /protein_id="ABD53189.1"
FT                   /translation="MRFLLIAVLTLVALTGCSRFIDYDGPQVTRVLVYKGERMMYLMHN
FT                   NDVLESYEIELGFAPEGHKLEEGDGRTPEGEYMIDRRNPNSQWYLSIGISYPNEDDIAQ
FT                   ARERGVDPGGDIFIHGTPRPFRRDQDWTVGCIAVTNAEMRQIYAMVENGTPISIYP"
FT   gene            complement(279820..280668)
FT                   /locus_tag="Jann_0273"
FT   CDS_pept        complement(279820..280668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0273"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53190"
FT                   /db_xref="GOA:Q28VS2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS2"
FT                   /protein_id="ABD53190.1"
FT                   /translation="MNLLIFGYGFSSKALARALPQTWTITATTRTSEKAMNMRGAEPRL
FT                   FPGDDLSQDIADATHVLISAGPDDGHDPVLATYRDAFAKAKPEWVGYLSTTGVYGDHQG
FT                   GWVTEDTPLVPSTKRGEARVAAEAEWMALHQDHGLPVHIFRLAGIYGPGRGPFAKVRNG
FT                   TARRIIKEGQVFSRTHVDDIAQVLMASIARPNPGAAYNVCDDDPAPPQDVIAHAADLLG
FT                   LPIPEAIPFEDAEMTPMGRSFYAESKRVDNTRIKDELGVTLLYPDYRSGLAALLSAEKT
FT                   S"
FT   gene            complement(280665..281696)
FT                   /locus_tag="Jann_0274"
FT   CDS_pept        complement(280665..281696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0274"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53191"
FT                   /db_xref="GOA:Q28VS1"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS1"
FT                   /protein_id="ABD53191.1"
FT                   /translation="MTDLKDALRTEALDAGFAKMGVCSPNAVPETAARLKAFVDAGFHG
FT                   QMGWMAERMHWRGDASALWPEAKSVVMLAEPYTPDSDPLDALARKDRATISVYAQGRDY
FT                   HDLVKKRLKRVGRWLLAQCPGEQIKVFVDTAPVMEKPLAQAAGLGWQGKHTNLLARDLG
FT                   NWVFLGAIFTTVELPIDEPEAEHCGSCTACLDICPTNAFPAPFQLDARKCISYLTIEHK
FT                   GPVDLALRAKLGNRIYGCDDCLAVCPWNKFAQTARDIRYAPRDDLRSPLLADLAALDDA
FT                   GFRARFSGSPIKRIGRDRFVRNILYAIGNSGQAKLVDAARPLTDDPDVAVADAARWAME
FT                   RLL"
FT   gene            complement(281693..282358)
FT                   /locus_tag="Jann_0275"
FT   CDS_pept        complement(281693..282358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0275"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53192"
FT                   /db_xref="GOA:Q28VS0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VS0"
FT                   /protein_id="ABD53192.1"
FT                   /translation="MNRLYHFPLSPFCRKVRLILAEKRIEVELVEEKYWEPSTEFLRRN
FT                   PAGKVPILKIDGITLSDSTAICEYIEETVPEPALMPRDPAHRAEVRRLVAWFDDKFHAE
FT                   VTRNLVHERVHKKLMRSGYPDGRAVKAGAQNIKFHIRYMDWLLDHRRWLAGDKMTMADF
FT                   TAAAHLSCLDYISDVDWSLSEPVKDWYATIKSRPAFRSILADQIFGFPQPPHYANLDF"
FT   gene            complement(282413..283132)
FT                   /locus_tag="Jann_0276"
FT   CDS_pept        complement(282413..283132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0276"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53193"
FT                   /db_xref="GOA:Q28VR9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VR9"
FT                   /protein_id="ABD53193.1"
FT                   /translation="MAKRARKSKKNVSRARLLAQAMRRWLLRGMFGLGALMLVWIVAYA
FT                   VVPVPTTIYMQQERARLGGIERDWVPMDQIAPVLARSVVAAEDANFCLHWGFDMTAIRD
FT                   AIADGAARGGSTISQQTVKNAFLWHGRSWVRKALEAAITPVMELVWPKRRVLEVYLNVA
FT                   EFAPGVFGAEAGAQHHFGVSAADLTARQASLMAAVLPNPQRRDAGSPSDLVNRRARSIA
FT                   DGAALIRADGRADCFAN"
FT   gene            283248..284216
FT                   /locus_tag="Jann_0277"
FT   CDS_pept        283248..284216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0277"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53194"
FT                   /db_xref="GOA:Q28VR8"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR8"
FT                   /protein_id="ABD53194.1"
FT                   /translation="MTNGYDSGRLNLPFVGISTFGKYDYVQDWSRIDADVAILGAPFDF
FT                   GTQWRPGARFGPRAIREASTLFAFGHAGAYDHEDDVTYLGPGTKIIDMGDADIIHTQTE
FT                   ASHANIETGVRAALAAGAIPVTLGGDHSINIPCIRAFFDQAPIHIVQIDAHLDFVDERH
FT                   GVRYGHGNPMRRAAEQSYVTGLSQFGIRNVSSTAKEGYDDARRFGSDIQSVRQIRAMGA
FT                   EAAAARVPEGVNLYVTIDIDGFDPSIASGTGTPSHGGFLYYEVLEFLAILAKRNCIVGV
FT                   DLVEVAPDYDRDGTTAILAAQVLLNLIGRILHAKALSADQV"
FT   gene            complement(284199..285170)
FT                   /locus_tag="Jann_0278"
FT   CDS_pept        complement(284199..285170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0278"
FT                   /product="putative DNA topoisomerase I protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53195"
FT                   /db_xref="GOA:Q28VR7"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR7"
FT                   /protein_id="ABD53195.1"
FT                   /translation="MLPDGLIYYPDSQPGISRRRCGRGFSYRAPDGTTIADTDMRRRID
FT                   ALAVPPAYNHVWISPRLNGHLQATGYDAATRKQYRYHPDWTRFRANRKFEDLPRFGHAL
FT                   PRLRAAIRTGLEAEPGSRDFVLAAVLGLIDRLSLRPGHPDYAEANGSFGATTLRSRHLL
FT                   ADEDGTRLRFLAKGGQKVSKTLRDKTLARALHKLDDLPGAPIATWLEGDEVRTVSPDML
FT                   ASFMADVTGEDGLTPKTFRTWNGSVAAMDVALSNDDLTISAMADAAAKRLNNTPTMARN
FT                   SYIHPEVIALSETEPDVRKILADATTPTRLRRSERALLNLIG"
FT   gene            complement(285210..285935)
FT                   /locus_tag="Jann_0279"
FT   CDS_pept        complement(285210..285935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0279"
FT                   /product="class II aldolase/adducin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53196"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR6"
FT                   /protein_id="ABD53196.1"
FT                   /translation="MDHAEARAEMAAAFRWTAREDMHEGVANHFSFAVNDGGTQFLINP
FT                   KHHFSTMKASDLWVLDADDPDSAEGDDAPDQTAWGLHGSLHRHVPHARCAMHVHSTYAT
FT                   VLASLADSRLPAIDQNSAIFHNRQVVDENYGGLALEDEGTRCARMFQDPSVRTMIMGNH
FT                   GVLFIGETVAETFMRMYYFERAARNYIIALSTGQALRRLSDEVAERTASQMEEDHGADD
FT                   DLLRGIRAVLDRDEPDYAN"
FT   gene            286144..287049
FT                   /locus_tag="Jann_0280"
FT   CDS_pept        286144..287049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0280"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53197"
FT                   /db_xref="GOA:Q28VR5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR5"
FT                   /protein_id="ABD53197.1"
FT                   /translation="MDRLTEMEAFATVVDQGGFTDAAKKMGISKSAVSKHVSSLEARLG
FT                   ARLLNRTTRRVSPTEIGLAYYDRARRVLNDAGEADALVTAMQSAPSGTLRVSIATDFGV
FT                   NHVSPILGEFLHAFPDITVNMVLNNRYVELISEGFDMAIRVGELEDSSLMARKICETQR
FT                   RMIAAPSYFEEYGRPERIDDLNEHKLLHYSNSSAGNVWKITAPSGELRQVRTAGWLTVN
FT                   DGQSLLNAAIGGLGIAYLPSFLYAEPLRQGLLVDAMPDLPTDVQGVYAVYPPGRYIQPK
FT                   VRSFIDYLVEAFRDKGPEDW"
FT   gene            complement(287215..288162)
FT                   /locus_tag="Jann_0281"
FT   CDS_pept        complement(287215..288162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0281"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53198"
FT                   /db_xref="GOA:Q28VR4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR4"
FT                   /protein_id="ABD53198.1"
FT                   /translation="MQRFGRTAMVCAAFICLPSAGQTFDLTFPAAAELVHISDPEGGQH
FT                   PIATGPWSATSGVPTQIASGDVQQFTWQVTGVDVTTAGLLMTLREQIEAQGYTVPFTCF
FT                   ASACGGFDFRHALPVGAAPEMHVDLGDFHYLTALSEDGDTRAALMISRGGAIGFVHLAL
FT                   IQPPSDPAPVIQSTRAPEPGVDDSPSPTDLIERLRTTGSAPLDDLQFETGASQLSGERY
FT                   GSLTALAAFLAEDPARSIVLVGHTDALGSLSGNIALSRSRALAVLQFLTGELGVDPAQV
FT                   EFQGIGFLSPRASNTTPEGREANRRVEVVLTTAE"
FT   gene            complement(288174..288911)
FT                   /locus_tag="Jann_0282"
FT   CDS_pept        complement(288174..288911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0282"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53199"
FT                   /db_xref="GOA:Q28VR3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR3"
FT                   /protein_id="ABD53199.1"
FT                   /translation="MNIADLFPVLQATWPAATSRTIGPFIVPAMDLGGNRVSAARLKNA
FT                   TARSVSEEELAAAQAAMAAQGRSPLFQVLDHQTPLSDMLDTQGYITRDPTDAMVIRARD
FT                   LAATPPPVTAFTIWPPLAIQTEIWDAGGIDAPRRAIMDRASGAKTSLFGRISDMPAGAA
FT                   YVGLHGDIAMLHALEVAPTARRKGLAAHMMRTAATWASDNGATWLSILVTQQNKGARRL
FT                   YTSLGLKPVGTYVYREDAGGQAR"
FT   gene            complement(288908..289636)
FT                   /locus_tag="Jann_0283"
FT   CDS_pept        complement(288908..289636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0283"
FT                   /product="molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53200"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR2"
FT                   /protein_id="ABD53200.1"
FT                   /translation="MPNPTAAMLVIGDEILSGRTRDSNMNHLAKALTDHGITLSEARMI
FT                   SDDHAVIARHVAELSGAYDHVFTSGGIGPTHDDITAEAVADALGAACGIRDDARAILQA
FT                   HYDKSGQELNAARLRMARVPDGAALIDNPISAAPGFTLGNVHVMAGVPKIFEAMLEGLL
FT                   PTLTGGAKMVSASLRVERGEGDIAGPLGDLAEANPDVSLGSYPFTQNGIHGSNVVARSQ
FT                   DKDAVARVMAALQQLFPEAT"
FT   gene            289723..290448
FT                   /locus_tag="Jann_0284"
FT   CDS_pept        289723..290448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0284"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53201"
FT                   /db_xref="GOA:Q28VR1"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VR1"
FT                   /protein_id="ABD53201.1"
FT                   /translation="MRFPTPLVPARLLRRYKRFLSDAVLEDGTEITAHCPNPGAMLGLK
FT                   DDGARIWLLPNDDPKKKLKYGWRLVELPDGHFAGIDAGLPNALVKEALAEGQIEALRGY
FT                   SSIRPEQKYGDENSRIDFLLSEPGRPDAFVEVKNCHLRRESDWAEFPDCVTDRGAKHLR
FT                   ELTKIARSGGRAVMLYVVQRTDCARFRLAPDLDPAYARAFDAARDAGVEVLCHGTDITP
FT                   EGITLTGPLPVDPSPQARD"
FT   gene            290667..291476
FT                   /locus_tag="Jann_0285"
FT   CDS_pept        290667..291476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0285"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53202"
FT                   /db_xref="GOA:Q28VR0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VR0"
FT                   /protein_id="ABD53202.1"
FT                   /translation="MDDFKGRLTKDGIRIHQIVDCAGMHRAGRLAADILDRVAPLVVPG
FT                   VTTGTLDAQIEAWVDEVGAKSATIGYRGYKHASCISINHVVCHGIPSDKKLKDGDIVNI
FT                   DVTVIVDGWFGDTSRMFVAGNLPRKAERLIQVTHDALFKGIEAVKPGKTFGDIGHAIQA
FT                   YVEAQRMSVVRDFCGHGLGQVFHAPPNVLHYGRPGTGPTLEEGMFFTIEPMVNLGRPET
FT                   KVLSDDWTAVTRDKSLSAQFEHSIGVTADGFEIFTLSPTGRFHPTYG"
FT   gene            291578..292351
FT                   /locus_tag="Jann_0286"
FT   CDS_pept        291578..292351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0286"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53203"
FT                   /db_xref="GOA:Q28VQ9"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ9"
FT                   /protein_id="ABD53203.1"
FT                   /translation="MSDQPAFTFDEASPEFVDATLVAPRKAGGPSKGAEAHRHKHRDRL
FT                   RQRFTDGGADAVPDYELLEMVLYGAILRGDTKPLAKRLIDRFGDLNRVLAAPVARLKEV
FT                   EGVGDKVVFQLKLIEATGHRMARAKVMQKPILSSWDALLAYCQTAMAHRDLEQFRVLYL
FT                   DRKNVLVADEAQADGTVDHVPVYPREVIKRALELNATALILVHNHPSGDPTPSEADVQM
FT                   TMAIRDAADVFNIAIHDHLVIGKARELSFRAEGYL"
FT   gene            complement(292391..293932)
FT                   /locus_tag="Jann_0287"
FT   CDS_pept        complement(292391..293932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0287"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53204"
FT                   /db_xref="GOA:Q28VQ8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ8"
FT                   /protein_id="ABD53204.1"
FT                   /translation="MPKHMRAVLGAALFSCLLAPAAAQDVELRSLDGSVELEGNLISYD
FT                   GAFYRLDTVYGALTVAADGVSCAGPGCPDLTTFVAEARIAGAATVAEGLLPELLAAFAE
FT                   SQGMALGVEDGPVYVLRRADGSPAARFAVTPGSTDDGFLALLNGEADIALTLREPSVGE
FT                   VAASEAASPDDPPLDDRVRVLALDALVPVVSSENPIDALSLPDLARLFSGEVTNWADLG
FT                   GPDAPIALHALAPGFGLSQAFATRVLLPSEAGLSAEMTRHESAEALAQAVARDAYAVGI
FT                   TARSGTGLAQALPLIGECGFPLSASVDAVKAEDYPLTAPVYMYLAPRRLPLLVRQFLAF
FT                   TETEVAERQVSDAGFVNQLLTRTPLALQGERLSNAIRAAGEDVDLQELQTVMEVLDSAE
FT                   RLSTTLRFNAGGADLDIQSRASVGRLAAAIERGTFDGRQLIFAGFSDGDGPSTVNARLS
FT                   LRRADVVRDAVMAAGVAALDRVELVTVGFGEAMPMACDDTDWGRAVNRRVEVWVD"
FT   gene            complement(293954..294967)
FT                   /locus_tag="Jann_0288"
FT   CDS_pept        complement(293954..294967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53205"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ7"
FT                   /protein_id="ABD53205.1"
FT                   /translation="MLNTLIIRAAAGCTVIIGGTLFAMESGWIAQSGPAQAADQAANGQ
FT                   SLISSSQPTGSMGPALPVIEENNVIVPLAEQSLAVEATIVPTSFNGPATTPAAPATGPT
FT                   DDVGGVSPLGLPCGINTTATAMPAAMVALDVTAPCRANAAVTITHSGLQIETSTDAVGL
FT                   LTLDIPAFETPAFFSVTFADGVEEAVLVSLPDLQDYDRIGLNWQGDMGLELHAMEFGAA
FT                   FGDAGHIWQDTPAGPEVAIAGDGGFLSVVETGDSFAQIYTLPRATLREGEQVRLSIDAP
FT                   VTLANCTRDVLARTLRTEAAGPVDVTELTFTAPPCDAVGDVLVLQNLLDDLRLASN"
FT   gene            complement(295104..297815)
FT                   /locus_tag="Jann_0289"
FT   CDS_pept        complement(295104..297815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0289"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53206"
FT                   /db_xref="GOA:Q28VQ6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VQ6"
FT                   /protein_id="ABD53206.1"
FT                   /translation="MLGLGSIAKKVFGSPNDRLVKSVRPIIAKINDMEPEFEALDDAGI
FT                   VAKTAELRNRALNGEKLDDLLPEAFANCREAAKRALGLRAFDVQLIGGLFLHRGNIAEM
FT                   KTGEGKTLVATFPAYLNGLTGEGVHVVTVNDYLAKRDSEWMGKVFTALGMTTGVVYPRQ
FT                   PDQEKRQAYACDVTYATNNELGFDYLRDNMRGSIAEMAQRGHNFAIVDEVDSILIDEAR
FT                   TPLIISGPTQDRSDLYMSIDKVIPLVQEHHYTLDEKTRQATFTDEGNDFLEETLSAEGI
FT                   LPEGQSLYDPESTTIVHHVTNALRAHKVFTKDKEYIVRDGEVVLVDEFTGRMMPGRRMS
FT                   EGLHQAIEAKEGCKIQPENVTLASVTFQNYFRLYGTLGGMTGTATTEAEEFADIYGLGV
FT                   VEIPTNRDIARIDDDDAVYRTGQEKYDAIVETIAEAHKKGQPVLVGTTSIEKSEMLGQL
FT                   LTKADLPHSILNARQHEQEAQIVADAGKLGAVTIATNMAGRGTDIKLGGNLEFQIMEAI
FT                   AADPDADPEEIRNRMEVEHATAEQAVKDAGGLYVLATERHESRRIDNQLRGRSGRQGDP
FT                   GRSSFFLSLEDDLMRIFGSERLDKMLNTLGMKEGEAIVHPWVNKSLERAQAKVEGRNFD
FT                   IRKQLLKFDDVMNDQRKVVFGQRRDIMGAEDIAEVAKDMRDQVIEDMVDTYMPPKTYAD
FT                   QWDVLGMKEAAQTTLGIDLPIEAWADEDGVDQEVATERLERAADEYMASKAAKFGPEQM
FT                   RNIEKQVLLQTIDQKWQEHLLTLEHLRSVVGFRGYAQRDPLNEYKTESFQLFESMLDGL
FT                   RTDVTEKLARIQPLTPEQQEQLMAQLRQQQAAAAGTEAVASAGGETGETAFPNAIPGFI
FT                   EDDPSTWGNPGRNDDCPCGSGKKFKHCHGRLA"
FT   gene            297976..298881
FT                   /locus_tag="Jann_0290"
FT   CDS_pept        297976..298881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0290"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53207"
FT                   /db_xref="GOA:Q28VQ5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ5"
FT                   /protein_id="ABD53207.1"
FT                   /translation="MIVNVRRPCPKGRCAPHKGNSLMKMLFASVAMAAALAAPAFADGH
FT                   DSAETVMATVNGHDITVGHLIAMRQMLPAEYQQLPDEVLFEGMLEQLIQQQVLADVAEA
FT                   NVTREMELLLENEQRALMAATYMDDIAMAELGEEELQAAYDEAYGEVEPTVEYNAAHIL
FT                   VEGEEDAQNLLTALGEGADFAELAAENSIGPSGPNGGALGWFTEGMMVPEFEAAVMELE
FT                   PGEVSSPVQTQFGWHVVLLNETREQAAPTLDDVRPELEETIRRGRVDARLEELMAEAEI
FT                   VRPETEVDPALIRNQDLIAE"
FT   gene            298909..300153
FT                   /locus_tag="Jann_0291"
FT   CDS_pept        298909..300153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0291"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53208"
FT                   /db_xref="GOA:Q28VQ4"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ4"
FT                   /protein_id="ABD53208.1"
FT                   /translation="MTETKTDGPAVSPLAPASFPDLPAIDGVRFAAGAVGIKKTGRVDV
FT                   MLAHIAPGATLAGVFTRSATRSAAVRDCQAKLAGLSGDEGLAIVVNSGNANTFTGKRGV
FT                   TDVDLIAQAASDALDLPASRVFTSSTGVIGEPLPAEKITAALPGLAADLSTQAEPAARA
FT                   IMTTDTFPKGAVARVDVDGTPVTIMGFAKGSGMIAPDMATMLAYIFTDAAIAPDALQQM
FT                   LSDCNARSFNAVTVDSDTSTSDTVLLAATSRAGNAPLTAPDAAFQAALLAVMQDLAHQI
FT                   VRDGEGATKFVEVRVTGAETDADATRVARSIANSPLVKTAVAGEDPNWGRIVMAVGKSG
FT                   AKADRDRLTIRLGEILVAEHGWVAESYSEEAGATYMKQEELLIDVDLGLGSGAATVWTC
FT                   DLTHGYIQINADYRS"
FT   gene            300162..300548
FT                   /locus_tag="Jann_0292"
FT   CDS_pept        300162..300548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0292"
FT                   /product="mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53209"
FT                   /db_xref="GOA:Q28VQ3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ3"
FT                   /protein_id="ABD53209.1"
FT                   /translation="MVSAVALIDAEGRLLLAQRPEGKSMAGLWEFPGGKVEDGETPEQA
FT                   LIRELQEELGIDTWESCLAPLTFASHAYETFHLLMPLFACRKWNGIPQSREGQTLKWVR
FT                   AADLRDYPMPPADIPLIPILRDWL"
FT   gene            complement(300891..302003)
FT                   /locus_tag="Jann_0293"
FT   CDS_pept        complement(300891..302003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0293"
FT                   /product="Ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53210"
FT                   /db_xref="GOA:Q28VQ2"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ2"
FT                   /protein_id="ABD53210.1"
FT                   /translation="MNMMPAGDAPALMDTDAPALTTTDAPALAHAPSDHPRVKMGKVGV
FT                   LLANLGTPDNYDYWSMRRYLNEFLSDKRVIDYSPWIWQPLLQLVILSKRPFSSGAAYKS
FT                   IWNHEAGESPLATITKDQTAKMKALMADRYGDDVVVDYCMRYGNPSTKSKVDELVAQGC
FT                   TKILFFPLYPQYAGATSATACDQFFRSLENIKWQPQVRTVEPYYANPLYIDALAQSIER
FT                   AYAAMDVKPDLLVTSYHGVPKRYLMEGDPYHCQCQKTSRLLKERLGWDDTQIVTTFQSK
FT                   FGPEEWLQPYTVEEVARLAEKGKKRIAVCAPAFSADCIETLEEINEEIRESFEEAGGES
FT                   FTYIPCLNDDDAHMNALATVVDDNLRGWIG"
FT   gene            complement(302000..302881)
FT                   /locus_tag="Jann_0294"
FT   CDS_pept        complement(302000..302881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53211"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ1"
FT                   /protein_id="ABD53211.1"
FT                   /translation="MQQSQPRLTDARALAAHRARVKGGTHIADARFLHDEAIAELQERL
FT                   KDVNRSFTAPAIVTDFPTIWYDLIPSAQFFPVREVLDLKPGAHDLVVHAMGLHWADDPV
FT                   GQVVQCARALAPDGLFLSAAFGGSTLTELRQALAQAEAQVMGGLSPRVAPMAEVRDMGA
FT                   LLQRAGLALPVADTLRKTVTYPDAIALMHDLRAMGETNALAERHKTIPPRALFPTAAAI
FT                   YAESFPAQENRIQASFEFVFLTGWAPHESQQTPLRPGAATSRLADALGTTEFDEGANPV
FT                   HDLPDDESLKQT"
FT   gene            302933..303661
FT                   /locus_tag="Jann_0295"
FT   CDS_pept        302933..303661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0295"
FT                   /product="competence protein F putative"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53212"
FT                   /db_xref="GOA:Q28VQ0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VQ0"
FT                   /protein_id="ABD53212.1"
FT                   /translation="MRLQTMLHAVFPPECLNCSARVEDAFAICGSCWGDTPFILGAACD
FT                   LCGTGLPGQTAAEGEALICGECQRVPRAWDHARAVFSYEGVGRKLVLALKHGDRTDIAR
FT                   AAGPWMARAAADLLEDKPLLVPVPLHWTRLARRRFNQSALLAWSLARHCDADVEPMALL
FT                   RLRPTPSQEGRSRDARYQNVDEAIIPHPRKGSAIKGRNVVLIDDVMTSGATLAIATDAC
FT                   RRAGAENVSVLALARVGDDI"
FT   gene            303701..303961
FT                   /locus_tag="Jann_0296"
FT   CDS_pept        303701..303961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0296"
FT                   /product="Glutaredoxin GrxC"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53213"
FT                   /db_xref="GOA:Q28VP9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP9"
FT                   /protein_id="ABD53213.1"
FT                   /translation="MAIVTLYTSPLCGFCHAAKRMLTDKGVSYAEIDVAADPSKRQEMM
FT                   SRANGRHTVPQIFIGDAHVGGYDDMAALERTGKLDPMLSAD"
FT   gene            304036..304479
FT                   /locus_tag="Jann_0297"
FT   CDS_pept        304036..304479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0297"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53214"
FT                   /db_xref="GOA:Q28VP8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP8"
FT                   /protein_id="ABD53214.1"
FT                   /translation="MSKHEDPLSVALFSEVFMIDQLARARLSKALPKGMELSHFSVLNH
FT                   LAATQEEKSPAQLARAFHLTRGAMTNTLNKLEWAGHIHVRPDWDDARRKMISISPAGRR
FT                   AREAAISAIVPILTEAVAEIGPGRVRDTLPLLRDVRRKLEDEG"
FT   gene            complement(304476..305240)
FT                   /locus_tag="Jann_0298"
FT   CDS_pept        complement(304476..305240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0298"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53215"
FT                   /db_xref="GOA:Q28VP7"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VP7"
FT                   /protein_id="ABD53215.1"
FT                   /translation="MTAAPDATGTVNTVDAGEVAKFEAMAAEWWDLEGKFKPLHMLNPT
FT                   RLDYITQQIAAEFGRDLKADAPFAGLHILDIGCGGGLLAEPMARLGADVVGADAAERNI
FT                   PVAQVHAAQSGLEIDYRHTTAEAMADAGEQFDVVLNMEVVEHVVDPLGYLTACQRLLKP
FT                   GGLMVCSTLNRNPKSYLMAIIGAEHVMRWLPKGTHEWSKFITPDELFDLIRQAGLDPVD
FT                   RKGFVFNPLLWTWGISERDMSVNYVTASVKQV"
FT   gene            305350..306300
FT                   /locus_tag="Jann_0299"
FT   CDS_pept        305350..306300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0299"
FT                   /product="prolyl aminopeptidase. Serine peptidase. MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53216"
FT                   /db_xref="GOA:Q28VP6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP6"
FT                   /protein_id="ABD53216.1"
FT                   /translation="MFPPIDPFDQRILEVGDGHHVYVEQCGNPRGAPVVVLHGGPGGGC
FT                   SPAMRRYFDPEVWRVILFDQRGCGRSRPHASTHANTTWHLVADIERIRNTLGIERWAVF
FT                   GGSWGATLGLVYAEAHPNAVAFLALRGVFLAMQRELNWFYGGGAGQFWPDQWQRFVNLV
FT                   PEEERGDLIAAYNRRLFSGDLMVETRFARAWASWENALASMESDGHGGESPADYARAFA
FT                   RLENHYFVNKGFLEEDGQILRDVHRIAHIPGMIVQGRYDMICPPISAHTLASKWPGGRL
FT                   HMVRSAGHALSEVGISQELVRVMRAVGEKRPKYGL"
FT   gene            complement(306420..307658)
FT                   /locus_tag="Jann_0300"
FT   CDS_pept        complement(306420..307658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0300"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53217"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP5"
FT                   /protein_id="ABD53217.1"
FT                   /translation="MPKDSLKSGLFAPKLTGAARPGLCTDCGISRMGDGKACGKACQFI
FT                   APDYPTAENRIHGRSAEPALAEEAFFGVTHSMQRAALTVPADGAQWTGITTELAAELLR
FT                   SEAVTAVLAVAPHPDDRWKPLPVIVTDPDEMAKCRGMRMGYAPTLAALEPAIAAGHTRI
FT                   AVIGIPCQVYALRQIEQTLGLDRLYVIGTPCSDNTTTENFHHFLSLLDDAPETISYLEF
FT                   RADYKVELRFDDGRAPRVVPFLKLPISKLDPDFFPLTCKTCVDYTNRLADITVGYMGGD
FT                   GDQWVITRNARGAEMLAAISDRITFTPLTDKGKRGGAVKGFLANTERAAGGMPLRSMPD
FT                   WLRPLVSFLQPRIGPRGLEFARARVEMKAIDTILHLRRTHPARVKNMVPGHVWSVAEPY
FT                   DLTPTENERPAQD"
FT   gene            complement(307735..309240)
FT                   /locus_tag="Jann_0301"
FT   CDS_pept        complement(307735..309240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0301"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53218"
FT                   /db_xref="GOA:Q28VP4"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP4"
FT                   /protein_id="ABD53218.1"
FT                   /translation="MDRRTLLALMAAGLTPLPRPVFGQSERSLLDAARALAAAAYVPPS
FT                   GELPAPFADLDYNAYRGIRPIDGLAASLPQGEDFTVDLLPPGLYFTEPVTVERRVNGTL
FT                   RDLPLTPDLFTFEPRYFDDIPETSPGTGFSGMRVRYPLNNPDVMDEVAVFQGASYFRAI
FT                   GQAMAYGLSARAVALGTGGSAPEEFPRFTHMRLNEGVGGKIGMEALIDSPSLSGHLAME
FT                   ITPGRDTAMDISVTLFPRTRLDTIGIAPLTSMFLKGPMHGAASDDFRPRVHDSNVLYIE
FT                   NGAGEHLWRPIANPTRLETSAFADTGPACFGLYQTTRTYEDFEDTEARYHERPSALVQP
FT                   SGDWGPGAVMLVEIPTSTEFLDNIVAFWRPEAALEPGGEYRFDYRLTWTLDDPTHGLPA
FT                   PIVQSRSGREHEFPTTRRFVIDFDTGPDGLMADVSAFGGAADAIAGTSVFALPDGRGTR
FT                   VTFVVTPGEADALELRLVLRDDAGAAASPVWLHRWTRKRDGGV"
FT   gene            complement(309251..309796)
FT                   /locus_tag="Jann_0302"
FT   CDS_pept        complement(309251..309796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0302"
FT                   /product="cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53219"
FT                   /db_xref="GOA:Q28VP3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP3"
FT                   /protein_id="ABD53219.1"
FT                   /translation="MTISTTAYKAPARWLHWLMALLVVPMIPVGFIMIQDGLPRALQNS
FT                   MFISHKNLGTLVLLLVIVRLIYRWRNAPPPEPAHLPGWQVRIAGLTHTALYALLLIMPL
FT                   AGYIRVRAGGFPIEALDALGIPSLVPRSDALAEVAKSVHFFGAWALALLLAMHIGAALF
FT                   HGLIKRDGVFSRMWPRST"
FT   gene            309907..310644
FT                   /locus_tag="Jann_0303"
FT   CDS_pept        309907..310644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0303"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53220"
FT                   /db_xref="GOA:Q28VP2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP2"
FT                   /protein_id="ABD53220.1"
FT                   /translation="MMSDKPSDTDDGLASTSLSVAVQFVGAGCVGAAAVATLAWALVGN
FT                   ALAIGIAVIFFAAVMAIALVGLVASFPHRVIGLCNLATIARLALVSVLIAALVAPAASA
FT                   WAVFGLAVLAFALDGLDGYLARREGRASAFGARFDMEVDSLLALTLALLTWQSGAVGAY
FT                   VLILGLPRYAFWVAQVPFPWLGHDLPERFSRKVACVVQIAALILALFPPAPSILVGSIA
FT                   GLAAIALVWSFSLDARTLWRAQT"
FT   gene            310641..312260
FT                   /locus_tag="Jann_0304"
FT   CDS_pept        310641..312260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53221"
FT                   /db_xref="GOA:Q28VP1"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP1"
FT                   /protein_id="ABD53221.1"
FT                   /translation="MRLLRLAIAALILFLVLIQPNHPAALAWGALGVFPLELPAILLAM
FT                   IAFGKGRIGRVIRLLLTIVLVFVAILKTADIIMFDALSRGFNPVADLPLIDAFIRLLSG
FT                   TLGPVLTGAASIGAVLVAVLIAWLIWWALGVWSRVSVRPWLARGSGLAAAVTTLLVIAE
FT                   AGDTMGQWDLPAQPPGTAFTARLGAERVGMIRRTIIELRAFRDEVANDPFTGADGLFAQ
FT                   IDRDVLIIYVESYGRTSFDTLFYADLHRETLATYQARLGDLGLSMQSGFLASPTHGGQS
FT                   WLAHSTVANGMWIDNQVRYAAALSSGRETLFHHAANAGLRTATVMPQITLDWPEALVMG
FT                   FEEILTFDDLGYEGLPFNWVTTPDQFTLAALDRLLRDANDPRHLLAQVALISSHAPWVP
FT                   VPEIVPWEDIGDGTIFNEIAASGDTPAVVWRDRERVRFQYRLAVDYALQAVFEYAVLHA
FT                   DDPPLMVVIGDHQAASSIGLDERREVPIHIIGPDALVSALGEIAPSGGLLPDENAGVIP
FT                   MDALRDIFLEAYSDAPDQRRGE"
FT   gene            312257..313201
FT                   /locus_tag="Jann_0305"
FT   CDS_pept        312257..313201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53222"
FT                   /db_xref="GOA:Q28VP0"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VP0"
FT                   /protein_id="ABD53222.1"
FT                   /translation="MTFPTVPTYLMRALQIAVMAVVVWLLWRAVDWREALALLRSADPR
FT                   WLVLAALALTMQTILSALRWRLTAARLRILIPVPEALREYYLSQVVNQSLPGGVVGDAS
FT                   RAVRARGQAGLLASGQAVVFERIAGQMGLLAILAVGLILALVLPTGMAWPVWLIAPVAV
FT                   GGAILIGVVTALWLQSSGDTALGRTIRSFRSAVMGDDVWRHQLGLSLGTALCNITAFGF
FT                   CAAALGVTLPLLAALSLVPLILFAMVLPLSISGWGLREGAATVLFPLVGASMGEGLAVS
FT                   VAFGLVFLSTVVPGLILTWMRPNAPVFGRRRAK"
FT   gene            313254..314249
FT                   /locus_tag="Jann_0306"
FT   CDS_pept        313254..314249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0306"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53223"
FT                   /db_xref="GOA:Q28VN9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN9"
FT                   /protein_id="ABD53223.1"
FT                   /translation="MIIRPKDLTRRSVLATGATALGALAVAPKMAFAQTAVSLQLSWLH
FT                   STQFAGSYMASDRGFWSEAGLDVSLLPGGPNAPVEPPVVAGTALVGISAADYTAAAVEE
FT                   GAPFKIIGVAMQNNPFAITSLTSNPVNVPGDLEGKRIGMALANTPVLRALCTLNGVDFD
FT                   AIEVIPTQYSPQPLVAGEVDCLLSWETDLPVALTVQGIDNTTMLLADHGYAVHSQTYIA
FT                   TEDSLANRRADIVALMAGEVAGWEAYREDTDAATDLTLSMFPDAGLDRETQLLQAARQV
FT                   PLMFSNLTDANGFGWWTDDTVAANIETLALLDRTVTPDLWDRSILEEVHG"
FT   gene            314253..315032
FT                   /locus_tag="Jann_0307"
FT   CDS_pept        314253..315032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0307"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53224"
FT                   /db_xref="GOA:Q28VN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN8"
FT                   /protein_id="ABD53224.1"
FT                   /translation="MSSEVICKALAKTYRGGVEAVRPLDLTLASGQTTALVGPSGCGKS
FT                   TVLRMIAGLEDPSGGEITIGGAPPADTLRKAGLSVAFQDPSLLPWRSVRGNIELALTLA
FT                   RRPVDAVEVDQLIHLVGLDGFADTRPAELSGGMRQRAAMARALATQPGLLLLDEPFGAV
FT                   DELTRQQLANDLPGIWEARGTTTVLVTHSVSEAVLLSDRVVVLSPRPARIVADIAIDLP
FT                   RPRRSEITRTPAFTDLVEAVFAALSEGMAETMPKAAQ"
FT   gene            315059..316594
FT                   /locus_tag="Jann_0308"
FT   CDS_pept        315059..316594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0308"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53225"
FT                   /db_xref="GOA:Q28VN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN7"
FT                   /protein_id="ABD53225.1"
FT                   /translation="MPRRIPWFGPVLAVLIWELLGRSLTDAFVLAAPSAILGYLFENAG
FT                   LMTRALIETLKNAAAGFMIGNLAAVALAIIATVWPRSDAMVRGLALVVFCLPLVATGPI
FT                   LRVVFGPGDGPQIVLAALAVYYTTLIPLLVGLRALPSGWLDLVRSYGRGRLAALIHVRA
FT                   MAALPYFVAGLQIAAPAAFLGAMVGEFTGAERGMGVLTIRAMRGMNVEMTWALAVVATA
FT                   VAVLGYAAIGWIARKTLRDEPPVILAPPSVGRRGNAWMTLIGVTVALLVIWWGGLQILN
FT                   VSPFFAKGPAEVFDALFLAPDAGVVRATLMEALGETAVFLLPGYAAGIGVGALLAMLLV
FT                   VMPSLAGTAMPLAIALRSVPIITTAPLVVLFTGRGAVGTIVLVAIMVFFPTFVACLHGL
FT                   RQAPGRVIDVMRSYAASPFDVLTRVRVPAMLPAFFAAARMNVPASVLAVTVVEWLATGN
FT                   GIGSLMALSASQSDYDMLWSSVVLVAVLSSLGYAGVGWLERRVLATYAPEQLT"
FT   gene            316591..317634
FT                   /locus_tag="Jann_0309"
FT   CDS_pept        316591..317634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0309"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53226"
FT                   /db_xref="GOA:Q28VN6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN6"
FT                   /protein_id="ABD53226.1"
FT                   /translation="MRQAAFAIPGDINIITGGYIYEKRLLEELRALGHDVSHLQLGASF
FT                   PDPTDADMADGIAQLQALDPARALILDGLVYGAIATEGLARVTAPIVAMIHHPLALETG
FT                   LDPAQRDHLFKTERDNLALAQQVLVPSPHTAQILRDDYGVPGHKIIVARPGSRPVGVTP
FT                   SPSDPPFILSVGLQHPRKGHDVLLKALAEVRDLPWRAAIVGSIHDTDYAGVLAAMLKDL
FT                   GLSDQVDLMGATPRDALDELYANASIFALATWYEGYGMVFDEAMSWGLPIVSCAGGAVP
FT                   DTVAEGAGLLVTPGHVGELADALSCVLTDAGRRGRMADASRNAGANLPSWQDTARVASG
FT                   VLDSLDA"
FT   gene            317627..318361
FT                   /locus_tag="Jann_0310"
FT   CDS_pept        317627..318361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0310"
FT                   /product="Methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53227"
FT                   /db_xref="GOA:Q28VN5"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN5"
FT                   /protein_id="ABD53227.1"
FT                   /translation="MRSAIGRSLDVYYRDHERTARMDALNATFVSSGDLVFDIGAHVGD
FT                   RTASFRRLGARVVTLEPQPKVFRALRLIHGRDPQVTLLREAAGAEVGEIDIHLNTRNPT
FT                   VSTASKALIDAAPNATGWADQTWDDTIRVPMTTLDHLITVNGTPSFVKIDVEGYEADVL
FT                   SGLNTVVPCLSFEITTIQRDVAAASLSRLSVLGAYEFNLSLGEDHALHHDIWTTASAMV
FT                   DTIQALPMSANSGDVYARLKVW"
FT   gene            complement(318356..318432)
FT                   /locus_tag="Jann_R0003"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(318356..318432)
FT                   /locus_tag="Jann_R0003"
FT                   /product="tRNA-Arg"
FT   gene            318540..319562
FT                   /locus_tag="Jann_0311"
FT   CDS_pept        318540..319562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0311"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53228"
FT                   /db_xref="GOA:Q28VN4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN4"
FT                   /protein_id="ABD53228.1"
FT                   /translation="MRGRNPFDGKPQMTLRDVADAASVSEMTVSRVLRNRGDVSDKTRE
FT                   RVFEAARTLGYVPNKIAGALASNRVNLVGVVIPSLSNMVFPDVLHGIGAALDGTELQPV
FT                   VGTSKYDLQQEEKVIYEMLSWRPSGLIVAGLEHTDSARAMMRNAGVPVVEVMDVDGDPV
FT                   AAAVGISHQAAGRAMADEILARGYTNIGYLGSSSTADARAQKRFRGFEAGMAEAGVTLA
FT                   DTIFYEGTSGFGTGRKMTQALLERTPDIDFLYYNTDMNAAGGLLYCLEKGMDIPGEIGL
FT                   AGFNSFEVLDGLPMRIATMDSQREAIGRRAAELMIANELTEEVVQLEPQFLPGDTVRDR
FT                   "
FT   gene            complement(319760..320848)
FT                   /locus_tag="Jann_0312"
FT   CDS_pept        complement(319760..320848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0312"
FT                   /product="periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53229"
FT                   /db_xref="GOA:Q28VN3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN3"
FT                   /protein_id="ABD53229.1"
FT                   /translation="MSRKLLSISATAALMGGTAMADVPSVAVDITPVHSLVARVMDGVG
FT                   TPNLIVQPGASPHEYSLRPSEATALQEADLVFWMGEDLTPWMEDAVETLAEGAMITTLL
FT                   EADGTTLLDFREGALFEAHDHEDHAGDGEHDDHDHDDDHDHEAHAEEEGHDHDGHGDEN
FT                   YAEEGAHEEYDHEDHAEHDDHEGHEGHDHGEHDPHAWLSPQNASTWLNLIASQLSAADP
FT                   ENAGAYFANAAAAREEMEALSAEISATLDPVRGGSFIVFHDAYQYFEVDFDFPAAGAIS
FT                   LSDATDPSPARIAEIQGRIRDEGIDCVLAEPQFNPGIVDVVLDGTEANTGVIDPLGASL
FT                   EPGPDLYPQLLRNMATTLADCL"
FT   gene            320905..321423
FT                   /locus_tag="Jann_0313"
FT   CDS_pept        320905..321423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0313"
FT                   /product="putative ferric uptake regulator FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53230"
FT                   /db_xref="GOA:Q28VN2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN2"
FT                   /protein_id="ABD53230.1"
FT                   /translation="MTSDARSQDAGNDTPLGFQNHDHRACVADALASADARSTAEGLRL
FT                   TPVRRKVLELLLQEHRALGAYAILDLLRDAGFGSQPPVAYRALDFLVENGFVHKIERLN
FT                   AFVACAHPGQTHSPAFMICRKCDAVAEAHSAPAKGALGAAARATGFQIERTVVEAEGVC
FT                   PACVEKDEA"
FT   gene            321420..322151
FT                   /locus_tag="Jann_0314"
FT   CDS_pept        321420..322151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0314"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53231"
FT                   /db_xref="GOA:Q28VN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VN1"
FT                   /protein_id="ABD53231.1"
FT                   /translation="MSLITVENLSVRYGANTVLRNVALTVEPGEIVTIVGPNGSGKTSL
FT                   LKAIIGAARPAAGQVTLRPGLRIGYVPQRLHIDATLPITVERFMGLTARVTREDCMAAL
FT                   KIAAVPDLLKRQMSQLSGGQFQRVLLARALINKPDVLLLDEATQGLDQPGSAAFYRQIE
FT                   DVRRETGCAVLMISHELHVVMSASDRVICLNGHVCCAGTPAVVASAPEYRALFGTGTGG
FT                   ALALYRHDHDHNHDHDHEAAE"
FT   gene            322151..322948
FT                   /locus_tag="Jann_0315"
FT   CDS_pept        322151..322948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0315"
FT                   /product="ABC-3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53232"
FT                   /db_xref="GOA:Q28VN0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VN0"
FT                   /protein_id="ABD53232.1"
FT                   /translation="MFDDFMTRATLAGVGVAIAAAPLGCFVVWRRMAYFGDATAHAAIL
FT                   GVALSLALQMSIFVGAVVVALVMALTVTALTGRGYAMDTLLGVMAHSALAFGLVAVSFL
FT                   SGIRIDLMAYLFGDILAVSRLDLLVIWGGAALVVALIAWRWSPLLTSTLNEELAYASSI
FT                   DPKREQLILTLALAITVAVAIKVVGVLLIAAMLIIPAAAARSFARTPEAMAVIAALIGG
FT                   LSAVVGLRAAYVFDTPAGPSIVCVAAIVFAAFSVIGWRRRDGA"
FT   gene            complement(323077..324489)
FT                   /locus_tag="Jann_0316"
FT   CDS_pept        complement(323077..324489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0316"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53233"
FT                   /db_xref="GOA:Q28VM9"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM9"
FT                   /protein_id="ABD53233.1"
FT                   /translation="MFLSIFDIFKVGIGPSSSHTMGPMTAAARFLEDLRNGREKEPGAG
FT                   ELGGLGCSLHGSLAFTGKGHATDRAVILGFAGFEPATLDPDQAEALETEIRASGIVTPP
FT                   GLPPLKFAPDADLIFDYDTTLPGHANGMILRAYDTNGHLYLEETYYSIGGGFVVTEKEL
FT                   NVQGDGPEALHAEKEEAGFPHPFGSAVEMLAMGARTGKTIAQMKWENEAAFAPRGQVTT
FT                   QLDAIWTAMDDCIDRGLRMEGELPGGLMVKRRAKAIYDQLKAEAGTNQAQPHVANDWLS
FT                   VYAMAVNEENAAGGRVVTSPTNGAAGVLPAVLRYYRDHCIGATEDGLRDFMMTAAAIGG
FT                   LIKHNASISGAEVGCQGEVGSASAMAAAGLCAALGGTNAQVENAAEIALEHHMGMTCDP
FT                   VAGLVQVPCIERNGLGAIKAVSAASLALRGDGTHFMPLDNCIEAMRQTGLDMNTKYKET
FT                   SEGGLAVNLPQC"
FT   gene            complement(324813..325367)
FT                   /locus_tag="Jann_0317"
FT   CDS_pept        complement(324813..325367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0317"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53234"
FT                   /db_xref="GOA:Q28VM8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM8"
FT                   /protein_id="ABD53234.1"
FT                   /translation="MNPNLQAERRRMQDLSTAPTITTQRLVLRGPDRDDLTEFTRFMTS
FT                   APSMIAQEETITAEQAWFGFLTGIGHWHWHGFGFFTVVLRETGHPVGRVGLIKHSNWPD
FT                   IELAWHLFEGAEGKGFATEAAMAVKKWAGEDLGLDMLHSYIDVDNARSQAVARRLGAVT
FT                   DGTRAPHEPEAEVWVHSMESR"
FT   gene            complement(325459..325534)
FT                   /locus_tag="Jann_R0004"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(325459..325534)
FT                   /locus_tag="Jann_R0004"
FT                   /product="tRNA-Lys"
FT   gene            325644..326489
FT                   /locus_tag="Jann_0318"
FT   CDS_pept        325644..326489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0318"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53235"
FT                   /db_xref="GOA:Q28VM7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM7"
FT                   /protein_id="ABD53235.1"
FT                   /translation="MRQMPDETPYPGLPFLKMHGLGNDFVVIDARGVARAMTPALARAL
FT                   GDRHRGVGFDQLAVIETGTDSDVELTFWNADGSTAGACGNATRCIARREMELTGKHRIT
FT                   LRTERGLLEAIDVGDGLTSVNMGEPVMGWRDIPLKGACDTLNLPIDGTPVATGMGNPHC
FT                   TFFVEDADAIDLETLGAKYERHPLFPQRTNVQFAHVVGPDHLRMRVWERGVGVTLASGS
FT                   SSCAVAVSAARRGLTGRKVRLTLDGGEISVDWRSDGVWMTGPTAHVFSGELTPAFLDAL
FT                   "
FT   gene            326486..327745
FT                   /locus_tag="Jann_0319"
FT   CDS_pept        326486..327745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0319"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53236"
FT                   /db_xref="GOA:Q28VM6"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM6"
FT                   /protein_id="ABD53236.1"
FT                   /translation="MSAPVFHTLGCRLNAYETEAMREMTAQAGLENAVVVNTCAVTAEA
FT                   VRKARQEIRKLRRDSPGAKVIVTGCAAQTEPATFEAMEEVDLVLGNSEKMTPETWQAMP
FT                   ADFIGNTEKVRVDDIMSVTETAQHLIDGFGTRSRAYVQVQNGCDHRCTFCIIPYGRGNS
FT                   RSVPAGVVVDQIKRLVDRGYNEVVLTGVDMTSWGADLPAAPRLGDLVMRILKLVPDLPR
FT                   LRISSIDSIEVDDALMQAIATEPRLMPHLHLSLQHGDDLILKRMKRRHLRDDAIAFCEE
FT                   ARRLRPEITFGADIIAGFPTETEAHFQNSVKLVEECDLTWLHVFPYSPREGTPAARMPA
FT                   VDGPTIKARAKQLRAKGEAAVNAHLSKQIGQLHNILMESPKIGRTEQFTEVVFAEDQPE
FT                   GEIVSAYITGQTDRQLLVAS"
FT   gene            327770..328423
FT                   /locus_tag="Jann_0320"
FT   CDS_pept        327770..328423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0320"
FT                   /product="negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53237"
FT                   /db_xref="GOA:Q28VM5"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM5"
FT                   /protein_id="ABD53237.1"
FT                   /translation="MHPNPAFRQEPVFTNVAMCQKRGFGMLSVNGDPAPMISHVPFFLN
FT                   ETGAMAELHLMRSNPIARHVTTATPAVIAVNGPDGYVSPDWYGTPDQVPTWNYVAIHLR
FT                   GVLHPMDEGLMREHLDRLSGHFEGRLAPKPVWTTKKMSEDALERMMRQILPFRFEVQDV
FT                   DGTWKLNQNKPDAAREGAADAIKQSPIGHEVETLGALMTGGVPSIDKDAPLTYI"
FT   gene            328454..328735
FT                   /locus_tag="Jann_0321"
FT   CDS_pept        328454..328735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53238"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM4"
FT                   /protein_id="ABD53238.1"
FT                   /translation="MALNIPPMAFIVLRYGAVAVAGFAAARFAPRGTLSPAVEAEMDAT
FT                   PDGMQMCKAPGQLAAAGKITKTLRVGRLGPMFRVDGTALARLKIRRLT"
FT   gene            328735..329349
FT                   /locus_tag="Jann_0322"
FT   CDS_pept        328735..329349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0322"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53239"
FT                   /db_xref="GOA:Q28VM3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM3"
FT                   /protein_id="ABD53239.1"
FT                   /translation="MDTGTIELLGSDASPFVRKARVLVAEAGITDVPYVQVTATPMGGE
FT                   ERLNAANPLGKIPALVRESGPTIYDSNVVCRFLDDRADAGLYPKDRLWECLTLEATGDG
FT                   IMEAAVGIVYEKRLRPDELWWNDWFDAQWVKVTRSLDALERQWMSHLYGPVDMGQISVA
FT                   CALGYLDLRHGDRNWRSGHDALATWYARFAERPSMVNTAPE"
FT   gene            329346..329762
FT                   /locus_tag="Jann_0323"
FT   CDS_pept        329346..329762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0323"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53240"
FT                   /db_xref="GOA:Q28VM2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM2"
FT                   /protein_id="ABD53240.1"
FT                   /translation="MKVRLAVSEAERQACFDIRRAVFIEEQQIPEAEEWDAHDATCLHY
FT                   LAGDGAGTARVIAKGDTAKIGRVAVTQAHRGTGLGAKIMQALMADARIRGFKTAELEAQ
FT                   VYAIPFYARLGFIAEGPEYDDGSGILHRLMRADL"
FT   gene            329808..330356
FT                   /locus_tag="Jann_0324"
FT   CDS_pept        329808..330356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0324"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53241"
FT                   /db_xref="GOA:Q28VM1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM1"
FT                   /protein_id="ABD53241.1"
FT                   /translation="MPLGEKLNGTLRAFIERQQMFFVATAAPTGRVNMSPKGADSLRIL
FT                   SDTRVQWLNLSGSGNETAGHLRQSDRMTLMFCAFEGDALILRLYGTASTLHPRDAGWKE
FT                   ASARFPKMAGTRQIFDMQIQSVNMSCGSGVPFMDYKSDRSAVEMIPFFEDLGQDGTDAF
FT                   WRRKNVETIDGYPTGLFGD"
FT   gene            330608..331183
FT                   /locus_tag="Jann_0325"
FT   CDS_pept        330608..331183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0325"
FT                   /product="Ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53242"
FT                   /db_xref="GOA:Q28VM0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VM0"
FT                   /protein_id="ABD53242.1"
FT                   /translation="MSDTHDPSGDRRDFLYYATAGTGVVVAGAAAWPLVNSMNPSADVQ
FT                   AASQLRVDVGGVEPGTQLTVLFLGKPIFIRRRTEDEIEAGRAVEVSELIDANARNANDE
FT                   SADAADINRTLTTSDGENSGEWLVMQGVCTHLGCVPIGEGAGDFGGWFCPCHGSHYDTA
FT                   GRIRRGPAPENLPIPAAEFIDDSTILLG"
FT   gene            331199..332554
FT                   /locus_tag="Jann_0326"
FT   CDS_pept        331199..332554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0326"
FT                   /product="cytochrome b/b6-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53243"
FT                   /db_xref="GOA:Q28VL9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL9"
FT                   /protein_id="ABD53243.1"
FT                   /translation="MGGIPHDHYEPNSRGEKWLHRRLPIVGLMYDTLMIPTPKNLNWMW
FT                   IFGIVLVFCLVMQIITGVLLVMHYTPHVDMAFASVEHIMRNVNGGWAIRYIHQNGASLF
FT                   FIAVYLHIFRGLYYGSYKAPREVTWIIGMLIYVLMMGTAFMGYVLPWGQMSFWGATVIT
FT                   GLFGAIPFIGDGIQTWLLGGPAVDNATLNRFLSLHYLLPFLILGLVIVHIWAFHTTGNN
FT                   NPTGVEVRRTSKKEAEADTLPFWPYFVIKDLFALAVILVIFFAIVGFMPNYLGHPDNYI
FT                   EANPLATPAHIVPEWYFLPFYAILRAFDTEVWVVIAADFLTGGIVDAKFFGVIAMFGAI
FT                   VVMALAPWLDTSSVRSGRYRPMFKWWFWVFVVNFIVLTWVGARPAEGPYPYISLIGAAY
FT                   WFAYFLVILPLLGVIEKPLPQPDTIEEDFNNHVSGDSGTPGSGTAPVASPAE"
FT   gene            332569..333378
FT                   /locus_tag="Jann_0327"
FT   CDS_pept        332569..333378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0327"
FT                   /product="cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53244"
FT                   /db_xref="GOA:Q28VL8"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL8"
FT                   /protein_id="ABD53244.1"
FT                   /translation="MLRKLAISATAALALSTGGAMAAGGAGEITNVPFSFQGPFGTFDQ
FT                   DQLQRGLQVYTEVCAGCHGLQYVPLRALADEGGIGWTDDEVRAYIDENFIEVYDPDLED
FT                   WRTAVPNDNFPANDGVGAPDLSLMAKARTGFSGPRGTAIYPLLYGLGGPEYIYSLLTHY
FT                   TGEEVEQFGTILYVNETMEGGLISMAPPLWEGAVEYADGTVATESQMAEDVAAFLMWTA
FT                   EPHMMARKQMGLVAVIILGIFSVLLYLTNKRLWAPVKARAKGTQPAE"
FT   gene            complement(333458..334147)
FT                   /locus_tag="Jann_0328"
FT   CDS_pept        complement(333458..334147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0328"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53245"
FT                   /db_xref="GOA:Q28VL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VL7"
FT                   /protein_id="ABD53245.1"
FT                   /translation="MLHLENIRVRQGSFTLSAHLTIAKGARVALMGASGSGKSTLLSTL
FT                   SGFLWPDAGRITMAGADVAKTPVADRPISILFQDGNLFPHLSVFDNVALGIRPNLKLGS
FT                   EDERRVTRALTQVGLEGMEQRKPSALSGGQQSRVALARMLLRDKPVALLDEPFSALDPG
FT                   LRREMLSLVRKLCDETGQTLIMATHDLRDAERLCDRVLLLDDGKVVLDAPLAEAVANNA
FT                   EPLRPWM"
FT   gene            complement(334134..335699)
FT                   /locus_tag="Jann_0329"
FT   CDS_pept        complement(334134..335699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0329"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53246"
FT                   /db_xref="GOA:Q28VL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL6"
FT                   /protein_id="ABD53246.1"
FT                   /translation="MAKRAQPITLVQGIGGAFVLLVILAILGPLGAVMIRAEGVNGLRP
FT                   ADWAAVRFTLLQAVLSAVVSCVAAIPVARALARRRFRGRGAYIALMGAPFILPVIVAVM
FT                   GLLAIFGRAGWLNAALEGIGAGTIEIYGLAGVVMAHVFLNLPLATRLILQAWLSVPSER
FT                   IRLAHSLNFTAQDMRRHFEWPLLRATLPGAALIIFLICTTSFAVALILGGGPSATTVEL
FT                   AIYQAFQFDFDLGRAALLGLIQVGICVGAGVVAWRFATATEFGGGLDRPAMHWPGDPHL
FT                   SRLWDGLALFAAGAFLLLPLAAVTGQGVGAIAGLPLSTWEAALRSILLALASTAFAVTL
FT                   ALPIALLIAGKAARAGLEGVSLLSIAVSPLVIGTGLFLIVFPIADPVALSLPITGLVNA
FT                   LVALPFLLRALIPAATQAEATQGRLADALGMQGTARLRHAILPRVRRPLGFGAGLAAAF
FT                   SMGDLGVIALFSTQGQETLPLEMYRLFGSYRTNDAQGAAVLLMALSLGMFWLFDRGGRV
FT                   NAAS"
FT   gene            complement(335675..336682)
FT                   /locus_tag="Jann_0330"
FT   CDS_pept        complement(335675..336682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0330"
FT                   /product="thiamine ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53247"
FT                   /db_xref="GOA:Q28VL5"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL5"
FT                   /protein_id="ABD53247.1"
FT                   /translation="MKLTNTTILTAGITAGLTLLTGAAFAQVPVLTVYTYDSFNSEWGP
FT                   GPGVELAFEEICECDLQFTSTGDGAALLARLRLEGARSEGDIVLGLDTNLMAAALDAGL
FT                   IAEHDSTPGDLTLPMTWDDPHFMPFDWGYFAFVHRTDMETVPGSFEDLAASDASIVIQD
FT                   PRSSTPGLGLLMWVQNAYGDEAAAIWEGLADNVVTVTPGWSEAYGLFLEGEADMVLSYT
FT                   TSPAYHLIAEDDAGFEAAAFAEGHYMQIEVGGILQTADNPDLAQQFLDFMISPAFQTVI
FT                   PETNWMYPAALPVDQLPEGFETLIQPETALIFTPEEAAAIRDDALATWQNALSQ"
FT   misc_binding    complement(336726..336841)
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="Jann_R0005; TPP riboswitch (THI element) as
FT                   predicted by Rfam (RF00059) score 67.73"
FT   gene            336913..338025
FT                   /locus_tag="Jann_0331"
FT   CDS_pept        336913..338025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0331"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53248"
FT                   /db_xref="GOA:Q28VL4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VL4"
FT                   /protein_id="ABD53248.1"
FT                   /translation="MSMNSYGHLFRVTTWGESHGPALGATVDGCPPGIDVDAAAIQHWL
FT                   DRRKPGQNKYTTQRREADEVEILSGVYEGQSTGTPIQLMIRNTDQRSKDYGDIAEKFRP
FT                   GHADITYWQKYGIRDPRGGGRSSARETAARVAAGGVARLALAALVPAVKITGYMVQMGP
FT                   HGIDRECFDLAQVDENPFWVPDAKAADEWAAYLDGLRKSGDSVGAVIEVRASGLPAGLG
FT                   APIYGKLDTDLAAAMMSINAVKGVEIGDGMAAAALTGSANADEIHMGDNGPEYSSNHAG
FT                   GILGGISTGQDVIVRFAVKPTSSILTPRATITKAGTPAEIITKGRHDPCVGIRAVPVGE
FT                   AMMACVVLDHILLQRGQIGGKVGETRGKIG"
FT   gene            338166..338885
FT                   /locus_tag="Jann_0332"
FT   CDS_pept        338166..338885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53249"
FT                   /db_xref="GOA:Q28VL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL3"
FT                   /protein_id="ABD53249.1"
FT                   /translation="MSRIGYLMGQNAQTDRSRRGYITIDWLVLAVAGIALLFLMGTLVR
FT                   TAADAEILASDGFHQLNGDDTLLAFQDFSFDAAGWAPSETSDRVPGIGPVLGPFGTEPV
FT                   QRSFSMPSDATVARISFDLHLVGDWTGQGAFHVSLAETEVVAIELPDAADPGVVDTQAI
FT                   QNDGIIVGVQSHAVTPRPGEATLPGVVDDFVTVSLEIIVSHPAETLALRLFSEVGGGAE
FT                   WTLDNFTVVATSGDTPS"
FT   gene            complement(338895..339290)
FT                   /locus_tag="Jann_0333"
FT   CDS_pept        complement(338895..339290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0333"
FT                   /product="thioredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53250"
FT                   /db_xref="GOA:Q28VL2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL2"
FT                   /protein_id="ABD53250.1"
FT                   /translation="MNRRILFLSAAALALTPLSAMAEMIDYTPGSAETAIASGQPVLVD
FT                   FAADWCSTCRSQERTITALRDANPAYDAAITFYRVDWDDYGRGDLSTSLNIPRRSTLVL
FT                   FRDGAEVGRIVAGTREADIRALLDAGL"
FT   gene            complement(339308..340021)
FT                   /locus_tag="Jann_0334"
FT   CDS_pept        complement(339308..340021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0334"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53251"
FT                   /db_xref="GOA:Q28VL1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL1"
FT                   /protein_id="ABD53251.1"
FT                   /translation="MEFLLAYAAGLLTLINPCVLPVLPIVLAGSLQSSRYGPLALAGGM
FT                   GLAFVTLGFGVIAAGHLVGLREETVSQAGAVLMMVFGAVLMIPQLSARFATATAGVAAK
FT                   ADDGMRDMQTDGWQGQFLGGLLLGAVWSPCVGPVLGSAISLASQGEELVRAFFIMVAFA
FT                   LGIGTIILTLGYGARAALQKRMGTLRAFAQASRPFLGAIFFLVGLAIYMRWHLMAEIWL
FT                   LDRMPIWLQDLSVSL"
FT   gene            complement(340076..340945)
FT                   /locus_tag="Jann_0335"
FT   CDS_pept        complement(340076..340945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0335"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53252"
FT                   /db_xref="GOA:Q28VL0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VL0"
FT                   /protein_id="ABD53252.1"
FT                   /translation="MDVRALVMGLTFALIWSSAFTSARIIVEAAPPLFSLSARFAISGV
FT                   IGISIALALGQRFNLTRNQWRAVIIFGLCQNAIYLGLNFVAMQWIEASFAAIIASTMPL
FT                   LVALANWTIFKERLPFMGIAGMVAGFAGVGLIMAQRFGGGADPLGIALCLIGAVALAAA
FT                   TLTVKSASSDGGNLLMIVGLQMIVGSAALLIPALALETLTIDWTTPFILAFIYTTLMPG
FT                   LAATLIWFLLVGRIGPTRAATYHFLNPVFGVAIAFLLLSEALSWIDALGVVIIAGGIFA
FT                   VQRARITA"
FT   gene            complement(341049..341339)
FT                   /locus_tag="Jann_0336"
FT   CDS_pept        complement(341049..341339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0336"
FT                   /product="histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53253"
FT                   /db_xref="GOA:Q28VK9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK9"
FT                   /protein_id="ABD53253.1"
FT                   /translation="MATKPMTKTQLVAALADEMGADKKAAGAALDAVSAVITKEVANGG
FT                   AVTIPGIGKVYCRERPERMVRNPATGEQIKKDADKQVKVTIAKALKDSVNG"
FT   gene            complement(341476..342960)
FT                   /locus_tag="Jann_0337"
FT   CDS_pept        complement(341476..342960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0337"
FT                   /product="AMP nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53254"
FT                   /db_xref="GOA:Q28VK8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK8"
FT                   /protein_id="ABD53254.1"
FT                   /translation="MTTHPPLHIETPDHGEPTAFTDASAAVAQLQTLYAEATQFLCDRF
FT                   GETLAHGAPERTRYRAYYPEIRLRTTSFAAVDSRLSFGHVSEPGTYATTITRPDLFCNY
FT                   LTQQIGLLLTNHGVSVHVGPSLTPMPVHFAVAQDASITVPQEGAGDFILRDVFDVPDLA
FT                   TTNDDIANGLGFTYEDGAYPLAPFTAQRIDYSLARLAHYTATDPGHFQNHVLFTNYQFY
FT                   VDEFEAYARTQLANPDSGYTSFVATGNVTITDAETPIAPLAKMPQMPTYHLTREDGSGI
FT                   TLVNIGVGPSNAKTATDHIAVLRPHAWVMVGHCAGLRNSQRLGDFVLAHAYLREDKVLD
FT                   DDLPVWVPVPALAEIQVALETAVAGVTKLEGFELKRIMRTGTVASFDNRNWELRDQSGP
FT                   VQRLSQSRAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGELKLPGMASDFYKDQV
FT                   SRHLLIGIRAMENLRDMPLARLHSRKLRSFQETAFL"
FT   gene            complement(343124..344950)
FT                   /locus_tag="Jann_0338"
FT   CDS_pept        complement(343124..344950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0338"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53255"
FT                   /db_xref="GOA:Q28VK7"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VK7"
FT                   /protein_id="ABD53255.1"
FT                   /translation="MIPCGPHRALQNWDMEPTPFPSWQDVASALVATAAGRAPADLVIR
FT                   GAKVVLVQTREVMDGWDVAIKHGRFAYVGPDASHCIGEDTQVEELSGHYLIPGLCDGHM
FT                   HIESGMLTPAEFTRAVIPHGTTSMFTDPHEIANVFGLRGVRLMHDEALLQPINVFTQMP
FT                   SCAPSAPGLETTGFEIGPDDVSEAMAWPGIVGLGEMMNFPGVVNGSQQMLAEIAATQAA
FT                   GKTVGGHYASPDLGPAFHAYAAGGPADDHEGTSETDAMARMRQGMRSMIRLGSAWYDIE
FT                   SQITAITERGLDPRNMIICTDDCFAKTLVEDGHMNRAVRHAIDCGCDPLIALQMATINT
FT                   ATHFGLEREIGQIAPGRRADMIVTRDLRTLPIEVVYARGQRVAQFGECLVECPHLDWPT
FT                   DTRHSVNLGKSLTAADFEIRSDAAEVTANVIGVVENQAPTKALTQTLPVRHGVVEPDGI
FT                   AQIALVERHRGTGGVTNAFVSGFGYGPGMAMASTVAHDSHHMIVVGTDRAMMAKAAMRL
FT                   GEVGGGITLWQDGTERALVELPIAGLMSDRPATEVAAKVTQLVEAMEAAGCTLNNAYMQ
FT                   HSLLALVVIPELRISDLGLVDVRTFELTPVLP"
FT   gene            complement(345037..345735)
FT                   /locus_tag="Jann_0339"
FT   CDS_pept        complement(345037..345735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53256"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK6"
FT                   /protein_id="ABD53256.1"
FT                   /translation="MRVAMWSGPRNLSTAMMYAFGNRPDCEAWDEPFYAAYLAQTGLDH
FT                   PMRQTVLASQPPHYGAVVERLLATPTQPVQYLKLMTHHMLPDTSLTWATGFANIHLIRH
FT                   PARVIASYTAKRAEITLDDIGFPQAARLHTALPGPIIDSADIRAAPEAMLRSLCEAIDL
FT                   PFDPAMLHWPAGPKPFDGAWAPHWYDAVHRSTGFAAAEGHLPEVPDHHRGLLKDALDIY
FT                   ETLHQSRLRP"
FT   gene            345842..346522
FT                   /locus_tag="Jann_0340"
FT   CDS_pept        345842..346522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0340"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53257"
FT                   /db_xref="GOA:Q28VK5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK5"
FT                   /protein_id="ABD53257.1"
FT                   /translation="MPRNPIHETVKVFTLSMAILAGIALQGGRAHAEDIRTTVVAGGCF
FT                   WCVESDFERVDGVIEVVSGFAGGSVPYPEYRDVVRGGTGHLEVVQITYDADVLPYAGLL
FT                   RLFLRSIDPLDAGGQFCDRGESYTTAIFVADERERDIARGAILEAEGSLGQSIVTPVRD
FT                   AAPFYAADEYHQDYYRSNDLVITRFGPRRKSVAYELYRTACGRDARVLEVWGSEAPFVA
FT                   DHLN"
FT   gene            complement(346562..346936)
FT                   /locus_tag="Jann_0341"
FT   CDS_pept        complement(346562..346936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0341"
FT                   /product="protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53258"
FT                   /db_xref="GOA:Q28VK4"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK4"
FT                   /protein_id="ABD53258.1"
FT                   /translation="MAPDARSEVAGATSRPYLAWDTQDDGTTPMTSLFQILLLLLSVVK
FT                   FIVIAHIIMSWLINFGVLNMRQPIVAQIWDGLNRLLEPIYGPIRRFLPNMGGLDLAPLV
FT                   VILGVYAIEIILRNNVALFL"
FT   gene            346989..347519
FT                   /locus_tag="Jann_0342"
FT   CDS_pept        346989..347519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53259"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK3"
FT                   /protein_id="ABD53259.1"
FT                   /translation="MYPYLRFGALVLRERRLPPMGIYDTHAMQMTCLPVDIDGFLEMNN
FT                   GRILTLFDLGRFALSIRIGLFEVLKAQKWGLVVAGSTVRYRSRITTFQTFEMRTRFLGW
FT                   DQRFFYLEQAMWRGDICCNHALLRTGVTAKGRLAPVGDVAKALGVEGDSPPLPAWAQRW
FT                   AEADGTRPWPPEF"
FT   gene            347571..348935
FT                   /locus_tag="Jann_0343"
FT   CDS_pept        347571..348935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0343"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53260"
FT                   /db_xref="GOA:Q28VK2"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK2"
FT                   /protein_id="ABD53260.1"
FT                   /translation="MDTVLPSTATGTRKRIWGWWAFDWASQPYNTLLLTFIFGPYVNEL
FT                   LGDGTQAQTAWGYGVGTAGFLIAISAPFLGAMADLSGRRIPFIWLFSVMYFVGSYGLWW
FT                   AAPGDFNLMLTLILFAIGLIGMEFATIFTNAMLPTLGGRNEIGRISGSGFAWGYVGGLI
FT                   ALVLMLFFFAENAETGKTLLGLDPILGLDAETREGTRAVGPLTAIWFGIGMIPFFLWVR
FT                   DTPLPGAVPMGQALRGAMPALMKTLRRLPSEKPLMAYLLSSMFYRDALNGMYVFGGIYA
FT                   SGVLGWSVVDVGIFGILAILTGAFFSWLGGRADGRFGPKPVIVLNVILLSFVALAVVFV
FT                   SRDSVLGIPVAEGSSLPDIAFYILGAFIGACGGALQSSSRTMLVRQAYPDRMTEAFGLY
FT                   ALAGKATSFIAPLSIGVVTQISGSQQVGVVPLVVLFTIGLILLFWVDPQGRKTND"
FT   gene            349068..349970
FT                   /locus_tag="Jann_0344"
FT   CDS_pept        349068..349970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0344"
FT                   /product="murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53261"
FT                   /db_xref="GOA:Q28VK1"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK1"
FT                   /protein_id="ABD53261.1"
FT                   /translation="MKRLFPFTLMVLAACNTGGPTVQLDATLSGSEARQYFGAETRGSG
FT                   GASEAIGFYSNGCLAGGVELPETGPTWQAMRLSRDRNWGHTELIDYIETLTANVARNTS
FT                   WNGLYVGDMAQPRGGPMLTGHASHQSGIDVDMWMLPARDLTLTEEERENLSSISVRANR
FT                   GATVNENWTADHAEVLRLAASDPRVARIFVTTGVKVWLCQNVEGDRSWLSHIRPANGHH
FT                   YHFHVRLNCPSGDRNCQNQPLPQGDGCQEAYDRAARIINPPPPGPPNNDPPVASPPRGM
FT                   RVALGDMPNQCVGVLSGLQ"
FT   gene            350095..350715
FT                   /locus_tag="Jann_0345"
FT   CDS_pept        350095..350715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53262"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VK0"
FT                   /protein_id="ABD53262.1"
FT                   /translation="MKHISLAALALLMAAPASAGGVVDPAPLDPVIISQPDHDWTGFYA
FT                   GAQLDLVANAETTLEPFGQLMSFNGELAGLFAGYRYDFGDIVLGGEIDYMRGTYDVDEI
FT                   APNILLLSPEVDVELLRAGIEVGYDLGDFLPYATAGYAHLTLDYGGFGEDSGDGWFAGI
FT                   GADYRVSENVTVGAELLHHQFEFNDFGLQHELTTVGINVAFTF"
FT   gene            350894..351484
FT                   /locus_tag="Jann_0346"
FT   CDS_pept        350894..351484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53263"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ9"
FT                   /protein_id="ABD53263.1"
FT                   /translation="MNRFLLPLLAMAFASPVAAQSSLPSSEGGWAGGHLGIQLGMPISS
FT                   SLTFDSAPGIESELDGMSGGVQIGFRRQTNAFVYGGEAAFLVSEPVIEQMGAPDVDVRV
FT                   TTTRLGAQAGYDLGRFLPYGTLGVARMTFQDTVGFGDTSSFGTFAGLGVEYQLGESTSV
FT                   GLQAVRENFENFNEGADINVTQTNVSVQFNIRY"
FT   gene            complement(351543..352382)
FT                   /locus_tag="Jann_0347"
FT   CDS_pept        complement(351543..352382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0347"
FT                   /product="conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53264"
FT                   /db_xref="GOA:Q28VJ8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ8"
FT                   /protein_id="ABD53264.1"
FT                   /translation="MKDDRKPFRDAHQDIEYAKTLPDTPQAQSPAYRLAFADPDFLCRD
FT                   ELRPVRLQLELLKPELGLDEHGIKSTIVLFGGARIPRPEDRDGARSDALRDMSKYYEEA
FT                   RAFAHAITERSVASNCTENVVVTGGGPGVMEAGNRGAQDAGGCSIGLNIVLPHEQEPNH
FT                   YITPELCFNFHYFAIRKMHFLMRAKAIAVFPGGFGTMDETFEALTLIQTGRMEQVPVLL
FT                   FGEAFWREIINWDALVRAGTISAEDLNLFRFVETAQDALDVIDGWTLSGKRGEIPGR"
FT   gene            complement(352518..352910)
FT                   /locus_tag="Jann_0348"
FT   CDS_pept        complement(352518..352910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53265"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ7"
FT                   /protein_id="ABD53265.1"
FT                   /translation="MSKLSLSALCGALLLSAGCVAVPVGPQAGGPAPTTPSAGSLAGSV
FT                   AGQAFVNPQTGQALNLWSDGTYTVSTGNQQSFGTWRTVEPSVQMCFTGPVAAYANGACI
FT                   PVRYDGDFLTLFNASRSQAMEAWAVQ"
FT   gene            353095..353922
FT                   /locus_tag="Jann_0349"
FT   CDS_pept        353095..353922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0349"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53266"
FT                   /db_xref="GOA:Q28VJ6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VJ6"
FT                   /protein_id="ABD53266.1"
FT                   /translation="MSNAQLETAIEAAWEARDTITPATMGETREAIEDTLAALDGGTLR
FT                   VAEKQDSGDWHVNQWAKKAVLLGFRLKDMEMQGGSAQGGSWWDKVDSKWATWGDNEWGA
FT                   AGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAYVDSGTMVDTWATVGSCAQIGKNVHLS
FT                   GGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRE
FT                   TGDVMYGEVPSGSVVVAGSLPSKNGVNLYCAVIVKRVDERTRSKTSINELLRD"
FT   gene            353996..354247
FT                   /locus_tag="Jann_0350"
FT   CDS_pept        353996..354247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0350"
FT                   /product="Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53267"
FT                   /db_xref="GOA:Q28VJ5"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ5"
FT                   /protein_id="ABD53267.1"
FT                   /translation="MQGLGFFAAIIVGGLAGWIASRFMGANTGIILNIILGIVGAVVAN
FT                   FLFGLIGLAPSGGWIMQGFVGFVGACILIAGLRMVRGR"
FT   gene            354312..354683
FT                   /locus_tag="Jann_0351"
FT   CDS_pept        354312..354683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53268"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ4"
FT                   /protein_id="ABD53268.1"
FT                   /translation="MTENEPKKPKKAKAIHQVFTLLVEVGRKAGDGLPKNATGAGLLCF
FT                   ASGVDEAEAVRETVAVLKQADLAPLDVTGYGSLADREHQGDEISDEERQLMERARAENS
FT                   VVVVQMTPFYGDGPDPAEA"
FT   gene            complement(354688..355734)
FT                   /locus_tag="Jann_0352"
FT   CDS_pept        complement(354688..355734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53269"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ3"
FT                   /protein_id="ABD53269.1"
FT                   /translation="MSWQAIWNEGRAFRSPPVVQTAPLRALTLWLELIVPRRPAPRRGR
FT                   GVVRDIPLRLWQGAAGGDRAISLYLIPDGSVRLLHGEIDLCTEPGTLRPGETLGVRYIA
FT                   CAKGRDDVFEVTNFDQDRVQILRSGLAIQSTLGDALPRSDGFLSIAHVAAVAASAMSAT
FT                   DLPGIEGRALIATVDGARAIETLRPGDELLDSQGTPHPLRWIEARPRLCLGRTAPIRLR
FT                   APYFGLRRDLVVTPQTRLLQTGPIVDYLCGTDAVLASAADLATGRAVVRDRTKPMRIFY
FT                   HLMLDDPACLLVENCPMETAHLGDVMALGGRQISQAACPVLSDVTPSLPLLDRAAARAL
FT                   VTAHARAA"
FT   gene            complement(355750..357342)
FT                   /locus_tag="Jann_0353"
FT   CDS_pept        complement(355750..357342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53270"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ2"
FT                   /protein_id="ABD53270.1"
FT                   /translation="MPTGNELPINEGASALQMANTIFGPGVTVNTASYTGWSQSSGIYT
FT                   NGDSVAPGVTPSDTGVILSTGRASHITQSNGDPNRSDSTSTNTPGPSNDPDFNAIAGFV
FT                   GSNDASFLEVNFTPTTDVLTMQFTFASEEYPEYTGSVFNDIFGVWVNGALVASPVVNVT
FT                   QINSVNQSENATLFNNNTDDDYNTEMDGFTVTLTLVMPVNINQPNDIKIGVADVADSAY
FT                   DSNVLIAAGSIQGEFVAESDSITHLEGLTSVLDVLANDPTSGGIAFITHINGVEVNPGD
FT                   SVTLSDGTIVTLLPSGELQIDPPATQTGLTSSETIHFTYTVDNGSGITDTAFVTVTAIP
FT                   CFARGTMILTAHGEKPVETLVPGDRIATRDNGLQEIRWIGTRKVAAEGRFAPIAIEAGT
FT                   FGMHRRLVVSPQHRVMLTHWMAEVMFGEDEVLVAAKDLVNDCSVRVLGPGDFDDGEVEY
FT                   FHLLFDQHQIIFSDGLATESFLPGPTVMNDLDAAVQEEVLALFPDIDPDTKDGYGPAAR
FT                   LPLRAFEARAMLA"
FT   gene            357639..358805
FT                   /locus_tag="Jann_0354"
FT   CDS_pept        357639..358805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0354"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53271"
FT                   /db_xref="GOA:Q28VJ1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VJ1"
FT                   /protein_id="ABD53271.1"
FT                   /translation="MSQIPTHAPVDPVALTADLIRCNSVTPLEGGALVLLEALLSDAGF
FT                   DCTRVDRGGIANLYARWGTRGNGKAFGFNGHTDVVPVGDEAAWTHPPFGAEVDGDWMYG
FT                   RGATDMKSGVAAFAAAAIDFVRDTPPDGAIVLAITGDEEGESTDGTIALLDWMEEVGER
FT                   IDVCIVGEPTCPEQMGDMMKIGRRGALTAFFEVIGKQGHSAYLHKVINPMPAVALLGHR
FT                   LSTHTLDEGTDHFDPSTCAITTIDTGNPANNVIPAKTRMTVNLRFNDLHSGDSLTAWLR
FT                   EEADRVAEDTGTTIRMTTKLSGESFLTPPGDLSDLVGKAVQAETGRQPTLSTTGGTSDA
FT                   RFVKNHCPVVEFGLVGHRMHQVDERVRISDIEDLKRVYGRVLTEYFAG"
FT   gene            complement(358833..359387)
FT                   /locus_tag="Jann_0355"
FT   CDS_pept        complement(358833..359387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0355"
FT                   /product="transferase hexapeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53272"
FT                   /db_xref="GOA:Q28VJ0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VJ0"
FT                   /protein_id="ABD53272.1"
FT                   /translation="MKTERQKMDAGKWYTCLDDELEALRVKARAAVHEHNTLPPDARGA
FT                   MGPKLAQLVRTGAAIIEAPFHCAYGINIVLGEQVFLNAGCTILDCAKVTISDQCQLGPN
FT                   VQIYCAEHHKDPIKRSVEGLEIARPVFIGKQAWIGGGAIILAGVTIGAGAVVGAGSVVT
FT                   KDVGPGAVVVGNPARPVGRAE"
FT   gene            359493..361829
FT                   /locus_tag="Jann_0356"
FT   CDS_pept        359493..361829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0356"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53273"
FT                   /db_xref="GOA:Q28VI9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI9"
FT                   /protein_id="ABD53273.1"
FT                   /translation="MTPPHLRATSPPMSNIPSKEQILQWITDNPGKRSKRDIAKAFGIK
FT                   GAARIDLKRILRELQEEGHLEKVGRTYRDPDKLPPVTILSVQAPDDNGDLFARPLEWHG
FT                   EGVEPRVLYTPRTADPAVGQGDRILAKLFAVEGSDAEDHQYTAKLIRKIGTNPRKILGI
FT                   FRKGAEGGVITPISKGSDKEWQVRAGDTHGAKDGELVEGELAGPKARMGAPRARITTRV
FT                   GDPGAARAVSLIAIHEHGIPDSFPNKVVAEADAAKPAGLTGREDLRDLPLITIDPADAR
FT                   DHDDACYAHADEDPGNKGGHVIWVAIADVAHYVTPDSALDREARKRGNSTYFPDRVVPM
FT                   LPDRLSGDLCSLHEGVPRAVIAVRMVIDARGEKIGHTFHRGLMTSVASLSYEEAQAAQE
FT                   GTLSERTAPLIEGSIRPLFAAYDALKIARAKRQPLELDLPERRIELDDAGNVTSVAFKD
FT                   RLDAHRLIEEFMVLANVAAAETLIAKRTPLLFRVHEEPSPEKLEALREVAASAGLTLAK
FT                   GQVLQTRHLNALLKAAGEDTSELISISTLRSMQQAYYNPENFGHFGLALKSYAHFTSPI
FT                   RRYADLIVHRALIAAHGWGPDAKIDGLSPDEIERLEDTAKLISGTERRSMVAERDTSDR
FT                   YLAAYLSDRVGAEFGGRISGIARFGVFVKLDETGADGLLPMRALGQEYFHFDAEAQTLM
FT                   GADTGTMISIGDRVLVKLAEAVPVTGGLILELLEHDGKAPSRGSGRGARKGGGRGRGKP
FT                   PARRKVSASKARKTKLRKKQDRSRP"
FT   gene            361969..363513
FT                   /locus_tag="Jann_0357"
FT   CDS_pept        361969..363513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0357"
FT                   /product="Lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53274"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI8"
FT                   /protein_id="ABD53274.1"
FT                   /translation="MPGLKYLSFAVVTALAMPALADPPAVSPLPMPRPADGAVTVLDVS
FT                   APSRRNVLIEVIAEEAIEVASADLGLSLTEDEVLADEATAEGGTAAEVEISALASETSP
FT                   RPVPRADVPADFAERAALLRAEAEADEAARRPPRTSDPEFRAWIAEFEARALAAGISAE
FT                   TFARAFDGLQLNTRVLERDRNQAEFSRALWDYLDTAVSATRIRNGREALSEWRTTLGRI
FT                   EAQYQVEAEVVVAVWGLESAYGAMRGSEGIVEAMASLAFDGRRQDFFEEQLIAALQILE
FT                   AGDTRARNMTGSWAGAMGHTQFMPTSYLEFAQDFDDDGRRNIWSDNPVDALASTAHYLV
FT                   EHGWVYGQPWGMEVRLPEGFDYRLAGEQERIGAAFWNAMGVRLVNGDPLPDHGPASILL
FT                   PAGAEGVALVVHSNFRVIERYNPADAYVIAIGHLSDRINGGPGFEAGWPRGDRALTFAE
FT                   REELQRLLRAVGHYDERIDGIVGPITIASVRSYQEAIGVTPDGYASVSILQRLRDG"
FT   gene            complement(363575..364042)
FT                   /locus_tag="Jann_0358"
FT   CDS_pept        complement(363575..364042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0358"
FT                   /product="MOSC"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53275"
FT                   /db_xref="GOA:Q28VI7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI7"
FT                   /protein_id="ABD53275.1"
FT                   /translation="METLATLTARHAQDGRLDWIGLRPKRLADIDAVASARLSADGLEG
FT                   DHARPGKRTLTLIQAEHLPVIAAIAGRPALEPHVLRRNLVVSKLNLQALRGKQIRIGDA
FT                   VIELTIPCAPCSRMEAALGPGGYTAMRGHGGWCARVITPGLLTIGAAVTPA"
FT   gene            complement(364220..364579)
FT                   /locus_tag="Jann_0359"
FT   CDS_pept        complement(364220..364579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53276"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI6"
FT                   /protein_id="ABD53276.1"
FT                   /translation="MAYDNALAARVRHALSDVDDLRDQKMMGALCFMVGDHMCCGVTGD
FT                   ALMVRVGRDGYDAALTEEHVGPMEMTGGRRPRGFVLVDPPGIEADEALVRWIRRGRDVV
FT                   AKLPARTLPQALVKT"
FT   gene            complement(364586..365074)
FT                   /locus_tag="Jann_0360"
FT   CDS_pept        complement(364586..365074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53277"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI5"
FT                   /protein_id="ABD53277.1"
FT                   /translation="MTDAQTRAPHGGVTATTDPTTGEVEASALFGTTPERLFRAITTKE
FT                   ICTWWVRPGVFNTEDWSGDVREGGRWAAAGIGGGQPYQLEGEFVTVEDPRRLAQTWTPV
FT                   GAPFEPALLTYDLTPQPGGVHLTLRHSGLPNADVCEKTRAGWETSLARLQEIIAAEKE"
FT   gene            365165..365584
FT                   /locus_tag="Jann_0361"
FT   CDS_pept        365165..365584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0361"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53278"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI4"
FT                   /protein_id="ABD53278.1"
FT                   /translation="MALDDDTNRGPGVSLLTGLDMSHITLCPAIAFNKIVGGRYKLHIL
FT                   CVLHRGPLRFGEIGRSLVKGGLGKPVTPRILSRELKDMTELGLLDRKEYPVVPKKVEYA
FT                   LGPRGKALLPILSEIVRWGATGVHEDMLEVSQSRH"
FT   gene            365685..366104
FT                   /locus_tag="Jann_0362"
FT   CDS_pept        365685..366104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0362"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53279"
FT                   /db_xref="GOA:Q28VI3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI3"
FT                   /protein_id="ABD53279.1"
FT                   /translation="MSPPFKIRALGEIAIRCDDLARMAAFYGDILGLERMVGSAAPNIV
FT                   FFRIAEGFGGHTQILALFEKDAQGPVTGAASSLHHIALTVRYADQDAIMAWYEEQGLTY
FT                   RVEHFGWVGWRGVFTTDPEGNTVELVAYDASLKDA"
FT   gene            complement(366101..366958)
FT                   /locus_tag="Jann_0363"
FT   CDS_pept        complement(366101..366958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0363"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53280"
FT                   /db_xref="GOA:Q28VI2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI2"
FT                   /protein_id="ABD53280.1"
FT                   /translation="MTRTVYVNGQYLPEQDATISIFDRGFLFADGVYEVTSVLDGKLID
FT                   FDGHARRLQRSLDELDMANPTTEDELLEIHRELVRANDITEGLIYLQVTRGAADRDFVY
FT                   PADDTPPTIVLFTQNKPGLAGNPMAQTGMKVISIEDQRWGRRDIKTVQLLYPSMGKMAA
FT                   KAAGAHDAWMVEDGMVTEGTSNNAYIVKGNTIITRNLGHEILSGITRAAVLRMAEEAQM
FT                   KVEERPFTMDEAKAADEAFVTSATTFVMPVVEIDGEAVGTGTPGHVTARLRDIYLDEMR
FT                   KAAV"
FT   gene            complement(366992..367789)
FT                   /locus_tag="Jann_0364"
FT   CDS_pept        complement(366992..367789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0364"
FT                   /product="putative polyhydroxybutyrate depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53281"
FT                   /db_xref="GOA:Q28VI1"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI1"
FT                   /protein_id="ABD53281.1"
FT                   /translation="MRLILATALALLASPALACGPDTDCSVANDRTYRYYMPADTTGPV
FT                   GAFFHAHGYRGSAGGAMNNAALRAMADRLGMAFIAMNADADDWNLAYRPRNPQQAEAAE
FT                   AAYVDAVIADVATRIDLDQSRLIATGFSAGGMMTWTLACEMGDVFAGFVPYSGTFWRTI
FT                   PATCPTPAAPLIHIHGDGDTVVPMEGRAIGPTRQGNVYDALAMYADHGAQPEATLQEMP
FT                   EGLTCFLRENAEGTVLDLCMFSGSHAYSTARVEWAIERILNRL"
FT   gene            complement(368087..369040)
FT                   /locus_tag="Jann_0365"
FT   CDS_pept        complement(368087..369040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0365"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53282"
FT                   /db_xref="GOA:Q28VI0"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VI0"
FT                   /protein_id="ABD53282.1"
FT                   /translation="MFKITRDKFKLDEVFTISRGSKTHAEVLTFEIDQGASGRGRGECV
FT                   PYARYGETLDSVEAQIQDYIDNGDSARFPPGAARNAIECAILDAEAKCNATTVWEMLRQ
FT                   PVPQPVTSAFTLSLDTPEKMRASAAKHAARPLLKIKLGTADDMARLEAVRAGAPKAAII
FT                   VDANEGWTAEIYTDLAPHLLRLGVQMVEQPLPAGQDDMLSEIARPLPVCADESCHDRAS
FT                   LPDLKGKYDMVNIKLDKTGGLSEALALRDAARAEGYTVMVGCMVGSSLAMAPAMLVAQG
FT                   AEIVDLDGPLLLAEDRTPPLKFDGSTIHPPEAALWG"
FT   gene            complement(369040..370041)
FT                   /locus_tag="Jann_0366"
FT   CDS_pept        complement(369040..370041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0366"
FT                   /product="protein of unknown function DUF1611"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53283"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH9"
FT                   /protein_id="ABD53283.1"
FT                   /translation="MIETPYLLFLGDAPDQLAAKVAQGIRDWRPENVIGQFRMEGCNAD
FT                   VKVADMDLAAAKASGAKTLVVGIANQGGYISPAWKRVLIEALAEGFDIASGLHNLLSDE
FT                   PDLVAVAKEYGRQLHDVRIPSVAYPIANGKKRSGKRCLAVGTDCSAGKMYTALAMDKEM
FT                   KARGLKSSFRATGQTGILVTGDGVPLDAVIADFMAGAVEWLTPDNDDDHWDMIEGQGSL
FT                   YHVSFSGVTMALIHGGQPDALILSHEPTRTHMRGLPHYALPTLEQLRDTALPLARIANP
FT                   KAEVVGISVNTAALGEDEALQTLADIEKRMGLPTADPFRQGAGRLCDALDAI"
FT   gene            complement(370189..370539)
FT                   /locus_tag="Jann_0367"
FT   CDS_pept        complement(370189..370539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53284"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH8"
FT                   /protein_id="ABD53284.1"
FT                   /translation="MSEYLPKEIRDQLAAARRQGKRKRATRSVHVGDEAFAIIEMSDHG
FT                   FALDTETAPRLRGLIDIYDGAQHLYQALIMASSEDGDLMRYDFKRNTATARTAPVDFVQ
FT                   SDTRPAGLLSKA"
FT   gene            370832..371812
FT                   /locus_tag="Jann_0368"
FT   CDS_pept        370832..371812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0368"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53285"
FT                   /db_xref="GOA:Q28VH7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH7"
FT                   /protein_id="ABD53285.1"
FT                   /translation="MGLLVDGTWQDTWYDTKKSGGAFKRQAAQFRNWITADGSAGPSGE
FT                   GGFKAESGRYHLYVSHACPWANRTLIFRALKDLQDHIDISVVHPDMMGDGWTFDTSHDG
FT                   ATGDTLYGLSFARDLYTKAQPGVTTRVTVPILWDTQRETIVSNESAEIIRMFNTAFNDI
FT                   TGNADDYYPEALRPRIDDINGRVYSDVNNGVYKSGFATSQDAYDGAVHALFDALDWLED
FT                   ILADNRYLTGDTITEADWRLFTTLVRFDPVYHLHFKCNRKRIVDYPNLWAYTRELYQWP
FT                   GVADQINFDHIVRHYHYSHESINPHRIIPINPQIDWTAPHGRSDR"
FT   gene            371855..372832
FT                   /locus_tag="Jann_0369"
FT   CDS_pept        371855..372832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0369"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53286"
FT                   /db_xref="GOA:Q28VH6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH6"
FT                   /protein_id="ABD53286.1"
FT                   /translation="MNVPFPKRDHGGGLDAAAAEYGGDLEAWLDLSTGINPNAYPVGQL
FT                   PQDIWGRLPDEGAMARLLDAARSFWSVPDGVEVIAAAGASPLIARMPDMTAFSGAYIPV
FT                   PTYNEYAAAFAARGRLNDPLNPQNPVHVYVHPNNPDGRMWPGSVIGGRPLTIIDESFCD
FT                   TVPDKTHMARAAEPGVIILKSFGKFWGLAGLRLGFAIAAPETFARSSSSASLQELMGPW
FT                   SVSGPALEIGARALQDHAWAEATRVRLGHDAARLDDMLLSAGAEIVGGTTLFRTYAWEQ
FT                   GAEVWQKRLAEHRIWSRIFPYSTNWMRLGLPATDEDWARLDAAL"
FT   gene            372829..373788
FT                   /locus_tag="Jann_0370"
FT   CDS_pept        372829..373788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0370"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53287"
FT                   /db_xref="GOA:Q28VH5"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH5"
FT                   /protein_id="ABD53287.1"
FT                   /translation="MIATAGLLFAAMILDALVGEPRWLWSRIPHPIVLMGRLIDWCDAT
FT                   FNRGAQRLNGGLVMAALGLSALGLGWVIAALPLGWLWQILIAAVLLAQRSLVDHVAAVA
FT                   VGLRRSLADGKRAVAMIVGRDTGPLDDAAVARAAIESAAENMSDGVVAPAFWFLVGGLP
FT                   GLLLYKITNTADSMIGHRTPRHEAFGWAAARFDDVLNYVPARLTALLIALTHGFDALRC
FT                   AYRDGPKHRSVNAGWPEAAMASALGLSLSGSRAYGGEMTEDPALNATGSRDATPGDIKA
FT                   AIRVLWRVWWAMLGGSVICILLGGWGALLLATVLLALI"
FT   gene            373855..375027
FT                   /locus_tag="Jann_0371"
FT   CDS_pept        373855..375027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0371"
FT                   /product="Lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53288"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH4"
FT                   /protein_id="ABD53288.1"
FT                   /translation="MRFLAPLLLSLSIGTAAHAQQCGGDFNQFVQGLRAEAAERGHSQE
FT                   AIDGFFRHASYYQRALDADRRQGIFTVPFTDFARRLISQGRMDNGRRNADRQAATFAEI
FT                   ERRFGVSQGILLAFWAFETDYGAFQGDYNTLDSLVTLAHDCRRPELFRPEVFGALELYE
FT                   MGDFDPVNTQGAWAGEIGMVQMLPEDIVAHGIDGDGDGHVYLQTSAPDALMSGANILSS
FT                   LGWRPGEPWLVEITVPQDLDWYQTGIHTTRSVADWQADGVAGRSGALPMPNAQASIVLP
FT                   QGRNGPAFMAYQNFNVLFEWNQSFTYVLTAAYFATRLEGAPVFDARNPEPGLGGDQMRR
FT                   LQTALQARGYDVGRIDGILGAGTRAAVREEQRRLGLPADAWPTSALLNAL"
FT   gene            375153..375998
FT                   /locus_tag="Jann_0372"
FT   CDS_pept        375153..375998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0372"
FT                   /product="ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53289"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH3"
FT                   /protein_id="ABD53289.1"
FT                   /translation="MHDIHHIPLSDIDADALPRDRISLAPSALSELQASIASLGLTHPI
FT                   EVWAKHDPLPDAPRHGLISGLRRLTAMRALGHTTIPAFIRAPSDIAEAMTRMVAENEIR
FT                   AAISPWEKGRLVTEAVAEGLFPTFDAATDSLYRTLDRHRRARIRAMADVVAEIGDHLLT
FT                   SPETLSQNQITRIAFALRADLGPLITTALRTSKQKSPDAQWKTLLPILLEAEETARTPR
FT                   APLYREGRPRRMAQVRSKLHIRRERTPDGWSLRFTGPEATGPLMEDIMDRVEGDFGQTR
FT                   "
FT   gene            376200..377846
FT                   /locus_tag="Jann_0373"
FT   CDS_pept        376200..377846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53290"
FT                   /db_xref="InterPro:IPR026487"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH2"
FT                   /protein_id="ABD53290.1"
FT                   /translation="MAKTRSYSLYLVKSDVEDFEDIFSENARDKIKAGDASLSESSELG
FT                   DQAVVYIFPGPPKPPSWLSEVTTVFQGIPALTNRSSCAVVVFKYASRIFVTAFAHGWQY
FT                   LDDSKIESDFGLMVAINSLDDAKVKRIDSSHLGEAMKGVSQSAFQRDLQAFGVDEALDL
FT                   VRRISGRVEDDDFASSISGATGLKITREMNLFDLPQIAEEALSRSKSKDYRNTGFYIID
FT                   KVRPILDRVVLATLDQKAVDVIKTGDDNFELSMPGWSDDDVVYYGLYGPRLRGRFPDLL
FT                   MSNYRAALGSTELAKLDVNKIQKHGVLAEFNNDGGAKKRWSLKKALVGSIVDSGGLYAI
FT                   SEGEWYRLDEQFKADVDAGFATLKEGWSNPPEVIKKMVSDDGKKTGFESEFSYNERCAN
FT                   KYGQVLLDQRILTVPAIPYGKFEAADLLDIEGKRLIHVKKSSRQSSVLSHFFKQGSNSA
FT                   RILKTIPEAREALVSKVRDLTDDVTADSLQTAMGEAMSGWKIEFHIVDAPRKDGTFMIP
FT                   FFSRITLRDESRTLKGMTYGVSLRFIPMPST"
FT   gene            complement(378024..381479)
FT                   /locus_tag="Jann_0374"
FT   CDS_pept        complement(378024..381479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0374"
FT                   /product="Chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53291"
FT                   /db_xref="GOA:Q28VH1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH1"
FT                   /protein_id="ABD53291.1"
FT                   /translation="MRFTKLRLNGFKSFVDPTDLVIADGLTGVVGPNGCGKSNLLEALR
FT                   WVMGENRPTAMRGAGMEDVIFGGAATRNARNFAEVSLQIDNTDRLAPAGFNEEDQIDII
FT                   RRITRDAGSAYKLNGKDVRARDVSMLFADASTGAHSPALVRQGQISELINARPKARRRV
FT                   LEEAAGISGLYQRRHEAELKLKGAEANLARIDDVLDQLASQLNTLARQAKQAARYREIG
FT                   TELRLTEGLLLFVRWRDADAARLRAEDALRDGLTAAAQAEVAARTAVEAREQAEEDLPP
FT                   LREEDTIAAAILQRLLVERDNLQAEADRAAAAVETLTNRITQIDKDREREEALNSDAGE
FT                   TVARLQAERTELQTAQKGQDARLGDARDAVTDARSVLAGQEAELSDLTEQSAALAARYQ
FT                   AIQRRMGEAEKAVARNTTDAQSAEQAASDAADRLQTLKREAEETADALTRATDLAARAE
FT                   ETLVETETARADAQAKETDARSARSEAEGRAGTLDAEVTALARVLERERGDGTQVLDEI
FT                   KVSPGFEAAIGAALSDDLKAARADTEGATGWTDLPDYDAAAPLPEGAQPAADVAQAPDV
FT                   LARRLSHIGIIDAADGPRLHSTLQPGQRLVSKAGDLWRWDGFAVAAADAVSTAARRLEQ
FT                   ANRLSELEEERLRARDKADDAKAAHKALAERLAHLTEADKSARTARRDAETQLSQASRA
FT                   AARAEADQSVLDGKLETLRLTASRHAEEADTARAELTRARDALAELDDLDAVRGRLDDV
FT                   KVTVEAARMTMLSKRAAFDEIKRDGEDRVSRIAKIGTEITNWQNRLTNAASRLAELEKR
FT                   RGEAETALAEAREKPARVAMRREQLAIQITQAEARKATSADALSVGEMNLRAASGAERD
FT                   TERAAGEARELRAASEARRDAAMEAVRTAADRITEEMELTPEALLDTLGDLPAPMPPAD
FT                   RIEQDVMRLRRQRDALGAVNLRAEEDSHEVQDEHDTLASEKTDLEEAIAKLRTGINSLN
FT                   KEGRERLLKAFDEVNTNFSRLFTHLFGGGEARLVLVESDDPLEAGLEILCQPPGKKLST
FT                   LSLLSGGEQTLTALALIFGVFLANPAPICVLDEVDAPLDDANVTRFCDMLDEMTRSTNT
FT                   RFLTITHHAVTMARMDRLFGVTMGEQGVSQLVSVDLKVAETLVA"
FT   gene            complement(381660..381890)
FT                   /locus_tag="Jann_0375"
FT   CDS_pept        complement(381660..381890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0375"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53292"
FT                   /db_xref="GOA:Q28VH0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VH0"
FT                   /protein_id="ABD53292.1"
FT                   /translation="MQTLEVIVRLDVMMARRKMKGRDLAAQIGITEANLSLLKSGKVKG
FT                   IRFETLAKICAALECQPGDVLEVMAPVLDPN"
FT   gene            complement(381890..382522)
FT                   /locus_tag="Jann_0376"
FT   CDS_pept        complement(381890..382522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53293"
FT                   /db_xref="GOA:Q28VG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG9"
FT                   /protein_id="ABD53293.1"
FT                   /translation="MPRAGIMCFISSPFLNPIIIVLQKVFSLLQGVMDNLLQTRRIARP
FT                   LSYLTTAALFAYPVTLAVLALSGYFDAAYLRDAYASTTLPDVIPKGTWVAVYAIALVSV
FT                   ALVCVLLWNIRALLVLFAIGDVLGAEVAHRIRRIGGLLLALAIYGVVSNTLTILALTAA
FT                   NPPGARSLAIGVSNTDLFLFLAAGLMTVIGLAMSEAARIAAENRGFI"
FT   gene            383203..383664
FT                   /locus_tag="Jann_0377"
FT   CDS_pept        383203..383664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0377"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53294"
FT                   /db_xref="GOA:Q28VG8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG8"
FT                   /protein_id="ABD53294.1"
FT                   /translation="MEDRVLTGLNQAEAKTSATAATAQDRGARTQTAYSSEELLERILT
FT                   SLTDDKAEDVVQIDLRGKSSIGDYMVVASGRSTRQVSAMAEKLVDKLKTDFGLYSKIEG
FT                   KDSGDWVLIDTADVIVHIFRPEVREFYQLEKMWQPEAPETTPGPGAAAP"
FT   gene            383715..384128
FT                   /locus_tag="Jann_0378"
FT   CDS_pept        383715..384128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0378"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53295"
FT                   /db_xref="GOA:Q28VG7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VG7"
FT                   /protein_id="ABD53295.1"
FT                   /translation="MIDDYLRRFDKTGRGLGLSLGQVVEVENRKGGGMAAEADLIRARL
FT                   PGGVFWVMDERGDVMTSPGFADRLGAQRDRGAGDLTMVIGGADGIDPTLRDEAGMAISF
FT                   GKMVWPHMLARVMLSEQLYRAASILAGGPYHRV"
FT   gene            384340..385854
FT                   /locus_tag="Jann_0379"
FT   CDS_pept        384340..385854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0379"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53296"
FT                   /db_xref="GOA:Q28VG6"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG6"
FT                   /protein_id="ABD53296.1"
FT                   /translation="MTDHPRPVVLCILDGWGIGQTQADNAPLLADTPVMDDLMARCPHA
FT                   TLLTHGRDVGLPEGQMGNSEVGHTNIGAGRVVKMDLVEINDAIEAGEFAGRAALVAFVE
FT                   TLKKSGGTAHLMGLVSDGGVHSQLAHLEAAVAVLVEAGVPVAVHAITDGRDVAPKSADG
FT                   FLRGLTLPEGAKIATVCGRYFALDRDTRWDRVERAYSAMVRGEGDGANDALGAVAQAYD
FT                   ADKTDEFIPPTVVGDYAGMRDGDGIFMLNYRADRAREILSALGDQAFDGFDVTGRPKFA
FT                   ARLGMVDYSKAHDAYMTTVFPKQEIVNTLGEWVSKAGLRQFRVAETEKYPHVTFFLNGG
FT                   VEVPEPGEDREMPKSPNVATYDLQPEMSAREVTDLLVRAIREPYDLIVVNFANPDMVGH
FT                   TGDLQAAIAACEAVDAGLGQAVAALEEMGGAMIVCADHGNCEMMVDPETGGPHTAHTTN
FT                   LVPVVMVGGPAGAGLRDGRLADLAPSLLALMGLEQPAEMTGESLIR"
FT   gene            385851..387011
FT                   /locus_tag="Jann_0380"
FT   CDS_pept        385851..387011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0380"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53297"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG5"
FT                   /protein_id="ABD53297.1"
FT                   /translation="MTSLRLHMIRPLLGLALIAALPLLAAVPGTAQSDPALTAREAGDM
FT                   LEAAAEALREAEGARDQVEALTETVRAYEHGLDALRAGIRDAALSERTILLVFDAERDR
FT                   LARLIGVLQRIEDAPAPATLLHPEGPLGTARLGMIVADVTPAVAREARALRAQLQELAE
FT                   LRAVQDDAVVQLQAALMGVQTARSALSQAIADRVDLPERFSLDPEAMARIAESVDSLGS
FT                   FAALLAETPAPTIDVVRDFATARGDIPLPALGTLVRGFNEADAAGITRPGALLAVPQTA
FT                   LLTAPWPASIRYAGPLLDYGNVIILEPQADYLLILAGAGDVFVTAGELVPSGAPLGLMP
FT                   DGNSDVEADLIVSDALGASAGLTETLYMELRQGGNPVDPMEWFAAQ"
FT   gene            387045..388370
FT                   /locus_tag="Jann_0381"
FT   CDS_pept        387045..388370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0381"
FT                   /product="carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53298"
FT                   /db_xref="GOA:Q28VG4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG4"
FT                   /protein_id="ABD53298.1"
FT                   /translation="MKKLMMAAVGGIAGGVLLSTQVAGPLLAQEAERNSSVYEQLDLFG
FT                   DIFERIRQNYVEDVDEAELIEAAINGMLISLDPHSSYISASDFEDMQVQTRGEFGGLGI
FT                   EVTQEDGFVRVITPMDDTPAMEAGVEAGDFITAVDGEALLGLTLEQSVDLMRGPVGSDI
FT                   IITIVREGADEPFDLTITRDRIQLTAVRARLEGNTAILRVSTFSDQTFPNLREGLLELI
FT                   EEVGGLDNMNGVVLDLRNNPGGLLNQAIRVSDAFLEQGEIVSTRGREPQDGERYNATPG
FT                   DMIEGLPMVVLINGGSASASEIVAGALQDHRRAVVVGTNSFGKGSVQSVMPLAGDGAMR
FT                   LTTSLYYTPSGRSIQALGVAPDIIVEQRDPIEVEEDEDGRPARTEAGLRGAIENSSLTE
FT                   DQLQQLEEERAIAEATAALRNEDYQLAYAIDILTGLGALGPN"
FT   gene            388371..388832
FT                   /locus_tag="Jann_0382"
FT   CDS_pept        388371..388832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0382"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53299"
FT                   /db_xref="GOA:Q28VG3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG3"
FT                   /protein_id="ABD53299.1"
FT                   /translation="MADLPYRPCAGVVLTNADGRIFAGQRAGFDTPAWQMPQGGLDKGE
FT                   DPLDAAYRELEEETGVGRDHVTFVAQTTDWLTYDFPPELALGRWKGKYGGQKQMWAHLQ
FT                   LDAPDSVINLTHKDVEFSDWRWMTKRDILTAIVPFKRGIYKAIFKEFGL"
FT   gene            388829..389311
FT                   /locus_tag="Jann_0383"
FT   CDS_pept        388829..389311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53300"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG2"
FT                   /protein_id="ABD53300.1"
FT                   /translation="MIRCAAFALSVFAAGPAVALSCAVPSVADSYGGAAASATDYVIGV
FT                   GALALTGQTNPPEGAVAQGGDINQMVGYTQPAQFTGGLFTGNGFGPSQHVNIEVNVTCI
FT                   VAWCGQAAEVDNALFFFRATNAGYVLDEGACPGNVFYDPTPAQLQQVQQCYDSGTC"
FT   gene            389298..389678
FT                   /locus_tag="Jann_0384"
FT   CDS_pept        389298..389678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53301"
FT                   /db_xref="GOA:Q28VG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG1"
FT                   /protein_id="ABD53301.1"
FT                   /translation="MARARQRCSGGVGGMNCALRPDLNVPHRIGSPSEREEAFFSLPRR
FT                   YLSAMIYCALSLRYLSAMIYCALSLRYLSAMTCYALPRRYLSAMTCYALPRRYLSAMTC
FT                   CALSLRYLSAMIYCATASLLER"
FT   gene            complement(389675..390853)
FT                   /locus_tag="Jann_0385"
FT   CDS_pept        complement(389675..390853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0385"
FT                   /product="Cupin 4"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53302"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VG0"
FT                   /protein_id="ABD53302.1"
FT                   /translation="MTNTFSFDWAIAPETPDTFFAEYFEKKPMLIKRGQPGYFSDLLSY
FT                   GEIDRVVSTMGLHVPEINVTRADGNITPADFAYETGQIDPVRVNQLHADGATVILSGLH
FT                   ERLPALARYCRAMEAAMSARVQTNIYMTPPGNQGFNPHYDGHDVLVLQVAGTKEWRIYG
FT                   TPVELPLADQAFERGMDVGEEAQRFVLEPGDAVYIPRGMAHDAVATDETSLHITTGLMF
FT                   RTWADALAEAVIAKAHREPSLRRALPPGFANNGVDLDDYKDTFAELIELVGDAHVGKLL
FT                   SGFREEFLTARVPRVEGQMAQLAKLDGLTMDSRMGAHPHIVFGIHDVPNEDQVCLVAQG
FT                   AEIILPAHARDAMEFCITTADFRLGDMEGDLDDAGKMVLAKRFVREGLMRVL"
FT   gene            391017..391307
FT                   /locus_tag="Jann_0386"
FT   CDS_pept        391017..391307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0386"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53303"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF9"
FT                   /protein_id="ABD53303.1"
FT                   /translation="MSSNDKKTKSLTDADISTDRPTGRRTFLGAMGAAGVGAALVPTGA
FT                   AAQGTDSDNGSWTDAAGCGRGSGGYSTGITDADNGSLGTDAPGAGRGAPYC"
FT   gene            complement(391364..392284)
FT                   /locus_tag="Jann_0387"
FT   CDS_pept        complement(391364..392284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0387"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53304"
FT                   /db_xref="GOA:Q28VF8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF8"
FT                   /protein_id="ABD53304.1"
FT                   /translation="MGDTAPYPGLAPDLWDLAREMAADPDPVPEHLRPISQLRAAVARM
FT                   EAALPPVPDDIQTRDWTMDVAGRAVPLRSYQTADARAAAMLYIHGGGWSLGSIRGHDLI
FT                   CADIARDTGLRVVSIDYALAPEHPYPAALTECVAVFQHLRTGASPLETVPGLWLGGDSA
FT                   GGNLALGAALKTKGAAGLFLIYPATDPTCGADSYTTHANAPYLSRDMMHRCWRDYLGGQ
FT                   SPDIYTSPNTADLRSLPQAVILTATLDPLLGDGEELAATFLAAGTPVWYETASGLIHGF
FT                   LRFRAISPASDAAFRRATAALAVRL"
FT   gene            complement(392285..392986)
FT                   /locus_tag="Jann_0388"
FT   CDS_pept        complement(392285..392986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0388"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53305"
FT                   /db_xref="GOA:Q28VF7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF7"
FT                   /protein_id="ABD53305.1"
FT                   /translation="MPDNTSSVSDTRIASTRVVQLGILAVVVVLVTSAVLLFVNLPDAD
FT                   AFNEAVVQVFEANEVRDPDAIRMLEVLAQSGTTFSKVLASYRAVIFVLMIFATALLVAC
FT                   LVFLVTIITLNRRMREIERQGIQVSSLILSREERVVLINNLEFKLTDAAMETLSVLAEA
FT                   RLDDDVLTGAQIESMVSGKHETDVDEAAGATRIKRLRDTLGNQMVSELLIKNIARRGYI
FT                   LAIDKDVIKMM"
FT   gene            complement(392958..393293)
FT                   /locus_tag="Jann_0389"
FT   CDS_pept        complement(392958..393293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53306"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF6"
FT                   /protein_id="ABD53306.1"
FT                   /translation="MKLPPFSTIDEHSIMTRFLKPLLAALALSVLAGPLHAACYADYRA
FT                   RMDNPLRLHYGVMQVPDSACSVGAASGVVAGRLSAQGWTLVNVSSVFDDSGLASRRADA
FT                   GQYFLRF"
FT   gene            393559..394059
FT                   /locus_tag="Jann_0390"
FT   CDS_pept        393559..394059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53307"
FT                   /db_xref="GOA:Q28VF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF5"
FT                   /protein_id="ABD53307.1"
FT                   /translation="MLRHLSRSFTAGALAITLALTGITATASPAAANNHRNNGGEAAAV
FT                   LGGLLLLYGLSQAGRNNGDRRQPQVIQPHRPHNPQPQFHPQPRFQPQPQFQPVHRVAPQ
FT                   HCFVQGHDGNGQYRGYRYRCMQNHAAQAHFLPSNCLRHVWTDRGQRTIYSARCLSNHGW
FT                   TFG"
FT   gene            394195..394794
FT                   /locus_tag="Jann_0391"
FT   CDS_pept        394195..394794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0391"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53308"
FT                   /db_xref="GOA:Q28VF4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VF4"
FT                   /protein_id="ABD53308.1"
FT                   /translation="MGPDFEIERELGGLVAGVDEVGRGPWAGPVTACAVVLDPMQVPDG
FT                   LNDSKKLSEARRDALAMQILRVADVSLGWASVEEIDALNIRQATFLAMRRAMDGLTTPP
FT                   THALIDGNAIPPGLSCPATCVVKGDGRSVSIAAASIVAKVRRDALMKELAVMHPGYGWE
FT                   TNMGYGTAKHAAGLHHLGVTQYHRRSFAPIAKILCG"
FT   gene            394900..396003
FT                   /locus_tag="Jann_0392"
FT   CDS_pept        394900..396003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0392"
FT                   /product="DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53309"
FT                   /db_xref="GOA:Q28VF3"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF3"
FT                   /protein_id="ABD53309.1"
FT                   /translation="MTINTKEKAAQALPLNTILAGDCIDVMNALPEASVDLIFADPPYN
FT                   LQLKGDLHRPNNSLVDAVDNDWDQFDSFKAYDAFTKAWLAAAKRLLKPGGAIWVIGSYH
FT                   NIFRVGAELQTQGYWILNDVVWRKSNPMPNFRGKRFTNAHETMIWASKDEGAKYTFNYE
FT                   ALKELNEGIQMRSDWVLPICNGSERLKDDKGDKAHPTQKPESLLHRVLVGSTNPGDVVL
FT                   DPFFGTGTTGAVAKALGRDYIGIEREEAYRVVAEKRLSRVRKFDKTSIAVTTPKRAEPR
FT                   VPFGQLVERGMLRPGEMLFSPRGQQAKVRADGTLIADDVKGSIHKVGAELEGAPSCNGW
FT                   TYWNFKRDGKNVSIDVLRQQIRAEMAG"
FT   gene            396206..396841
FT                   /locus_tag="Jann_0393"
FT   CDS_pept        396206..396841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0393"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53310"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF2"
FT                   /protein_id="ABD53310.1"
FT                   /translation="MKISVIGASRGIGRKVVEEALERGHSVTGMARSATSLGIDHAEFT
FT                   AIDGDATNATDVTQAIDGADAVILTLGVPKDARVLKSTTLFSDATRTLITAMEEAGIKR
FT                   LLTVTGFGAGDSKEKLSTPERLTQKAFLGRAYADKDLQEKLIRDSDLDWTIARPGILSD
FT                   NRKSNAYKVLVEKETWRNGLINRSDVADFLVTAAEDESHIHKTPALQR"
FT   gene            complement(397003..398136)
FT                   /locus_tag="Jann_0394"
FT   CDS_pept        complement(397003..398136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0394"
FT                   /product="alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53311"
FT                   /db_xref="GOA:Q28VF1"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF1"
FT                   /protein_id="ABD53311.1"
FT                   /translation="MISADKFAKIHRALPFWASLALIPLIAFVATKGGWWLVLIPLSTW
FT                   WLFAMLDQVAGLELENADPTTPDDQLFWYRAITLIWPPLQFATLFAVIFYATRADHLGG
FT                   VELVFLSFGMGVLSGTIGINYAHELMHQKSRLERWLGDLLMASVLYSHFRSEHLLVHHR
FT                   YIGTGRDPVTARYNEGFHRFFPRVLRESYGSSWRAEKTMLARKGLPWWDGSNPVWRYLA
FT                   LQAGFTALAFGIGGWVGLAIFLGQAFVAVWQLELTNYIEHYGLTRKHLGGGKYEHVQPR
FT                   HSWNAAHKASNWLLINLQRHSDHHYKPDRPYPLLQTYGEADAPQFPYGYPVMTAAAMVP
FT                   PLWKRVMNPRVKRWRAMYYPEITEWQAYDKLTHPEPR"
FT   gene            complement(398123..399160)
FT                   /locus_tag="Jann_0395"
FT   CDS_pept        complement(398123..399160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0395"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53312"
FT                   /db_xref="GOA:Q28VF0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VF0"
FT                   /protein_id="ABD53312.1"
FT                   /translation="MLDWYDVHARDLPWRVPPLSGLDADPYRVWLSEIMLQQTTVAAVK
FT                   AYFQRFTALWPTVGDLAAAEDAAVMGEWAGLGYYARARNLLKCARVVVEEHGGQFPRTE
FT                   AELLELPGIGPYTAAAVASIAFQQPAPVMDGNIERVMARLFAVEDPLPGCKSVLKEHAT
FT                   RLTPNDRPGDHAQALMDLGATICTPKNPACGICPVMEACTAHKRGIAADLPKKAPKKAK
FT                   PTRLGYVYVARQEDGSVLLETREEKGLLGGMLAFPTSDWSEAPTDVPPFAADWHDPGLE
FT                   VRHTFTHFHLRLALRVTNAASDTSPQRGEFLPRALFKPSSLPTLMRKAHDLSVGHFTGD
FT                   DHDLG"
FT   gene            399267..399806
FT                   /locus_tag="Jann_0396"
FT   CDS_pept        399267..399806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0396"
FT                   /product="protein of unknown function DUF1159"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53313"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE9"
FT                   /protein_id="ABD53313.1"
FT                   /translation="MPPRHTSGSYQAKSPNARRRRGFERAVTLVGPELKTPAEKRGFAE
FT                   TKLLTHWAEIAGPEIADMAVPVKVKFGRGFGGTLVLLTTGAKAPMLEMSREIIITRVNA
FT                   CYGYSAIKDVQVTQTAPTGFAEGQVAFNASKPKVKATPDPARMEKATKDLDHISDPVLR
FT                   DALRKLAGNIISQTNR"
FT   gene            399818..400501
FT                   /locus_tag="Jann_0397"
FT   CDS_pept        399818..400501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0397"
FT                   /product="thiol:disulfide interchange protein DsbA family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53314"
FT                   /db_xref="GOA:Q28VE8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE8"
FT                   /protein_id="ABD53314.1"
FT                   /translation="MQRRAMLLGGATGILGAGAYLLWNGRGGQRFQTEAPLTPFTAANA
FT                   QEATDLPDVLEMSKGNPDSGVTLIEYASFTCPHCRSFHTNVYPDLNRDYIEPGLINFVY
FT                   REVYFDRYGLWAGMVARCGGPLRYFGIVDLIYAQQSEWTQGSPAEIAENLKRIGRAAGL
FT                   SNEELDACMTDAAMAEAMIANYEAQMEEHPIAGTPAFVLNGEMSGNMNYNELRGRLDAA
FT                   IEAAG"
FT   gene            400508..401023
FT                   /locus_tag="Jann_0398"
FT   CDS_pept        400508..401023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53315"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE7"
FT                   /protein_id="ABD53315.1"
FT                   /translation="MQQALGAGRVFASHYQFVLCEDPDRVLADAENWTDDTIQLGFAGV
FT                   PKWRMIGTEANLNDHWIELSLDDQAPEPEHWQRIICCGFETATGAVHVMGLMDADPAIS
FT                   AKIAPGAYAAYICGRNLGVDAEGSELPTDAELAARDDVERYRIILVPGAPSEVGVLYDR
FT                   GGDAGSAP"
FT   gene            complement(401012..401998)
FT                   /locus_tag="Jann_0399"
FT   CDS_pept        complement(401012..401998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0399"
FT                   /product="lipid-A-disaccharide kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53316"
FT                   /db_xref="GOA:Q28VE6"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VE6"
FT                   /protein_id="ABD53316.1"
FT                   /translation="MRAPGFWHEPAGVASTLLAPLGALYAAGTARRLRTGPRVRVDVPV
FT                   ICIGNINAGGTGKTPTAIALAQRLLAKGVKVHAVTRGYGGEVEGPLCVEERTHTAKQVG
FT                   DEALLLSAFLPTWVSTDRQAGARAAVADGAECLILDDGFQNPALAYDLSIVVVDAWRGF
FT                   GNGRVIPAGPLREPVEIGLKRADIVLSIGPDAAQQRFATTWGRHIAVPHLTGTLQPLPT
FT                   GLPLDGLPVLAFAGIGHPEKFFQTLRSLGADLHATHALADHQPLTDTLMIRLLRDASMR
FT                   GAQVVTTEKDAVRLSPEFRAQVMTVPVRLEVDDWGPLDSAVDKVLGR"
FT   gene            complement(401998..403290)
FT                   /locus_tag="Jann_0400"
FT   CDS_pept        complement(401998..403290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0400"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid
FT                   transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53317"
FT                   /db_xref="GOA:Q28VE5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE5"
FT                   /protein_id="ABD53317.1"
FT                   /translation="MNRSFVLGLYLAWSARGARAFAERKLSQRLAAGKEDGARLDERRG
FT                   IANMPRPDGPLIWFHAASVGESLAVLELIRRLLDERDDLHLLVTTGTVTSAAVMAERLP
FT                   DRAIHHYAPLDAKPFVTAFLDHWQPDVAIWTESELWPTLIVETHARDIPMLLLNARMSK
FT                   SSHDKWRFARGMAQSLLERFQTALVQDNLTMVYLRRLGMPVSRMKVMGTLKEGAAALPC
FT                   NEDDRAAMAADLAGRPVWLAASTHEGEEKMVLQAHRMAMRSSPRLLLILVPRHPHRGDE
FT                   IADHMRTEGWRFTRRSADEDPADEAPVYLADTMGEMGLWYRLSPISFVGGSLVAIGGHN
FT                   PFEPAALGSAILHGPYVTNFVDIYDRLRDGGAAQLVSSPEKLAGQVAELLNPDEAANMA
FT                   AAAWQVISDGADVTDRALALIIDTLEEAETP"
FT   gene            complement(403297..403623)
FT                   /locus_tag="Jann_0401"
FT   CDS_pept        complement(403297..403623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53318"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE4"
FT                   /protein_id="ABD53318.1"
FT                   /translation="MPRLTPPPGPLRVHPKSKPDPIDREIPVPQRLHLVFGGELKDPQK
FT                   TEFENPEDIHVVGMFPDYQSAYDAWKSEAQRTVDNAHMRYFIAHIHRLRDEGVEASPTE
FT                   ELGS"
FT   gene            complement(404358..405140)
FT                   /locus_tag="Jann_0402"
FT   CDS_pept        complement(404358..405140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0402"
FT                   /product="Inositol-1(or 4)-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53319"
FT                   /db_xref="GOA:Q28VE3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE3"
FT                   /protein_id="ABD53319.1"
FT                   /translation="MPGPDDDLQLLIAAALRAGEIAKLHFGNDPKVYDKGDEGPVTEAD
FT                   LAIDTMLHETLRSARPDYGWLSEETEDTDARLTCEHVFICDPIDGTRAFIEGGKSFSHS
FT                   LSVVRNGTPTAAVVFLPMRDKLYAAHLGGGSTMNGTALQVTQTETLQDATALTTKGNLQ
FT                   PHHWHGDVPAIGKAYRPSLAYRMSLVGEGRFDAMMTFRPTWEWDIAAGALIIAEAGGAV
FT                   TDGYGQALRFNGSTAQVDGLLAGSPKIHSGLLAARAAK"
FT   gene            complement(405127..406476)
FT                   /locus_tag="Jann_0403"
FT   CDS_pept        complement(405127..406476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0403"
FT                   /product="microcin-processing peptidase 1. Unknown type
FT                   peptidase. MEROPS family U62"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53320"
FT                   /db_xref="GOA:Q28VE2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE2"
FT                   /protein_id="ABD53320.1"
FT                   /translation="MTDTQLAPLAHALLEAATRAGADAADALVVDGTSVSIGVLNGALE
FT                   QAERSEGIDMGLRVLVGQRQACVSASDTSAATVTDMAERAVAMARLAPEDPHAGLADVD
FT                   QLSTVRDGAALDMNDPGTDPDPAALEAMALEAEAAALAVDGISQVSDAGAGFSRRQIFL
FT                   AATNGFAGGYARTDHGLHCIAITGEGASMERDYFGDGRNHAGDLMSPADVGRIAAERTV
FT                   ARAGARKPPTGAFPVMYDERVAGGLIGHLLAATNGTAIARGASWARDLLGDQILPRGIS
FT                   LIEEPHRPRTSASRPFDAEGLPTADRLIVSDGVLTGWTLDLSTARKLGLTSTASATRST
FT                   GAPPSPSAGNACLTEGERTREDLLKEMGTGLLITSLIGSSINATTGDYSRGASGFWVEN
FT                   GEITHAVNECTVAGNLRDMLRGIVPANDARAHLSRVVPSLLVEGLTIAGA"
FT   gene            complement(406586..408076)
FT                   /locus_tag="Jann_0404"
FT   CDS_pept        complement(406586..408076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53321"
FT                   /db_xref="InterPro:IPR018666"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE1"
FT                   /protein_id="ABD53321.1"
FT                   /translation="MKRLCYTLSSLALAAASPAMADTSATELWAEWQAQAEISGQAVSA
FT                   EVTETDTGLTLSNFSTVFEEDGFSTTGSIDEIQLTENADGTVTVTYSDLYTIVFTFQVD
FT                   PGNPPANIELLLRHENLDMRISGDAGARTYAYTADEISITQGRLWGGGSEPPEIEVDMV
FT                   MSDIDTVYNVTGTDPETMRFTSEGAVGGLTMVMEVAAPPGEEGLFKAGLVIGPMQGTSE
FT                   GTLLSLASMNQTQGTLPEGFDLAGTTTYGPLGLEMQFEMPGEAFAALYSNDGGSIGASI
FT                   SGEAISYDIAASGARATLTGSDIPVPVEVSVGSSELALLMPLAAGDTPQDMGLRLSVQD
FT                   LMVGESLLGMVDPAQALPRDPASLLLDATGQVQLFMDLMNINPEELTGPPGELRAITVN
FT                   ELNLSVGGAELSGTADLSFAPNQIIPMPVGSADLELSGGNALMDALVAGGLVPAAQSGM
FT                   IMGMTNVFARPGAGPDTLETTVEFGADGSITANGVPLQ"
FT   gene            408228..408977
FT                   /locus_tag="Jann_0405"
FT   CDS_pept        408228..408977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0405"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53322"
FT                   /db_xref="GOA:Q28VE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VE0"
FT                   /protein_id="ABD53322.1"
FT                   /translation="MAHVVDGKVVAITGASRGIGAAAAREFAALGAKVVLLARSRDAIA
FT                   ELAGEIGENALAVPCDVVRYWEVEAAFGAAVDTFGALDVVINNAGVIEPVARIEDANPD
FT                   GWGQAIDINLKGTFNGVRAALPHMGGGGTIIGISSGAATNALEGWSHYCASKAAALMLT
FT                   RSLHKEMGDRGIRALGLSPGTVATQMQVEIKASGVNPVAGLDWSDHIPPEWPAKALAWM
FT                   CTEAADPYLGGDISLRDEGIRAVVGLA"
FT   gene            409006..409617
FT                   /locus_tag="Jann_0406"
FT   CDS_pept        409006..409617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0406"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53323"
FT                   /db_xref="GOA:Q28VD9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD9"
FT                   /protein_id="ABD53323.1"
FT                   /translation="MIDVSDQDGLRSVTLSRPEKANSLTTAMLTDLVEVFEGSHRVRAL
FT                   ILTGAGAKVFSAGADLEEAHGGLATSPLWEQASGALAALPCLTIAALNGTLAGGAFGMA
FT                   LACDIRLSVPHAKFFYPVAKLGFLPQPSDPARLSALIGPARTKLILLAAEKLSADEALS
FT                   FGLVDRICTPDDLLPVARDLASASLNGDPFTLHKIKAMIP"
FT   gene            409690..410883
FT                   /locus_tag="Jann_0407"
FT   CDS_pept        409690..410883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0407"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53324"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD8"
FT                   /protein_id="ABD53324.1"
FT                   /translation="MTQHHIDALVIGSGPAGFMAAETLVRAGRNVTIVEAKPSVGRKFL
FT                   MAGKSGLNLTKDEPLEDFTRAYGAARDWLYPMIAQLDPVEVMAFAEDLGQPVFTGTTGR
FT                   VFPKAMKASPLLRAWLQRLDAQLFLRWRWTGFDGDALTFDTPDGPQTLSTKVTVLALGG
FT                   ASWSRLGSDGAWSDILASKGVALAPFQPANMGFRVTWSDHMAPHFGTPLKNIALMAGDM
FT                   RQRGEAVVSHRGLEGGGIYAVSSAVRDGADLAFDLLPDRTVESLMSRLRTRPKKQTMTK
FT                   ALTGLGLDPLKRALLQEFARPLPEDPTTLAALIKALPVKHDGPRPMDEAISTAGGVPQT
FT                   AVTKGLMLEAIPGVFVAGEMLDWEAPTGGYLINGCFATGRWAGANAAMHHDGVSFAG"
FT   gene            complement(410880..411482)
FT                   /locus_tag="Jann_0408"
FT   CDS_pept        complement(410880..411482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0408"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53325"
FT                   /db_xref="GOA:Q28VD7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD7"
FT                   /protein_id="ABD53325.1"
FT                   /translation="MSEYVVFGGARSRAMRVLWMLEELGLDYAVVPTLPRSEDVRALNP
FT                   TGKIPVLVEDGVAISDSVAIMTYLADKHGRLTAPAGTIARAQQDAFVQAVNDEIDAVLW
FT                   AAARHSFILPEEQRVAGVKDSLRWEFARNEDAIADRMSADGPFVMGEEMCLADILLSHC
FT                   VGWAGSAKFDARNDRLLAHNAMMRARPAFKRALAAGT"
FT   gene            complement(411479..412510)
FT                   /locus_tag="Jann_0409"
FT   CDS_pept        complement(411479..412510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0409"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53326"
FT                   /db_xref="GOA:Q28VD6"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD6"
FT                   /protein_id="ABD53326.1"
FT                   /translation="MKLSTRDANVYFKRPDTSAAGCLIFGDDAMRVALKRQDLLAALLG
FT                   AAAEEEMRLTRMTGADLRSDSAGLLDAVKAVGFFPGPRAVLVEGATDGLAKVFTAAFEE
FT                   WQDGDAQIIATAGRLTAKSALRKVFEGNKRAYAAAIYDDPPGRAEIEDMLKAAGITNTD
FT                   REAMVDLEGLARSIGPGDFRQMVDKLGLYKRGDATPVLPADIEAVAPLTREAELDDILH
FT                   ATAEAETGAIGPILVRLKQQGTTPVSLCIAALRHFRALHSAAAHPDGPAAGLQAMRPPV
FT                   FGPRRDRMARQASRWGQSALEAALSMLVETDLTLRSASTAPQMAVMERTLIRLAMLPGR
FT                   GRR"
FT   gene            complement(412521..413003)
FT                   /locus_tag="Jann_0410"
FT   CDS_pept        complement(412521..413003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0410"
FT                   /product="lipoprotein putative"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53327"
FT                   /db_xref="GOA:Q28VD5"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD5"
FT                   /protein_id="ABD53327.1"
FT                   /translation="MSLFRRRTLLVLLSALPLAACNFQPVYGPGGSGDIIRDQIRVAEP
FT                   NSRLEFELVSRLEDRLGAGSSYALNYSVSVATRNLAIDETAVINRVNLVGNLNFNVTEV
FT                   GTGRNVQTATVSTFTSYATTESPVATESARRDAEDRLAVALADQMVTRLIAGAQSW"
FT   gene            complement(412990..415581)
FT                   /locus_tag="Jann_0411"
FT   CDS_pept        complement(412990..415581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0411"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53328"
FT                   /db_xref="GOA:Q28VD4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VD4"
FT                   /protein_id="ABD53328.1"
FT                   /translation="MSRYDPSMIEPKWQKAWAEAGTFTASMEGNKPKYYVLEMFPYPSG
FT                   RIHIGHVRNYTMGDVIARHKKAMGHNVLHPMGFDAFGLAAENAAMDRGIHPKDWTYKNM
FT                   DDMRDQMRPLGFSIDWSRDLATCDPDYYGQQQALFIDMMEAGLIDRKNAVVNWDPVDMT
FT                   VLANEQVEDGKGWRSGAEVERKELTQWFFKISDYSDELLEALDGLDDWPAKVKLMQANW
FT                   IGKSRGLQFAFGLVEPVGGHDRVDVYTTRPDTLLGASFVGISPDHAIAKQLESESEDIA
FT                   AFCAECRKGGTTAAEVETAEKLGFDTGLKVRHPFDTAAQLPVYIANFILMDYGTGAIFG
FT                   CPAHDERDLDFARKYDLPVVSTYVPIDDEGHVLPEDGGAAYVPPKPDPVRYIRGFAGEE
FT                   IQSGNDAIDAAVTFCEAEGVGQGVTKFRLRDWGLSRQRYWGCPIPVVHCDACGVVPEKK
FT                   ENLPIELPYDVTFDVPGNPLDRHPTWRNTPCPSCGAPALRETDTMDTFVDSSWYFARFT
FT                   APHADTPTSKAEVEYWMNVDQYIGGIEHAILHLLYSRFFARAMHITGHLPRKAIEPFDA
FT                   LFTQGMVTHAIYKTTDAKNRPVYHYPETVDLRDGGGYLDDGTAVEIIPSAKMSKSKNNV
FT                   VDPIEIIKQYGADTARWFVLSDSPPERDVEWTASGAEAAYKHLGRVWALCDRISEAARS
FT                   VSEEAQPAAGEHDTALLREMHKTIRDVTNGVDSFGFNAAIAKLYAFTNTLQKSKASHKA
FT                   QREAVMTLAQLMAPMTPHLSEDIWAHQGGDGLIADAPWPVANEAMLVESTVTLPIQING
FT                   KRRSEVTVAKDASKEEVEKRALADDAVVRALDGAAPKKLIVVPGRIVNVVI"
FT   gene            complement(415665..416147)
FT                   /locus_tag="Jann_0412"
FT   CDS_pept        complement(415665..416147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53329"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD3"
FT                   /protein_id="ABD53329.1"
FT                   /translation="MLKRFANYLGLAVVIGALAACNGLANNREASNETLRRDGLLADPS
FT                   RETIWDLFGNNDDPSVTVEVNRYLWRASLEILDFMPLEAADPFTGILVFDYATPPGGNR
FT                   AYRATVYVSDPALEARSLRVALQGRGGSAVSRETARQVEDAILTRARQLRVADGNL"
FT   gene            416655..417665
FT                   /locus_tag="Jann_0413"
FT   CDS_pept        416655..417665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53330"
FT                   /db_xref="GOA:Q28VD2"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD2"
FT                   /protein_id="ABD53330.1"
FT                   /translation="MKKVLFATTALIATAGIAAADGHTGVALSGSAEMGVIGGDNTNTQ
FT                   FWTHVDVTFTLSGETDGGITFGAAVDLDEAGDAIDTADGRDGVAIFISGDFGTLTMGDT
FT                   DGALDFAMQEVAVNNAGSIADDETAHGGYLGSYGDGAYDGQILRYDYSIADFAFAVSVE
FT                   LDDADVRDVGYALGATYNLSFGGGSATFGAGVQFIDAVNYNPGNTNAFTGQDLDGEYLI
FT                   YGVSASVSLDNGLAVGIAYTDYQSEEAVADDEYTHIGFGAGYTFDAITVSANYGMWEID
FT                   ADGAAPDEEITGYGLAAAYDFGGGLSAHLGYNMTETDAPAGADNSTWSLGLAMSF"
FT   gene            417738..418391
FT                   /locus_tag="Jann_0414"
FT   CDS_pept        417738..418391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0414"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53331"
FT                   /db_xref="GOA:Q28VD1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD1"
FT                   /protein_id="ABD53331.1"
FT                   /translation="MALSDITTRLAACAETHGRAAADITLIAVSKVQPTERVDAVLTEG
FT                   HRIFGENRVQEAQGRWPDFQARFDGIDLHLIGPLQTNKARQAVEMFGTIHTVDRPKLAK
FT                   TLARLAQERGTSPDLFIQVNTGEEPQKAGCLPSEADAFIADARAMDLPLLGLMCIPPVD
FT                   EEPSLHFALLAKIAKRNGLSGLSMGMSSDFETAIAQGATHIRVGSAIFGERTPV"
FT   gene            complement(418443..419021)
FT                   /locus_tag="Jann_0415"
FT   CDS_pept        complement(418443..419021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53332"
FT                   /db_xref="GOA:Q28VD0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VD0"
FT                   /protein_id="ABD53332.1"
FT                   /translation="MRRRSPKPPPTRICTSLKACSSGMSPEDLVLTPSGLRFWGARLPF
FT                   TVGRGGVVRDKREGDGGTPVGTHRIVGCLYRADRGPKPCDWAVPIGPNDLWSDDEASDD
FT                   YNLMVRRPYMGTAERLARGDPLYDIVLITDWNWPEAQPGRGSAIFIHQWRGPGRSTEGC
FT                   VAVSRRHLRWIVPRINHGTRLIVPDTLAR"
FT   gene            complement(419272..420345)
FT                   /locus_tag="Jann_0416"
FT   CDS_pept        complement(419272..420345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0416"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53333"
FT                   /db_xref="GOA:Q28VC9"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC9"
FT                   /protein_id="ABD53333.1"
FT                   /translation="MSLLPSISDLVARARSDLRVGLPVVLDRDGTGLIVLACETASDAR
FT                   LEALRALGPVTAAITGWRAETLKIRIYDGDIARITMPADAGARWLAELADPACDLSAPM
FT                   RGPFREDRDGDASLHRIALDLTKSAQLLPAIAGVEVSAWPEGLTILPADLAAQDLAMSA
FT                   PLSPVAAARLPMALAGAGRLHIFRPDNAGIEHYAIEVGRPDRSRPVLARLHSACFTGDV
FT                   LGSLKCDCGPQLHAALAEMGRIGEGVLLYLNQEGRGIGLANKMRAYALQDQGFDTVEAN
FT                   HRLGFEDDERDFRIGADLLRRMGFDAVRLMTNNPRKVEMMDAEGIDVAERVPLIIDPNR
FT                   HNADYLQVKRTKSGHLL"
FT   gene            420512..421198
FT                   /locus_tag="Jann_0417"
FT   CDS_pept        420512..421198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0417"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53334"
FT                   /db_xref="GOA:Q28VC8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC8"
FT                   /protein_id="ABD53334.1"
FT                   /translation="MANLKKILLVDDEDDLREALSEQLVMTEDFDVFEAANGAQAMERA
FT                   KEGIYDLVILDVGLPDTDGRELCRLMRKQGVKCPVLMLTGHDSDADTILGLDAGANDYV
FT                   TKPFRFPVLLARIRAQLRQHEQSEDAVFQLGPYTFKPAMKMLITEDERKIRLTEKETNI
FT                   LKFLYRAQDGVVARDVLLHEVWGYNAGVTTHTLETHIYRLRQKIEPDPSNARLLVTESG
FT                   GYRLVA"
FT   gene            421438..422079
FT                   /locus_tag="Jann_0418"
FT   CDS_pept        421438..422079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0418"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53335"
FT                   /db_xref="GOA:Q28VC7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC7"
FT                   /protein_id="ABD53335.1"
FT                   /translation="MLDVALYLPGILLSYAAFLLAIASPGPNILAVIGTSMGVNRRSGM
FT                   ALAMGVATGSFTWALLTVFGLSALLATYAQALIAIKIFGGLYLLWLAYKAFKSAMASHD
FT                   IEATELAGGKRSPWGYARRGYVIQMTNPKAALAWIAIISLGLSDGAPAWVGAVIVVGTF
FT                   ALSIAIHMLYAIAFSTPVMVRLYGRARRGIQGVLGTFFAYAGLRLLTDRT"
FT   gene            complement(422110..423360)
FT                   /locus_tag="Jann_0419"
FT   CDS_pept        complement(422110..423360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0419"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53336"
FT                   /db_xref="GOA:Q28VC6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC6"
FT                   /protein_id="ABD53336.1"
FT                   /translation="MPALIRENRNFRLLMSGAGVSNLSDGIGALAFPWMATLITTDPRA
FT                   LAIVAFATRLPWFLWSLPVGVWTDRADRQKMMVRADLARMALAMAVVALIVAGPRDGGQ
FT                   VAWMIGGLAALAFLMGTAEVFRDNAAQTALPSVVPKDRLEEANGQIWSVEQVMGQFIGP
FT                   PLAGFLIAVAAPAPFLFEALGFALAAFAVWAIAFPARGALVPRRGFWTEMNAGWTWIRE
FT                   HKVILQLALILGGLNAAHMAGFTILVLFSQEVLGLGAVGHGMLLTAGAAGGVAGGLLCP
FT                   WVAKRLGASRSLWVALALMPLPFLGLYFTSQVWVAVVLLFLETFVAVLWNVVTVSFRQR
FT                   VIPDALLGRVNSIYRFFGWGMMPLGALAGGWIMALAEPSMGREDALRLVFLLCAGLFAA
FT                   LFLYGLARLRLPKGAAG"
FT   gene            423418..424377
FT                   /locus_tag="Jann_0420"
FT   CDS_pept        423418..424377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0420"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53337"
FT                   /db_xref="GOA:Q28VC5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC5"
FT                   /protein_id="ABD53337.1"
FT                   /translation="MRFLFKLLLALVLLAGVALAGFRIAADQREVMAAADAAPEDGRLA
FT                   PTALQGIFAIERGPADGPPVLLIHGSVGWSGSWRHTLEVLAQDGYRAIAIDLPPMGYSD
FT                   RDPDGDYGRAASAARILAFIDAETITPHIVAHSFGAGAAIEAVMQRADAFASLTIINGA
FT                   LPLDPDATDLPAILRPLWLREALVSATVTNPLASRRLLQAFLYRKDTATDEVLEVLAQP
FT                   SRLDGATEALSIWLPTLLVPPTNLPSVTSAAYGTLDLPVALIWGEQDTTTPLPQGENLR
FT                   DLIPGASLTILPDVGHIPMIEDPAAFDAALLAALSEMR"
FT   gene            424521..425309
FT                   /locus_tag="Jann_0421"
FT   CDS_pept        424521..425309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0421"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53338"
FT                   /db_xref="GOA:Q28VC4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC4"
FT                   /protein_id="ABD53338.1"
FT                   /translation="MPFTLATWNINSVRLRQPIVSQLMTEEAPDILCLQECKSPVDKMP
FT                   SDVFAALGYTHVVARGQKGYNGVAIYSKLPMEEAGSHEFAGLDHARHIAGRLENGVTIH
FT                   NFYVPAGGDVPDRDVNIKFGQKLDYLTDMRDWAKTDTPQKSILLGDLNIAPREDDVWSH
FT                   KQLLKVVSHTPIEVEHLAEAQDAGGWVDVTRKDIPDGPLFSWWSYRSPDWDNADKGRRL
FT                   DHVWATPDISNAAHSSRIARHVRGWEKPSDHAPVFATFDL"
FT   gene            425376..426296
FT                   /locus_tag="Jann_0422"
FT   CDS_pept        425376..426296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0422"
FT                   /product="thioredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53339"
FT                   /db_xref="GOA:Q28VC3"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC3"
FT                   /protein_id="ABD53339.1"
FT                   /translation="MLELGQTPNAAPDAAPADLIKDTTDATFMADVVDASQTTPVIVDF
FT                   WAPWCGPCKTLGPQLEAAVTAAKGKVRMVKVNVDENQQIAAQLRVQSIPMVYAFVDGQP
FT                   IDGFQGAVPESQIKDFVTKLAAMSKEDGGLAEALEAAEEMLSMGEHDDAAQTFAAILGE
FT                   EPENAAAMGGLARAHLAMGQVDEAEQLLSTAPDAIFNAPELEAVRAQIELARQAESAGP
FT                   LAELQAAVDANPDDHAARFELAQALHANGDVEQAVDQLLELFRRDREWEDAKAKTQLFT
FT                   IFDALPPQDPIALTGRRRLSSMIFA"
FT   gene            426324..426968
FT                   /locus_tag="Jann_0423"
FT   CDS_pept        426324..426968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0423"
FT                   /product="peptidase S16 lon-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53340"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC2"
FT                   /protein_id="ABD53340.1"
FT                   /translation="MMTHADLPGTIPIFPLPGALMLPRARLPLHIFEPRYLQMIEDTLK
FT                   TSHRLIGMVQPFEAPGSGEQKLHHIGCAGRLTQFSETEDGRYMITLAGMSRFRISKEVQ
FT                   GFAPYRRCDVSWDGFSADLGPTEVDKLFDRDSFLDLLNRYFEAQDLSTDWDSLKDAEDE
FT                   LLINSLSMLCPFDPEEKQALLEAPSLSTRRETLVTLLEFALASGTDEERMQ"
FT   gene            426965..427165
FT                   /locus_tag="Jann_0424"
FT   CDS_pept        426965..427165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0424"
FT                   /product="protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53341"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VC1"
FT                   /protein_id="ABD53341.1"
FT                   /translation="MSDGDTNGPTGPIDRRMLEALVCPMTQAPLSYDAEKQELISKAAH
FT                   LAYPIRGGIPIMLEEEARKLD"
FT   gene            complement(427308..428435)
FT                   /locus_tag="Jann_0425"
FT   CDS_pept        complement(427308..428435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0425"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53342"
FT                   /db_xref="GOA:Q28VC0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VC0"
FT                   /protein_id="ABD53342.1"
FT                   /translation="MDALPAQTREETGFDGRAYALALASVRMLDALGIWNQVEDHAQPM
FT                   LEIKASDGRAGEGAAPFFLHFDHAEIEEGPMGHMLEDRYLRRALMAAMEASSLVAHRAA
FT                   SRVLSQDTNGMASVTLDGGEVLRGRLLIGADGKRSGVAERAGIRRMGWDYNQTALVCAV
FT                   DHDRPHNGIAHQFFMPGGPLAILPLPGNRSSIVWSESEPRASELAAADDDTFMDALRPA
FT                   FGDFLGNISLTGQRHSYPLSLSLAQAFVAEKLALVGDAAHGVHPIAGQGLNLGLRDVSA
FT                   LAETLADAKRRGEDFARRDVLDRYQQWRRFDTAGLAVATDSVNRLFSNDNPAVRAIRDI
FT                   GMGAIGALPTLRRRFIREAAGLTGDLPRLMQGRTL"
FT   gene            428619..429941
FT                   /locus_tag="Jann_0426"
FT   CDS_pept        428619..429941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0426"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53343"
FT                   /db_xref="GOA:Q28VB9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB9"
FT                   /protein_id="ABD53343.1"
FT                   /translation="MDWLSKSASEIGRGIGAGDVDPVALTEGYLDVIKASPFGDRIYAR
FT                   TTRDRALAEAIAAHDRAKAGVRRGLLDGVPISWKDLFDTAGVVTEAGSNLLEGRVPDKD
FT                   AEVLANATRAGLVCLGKTHMTELAFSGLGVNPSTATPPNANDPELAPGGSSSGAATSVA
FT                   YGMAAAGIGSDTGGSVRLPSAWNDLVGFKPSHGALSLDGVVPLAASFDTVGPLCRTVED
FT                   CAELFAVMGNTKAADLAGASLDGTRLLVLNPYASDVRDAPGAAFQSAVERLSTAGALIE
FT                   NADIPAVNEAMDTTLSLYTAEAYGTWGKVIEANPDKMFHRIRDRFRQGAEVKAADFVAL
FT                   WQRLRALRQAYYKATASYDAVLIPSAANLPPNVARLDSDDDYFVTENLLTLRNTRVGNL
FT                   MGVCAVTLPTGVPSTGLMMMCSPGDDARLLRLARAAEGALA"
FT   gene            430047..431228
FT                   /locus_tag="Jann_0427"
FT   CDS_pept        430047..431228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0427"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53344"
FT                   /db_xref="GOA:Q28VB8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB8"
FT                   /protein_id="ABD53344.1"
FT                   /translation="MVFPERFSNLPDYAFPRLRTLLDSHEPGAEPIAMTIGEPRHDFPP
FT                   WIAEIIGQNLHGFGKYPENDGTLSLRTAQADWLGRRYGVDVDPARQILALNGTREGLYN
FT                   ACMSLCPERKNGQKPVVLTPNPFYQVYAVAALSVGAEPIYLPATEATGDLPDFHAVDPA
FT                   ILDRTAIAYICSPANPQGAVASEAYWEGLIALAEQHDFKIFADECYCEIYRDSPPPGAL
FT                   EIAHKMGADPERVMVFHSLSKRSNLPGLRSGFCAGGPESIARMKTLRAYAGAPLPMPLQ
FT                   AVAEAVWTDEDHVIDNRNLYRVKYKIADDILGDVQGYKGPEAGFFLWLPVQDAEQATLK
FT                   LWQETGVRVLPGSYLAREVDGVTPGHDKIRVAMVAEKEEMRRGLKTLRKTLYE"
FT   gene            431241..434132
FT                   /locus_tag="Jann_0428"
FT   CDS_pept        431241..434132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0428"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53345"
FT                   /db_xref="GOA:Q28VB7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB7"
FT                   /protein_id="ABD53345.1"
FT                   /translation="MAYQTRQREPLLDGHMQEIVSRRGREMCGIALVGVGVALAAMLWS
FT                   YVPEDPNWMAATDAQPENLLGRGGASIAALMMMIMGFAAWVLPVASIIWGARFVLHRGQ
FT                   ERALGRVLFVPIAVALAAIYAASHVPPVGWTHSFGTGGLFGDTILGAILSALPMAPQVG
FT                   IKLAAFVAFVLTAGMVLFVLGVTQRELGLTLRFLLVGLIATSTALAALSRRVGRGLGRG
FT                   AGAAAVALQERRAARAERAAAMEIEAAYTTTGQPRVQRADASMDPDMTPVAPVPAQQGL
FT                   FSRRPGLRREPEAMLEAPLPEADPMLVEDLYDEPAGEDRVRSRISDAIRARRRPTEAPA
FT                   TGNTIADVAARARVTPGTPSRVPGLNRVEPPLTAAHREAVADPYEIYETPEAPMAEAEP
FT                   VELRRPEPEQAPMATSIAAPQVQPEVQRRVIQQPMRKPAMQSRQAQADSQPSLPLSEPE
FT                   PYEFPPLTLLTNPSTIERHHLSDEALEANARMLENVLDDYGVKGEIVSVRPGPVVTMYE
FT                   LEPAPGLKASRVIGLADDIARSMSALSARVSTVPGRTVIGIELPNQNREMVVLREMLSH
FT                   RDFGDGSHKLPLALGKDIGGDPIIANLAKMPHLLIAGTTGSGKSVAINTMILSLLYKMK
FT                   PEDCRMIMIDPKMLELSVYDGIPHLLSPVVTDPKKAVVALKWTVGEMEERYRKMSKMGV
FT                   RNIDGYNSRVKDALEKGEMFSRTFQTGFDDESGDPVFETEEYLPEKMPYIVVIVDEMAD
FT                   LMMVAGKEIEACIQRLAQMARASGIHIIMATQRPSVDVITGTIKANFPTRISFHVTSKV
FT                   DSRTILGEMGAEQLLGMGDMLYMAGGAKITRVHGPFCSDEEVEEIVRHLKSFGPPDYAS
FT                   SVLDGPDDDKESDIDAVLGLATGGNTGGEDALYDQAVAIVIKDRKCSTSYIQRKLGIGY
FT                   NKAARLVEQMEENSLVSSANHVGKREILVPEQD"
FT   gene            434311..434922
FT                   /locus_tag="Jann_0429"
FT   CDS_pept        434311..434922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0429"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53346"
FT                   /db_xref="GOA:Q28VB6"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB6"
FT                   /protein_id="ABD53346.1"
FT                   /translation="MSITRRHLLGATAAFILAGTSAAFANAIPLAQLSGYLNAMQTAES
FT                   PFTQINSDGTVSTGTVYIHRPGRVRFDYDGDDLLVMAGGSQVAIFDGRASGPPEQYPLD
FT                   QTPLRIILQRNVDLGQSGMVSEHSFDGTSTRVVARDPQRPNIGSITLVFTPNPIELRQW
FT                   VITDEGGAQTTVILGALEQGGRIPARFFSIPQEVNARNGD"
FT   gene            complement(434951..435529)
FT                   /locus_tag="Jann_0430"
FT   CDS_pept        complement(434951..435529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0430"
FT                   /product="lipoprotein putative"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53347"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB5"
FT                   /protein_id="ABD53347.1"
FT                   /translation="MYRRTLLLGLTASLVACGRSQEFNSPRNLDNACGLIAERPNYFRA
FT                   MRRAERNWNVPVHVQMAVIHQESRFDGDIRPPFEFALGIIPVGRQSSAVGYSQALDGTW
FT                   DEYRQETGNRRADRTDIADATDFMGWYMNLTVERNNIPLTDARRQYLAYHEGHTGYARG
FT                   SYNSKPWLIEVAGRVEARAERYRQQLESC"
FT   gene            complement(435623..436510)
FT                   /locus_tag="Jann_0431"
FT   CDS_pept        complement(435623..436510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0431"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53348"
FT                   /db_xref="GOA:Q28VB4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB4"
FT                   /protein_id="ABD53348.1"
FT                   /translation="MNLALTVLDITAPVFILGAAGFIWVRAGYEYPTAFVTRLAMTLAV
FT                   PCLIFTTLVAADIEPRALAQLSMAAILCYGLITLGAWVVVRMFRLDTRAYLAPLTFGNT
FT                   GNLGLPLALFAFGETGLGLAVVIFAVMAIIMFTVGLWMVAGVQNPLRVLREPILWASVL
FT                   GVLFLSAGWTPPNVALNSLTLIGHMGIPLMLLTLGAAVARLKPARVLPAFGLSAIKLSI
FT                   GLLVGIGVGLAFGLSGAPLAVLILQMATPVGVTSYLMAERYKTDPDAAASLVVTSTLLA
FT                   IVALPITLSFLLPG"
FT   gene            436599..436925
FT                   /locus_tag="Jann_0432"
FT   CDS_pept        436599..436925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0432"
FT                   /product="Hemimethylated DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53349"
FT                   /db_xref="GOA:Q28VB3"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB3"
FT                   /protein_id="ABD53349.1"
FT                   /translation="MLETQAKYNIGQIVKHRKHPFRGVVFDIDAEFSNSDEWYEAIPED
FT                   ARPLKDQPFYHLLAENDQTYYVAYVSEQNLVPDDTGEPVTHPDLPDLFGEFSNGHYPLE
FT                   YQLN"
FT   gene            437344..439068
FT                   /locus_tag="Jann_0433"
FT   CDS_pept        437344..439068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0433"
FT                   /product="Type I secretion system ATPase PrtD"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53350"
FT                   /db_xref="GOA:Q28VB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB2"
FT                   /protein_id="ABD53350.1"
FT                   /translation="MRVTAKDELAEFRRRNAWILWSVALFSLFVNLLMLTGPLYMLQVY
FT                   ERVLGSGSEETLLALSVLVAFLFAMMGILDYARARVAARFGARMQEAFDARVFRAALDR
FT                   AQRTGQAQTALGDLASVQRVMSSPVFMAVFDLPFTPIFLVAIFSFHVWLGWFALGAAVT
FT                   LIIVTIINRLTTAQPLAEAAETGRVADRMAGEMQSSAEVIRSLGMQGAAFSRWHRQRAR
FT                   ALDVSMRVADRAGGYATLSKTLRLFLQSAILGLAALLVLRGEIRAGAMIAGSILMGRAL
FT                   APIDLAIGQWPMIQEALRGWGRLRTLLLEQREEPDRLTLPRPKAALEVAGLTIAPPGEN
FT                   KPSLRGVSFRLEPGEALGIIGPSGSGKSTLARAITGVWPVAGGSIRLDRATLDQYDPDA
FT                   LGKLIGYLPQSVSLFDGTVAENIARLDPEPSGEAVTAAAVAAAADSMIRELPNGYDTEV
FT                   SGLGTRLSGGQVQRVGLARALYGNPVLLVLDEPNSALDHEGSEALNKAVQGMKAAGNSV
FT                   LIMAHRPNAIQECDKLLVLSGGLVKAFGPRDEVLAKVLQNSAEVQRVTNAKVSGDLT"
FT   gene            439065..440372
FT                   /locus_tag="Jann_0434"
FT   CDS_pept        439065..440372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0434"
FT                   /product="Type I secretion membrane fusion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53351"
FT                   /db_xref="GOA:Q28VB1"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB1"
FT                   /protein_id="ABD53351.1"
FT                   /translation="MSGAKRPSWSVRGPMLLGLIALLVLVVGFGGWSVSSTLSGAVVAS
FT                   GQIEVDRNRQAIQHPDGGVVAELLVDEGDRVGEAQVLVRLDTSESETELAVARARLAET
FT                   AARRVRLQAERDGLDRLTFSEDLVAFAAGNPEIAEVVAGQRNLFAARADSLAREEEQLR
FT                   GRITQIGTQVDAMRAQEEALVEQITLVEDELVRREDLLERGSGTVEPVVRLRQELVQLR
FT                   GQLGQATAGRAEAAERIIETELAILQLTTTQREQAISELRELRVTEQELVERTANLERR
FT                   IARLELRAPVAGTIHGLTIFGARAVLRPADPFAYIVPEGRPLVISARVPAIDIDQVFEG
FT                   QTVSLTFPAFDQSSMPEVTGEVAQVSADAFVDEVSGSSFYRAEITMTEEQAQLLGARVL
FT                   IPGMPVEAFIRTEDRTPLAYLLEPFTTYFSRAFRES"
FT   gene            440439..440906
FT                   /locus_tag="Jann_0435"
FT   CDS_pept        440439..440906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0435"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53352"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VB0"
FT                   /protein_id="ABD53352.1"
FT                   /translation="MGGNFEKRLGDLGVTLGDATAPAANYVPFVQVGDTLYVSGQISIE
FT                   NGQMITGRIGADLTVEEGAAAAKVCAINLLAQVKAACGGDLDKLARVVKLTGFVNSTPD
FT                   FGDQPKVINGCSDFLVEALGDAGRHARSAVSAGALPFNVAVEIEGIFQIKP"
FT   gene            440903..441679
FT                   /locus_tag="Jann_0436"
FT   CDS_pept        440903..441679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0436"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53353"
FT                   /db_xref="GOA:Q28VA9"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA9"
FT                   /protein_id="ABD53353.1"
FT                   /translation="MNPALPPEFLDRPLTHRGLHDRSKGVIENSAGAVRAAVAHGYGIE
FT                   IDVQLTSDGAAMVFHDERLDRLTGESGPIRGWAARDLVNLTLTGSSETVPTLPEVLEIV
FT                   GGRVPLLIELKDQSGGTGSAPDELERAVAKALEGYEGLVAVMSFNPHMVANMAKRAPSV
FT                   PRGIVTDGYTETEWPDLSPDTLQALREIGAFDAVGASFISHNWEDLAAPRVAELKARGV
FT                   PILCWTVKSAEDEAQARRVADNITFEGYTPTPRAKD"
FT   gene            441731..442894
FT                   /locus_tag="Jann_0437"
FT   CDS_pept        441731..442894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0437"
FT                   /product="protein of unknown function DUF482"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53354"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA8"
FT                   /protein_id="ABD53354.1"
FT                   /translation="MDGDTQISIEALTSLSQITAEEWDACACPEDGRPLDPFTTYRFLD
FT                   ALEQSGSVGPGSGWQPRYLVARMDDQVIACAPMYAKGHSQGEYIFDHNWAHAYENAGGA
FT                   YYPKLQIAAPFTPATGRRFLTRPGHDATGISALIQGAVQIAADNDLSSLHVTFCTEDEA
FT                   IAGERIGLMRRWSQQFHWVNDGYADFDGFLASLSSRKRKNIRKERARAQAFGGEIVSLT
FT                   GAQIKAEHWDAFWHFYQDTGARKWGTPYLTRAFFDIVHETLTDDMLLCLAIREGQPVAG
FT                   ALNFIGADTLYGRYWGCVEDHPCLHFELCYYQAIDYAIANGLSRVEAGAQGAHKLARGY
FT                   LPVATHSLHWVRDAGFAEAIGRYLEAEREAVDEEIEVLTGYGPFKRA"
FT   gene            442912..443208
FT                   /locus_tag="Jann_0438"
FT   CDS_pept        442912..443208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0438"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53355"
FT                   /db_xref="GOA:Q28VA7"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VA7"
FT                   /protein_id="ABD53355.1"
FT                   /translation="MAEKLDDAARAKAVASLADSGWEDVQGRDAIHKTFVFKNFTRAFG
FT                   WMTQVAIVAEKMDHHPEWSNVYKTVEVTLATHDVGGLSELDVTLAQKMDRLAQ"
FT   gene            complement(443239..443727)
FT                   /locus_tag="Jann_0439"
FT   CDS_pept        complement(443239..443727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0439"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53356"
FT                   /db_xref="GOA:Q28VA6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA6"
FT                   /protein_id="ABD53356.1"
FT                   /translation="MTLSMGDTLPNATLLRMGAEGPEPVELDTLTKGRKVAIFAVPGAY
FT                   TGVCTEAHLPSFMRNMNGFEAKGVEKVICIAVNDPFVLDTWATTTGAAETGIVMLADPA
FT                   ATFTKAVGMNWTAEAVGFHDRSKRYALYAEDGVVKTLHEEDNAGTCEVSAGESLLAVI"
FT   gene            443809..445017
FT                   /locus_tag="Jann_0440"
FT   CDS_pept        443809..445017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0440"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53357"
FT                   /db_xref="GOA:Q28VA5"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA5"
FT                   /protein_id="ABD53357.1"
FT                   /translation="MDSIIVIGAGQAGASCVAKLRAEGFEGKITLIGDEPVPPYQRPPL
FT                   SKAYLLGDMALERLFLRPEAWYADNEVELRLGAPVDAIDAAEKTISVEGDVLPYEALVL
FT                   ATGSTPRRLPAKIGGDLGGVHVVRTLADVDAMEPEVTGNRRALIVGGGYIGLEAAAVAR
FT                   KRGMEVTLIEAAPRILGRVAASETADYFRDVHRANGVRILEGVGLECINGVDGRVVGAM
FT                   LTNGEEHPYDVVIAGIGIVPNDSPAEMAGVTLDNGIATDLQGRTSDPSIWAAGDCASLP
FT                   FRGERIRLESVQNAIDQAEAVAKNILGATEDYVPKPWFWSDQYDVKLQIAGLNTGYDKV
FT                   VVRDGGAARSHWYYNGDTLLAVDAMNDPRGYMIGKRLIEAGKSPSADIVADPDSDLKPL
FT                   LKA"
FT   gene            445028..445585
FT                   /locus_tag="Jann_0441"
FT   CDS_pept        445028..445585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0441"
FT                   /product="conserved hypothetical protein 95"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53358"
FT                   /db_xref="GOA:Q28VA4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA4"
FT                   /protein_id="ABD53358.1"
FT                   /translation="MRIVGGRLRGKKLADVGTGDAAAHLRPTTDRVRESLFNLLTNGRN
FT                   GDLVRGATVLDLFAGTGALGLEALSRGAEHVTFVDSGAASRALLRENIALCAAPGVTKV
FT                   FRTDVSDLGPPKTPSDLVFLDPPYGEGLGEMAIDTLLAQGWLAPGATLVWEESAPPIIP
FT                   APFQMLDQRGYGQTTITILRFP"
FT   gene            445582..446238
FT                   /locus_tag="Jann_0442"
FT   CDS_pept        445582..446238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0442"
FT                   /product="HAD-superfamily hydrolase subfamily IA variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53359"
FT                   /db_xref="GOA:Q28VA3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA3"
FT                   /protein_id="ABD53359.1"
FT                   /translation="MIPDLVIFDCDGVLVDSEPLSNQVTVDALADMGIHMSLDEIMAMF
FT                   VGKSMAQVAAGVRAMGAPLPGSDAEWIDTLYTETYARLRQGVDPIPGVVGVLDALDTAG
FT                   VPYCVASNGSDEKMDITLGGTGMAERFKGKRFSAHTLGVSKPDPELFFIAAKYMSVVPS
FT                   RAVVIEDSPSGALGAQRAGMRCFGYAPEGGDALEEVGAHVFQSMNDLPALLGIKD"
FT   gene            446342..448399
FT                   /locus_tag="Jann_0443"
FT   CDS_pept        446342..448399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0443"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53360"
FT                   /db_xref="GOA:Q28VA2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA2"
FT                   /protein_id="ABD53360.1"
FT                   /translation="MLVEHPDTSAILKSTFGFDAFRPGQAEIVEAVASGKDVLAIMPTG
FT                   GGKSLCFQLPALVRDGVTVVISPLIALMRDQVRGLREAGVEAGALTSGNTPEETDAVWE
FT                   GLERGTLKLLYLAPERLASTGTERMLARAGVSMIAVDEAHCVSQWGHDFRPDYLRLGAL
FT                   RRALNVPLAAFTATADAETRAEICERLFEDPPEVFLHGFDRPNLTLAFEVKNQPRQQIL
FT                   SFAAARKGQSGIVYCGTRAKTETLAKALRDEGHSACHYHGGMEADDRRIVETRFNREDG
FT                   LIVCATVAFGMGVDKPDIRWVAHADLPKSIEGYYQEIGRAGRDGAPADTLTLYGPDDIR
FT                   FRRQQVDEGLAPPERKTADHARLNALLGLAEAQGCRRKVLLSYFGDEAEDCGNCDLCAR
FT                   PPELFDASVAVQKALSVMLRTGEYFGAGHLIDVLLGAQNEKIRQRGHDRLSTYGIGTEF
FT                   DKRGWQAVFRQMMGRDLVRPDPERHGAFRMTDAARPILRGEEGITLRKDTISKAPRRPA
FT                   VKMLVSEEDAPLMSALKAKRRALAEDARVPAYVIFTDKTLIEMAEKRPDTLDDMARISG
FT                   VGATKLERYGTAFLQVITGDTPEAVHPARRALAGRDAGDVFDRLMEVQQDLMRGDDGTG
FT                   KYLSVNHSTLRRIAERRPASLHDMARIAGMGDKQVDRFAEAFLEVLREAG"
FT   gene            448451..449227
FT                   /locus_tag="Jann_0444"
FT   CDS_pept        448451..449227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0444"
FT                   /product="protein of unknown function DUF328"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53361"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28VA1"
FT                   /protein_id="ABD53361.1"
FT                   /translation="MLTVISPAKRLDWAKRELATTAPDFMDDAVTLARAAKRLSQADLR
FT                   KLMDISADLAKLNADRFKVFEEAPEGERPAALAFAGDTYIGLEATSLDADTMDYAQDHL
FT                   RILSGLYGLLRPLDAIRPYRLEMGSRLKTRKGPSLYAYWGPRLAQALNVQAKAVDTKTL
FT                   INCASVEYFSAVDEKALDLDIVTPQFFEDKPGGPKIVSFFAKKARGAMARFVQERRLTS
FT                   PHQILDFDTGGYSHAPDLSAPGKPAFLRSEAAQKAA"
FT   gene            complement(449270..449566)
FT                   /locus_tag="Jann_0445"
FT   CDS_pept        complement(449270..449566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0445"
FT                   /product="protein of unknown function DUF1244"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53362"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="InterPro:IPR036810"
FT                   /db_xref="UniProtKB/TrEMBL:Q28VA0"
FT                   /protein_id="ABD53362.1"
FT                   /translation="MSEPTKTELEAATFRRLLAHLDSRKDVQNIDMMNLTGFCRNCLSR
FT                   WYQEEAADRGVTIDKDAAREIIYGMPYPEWRDKYQTEASAEQQAAFEGNKSAH"
FT   gene            complement(449588..450325)
FT                   /locus_tag="Jann_0446"
FT   CDS_pept        complement(449588..450325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0446"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53363"
FT                   /db_xref="GOA:Q28V99"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR011227"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V99"
FT                   /protein_id="ABD53363.1"
FT                   /translation="MTDAVEILGAERSGRWVVTCDHACNRVPDDVAGGDLGLPPADMAR
FT                   HIAYDVGALGVARAMGEALNGPVVTSRFSRLVIDPNRGEDDPTLLMQIYDGSIIPANRG
FT                   ASQAEIDRRLDRFHRPYHRALAHVIAQRDDPIVVAIHSFTPQLIGRAPRPWHVSVLYAG
FT                   DTRLPYPLLARLRDEDDLCVGDNEPYSGHLPGDALDRHGVQPGRLHVLIEVRNDLIETA
FT                   EDQARWGVRLAQMLEAAATSADL"
FT   gene            450520..451968
FT                   /locus_tag="Jann_0447"
FT   CDS_pept        450520..451968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0447"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53364"
FT                   /db_xref="GOA:Q28V98"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V98"
FT                   /protein_id="ABD53364.1"
FT                   /translation="MKRDRNVKIVATLGPASDDYEMIRALHEAGADVFRLNMSHGDHSE
FT                   IAVRHGIIRQIEADLGQPIAILADLQGPKLRVGVFDNDDGYDLDVGATFRMDLDDTPGD
FT                   TTRVQLPHTEIFAALEPGAHLLINDGKIRVKVLECGTDYANCEVLAGGRISNRKGVNVP
FT                   DVVLPLAALSEKDRKDLEFVCELGVDWLALSFVQRREDVDEARSLAKGRAAVLSKIEKP
FT                   SAVANFGEILEASDGIMVARGDLGVELPVQNVPPIQKLLVRKCRNAAKPVIVATQMLES
FT                   MIESPMPTRAEVSDVAAAIYEGADAIMLSAESAAGDFPIEAVTTMNNVAVEVESDPTYR
FT                   SIIEASRGGEKETVADAIVSAAREIAETTNIKLICCFSESGSTAALTARERPNVPILAL
FT                   TSRQATARRMCLTWGCHCVKVGSVGRFKEAVISAVRAATTEGLAETTDQIVVTAGVPFG
FT                   QSGSTNILRIAPCDERLIYASELE"
FT   gene            451965..452201
FT                   /locus_tag="Jann_0448"
FT   CDS_pept        451965..452201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53365"
FT                   /db_xref="GOA:Q28V97"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V97"
FT                   /protein_id="ABD53365.1"
FT                   /translation="MTLPVGADILLVIATVVGILSLSSIVAAWTIKRWPFVALISFVIA
FT                   AALAYYVHLTVPGGLAPLDIPNAFISVVARIVN"
FT   gene            complement(452214..452816)
FT                   /locus_tag="Jann_0449"
FT   CDS_pept        complement(452214..452816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0449"
FT                   /product="Exopolysaccharide synthesis ExoD"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53366"
FT                   /db_xref="GOA:Q28V96"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V96"
FT                   /protein_id="ABD53366.1"
FT                   /translation="MSEPHPPLAEAPPASLPDIIDRVLDAARVDVTDIRTILQSFGRAS
FT                   FTPVLLLPAMAVATPLSGIPLFSSFAGLLIALVSAQMLARRNYLWLPDWILRRQITGGK
FT                   LRAAFERIRPVAVWIDARTAQRFRLLSRRPLIFLPQLLCLVSGLMMPVLEFVPFSSSVV
FT                   GIGVAILALGMLARDGALIVLGLLPYAGVVWLVYRVV"
FT   gene            452987..453187
FT                   /locus_tag="Jann_0450"
FT   CDS_pept        452987..453187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0450"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53367"
FT                   /db_xref="GOA:Q28V95"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V95"
FT                   /protein_id="ABD53367.1"
FT                   /translation="MPKMKTKSSAKKRFKVTSTGKVMAAQAGKQHGMIKRSNKFLRNAR
FT                   GTSELSAPDSKIVKSYMPYDR"
FT   gene            453200..453559
FT                   /locus_tag="Jann_0451"
FT   CDS_pept        453200..453559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0451"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53368"
FT                   /db_xref="GOA:Q28V94"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V94"
FT                   /protein_id="ABD53368.1"
FT                   /translation="MSRTKGGTVTHRRHKKVIDAAKGYYGARSTNFRTATQAVDKANQY
FT                   ATRDRKNRKRQFRALWIQRINAAVRQHDEALTYSRFINGLAKAGIEVDRKVLADLAVHE
FT                   PDAFSAIVDQAKAAL"
FT   gene            453704..454777
FT                   /locus_tag="Jann_0452"
FT   CDS_pept        453704..454777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0452"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53369"
FT                   /db_xref="GOA:Q28V93"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V93"
FT                   /protein_id="ABD53369.1"
FT                   /translation="MDGLNDLRAGWLDRIGGATDEATLEEFRVAALGKKGEISLKMREL
FT                   GKMTPEERQVAGPALNALKDEVNAAIAAKKAGLADAALDERLKAEWLDVTLPARPKRVG
FT                   SIHPVSQVTEEVTAIFADMGFSVAEGPQIETDFYNFDALNIPGHHPARAEMDTFYTHRA
FT                   EGDNRPPHVLRTHTSPVQIRHMEKHGAPCRIIAPGRVYRADYDQTHTPMFHQVEGLVLG
FT                   RDVSMANLKWVLEEFYSAFFGVQVKTRFRASHFPFVEPGAEVDIQCSFEGGTVKVGEGD
FT                   DWLEILGSGMVHPKVLEAGGIDPQEFQGFAFGMGIDRIAMLKYGIPDLRDFFASDLRWL
FT                   RHYGFASLEMPSVHAGD"
FT   gene            454781..455194
FT                   /locus_tag="Jann_0453"
FT   CDS_pept        454781..455194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53370"
FT                   /db_xref="GOA:Q28V92"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V92"
FT                   /protein_id="ABD53370.1"
FT                   /translation="MTTQRQIDRLLLIVQASDEETIRARSVFLEDLFPGDVAEPTWHTL
FT                   NPEDGPTLRAAIRLGLLKEEYVRWLPDYPDELIPDGGDFIVTLTGAGTERLLKPNEGFV
FT                   PRAWKQVRTNIPTIAAAVITALAINWAIKYFGA"
FT   gene            455198..457600
FT                   /locus_tag="Jann_0454"
FT   CDS_pept        455198..457600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0454"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53371"
FT                   /db_xref="GOA:Q28V91"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V91"
FT                   /protein_id="ABD53371.1"
FT                   /translation="MKFTLSWLKDHLDTDASVTEITDALTDLGLEVEGVEDRAEALKTF
FT                   TIAHIQSAEQHPDADRLRICQVETNDGLQQIICGAPNARAGINVVLAKPGDYIPGLDIT
FT                   IGVGKIRGVESFGMMASEKELLLSDEHNGIIELKDAQVGQKFIDWLAKHDPAKVDPVIE
FT                   IAITPNRQDALGIRGIARDLSARGVGTLKAHDPAEIKGTYPSPISITIDADTLDTAPHF
FT                   TGRLIKGVKNGPSPAWLQDRLRAIGLRPISALVDITNYFTFDQNRPLHVFDADKVAGGL
FT                   RVHKAAGGEEIVALDDKTYTLPEGHMVISDDTGVESIAGIMGGAATGCTEDTVNVFLES
FT                   AWWDTVAIAYAGRALKINSDARYRFERGVDPDYTLPGLHAATQMVLDLCGGEASEVVEA
FT                   GKPLDTARSYTLRPGRVKSLVGMDVAREEQARILTALGFSATGTDTLEVWVPSWRRDVQ
FT                   GEADLVEEVARVTSLSQLKPQPLPREPGVPAPVLTPMQKRERSARRTMAALGYNECVTY
FT                   SFIDKASAELFGGGTDAVMLENPISSEMSHMRPAVLPGLLQAAARNQARGMMDMALFEV
FT                   GAGFHGGEPGEQHLLASGLLIGHTGPRDPHGARRPVDVYDVKADAEAVLSAIGAPAKAQ
FT                   ILRGAREWWHPGRHGMICLGPKKVLGIFGEVHPKVLAAMDIKGPAMAFTIFPQEVPLPR
FT                   STNASRGAVTMSDLQAVERDFAFVVPSDVPALDLVNAAAGADKTLIADVRVFDEFIGGS
FT                   LGEGNKSIALAVRMQPQDKTLTEEEIEAVADKIVTKVSKATGGVLRG"
FT   gene            457668..458111
FT                   /locus_tag="Jann_0455"
FT   CDS_pept        457668..458111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53372"
FT                   /db_xref="InterPro:IPR019884"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V90"
FT                   /protein_id="ABD53372.1"
FT                   /translation="MKVYLSGEIHTDWRERIVAGSEGLDVTFSSPVTDHDASDDCGVAI
FT                   LGAEPNKFWHDHKGAKVNAIRTRHGIENADIVVVRFGEKYKQWNAAFDAGMAAALGKPL
FT                   IVLSMPEHQHPLKEVHGAALAVAEEPEQVVQILRYVLTGRLPG"
FT   gene            complement(458202..458903)
FT                   /locus_tag="Jann_0456"
FT   CDS_pept        complement(458202..458903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0456"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53373"
FT                   /db_xref="GOA:Q28V89"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V89"
FT                   /protein_id="ABD53373.1"
FT                   /translation="MTAVTDHPINSRWPANDPSVLQLYSFPTPNGVKVSIALEEMGLPY
FT                   EAHRITLSDADVKSDAFLALNPNNKIPAIIDPDGPGGAPLELWESGAILIYLAEKTGKL
FT                   IGTTEAQKYEVIKWVMFQMGGLGPMFGQLGYFSKFAGSEIEDPRPKQRYVDEAKRLLAV
FT                   LEKQLAGRDWIAGDYSIADIAIAPWLAALDFYGTKGVVGWDDLTHVPAYLDRFLAREAV
FT                   KVGRNTPPREG"
FT   gene            458997..459488
FT                   /locus_tag="Jann_0457"
FT   CDS_pept        458997..459488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0457"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53374"
FT                   /db_xref="GOA:Q28V88"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V88"
FT                   /protein_id="ABD53374.1"
FT                   /translation="MCECARKSIPCEQELKDWDTHMINEFKDFIAKGNVMDMAVGIIIG
FT                   AAFTAIVTSLVGDLINPIIALFTGGMDFSGWFYVLGDGECASVAACTEAGISVFAIGNF
FT                   LMAIINFLIIAFVVFMLVKMVNRVKAAAEKPDEVAPEVETGPSEIDLLIEIRDGLKARG
FT                   "
FT   gene            complement(459549..460667)
FT                   /locus_tag="Jann_0458"
FT   CDS_pept        complement(459549..460667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0458"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53375"
FT                   /db_xref="GOA:Q28V87"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V87"
FT                   /protein_id="ABD53375.1"
FT                   /translation="MHIGCPTEIKPQEFRVGITPAAAREAVVHGHRVTMQAGAGTGAGF
FT                   TDEDYTAAGAEIAATAKDVFAAAQMIVKVKEPQAVERAMLRKGQILFTYLHLAPDPDQT
FT                   ADLLQSGVTAIAYETVTDRTGGLPLLAPMSEVAGRLAPQVGSWALQKANGGGGVLMGGV
FT                   PGVGPAEVVVIGGGVVGTQAARVAAGMGADVTILDRSLPRLRYLDDAYRGAFKTRYASA
FT                   DATAQLITTADMVIGAVLIPGAAAPKLVTKDQLSTMNPGAVIVDVAIDQGGCFETSKAT
FT                   THQDPIYEVDGVVHYCVANMPGAVARTSTLALGNATMPFMLALADKGWKQACADDPHLL
FT                   EGLNTHEGKLTNYAVGMALGLDVLSPSLAIKG"
FT   gene            460789..461271
FT                   /locus_tag="Jann_0459"
FT   CDS_pept        460789..461271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0459"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53376"
FT                   /db_xref="GOA:Q28V86"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V86"
FT                   /protein_id="ABD53376.1"
FT                   /translation="MTREITKEVELDAMDVAILQALQRQGRITHADLSEKVNLSPSACH
FT                   RRVQRLEASGVIRDYVALVSPRAVGRVTTVFVEIKLQGQSDETFDAFEKAVARVPDVLE
FT                   CHLMAGSADYLLKVVARDSEDFARIHRQHLARLPGVAQLQSSFALKTVFKTTALPV"
FT   gene            complement(461285..461626)
FT                   /locus_tag="Jann_0460"
FT   CDS_pept        complement(461285..461626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0460"
FT                   /product="branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53377"
FT                   /db_xref="GOA:Q28V85"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V85"
FT                   /protein_id="ABD53377.1"
FT                   /translation="MTSVTDHWSAGEIWFIIATLGVATYLIRLSFLGLIGNRALPAWLL
FT                   RHLRYTPVAILPALVTPLVVWPTTTEGALSPPHLVGAIAAMSVGYWRKSPIWAVVAGMV
FT                   SFLIVRAVF"
FT   gene            complement(461623..462345)
FT                   /locus_tag="Jann_0461"
FT   CDS_pept        complement(461623..462345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0461"
FT                   /product="AzlC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53378"
FT                   /db_xref="GOA:Q28V84"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V84"
FT                   /protein_id="ABD53378.1"
FT                   /translation="MTPETTSRDFKTRSAFWRGARDCGPFLFVAGPFGMLFGVVGTEAG
FT                   LNIAQVMGFSVVIIAGASQFAALQLMLDEAPTIIVLLSAIAVNLRMAMYSASLAPHLGA
FT                   ASLWQRALVGYMNVDQTYAVSVLKYEAEPQMTLPQKLGYFFGACLPIIPIWIVTTFIGA
FT                   LLGSSIPTQWGLEFAVPVTFIALVAPALRTPAHIVAALASIILALIFAGLPYKLGLLPA
FT                   GIGAMMVGAEVERRMGQR"
FT   gene            462429..462965
FT                   /locus_tag="Jann_0462"
FT   CDS_pept        462429..462965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0462"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53379"
FT                   /db_xref="GOA:Q28V83"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V83"
FT                   /protein_id="ABD53379.1"
FT                   /translation="MILAGGQGRRIGGDKACVLLGGKPLWRHVLDRVEPQVARVAVNAS
FT                   VPFGGRPFVADDVPGMGPLGGILAAMIWAKGQGADRVLTVAVDTPFLPSDLAERMCAAT
FT                   GRIVVAKTTDGLHGTTAVWDVGLADDLRWALDAGTRKVTDWANGVGIAPVVFQDASAFF
FT                   NVNTPEDLAAAEARL"
FT   gene            462986..463819
FT                   /locus_tag="Jann_0463"
FT   CDS_pept        462986..463819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53380"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V82"
FT                   /protein_id="ABD53380.1"
FT                   /translation="MVDWSARSAPSPAKPTKDSIFMGVSRSGREVVSYYRTRIAAMRVL
FT                   TGLLDGELRAGRRVLVGFDFPFGYPQGFARAVTGHDDPLRVWEWMAAAIRDDDRNRNNR
FT                   WDVAKMLNGMFPGVGPFWGCPAGVATDVLPAKGRARRGHGMEERRDVERRLPRAQPCWK
FT                   LFTTGSVGSQVLMGLPHVQRLRERYGTALSVSPFEAPDTPIVLAEIYPGLIDAAVKSRV
FT                   ADGEILDAVQVRLVARAFASLKPAHLDAMLQEGDLEEGWILGLGHEAALIAGLDP"
FT   gene            463816..464697
FT                   /locus_tag="Jann_0464"
FT   CDS_pept        463816..464697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0464"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53381"
FT                   /db_xref="GOA:Q28V81"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V81"
FT                   /protein_id="ABD53381.1"
FT                   /translation="MTARSVGFGLLLAAFGTVVLTPDAMLMRLSGMDGVQMLGWRSTLM
FT                   GCVLIAAWAGSRVGQWRADAALIFSGGGLAIALCQGVNGALFTFGIVGAPVTIVLLGVA
FT                   TVPIFAAIFSWTLMGEATGRATWVTIVVVLAGITIAVFGKGDGGVEAGAIKGALYGLGV
FT                   AICLALSFVLIRRMGDVPILPTVGLGALGAGAVGIALTGSDLMGGDVVLWPILLTGAVV
FT                   LPVSFFCLSLASRYTAAANVSLLLLLETVLGPLWVWLAVGEAPTPMMLGGGAIVVASLS
FT                   VYLVHQRLTAGR"
FT   gene            complement(464681..465850)
FT                   /locus_tag="Jann_0465"
FT   CDS_pept        complement(464681..465850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0465"
FT                   /product="aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53382"
FT                   /db_xref="GOA:Q28V80"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V80"
FT                   /protein_id="ABD53382.1"
FT                   /translation="MSFDEIIDRRGTHCTKWDMMETLYGVSPDDGISMWVADMDFRPPQ
FT                   CVQDAVADMHAHGVYGYFGDDSKYRAAICWWMQERHGWSVDPSHIFSTHGLVNGTSMCI
FT                   DAFTAPGDGVVLFTPVYHAFAKVINASARDLCELEMPIVDGRLTLDFEAFDTQMKGHEK
FT                   MLVLCSPHNPGGRVWTREELEGIADFARRHDLILVSDEIHHDLTMPGQTHIPMAHIDGI
FT                   EDRLVMMTAATKTFNIAGSHIGNVIIADDTLRATFAGRMAALGMSPNSFGLFMVTAAYS
FT                   PEGAEWLDELRAYLAENARVFDEGINAIPGLRSMALESTYLAWVDFSGTGMTKDEFTAR
FT                   VTSSAKIAANHGPTFGKGGDSFLRFNIAAPRAVIEDAVTRMKAAFSDLQ"
FT   gene            465992..466516
FT                   /locus_tag="Jann_0466"
FT   CDS_pept        465992..466516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0466"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53383"
FT                   /db_xref="GOA:Q28V79"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V79"
FT                   /protein_id="ABD53383.1"
FT                   /translation="MKLPILIHPDPRLKKVAAPVPDVTDELRALADNMLSTMYDAPGIG
FT                   LAAPQVGVGQRLIVLDCEKGDDVTPRPLAMFNPEVIASSDEMNTYDEGCLSIPDIYADV
FT                   TRPEAVTVRWMDVNGAEQEETFDGLWATCVQHEIDHLEGKLFIDYLSGLKRQLITRKMV
FT                   KLKRDRAREGA"
FT   gene            466513..466998
FT                   /locus_tag="Jann_0467"
FT   CDS_pept        466513..466998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0467"
FT                   /product="formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53384"
FT                   /db_xref="GOA:Q28V78"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V78"
FT                   /protein_id="ABD53384.1"
FT                   /translation="MSVRRVLLWPDPLLSVVCDAVVAVDPELIKDLFDTMYAAKGRGLA
FT                   APQIGVLQRVFVVDVTWKEGARDPRVFINPVVRDSGEDMRSMEEQCLSIPDLPMQVTRP
FT                   TTLTLDWETPEGRKTTGTFDGNLARCILHELDHLDGTVIFDHQSPARRAELEAAYAD"
FT   gene            466988..467482
FT                   /locus_tag="Jann_0468"
FT   CDS_pept        466988..467482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0468"
FT                   /product="formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53385"
FT                   /db_xref="GOA:Q28V77"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V77"
FT                   /protein_id="ABD53385.1"
FT                   /translation="MPIRPFVPYPDKRLRTMAETVGPVTDAHREIWQDMIDTMDAMPGV
FT                   GLAAPQIGVMLRLAVVDASDDRGQAIRMADPEIISASDEMNTYPEGSPNLPGVTAKITR
FT                   PARVTVAFTDHMGLRVRQEFVDLWATSVQHQIDHLAGKVYVDHLSRTKREMVIKKSRRG
FT                   S"
FT   gene            467482..468387
FT                   /locus_tag="Jann_0469"
FT   CDS_pept        467482..468387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0469"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53386"
FT                   /db_xref="GOA:Q28V76"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V76"
FT                   /protein_id="ABD53386.1"
FT                   /translation="MRIIFMGTPDFSVPVLDALVAAEHEVVAVYSQPPRPAGRGKRDRP
FT                   SPVQARAETLGLTVRNPVSLKSTEEQSALADLNADVAVVVAYGLILPQAVLDAPARGCL
FT                   NIHASLLPRWRGAAPIHRAIMAGDTMTGVCIMQMEAGLDTGPVLLRRETSIGAEDTTGT
FT                   LHDRLSAIGAKAIVDALSQLDELTPKPQPDDGVTYATKIDKSEAKVDWTAPAPHINRQI
FT                   LGLSPFPGAWTMAGGKRLKLLQSRVANGTGALGEVLHGLTVACGDGAVEISRVQPEGKG
FT                   AMDAKDWLLGARIAPGTVLE"
FT   gene            468447..468731
FT                   /locus_tag="Jann_0470"
FT   CDS_pept        468447..468731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53387"
FT                   /db_xref="GOA:Q28V75"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V75"
FT                   /protein_id="ABD53387.1"
FT                   /translation="MVLFSFFGSLMIAGIVAFLFEKWDFTHNGILPSVFIAWGAVLVLF
FT                   FVRSLFGLTLGSPGLDAVIGSAAALILIPTEYASKRRGKDSSDRPWRNR"
FT   gene            468823..469779
FT                   /locus_tag="Jann_0471"
FT   CDS_pept        468823..469779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0471"
FT                   /product="Citrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53388"
FT                   /db_xref="GOA:Q28V74"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V74"
FT                   /protein_id="ABD53388.1"
FT                   /translation="MSFRIQPTPIARPNRCQLFGPGSNPKLFEKMAASAADVINLDLED
FT                   SVAPDDKAMARSNIINAIKDVDWGNKTLSARINGLDTPYWYRDVVDLLEADTDRLDIIM
FT                   IPKVGCAADIYAVDALVTAIEAAKGRSKPVGFEVIIESAAGIAHVEEIAAASPRMQAMS
FT                   LGAADFAASMGMQTTGIGGTQEAYYMLHEGAKYWSDPWHWAQTAIVAACRTHGVLPVDG
FT                   PFGDFSDDEGYRAQARRSATLGMVGKWAIHPRQIAVANEVFTPSEEAVAEAEEILSAME
FT                   AAKASGAGATVYKGRLVDIASIKQAEVIVKQAKMINS"
FT   gene            469854..471029
FT                   /locus_tag="Jann_0472"
FT   CDS_pept        469854..471029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53389"
FT                   /db_xref="GOA:Q28V73"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V73"
FT                   /protein_id="ABD53389.1"
FT                   /translation="MNTSVFFDIAAALAVTALLAESYGAVRRRMVGTNLAPVVLGVLFG
FT                   LMALLQMFNPVEPYDGLIIDMRNVPIALAGAFLGWRGVLPCLAIAFATRYGIGGVGMLA
FT                   GVVGMTIAGLAGIIWARLTAHLEQRGLGLLLLLAAAMSTHVVSGVVVPRDMAIWFFSVA
FT                   AAPIVLVNFLAVPLIGSLLERENRRIQRENKLSAAITRDPETGLLTGPALVRDLTNAYA
FT                   AQPFGTFAGFLKVTPDRRFWSLYGGLFGAAHPRPVDASDLTQAVDHAALAGTCADGSVL
FT                   IPLSAWEIENITRVKSALRSAMRNKLRQGETLGLLDMAVIEAAEPAEFIRVAKRAALTA
FT                   QPDWSRAPMAGKTRAKDTSQLASVRRSKIFNPEEHDVLFAKADFLIDRSHS"
FT   gene            471113..472072
FT                   /locus_tag="Jann_0473"
FT   CDS_pept        471113..472072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0473"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53390"
FT                   /db_xref="GOA:Q28V72"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V72"
FT                   /protein_id="ABD53390.1"
FT                   /translation="MNYLDFEKPLAEIEGKAEELRAMARREEGMDVEEQAAALDKKAAD
FT                   LLRTLYADLTPWRKCQVARHAQRPHCQDYIDALFTEYTPLAGDRNFADDHAIMGGLARF
FT                   DDTPVVVIGHEKGHDTKTRIERNFGMARPEGYRKAVRLMDLADRFNLPVITLVDTPGAY
FT                   PGKGAEERGQSEAIARSTEKCLQIGVPLISVIIGEGGSGGAVAFATADRLAMLEHSVYS
FT                   VISPEGCASILWKDAEKMREAAEALRLTAQDLHKLGVCDVVINEPLGGAQRNKDAAIES
FT                   VGKAIASMLAGFGDADRATLIAGRRKKFLDLGSKGLAA"
FT   gene            472069..472590
FT                   /locus_tag="Jann_0474"
FT   CDS_pept        472069..472590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53391"
FT                   /db_xref="GOA:Q28V71"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR039131"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V71"
FT                   /protein_id="ABD53391.1"
FT                   /translation="MTNRRQALCGLLAGPLLALPLKAEPMRPIADFSWRYAADTVMGGV
FT                   SAGRGWVEDGVLRLTGTVSTANNGGFIQVRTDLPDGLSDTILHLRVRGNGERYFVHLRS
FT                   VQSTRPWMSYRAEFPTTADWTDITLPLTAFTPSRDGMPAQIAAEDVRSLGIVAYGRDHE
FT                   ADVSVSHISV"
FT   gene            complement(472799..473398)
FT                   /locus_tag="Jann_0475"
FT   CDS_pept        complement(472799..473398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0475"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53392"
FT                   /db_xref="GOA:Q28V70"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V70"
FT                   /protein_id="ABD53392.1"
FT                   /translation="MKTITDIAELEALYDAAVPTSLTKVVPALTPLYRQWIETARFMVL
FT                   STVGPEGTDASPRGDDGPVVRIVDDRTLMMPDWRGNNRIDSLRNIVRDGRVSCMFMVPG
FT                   AGNVVRINGTAVLTDDPDLTKTFEQRGKHPKSVIVITTGEVYFQCAKAIMRSGLWTRDD
FT                   AEGLPKAGDFITDVDPDFDGKTYDAEYPVKAPERMW"
FT   gene            complement(473395..474120)
FT                   /locus_tag="Jann_0476"
FT   CDS_pept        complement(473395..474120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0476"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53393"
FT                   /db_xref="GOA:Q28V69"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V69"
FT                   /protein_id="ABD53393.1"
FT                   /translation="MQTIRSFLHIVQMYVAMLIIAVVFFPWALFSPRGAHAACHTYCAW
FT                   VFWTLRWMVGLRVEVRGTPPTDEVLVAAKHQSFLDVMVIYHAVPRGKFIMKRELMFAPF
FT                   LGQYGLRIGCVPVNRGKRGAAIKKMLEDVRSGKQQGGQLIIYPQGTRIAPGVSAPYKAG
FT                   TGALYAQMGQPCVPVATNIGVFWPKTGITRKPGVAVVDFLPRIEPGMEAKPFLDRLEHD
FT                   IETASNALLDEAGFRRDET"
FT   gene            complement(474120..475022)
FT                   /locus_tag="Jann_0477"
FT   CDS_pept        complement(474120..475022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0477"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53394"
FT                   /db_xref="GOA:Q28V68"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V68"
FT                   /protein_id="ABD53394.1"
FT                   /translation="MSGLSSLFNMVRGDAQADRVVPRSGQSARLTLATSAAMAFLAVFA
FT                   MALSMASGRLADRWSEALAQSATIRISAPEAELEAQTGAVLTVLEQTPGVQSARALTDE
FT                   DQQALLAPWFGTDLPLEDLPIPRLIEITETAGGFDADGLRQRLVAEAPGAVLDDHDRWR
FT                   RPLADAADRLRLLGGLALVLILGATAAMVTLAAQAALSANEQVIRVLRLVGARDSYIAH
FT                   AFVRRFTVRALTGAAIGTSIGLLSVLLLPSAQDTAAILTGLSFSGKGWFWPLLIPGLAA
FT                   TTAFIATRFAAFRTLRGLQ"
FT   gene            complement(475019..475696)
FT                   /locus_tag="Jann_0478"
FT   CDS_pept        complement(475019..475696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0478"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53395"
FT                   /db_xref="GOA:Q28V67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V67"
FT                   /protein_id="ABD53395.1"
FT                   /translation="MIEMQDAAYGYGAEPLLSGLSLQLPPGSFHFLTGPSGAGKTTFLK
FT                   LCYAELLPTGGHISLFGHTATGLARDGIADLRQRIGVVHQDCKFLDHLPLSENLALPLT
FT                   VTGKGSMVQESNLTELIGWVGLSARANAFPPELSGGERQRAALARAIIMDPELIIADEP
FT                   TGNVDWEMSLRLLNLLIELNKLGKTVVIATHDLALIRAAKQRVQARVLRIQNGEIISAG
FT                   ADL"
FT   gene            475951..476775
FT                   /locus_tag="Jann_0479"
FT   CDS_pept        475951..476775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0479"
FT                   /product="Zinc finger/thioredoxin putative"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53396"
FT                   /db_xref="GOA:Q28V66"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V66"
FT                   /protein_id="ABD53396.1"
FT                   /translation="MRLTCPNCSARYEVDEDMVPASGRDVQCSNCSQTWFQPGPRRTEP
FT                   KAPEPETDAPEVETAQEEPRLAEVSVDGPSGAPGEEATEDEPRPARRQIDPNVTDILRE
FT                   EAEREARLRRSDPAPDPAPQQEEMPLTEEPSTQRERRLADLEGAADAFDTDQITAAVAT
FT                   AAAASRREQFPDIEEINSTLRATGDRHEGAEDGTDVDTVSAASRRRGSVRRGFFSVILL
FT                   ACIAVGIYAYAGQIAEAVPQLGPALEQYVDAVNSARFWLDDMARSLAGETGN"
FT   gene            complement(476812..479364)
FT                   /locus_tag="Jann_0480"
FT   CDS_pept        complement(476812..479364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53397"
FT                   /db_xref="GOA:Q28V65"
FT                   /db_xref="InterPro:IPR012683"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V65"
FT                   /protein_id="ABD53397.1"
FT                   /translation="MTEDNANTGPKTDAIRWLIWPLRLTRLGMAAERFVRAFWPVWTLA
FT                   FVAFAALAFGTGTLASPTTVWSGLALVSLALVVLVFVGIRRFKMPSHQDALERLDATMP
FT                   GRPITTLLDTPAVGGSDPASQSVWAVHVARMANRAASARAPQPDLRVSRNDPYALRYIG
FT                   VTAIAMALLFGGLSRVTEVGEVPLGPGAATAAAGPSWEGWVEPPIYTGLPSLYLNDITA
FT                   DTFEAPLGSDITLRAYGAPGEITLRTDIGPVPELDDGAYAQTVTMERGGTLAVDGPGGR
FT                   EWQVAVRPDQPPTVALEGEVEGEPPSAMQFSFTASDDYGVRSGTATIRLNPVAADRRFG
FT                   LAVDPEPREPVVLDLPMPFRGNRDEFTEVVLEDLSEHPFANLPVTLTLTVTDDAGQIAT
FT                   VSYDVARLPGQRFFDPLANALIEMRRDILWNRENATRSARLLRALTHRPEDGLEEGVYL
FT                   GLRSAIQRLEAAIDMISFETQEDVAEILWNAALELEFGDLDSALERLRRAQERLEEAMR
FT                   QGASDEEIAQLMQEMREAMDEYMQELADNTEFGDDTDQPDEGERQEMSNADLDEMLRRI
FT                   EELMQEGRMAEAMEMLQALQEMLENMEITQGEGGGDGPQTPGQEAMEGLQETLRGQQEL
FT                   SDDSFQELQDQFNPNRPGQQSEQQGNAPQGNQPGQEGQNPGDIAGGDSGQGSLAERQQE
FT                   LLRQLEEQARRLPGTGTEAGDEALEQLDGAGRAMDEAAEALERGGIAEALDLQSEAMEA
FT                   LREGMTQLSEALAQEQGAEPGQGPAEGNMAESRPMQDPLGRQAGNNGALGSDEDGLGDG
FT                   VDARERARELLDLLRDRAAEQTRPEIERDYLRRLLDQF"
FT   gene            complement(479396..480661)
FT                   /locus_tag="Jann_0481"
FT   CDS_pept        complement(479396..480661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0481"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53398"
FT                   /db_xref="GOA:Q28V64"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V64"
FT                   /protein_id="ABD53398.1"
FT                   /translation="MDHFLYKNGALHAEDVPVADIAASVGTPFYVYSTATLTRHFQLFE
FT                   EALGGMDHLICFAVKSNSNQAVLSHMAMLGAGMDVVSGGEYLRAKAAGVPGDKIVFSGI
FT                   GKTEDEMRLALNGGIRQFNVESEPEMHRLSRVATALGVTVPITVRVNPDVDAKTHAKIA
FT                   TGRKEDKFGIPIARAREVYALAASLPGLQVIGIDVHIGSQLTDLEPFEIAYAKVAELTE
FT                   QLREDGHTITRLDLGGGLGIPYERSNSAPPLPIEYGEVIKRTVGHLGCEIEIEPGRLIS
FT                   GNAGLLVASTIYVKHGEDRDFLILDAAMNDLIRPAMYGAYHDIIPVVEPAPGAEQSPYD
FT                   IVGPVCESGDTFAKQRDLPPVKEADLIAFRSAGAYGAVMSSEYNTRPLIPEVLVNGDQF
FT                   AVIRARPSFDDMINRDTLPQWM"
FT   gene            480741..481709
FT                   /locus_tag="Jann_0482"
FT   CDS_pept        480741..481709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0482"
FT                   /product="Alcohol dehydrogenase zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53399"
FT                   /db_xref="GOA:Q28V63"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V63"
FT                   /protein_id="ABD53399.1"
FT                   /translation="MAKTAIIEAHGGPEQLKIVERDVGEPGAGEIRIRHHAVGLNFIDC
FT                   YQRSGLYPMELPHALGMEAAGVVEAVGDGVTHLAVGDRAAYACSPPGAYTEARVMPAAQ
FT                   VCPLPDEISFEDGAAMMLKGLTTQYLFHRTTPISKGDTVLFHAAAGGVGLIACQWARSE
FT                   GIRLIATAGSDEKCTLAVEHGADVCINYRDEDWVAKVKDLTGGVDVVMDSVGADTFEGS
FT                   LDCLKPLGFMISFGNASGPVPPFELATLAQKGSLKITRPTLFAHIADHAKCQQMAAELF
FT                   EKVTSGAVKIRIDQRFALEDVAEAHRTLEARKTTGQTVLIL"
FT   gene            complement(481758..482084)
FT                   /locus_tag="Jann_0483"
FT   CDS_pept        complement(481758..482084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53400"
FT                   /db_xref="GOA:Q28V62"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V62"
FT                   /protein_id="ABD53400.1"
FT                   /translation="MRIIYLALIVAGIYYPWRHFYAWFEENGWDLGPMIDAWYVNEATT
FT                   ALTWDLTIAAIALMVWVAYEVVTKRAWLWLLVVPVTFGIGVSAGLPLALLLLTIQRGGG
FT                   RAAG"
FT   gene            482260..483906
FT                   /locus_tag="Jann_0484"
FT   CDS_pept        482260..483906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0484"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53401"
FT                   /db_xref="GOA:Q28V61"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V61"
FT                   /protein_id="ABD53401.1"
FT                   /translation="MSKIERESMEYDVVIVGAGPAGLSAAIRLKQLDAELNVVVLEKGS
FT                   EVGAHILSGAVLDPVGLDALIPDWQDKGAPLNVPVKDDNFYMLGEAGGIRIPNFPMPPL
FT                   MNNHGNYIVSMGNVCRWMAEQAEALGVEIFPGMACSELVYGDNGEVRGVVAGVFGLEAD
FT                   GSIGEGTEPGMELLGKYVFLSEGVRGSLSQEVIGKYNLATGYEPQKYGLGMKEIWEIDP
FT                   EKHREGSVTHTMGWPLGKNAGGGSFIYHLENNQVYVGFVVHLNYKNPHLFPYMEFQRFK
FT                   HHPMVAELLKGGKRIAYGARAITEGGYQSMCKMVAPGVALLGCSVGMVNVPRIKGNHNA
FT                   MLSGKAAAEAAYAAIQDGRASDELSDYEIEVREGAIGQDLKKVRNVKPMWSQKGLVASL
FT                   AFGGLDMWTNTLGFSLFGTMKHGKTDADATEKAARWNPIEYPKPDGVLSFDRLTNVAFS
FT                   FTNHEESQPAHLRLRDSTVPVAVNLPDYAGPSQRYCPAGVYEFVKDGDDDKFVINFQNC
FT                   VHCKTCDIKDPSQNIHWTVPQGGDGPNYPNM"
FT   gene            484009..485709
FT                   /locus_tag="Jann_0485"
FT   CDS_pept        484009..485709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0485"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53402"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V60"
FT                   /protein_id="ABD53402.1"
FT                   /translation="MRVTRPIFALALAALISPLTAPGSAQADSLAGAYLAGRSAAITGD
FT                   HAQAATYFDRAIQLDPGNAFLVSNSVFAHASLGEWAAAAEVAEGLPDGAEGQELVALVD
FT                   FVRHVSEDRLQEAIDMIEAGDGPGPLADDLARAWLTFGQGDMSGAVDTFEALASERGLE
FT                   ELAALHLALARAAVGDFEAAHEILSGGTGVQISNTERVVRARAVVMLQLDMRAEALDLL
FT                   DGYTQAVPDPGLLALQARVGSGEDVPYDFVNTAQDGVAEVFFTVAQLLAGDRNTTLPLL
FT                   MAQAARGIDPDHTDAMVLAGEFMGATEQFQLAAATYGEVPEDDPNYIEAQMGRAEALES
FT                   LGQEEEAIGILADLAAARPDLASVQAAYGDILRRDEQFEGAIEAYTAVLDLVDADQPRY
FT                   WFIHYARAISYHQTDNWDPAEADFRRALELNPEQPNVLNYLGYSLVEQRRNFDEALGMI
FT                   QRAVAARPESGYIIDSLGWVYYRLGRFEEAVAPMERAVELEPNDPIVNDHLGDVYWVNG
FT                   RYREAEFQWHRALSFDPEEEDAVRIRRKLEVGLDVVLEEEGGVGVLEEE"
FT   gene            485706..486536
FT                   /locus_tag="Jann_0486"
FT   CDS_pept        485706..486536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0486"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53403"
FT                   /db_xref="GOA:Q28V59"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V59"
FT                   /protein_id="ABD53403.1"
FT                   /translation="MSAATFRGYAPAKVNLALHVTGRRVDGYHELDSLVVFAGVGDRLE
FT                   IAPADALSLTVTGPRAEGVPDDARNLVWKAADWLAPGRGAAMTLDKHLPHAGGIGGGSA
FT                   DAACALRGLAEIWDVDVPDGAEALGADVPVCLHGQPVRMRGIGDVLDAVPPLPPMWIVL
FT                   VNAGVEVPTGAVFKAMERVDNPPLPAPAWDGFDSFLVWLERTRNDMESSARSQAPVIGM
FT                   VLERLRALPGCRFTRMSGSGGTCFGLFETEIAARDAALGLPKHWWVTYAPVLRA"
FT   gene            complement(486583..487590)
FT                   /locus_tag="Jann_0487"
FT   CDS_pept        complement(486583..487590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0487"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53404"
FT                   /db_xref="GOA:Q28V58"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V58"
FT                   /protein_id="ABD53404.1"
FT                   /translation="MSLDTPTQKPHDRLSAALKDDLTAVNTLIRARMASKHAPRIPEVT
FT                   AHLVEAGGKRIRPMLTLACARLCGYSGDDHVKLAATVEFIHTATLLHDDVVDESEQRRG
FT                   RPTANLLWDNQSSVLVGDYLFARAFQLMVEPGNLRVLDILSNAAATIAEGEVLQLTVAS
FT                   NIETPEETYLQVIRGKTAALFEAACEVGGVIAGRDTFIIQALATYGDGLGVAFQMADDL
FT                   LDWGGVDGGAQLDKNIGDDFRERKMTLPVIRAIAAANGDERAFWARTIGKGDQRDGDLE
FT                   QALDVLQRHGTLASTRDAANDHVARAKAALTNLPDDPLRDMLADLADYVVARLN"
FT   gene            487641..487862
FT                   /locus_tag="Jann_0488"
FT   CDS_pept        487641..487862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53405"
FT                   /db_xref="GOA:Q28V57"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V57"
FT                   /protein_id="ABD53405.1"
FT                   /translation="MLEILRSNDPTIIAFATALLRGEDIEVFEMDVHMSGLEGSIGILP
FT                   RRLLVRRAEAAAAEVVLRDNELPVSEWN"
FT   gene            487853..488596
FT                   /locus_tag="Jann_0489"
FT   CDS_pept        487853..488596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0489"
FT                   /product="methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53406"
FT                   /db_xref="GOA:Q28V56"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V56"
FT                   /protein_id="ABD53406.1"
FT                   /translation="MELTDTFGDAVTQDGFLNGRVMAWQPRKGYRAATDPVFLAAACPA
FT                   TTGESVLELGCGVGVAALCLQARVPGVEVTGVERQAAYADLARRNGVDVVQADLTSLPT
FT                   ALRQRSFDHVIANPPYYGPGTGSDDAGRDEALREETPLAEWGRIARARLIPGGWLTMIH
FT                   MAERLPDVLGALTGFGSISVLPLAAREGRAAGRVVVRARKGARGAFRLLPPVHVHDGEI
FT                   HRGDGDDFSATTRAVLRDGAPLPFG"
FT   gene            488704..488868
FT                   /locus_tag="Jann_0490"
FT   CDS_pept        488704..488868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0490"
FT                   /product="protein of unknown function DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53407"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V55"
FT                   /protein_id="ABD53407.1"
FT                   /translation="MSLNAHLQELKKKHANLSATVEEQQRSPAADPLTLRDMKKEKLRL
FT                   KEEIARLDS"
FT   gene            complement(488947..489894)
FT                   /locus_tag="Jann_0491"
FT   CDS_pept        complement(488947..489894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0491"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53408"
FT                   /db_xref="GOA:Q28V54"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V54"
FT                   /protein_id="ABD53408.1"
FT                   /translation="MSDRLPPLTALRAFDAAARHMSFSKAAAELNVTPAALSFQIKSLE
FT                   EHLEAPLFRRLNRAVELTDAGKALAPGASDGFTALASAWRAANRTVDQTSLTVTAGPAF
FT                   TAKWLAPRLFKFAMANPEIELRFSATLRLMDFARDDVDVAIRFSLAKEDPNLDSRPIIR
FT                   EWVTPMMTPELAEAYPDPTDLARAPLLHQDDIQFLKPAVDWPAWFRAAQLPPRFAAGAR
FT                   FSQADHAIDAALAGAGVVLGRISLAEKDLKEGRLVMPYKIALATEAKYSFVCPEGSDAR
FT                   PQVRAFREWIEAETATLDAYREGLTFVNAAEVEQ"
FT   gene            complement(490688..491410)
FT                   /locus_tag="Jann_0492"
FT   CDS_pept        complement(490688..491410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0492"
FT                   /product="Acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53409"
FT                   /db_xref="GOA:Q28V53"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V53"
FT                   /protein_id="ABD53409.1"
FT                   /translation="MGRVALVTGGSRGIGEAISKALQADGYTVAATYAGNDEAAAKFTD
FT                   ATGIKTYKWNVADYDSSKAGIEQVESDLGPIEVVVANAGITRDAPFHKMTPQQWNEVID
FT                   TNLTGVFNTVHPIWPGMRERKFGRVIVISSINGQKGQFAQTNYAATKAGDLGIVKSLAQ
FT                   EGARAGITANAICPGYIATEMVMAIPEKVRDSIVAGIPAGRLGEPEEIARCVCFLASDD
FT                   SGFINGSTISANGAQFFV"
FT   gene            complement(491500..492675)
FT                   /locus_tag="Jann_0493"
FT   CDS_pept        complement(491500..492675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0493"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53410"
FT                   /db_xref="GOA:Q28V52"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V52"
FT                   /protein_id="ABD53410.1"
FT                   /translation="MTNVVIASAARTPVGSFLGSFANTSAHDLGKTVIEAVVERAGIDK
FT                   ADVSETILGQVLTAAQGQNPARQAHINAGLPKESAAWSINQVCGSGLRAVALGAQHIML
FT                   GDASVVVAGGQENMSMSPHAAMLRQGQKMGDMKYIDTMIRDGLWDAFNGYHMGQTAENV
FT                   AEKWQISREQQDEFAVASQNKAEAAQKDGRFADEITPVIVPNRKGDITVDADEYIRHGA
FT                   TMEAMAKLRPAFTKEGSVTAANASGLNDGAAATLLMSADDAEKRGIQPLARIASYATAG
FT                   LDPSIMGVGPIYASRKALEKAGWSVDDLDLVEANEAFAAQACAVNKDMGWDPSIVNVNG
FT                   GAIAIGHPIGASGCRVLNTLLFEMQRRDAKKGLATLCIGGGMGVALCVERD"
FT   gene            complement(492860..493690)
FT                   /locus_tag="Jann_0494"
FT   CDS_pept        complement(492860..493690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0494"
FT                   /product="diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53411"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V51"
FT                   /protein_id="ABD53411.1"
FT                   /translation="MRDDSVEPAEPGLASPLDAAINQRDRGTLAMVQQALARGDTRLAF
FT                   QPIIRADGKGVAFYEGLIRVLDETGRVIPASDFMGAVEDSDIGRQIDCAALDIGLRMLR
FT                   DHPGLRLSINMSARSVGYPRWMKILRTCLRDHPIVVERLILEITESSVMIMPEIVAIFM
FT                   EDLQDKGITFALDDFGAGYTAFRHFKTFYFDVLKIDGQFTRDIAHDADNQVLSEALISL
FT                   ARHFDMLVVSESVETAEEASWLVSAGVDCLQGYYYGPPTMKLPDVGTNQIARTG"
FT   gene            493791..494378
FT                   /locus_tag="Jann_0495"
FT   CDS_pept        493791..494378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0495"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53412"
FT                   /db_xref="GOA:Q28V50"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V50"
FT                   /protein_id="ABD53412.1"
FT                   /translation="MANDRADGRCDWCGTDPLYVDYHDTEWGVPEYDSRALWEKLVLDG
FT                   FQAGLAWITILRKRDAFRDAFEGFNPEVIAGWGEADVQRLLANPGIVRHRGKIEATITN
FT                   AQAWIALEEGEGFDTFIWRYVDGTPLRNSFATMAEVPPSTEMSTRMSKDLKKAGFKFCG
FT                   PTIVYAWLEATGVVNDHLTGCFRYDEVTALAR"
FT   gene            complement(494544..495098)
FT                   /locus_tag="Jann_0496"
FT   CDS_pept        complement(494544..495098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0496"
FT                   /product="thiol:disulfide interchange protein putative"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53413"
FT                   /db_xref="GOA:Q28V49"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V49"
FT                   /protein_id="ABD53413.1"
FT                   /translation="MIAAYIASALGANALVAGQGMAQDLSELQVGDMRGLVIHSDPVAV
FT                   SDLPFVQADETEGALADYAGQHVVLNFWATWCAPCREEMPSLQALQDELGGDAFQVVTL
FT                   ATGRNPPQAIRRFFDEEGVTTLPQHRDINQQIAREMGIFGLPITVVLDPSGQEIARLRG
FT                   DADWASPEAVAMLQAIIASGS"
FT   gene            495148..496578
FT                   /locus_tag="Jann_0497"
FT   CDS_pept        495148..496578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0497"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53414"
FT                   /db_xref="GOA:Q28V48"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V48"
FT                   /protein_id="ABD53414.1"
FT                   /translation="MTDTGSSDTNTDTTGTSKANTMWGGRFAAGPDAIMEAINASISFD
FT                   QRMARQDIEGSRAHAAMLAATGIVESSDVDVIREGLLTVLSEIEGGTFQYSTALEDIHM
FT                   NVEARLTEIIGTPAGRLHTARSRNDQVATDFKLWVRDQMDAAISGIEALQRALLGQAEA
FT                   GADWVMPGFTHLQTAQPVTWGHHMMAYVEMLGRDASRFRDARTRMNESPLGAAALAGTS
FT                   FPIDRDMTAEALGFDRPSANSLDAVADRDFALEFLSAASICAMHLSRFAEELVIWSSAQ
FT                   FRFVALSDRFSTGSSIMPQKKNPDAAELIRAKIGRIFGANVALMTVMKGLPLTYSKDMQ
FT                   EDKEQTFDAADNLMLALAAMEGMVRDMQANVPSLEAAASSGFSTATDLADWLVRELNMP
FT                   FREAHHVTGSLVKLAEDKGCDLPDLALSDMHSVHGDITDGVFDVLGVHNSVASRTSYGG
FT                   TSPVQVREQVARWRDILG"
FT   gene            496937..497407
FT                   /locus_tag="Jann_0498"
FT   CDS_pept        496937..497407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0498"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53415"
FT                   /db_xref="GOA:Q28V47"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V47"
FT                   /protein_id="ABD53415.1"
FT                   /translation="MEKIPMTPKGLEAMNGELKQLKSVERPAIIKAIAEAREHGDLSEN
FT                   AEYHSAKEKQSFIEGRIKELEGSISLAQVIDPATLSGAIKFGATVDLVDEETEEEKTYM
FT                   IVGEAEADIEKGLLNIKSPLARALIGKEEGDSVEVRTPGGAKGFEIVKISYV"
FT   gene            497451..498503
FT                   /locus_tag="Jann_0499"
FT   CDS_pept        497451..498503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53416"
FT                   /db_xref="GOA:Q28V46"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V46"
FT                   /protein_id="ABD53416.1"
FT                   /translation="MTSSSEPTSSAPAAPKAAPTALDLGLYARSEGGPRITAVEVVAFA
FT                   VSALWIVAVIFLGFGSTEEGGATSGLSQILSILAVILPLALIWVAAMAARTARALRQEA
FT                   ARLQASIDAMRAAYVEQQQRHSMEMKPELAQKLDDLVAAQQAADTKLATFTSLRVMDPA
FT                   ELRAAVPPTLAAVDMSQPQPALGLVQEVEAEPISVADFIRALNFPENEHDKEGFRTLRR
FT                   ALEDRATERLIRASQDVLTLLSQDGIYMDDLRPDRSKSEVWRRFAKGERGRAIASLGGI
FT                   HDRSSLVLAAGRMRKDPVFRDAVHHFLRHFDWTFMEFEKNASDEEIAHLADTRTARAFM
FT                   LLGRVTGTFD"
FT   gene            complement(498510..499136)
FT                   /locus_tag="Jann_0500"
FT   CDS_pept        complement(498510..499136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0500"
FT                   /product="protein of unknown function UPF0126"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53417"
FT                   /db_xref="GOA:Q28V45"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V45"
FT                   /protein_id="ABD53417.1"
FT                   /translation="MTVALSLDYAAVLIFALTGALAASRAQLDIVGFIFFAALTAVGGG
FT                   TIRDLLLGRDTVFWIANTTPIAIAMVAAIVVFFSAHLVESRLKWLIWLDAAALAIAVAA
FT                   GVAVATQMEASIGVALVMGVATGTFGGLMRDVVANEVPLVLKQGELYVTAAVAGASAAL
FT                   IGAHFLPEDTIWPTVLCVAVTFGLRAGSLLFGWSLPVYKARPPRA"
FT   gene            complement(499133..499522)
FT                   /locus_tag="Jann_0501"
FT   CDS_pept        complement(499133..499522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0501"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53418"
FT                   /db_xref="GOA:Q28V44"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V44"
FT                   /protein_id="ABD53418.1"
FT                   /translation="MDKVCPVVLRPGRRVLAFRHPQAGLQLVKGGIESNEAPAAAAARE
FT                   LYEEAGLSLWPVRDLGHSTRIARGDTWHFWLMAHSILPEAWDHHTDDDGGHRFAFFWHP
FT                   IGEPPPPDFAPPFVRALDHIAATIP"
FT   gene            complement(499515..499988)
FT                   /locus_tag="Jann_0502"
FT   CDS_pept        complement(499515..499988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0502"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53419"
FT                   /db_xref="GOA:Q28V43"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V43"
FT                   /protein_id="ABD53419.1"
FT                   /translation="MPDLVAYTDGACSGNPGPGGWGALMRAKDGDTILKERELKGGEAD
FT                   TTNNRMELLAAISALEALDRPSTLTIITDSAYVKNGITGWMHGWKRNGWKTSTRKPVKN
FT                   VDLWQRLDEAQSRHTVTWEWIKGHAGHEGNEKADELARAGMAPFKTGKRGKDG"
FT   gene            complement(499981..500574)
FT                   /locus_tag="Jann_0503"
FT   CDS_pept        complement(499981..500574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0503"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53420"
FT                   /db_xref="GOA:Q28V42"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V42"
FT                   /protein_id="ABD53420.1"
FT                   /translation="MSDDQTLSVYGDAVDRYTATPMEPEHIAALDHFAASVRPGGRVLD
FT                   LGCGPGLQAETLVAAGLDVDAVDATPAFVEAAQSRGLNARIAVFEDLPGAEIYYGIWAS
FT                   FSLLHARRDTVSGHVARLAGALSPGGIFFLGMKTGTGEARDGLGRFYSYFSVEELHQML
FT                   EDAGLRVTQTVTGRGKGLSGSDDTYALVHAVRDA"
FT   gene            complement(500571..501026)
FT                   /locus_tag="Jann_0504"
FT   CDS_pept        complement(500571..501026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53421"
FT                   /db_xref="GOA:Q28V41"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V41"
FT                   /protein_id="ABD53421.1"
FT                   /translation="MIRIPSSALLLGLAGLIPFLWGASSSASLLLDYMPVSLPAAFTGA
FT                   SILTAYGTIILSFMAGVIWGFAAKAGGPWMPLGLALSTVPALWIFFFTGQPHSTQLVVL
FT                   GAGFIGLLALDVACVRKGLAPGWWLALRLLLTGVVVFCLLIGFLLIP"
FT   gene            complement(501158..501790)
FT                   /locus_tag="Jann_0505"
FT   CDS_pept        complement(501158..501790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0505"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53422"
FT                   /db_xref="GOA:Q28V40"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V40"
FT                   /protein_id="ABD53422.1"
FT                   /translation="MNGPHAMITTQFLLTALVVVIAPGTGVVYTLALGLGRGRKAAIWA
FT                   ALGCTFGIVPHLLAATLGLAAVLHASALLFNIVKFLGVAYLLYLAVSALRSGGALSIEP
FT                   ATTVESGLTVAKRGALINILNPKLSIFFLSLLTPFLSGNPATVTQEIVVLGGIFMAMTF
FT                   AVFVLYGLFAATARTYILGSTRIMAWMNRSFAAIFALLAGRLALERA"
FT   gene            complement(501842..502318)
FT                   /locus_tag="Jann_0506"
FT   CDS_pept        complement(501842..502318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0506"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53423"
FT                   /db_xref="GOA:Q28V39"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V39"
FT                   /protein_id="ABD53423.1"
FT                   /translation="MPTPFDPLLVLSRPLMANLSTITHHGEPRNAPVWFAWEDDALWML
FT                   SDVTSSSPHRIARNPKVAVEIVDYDNTEGILRHLGLRGDATVEPMNPDLFRRLLRRYLG
FT                   PEDTQNQWFIENIARIDDPNGRLIRLEPTSIFTNDVSFFRTGPALATATARQST"
FT   gene            complement(502885..503844)
FT                   /locus_tag="Jann_0507"
FT   CDS_pept        complement(502885..503844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0507"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53424"
FT                   /db_xref="GOA:Q28V38"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V38"
FT                   /protein_id="ABD53424.1"
FT                   /translation="MTQTPKPPLTIYLAAPRGFCAGVDRAIKIVEMALEKWGAPVFVRH
FT                   EIVHNKYVVDDLKAKGAVFVEELSDCPDDRPVIFSAHGVPKSVPQAAAARQMVYVDATC
FT                   PLVSKVHIEAQRHSDNGLQMVMIGHKGHPETIGTMGQLPDGEVLLVETVEDVATVEVRD
FT                   PSRLAFVTQTTLSVDDTIEIVEALTTRFPAIVGPHKEDICYATTNRQEAVKAMAPKAEA
FT                   MLVVGAPNSSNSKRLVEVGSRAGCAYSQLVQRAADIDWRALGDIKTLGITAGASAPEVL
FT                   IEEVIQAFEDRFDVTRELVETAVENVEFKVPRVLRETA"
FT   gene            503987..504523
FT                   /locus_tag="Jann_0508"
FT   CDS_pept        503987..504523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0508"
FT                   /product="putative peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53425"
FT                   /db_xref="GOA:Q28V37"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V37"
FT                   /protein_id="ABD53425.1"
FT                   /translation="MLMPRQTVPALNVPLLGGETFDLASEDSPRGTVVCFYRGLHCPLC
FT                   ATYLTEFEKLAGEFAERGVGSVAISSDGEERAQGMADKIGADKLRFGYDMSLAKAREWG
FT                   LYISTSRGKTSIGIEEPALFAEPGLFLINPDNTLYYMSVQTMPFVRPHFRELLGAVDFA
FT                   IEKSYPARGEYTGAV"
FT   gene            complement(504520..505095)
FT                   /locus_tag="Jann_0509"
FT   CDS_pept        complement(504520..505095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0509"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53426"
FT                   /db_xref="GOA:Q28V36"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V36"
FT                   /protein_id="ABD53426.1"
FT                   /translation="MEDKSKEARRRQIEDAAYKMLGEKGYAGTSMQGIARAAKASNETL
FT                   YNWYGDKKGLMAALIARNTDTVRDTLSSHINADPLDRLAHLGPTLLAMVLGSRAVALNR
FT                   AAAADPSGDLGRALARGGRETVAPMVTALMTDSPLRGQPDRLTQLYLTLLIGDLQIRRA
FT                   TGAMEPPTQEFCTTRAAEALDMLKRLAT"
FT   gene            505199..505714
FT                   /locus_tag="Jann_0510"
FT   CDS_pept        505199..505714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53427"
FT                   /db_xref="GOA:Q28V35"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V35"
FT                   /protein_id="ABD53427.1"
FT                   /translation="MRGLGLSLGFASVLFAGAIFGFFYAWVCSTMWGLDAADPRIAIAA
FT                   MQAMNASVRNAVFFPTFFLTPVIMIAAAAVIRGRAGGFFAVGGVVYLLGGLILTMAVNV
FT                   PMNEALAVVQVPDDIDSARTIWEAYSPRWQVYNVARTLASGVAMMLAAAGLWTLGQATR
FT                   AGDHPSGL"
FT   gene            complement(505711..506286)
FT                   /locus_tag="Jann_0511"
FT   CDS_pept        complement(505711..506286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0511"
FT                   /product="protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53428"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V34"
FT                   /protein_id="ABD53428.1"
FT                   /translation="MFYRDERLALFIDGSNLYAAAKALGFDIDYKLLRSEFMQRGKLLR
FT                   ANYYTALLENDDYSPIRPLVDWLHYNGFNMVTKPAKEFVDSQGRRKVKGNMDIELAVDA
FT                   METAPHVDHIVIFSGDGDFRPLVESLQRKGCRVSVVSTIRSQPPMIADDLRRQCDNFIE
FT                   LLDLKEAIGRPPREPRPEPSAQIEVVAD"
FT   gene            506413..507000
FT                   /locus_tag="Jann_0512"
FT   CDS_pept        506413..507000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0512"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53429"
FT                   /db_xref="GOA:Q28V33"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V33"
FT                   /protein_id="ABD53429.1"
FT                   /translation="MYTNDARAGLIALGANLPSGGLPPEISVPKAMARLVERVGGPHSQ
FT                   SRLFHTPAFPPGSGPQFVNAAVKIEWRGHAGELLALLHEIEEEFGRTRAHRWEARVMDL
FT                   DLIGLGDAILPDAATRANWANLPPERAAQVVPDQLILPHPRLAERGFVLVPLADIAPEW
FT                   VDPATGLTVAEMLAARPHAELAGIHPVPVAAE"
FT   gene            507105..507458
FT                   /locus_tag="Jann_0513"
FT   CDS_pept        507105..507458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0513"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53430"
FT                   /db_xref="GOA:Q28V32"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V32"
FT                   /protein_id="ABD53430.1"
FT                   /translation="MARVTVEDCVDKVPNRFELVMLASHRAREIAAGDPLTIDRDNDKN
FT                   PVVSLREIADETQSADDLRERLIESHQTQIEVDEPEEDAMALLQGVEQDRPAQDDMSEE
FT                   QMLRALMEAQGQK"
FT   gene            507462..509630
FT                   /locus_tag="Jann_0514"
FT   CDS_pept        507462..509630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0514"
FT                   /product="(p)ppGpp synthetase I (GTP pyrophosphokinase)
FT                   SpoT/RelA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53431"
FT                   /db_xref="GOA:Q28V31"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V31"
FT                   /protein_id="ABD53431.1"
FT                   /translation="MAADGRPADETVAEDAITVDDLLSLVRNYNPKARESLIRDAFAYG
FT                   ARMHDGQTRHSGEPYFTHPVAVAAILTEQQLDDATIVTALLHDTIEDTRSTYGEVAKHF
FT                   GPEIAELIDGVTKLTNLQLSNRESKQAENFRKLFMAMSKDLRVILVKLADRLHNMRTIR
FT                   HMRPDKQKQKAQETMDIYAPLAGRMGMHWMREELEDLSFRVLNPEARSSILRRFITLQK
FT                   ETGDAIPKISDDIETVLNKRGVHADVYGRAKKPYSIWRKMQEKKLAFSRLSDIYGFRVI
FT                   TETEDDCYRVLGAIHQRWKSVPGRFKDYISQPKSNGYRSIHTTVSGRDGKRVEVQIRTY
FT                   QMHEVAEAGVAAHWAYRDGVRTQNPFAVDPTKWLESLTERFENAEDTNEFLEHVKLEMY
FT                   SDQVFCFTPKGDVVKLPRGATPIDFAYSIHTRIGHSCVGAKVDGLRVPLWTRLKNGQSV
FT                   DIITAEGQTPQATWIDIATTGRAKAAIRRSLREVDRDRYIKLGRELARVAFEQIGKKAT
FT                   DKALATAAKALVLSDGDEVLARIGSAELSARQVVAELYPELANPDDASAIEGARAVIGL
FT                   PPGARILRAQCCQPVPGERIVGITYHGKGPILHSIDCPALAAFDDQPDRWIDLHWTEGR
FT                   HASIHNVTANVTLSNENGVLGRICTLIGEQNANISDLHFIDRKPDFFRILIDMDVRDAE
FT                   HLHAVMMAVEADSDVAALDRFRDLDRRP"
FT   gene            509721..510353
FT                   /locus_tag="Jann_0515"
FT   CDS_pept        509721..510353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53432"
FT                   /db_xref="GOA:Q28V30"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V30"
FT                   /protein_id="ABD53432.1"
FT                   /translation="MFRRRDYRPWYRIILEVLWPRGGWLRAAQYVQHRMRRLPGTPEQI
FT                   ARGVFAGAVTVFTPYFGLHFVIAALLARAMRGSIFAALLATFIGNPLTYVPIAALSLNL
FT                   GHFMLGSRPTVGVNDSLFRRFGGASRDLWHNIKALFTPEQAHWGELQIFWDTVMWPWTV
FT                   GGILPGLLCGTICYFLTVPVVRAYQKSRAARLRKKMDKLRKQAEAAE"
FT   gene            510374..511120
FT                   /locus_tag="Jann_0516"
FT   CDS_pept        510374..511120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0516"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53433"
FT                   /db_xref="GOA:Q28V29"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V29"
FT                   /protein_id="ABD53433.1"
FT                   /translation="MSAMEKLRLGVNIDHVATLRNARGGALPDPVRAAVLAEQAGADGI
FT                   TAHLREDRRHIRDADIAAIMEAITIPLNFEMAATDEMQEIALGHLPHAACIVPERREER
FT                   TTEGGLEVAGDDNRLAQYIAPLKDAGIRVSLFIAAERSQIEAAARIGAPVIELHTGAYC
FT                   DYDAEGDVAARDAELARLIAGAKLGVELGLEVHMGHGLNYDTVAPIAALPEVAELNIGH
FT                   FLIGESIFVGLEAAMTEMRARMDAAR"
FT   gene            511120..511557
FT                   /locus_tag="Jann_0517"
FT   CDS_pept        511120..511557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53434"
FT                   /db_xref="GOA:Q28V28"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V28"
FT                   /protein_id="ABD53434.1"
FT                   /translation="MAVNLKRYGLVYLGTIVGLVGLSNAMVYFLDMSLPTGISTILPAW
FT                   LAAMTEGQKASDAKAPQYTGPQAWAQARRMTVVVVVINCIFGAIIFIYSDVATLLAQAP
FT                   VLITALLLIGFAVTFLVNRFALTWGYKVQHRAIVRKESRVG"
FT   gene            511554..512012
FT                   /locus_tag="Jann_0518"
FT   CDS_pept        511554..512012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53435"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V27"
FT                   /protein_id="ABD53435.1"
FT                   /translation="MTVSWVGQQAFGMALGATLLCANPVSAFVTAPCGPEFSPLTITEP
FT                   WEESSRTFAEGAIRIFEIFIDPNVASGAALGILHPNAPGSDSYRTCTAIYAGDQFRYFA
FT                   QAFVADATAVYDASVGLIITVPVAFADGNGPVMLRFAVNQATGVVRLL"
FT   gene            512018..512614
FT                   /locus_tag="Jann_0519"
FT   CDS_pept        512018..512614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0519"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53436"
FT                   /db_xref="GOA:Q28V26"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V26"
FT                   /protein_id="ABD53436.1"
FT                   /translation="MSALAALGTFLVAAGSPGPATLAVAGASMASGRRAGLALGAGLAV
FT                   GLAVWGVAVGLGFGALVAQSPVFLTIFKVIGGGYLLYLAWVSARSAMANHAPPEAMNSG
FT                   RAFRRGLFLNLGNPKAALAWIAALALGSGDGAVGWGVVAACAILGAVIYGAYALAFALG
FT                   PVRGLYTRARRGIEAATAGLFALAGLRLLTWRGAP"
FT   gene            512611..513063
FT                   /locus_tag="Jann_0520"
FT   CDS_pept        512611..513063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0520"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53437"
FT                   /db_xref="GOA:Q28V25"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V25"
FT                   /protein_id="ABD53437.1"
FT                   /translation="MILGIGTDLANIERIEGTLERFGDRFRNRVFTDREQARAERMPEP
FT                   AAVYAKRWAAKEACSKALGTGLRMGIAWKDMSVRNLRTGQPVMEVTGWARERLDQMTPD
FT                   GYGAVIHVTLTDDHPWAQAMVVIEALTPEEAELRPDLGPAARRTMS"
FT   gene            513215..513994
FT                   /locus_tag="Jann_0521"
FT   CDS_pept        513215..513994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0521"
FT                   /product="signal peptidase I. Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53438"
FT                   /db_xref="GOA:Q28V24"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V24"
FT                   /protein_id="ABD53438.1"
FT                   /translation="MADSEGGIMETVKTVAWALVIAGIFRTLFFQPFWIPSGSMKDTLL
FT                   IGDFLFVNKMAYGYSRHSCPFSMCPFEGRIFGSDPERGDVVVFRHPTNETDFIKRVIGL
FT                   PGDRVQVIDGVLHLNGEPVRLTPEEPFEEIAEAQGPQGHVPRCANAPVGEGGVCSKERF
FT                   TEELPGGVTHSILNIQEGTRGDNTPEFVVPEGHFFVMGDNRDNSIDSRFPQSIGGVGFV
FT                   PAENLLGRADRVIFSSAGQRMIYFWTWRSDRFFRAIE"
FT   gene            514001..514684
FT                   /locus_tag="Jann_0522"
FT   CDS_pept        514001..514684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0522"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53439"
FT                   /db_xref="GOA:Q28V23"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V23"
FT                   /protein_id="ABD53439.1"
FT                   /translation="MKPARELTAFMDRLGYVFEDPALLARALTHSSLSSPTRGDNQRLE
FT                   FLGDRVLGLVMAEAVLAADTDAKEGTLAPRFNALVRKEACADVARQIDLGAAMRLGKSE
FT                   MSAGGRRRMALLGDAMEAVIAAVYLDGGFASARDLVLRLWSERVQSVEEDARDAKTALQ
FT                   EWAQARGMAPPTYTEVARSGPDHAPVFRVRVTLSSGENAEAQAKAKRQAEQQAAKDLLA
FT                   QLAGE"
FT   gene            complement(514692..515186)
FT                   /locus_tag="Jann_0523"
FT   CDS_pept        complement(514692..515186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53440"
FT                   /db_xref="GOA:Q28V22"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V22"
FT                   /protein_id="ABD53440.1"
FT                   /translation="MLVRLCKIAMLLGLASFAFLVTFNNVTDYQSNFAFVQHVLSMDTT
FT                   FPDNAAMYRAVETPWMWHAGYWMIIAGEGLTALLLLAGAASLFIARNDPAIVFQDRKAL
FT                   AVVGCTIGFLVWFVGFMTVGGEWFLMWQSDIWNGQQAAFRFYMSILVVLIFVMQPDEEV
FT                   R"
FT   gene            515450..516388
FT                   /locus_tag="Jann_0524"
FT   CDS_pept        515450..516388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0524"
FT                   /product="GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53441"
FT                   /db_xref="GOA:Q28V21"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V21"
FT                   /protein_id="ABD53441.1"
FT                   /translation="MMQRPLPMTDPTTRAGFIALIGEPNAGKSTLLNRMVGAKVSIVTH
FT                   KVQTTRARIRGVAMEGDSQLVFVDTPGLFRPRRRLDRAMVKAAWTGAADADVVVLLIEA
FT                   HRGLTDGVQAILDGLKERTGDRKVALAINKIDRVDAPVLLKLTEDLNAAYPFDETYMIS
FT                   AEKGHGVKELRTWLAAEVPEGPWLYPEDQIADLPLRMIAAEMTREKLTLRLHQELPYQL
FT                   TVETEAWENRRDGSAKIDQIIYVARDGHKGILLGKGGETIKSVSKAAREEIAEFVGHPV
FT                   HLFLQVKVRPGWLEESERYSEMGLNFKDGNA"
FT   gene            516385..516717
FT                   /locus_tag="Jann_0525"
FT   CDS_pept        516385..516717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0525"
FT                   /product="protein of unknown function DUF1491"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53442"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V20"
FT                   /protein_id="ABD53442.1"
FT                   /translation="MSARLTADFWVAAYLARLRVEDIPAFIVSRGDGTAGAVLVKQSPL
FT                   DGTATLHQRSFDPMTGTRDWMVLTQGPETDVDAAIARQQSFDPDLWVIEVEDRAGRHLL
FT                   DAPGLD"
FT   gene            complement(516727..517344)
FT                   /locus_tag="Jann_0526"
FT   CDS_pept        complement(516727..517344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53443"
FT                   /db_xref="GOA:Q28V19"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V19"
FT                   /protein_id="ABD53443.1"
FT                   /translation="MFPALPLRARWTAMVIALVAGGSVLVMFFYNLATDRYGDEVTTAW
FT                   AMARFFTILTNIAVAWTFLNAALRRDGVRPAWTAALTLAMVLVGAVYHTLLSGITTYVG
FT                   WGAWANHGLHTFVPTACLLWWIAFAPKNRLQFRDLPMFIVWPCVYVAYALARGAQDGVY
FT                   PYPFMDLAEKPPLVVATNLAALLTVLLIGGVIFVMAARFADR"
FT   gene            517438..518172
FT                   /locus_tag="Jann_0527"
FT   CDS_pept        517438..518172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0527"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53444"
FT                   /db_xref="GOA:Q28V18"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V18"
FT                   /protein_id="ABD53444.1"
FT                   /translation="MDWRADGILLAVRRHGEASAIIELFTADQGCHLGVVRGGASRKMA
FT                   PLLQVGAQLDATWRARLSDHIGSYTVELVKGRAAEVMEDRVALAGLSSVCALLSFSLPE
FT                   RAAYPGLFARTLAVLDGLGAERWAEAYLGWEMALLTEMGFGLDLSQCAATGVTQDLAFI
FT                   SPRTGRAVSRAAAGEWADRLLPLSPALEGMARGPEDILAGLAVTGHFLATHLAPSLGDK
FT                   PLPAARQRLIDALERQVIRGGS"
FT   gene            complement(518153..518689)
FT                   /locus_tag="Jann_0528"
FT   CDS_pept        complement(518153..518689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0528"
FT                   /product="2'5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53445"
FT                   /db_xref="GOA:Q28V17"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V17"
FT                   /protein_id="ABD53445.1"
FT                   /translation="MRAFVALPLTDPAIDALTRVQSTLPTGKPVPEENLHLTLAYLGEV
FT                   SEDVLETLHDMLSAARLPSADIAFEGLGTFAEMERGLTFGAVAPSDALTALQTKVAQLA
FT                   RQAGVLLPRRRFRPHVTLTRANRQPKGPTRDRLASAIGTPIKVPGFTARTANLYESTLT
FT                   PSGARHEVLASYPLG"
FT   gene            complement(518690..519688)
FT                   /locus_tag="Jann_0529"
FT   CDS_pept        complement(518690..519688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0529"
FT                   /product="Dihydrokaempferol 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53446"
FT                   /db_xref="GOA:Q28V16"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V16"
FT                   /protein_id="ABD53446.1"
FT                   /translation="MPNHVFLTGVTGFIAKRIALDLLNGGHTVTGSLRNPARADEVRDA
FT                   LHPHLTDPGSLEHLTFATLDLTRDEGWTDAMAGCDTLMHTASPFPLSSPKDENDLIRPA
FT                   VDGTLRALNAAKDAGVTRVILTSSVVAIEANDRPNPQTPANWTDVNHPRATPYYTSKTL
FT                   AERAAWDFVAEHPEMQLTTINPSLVLGAPLDDNYGTSLSLIERMMAGKDPALPPLGFGL
FT                   VDVEDVSAMHIAAMARPESAGNRYIASAGSMMMPAIGAHLKGIYPDRKIATRQAPGWLL
FT                   RVLALFDPSIRTILPQLGHMPEFDTSVSIRDLGITFTPATTALKRAADAVT"
FT   gene            complement(519783..521465)
FT                   /locus_tag="Jann_0530"
FT   CDS_pept        complement(519783..521465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0530"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53447"
FT                   /db_xref="GOA:Q28V15"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V15"
FT                   /protein_id="ABD53447.1"
FT                   /translation="MPRDAQQQPETAVILSDLLALTSSAVAPAEALLNKAKSHLRYVLS
FT                   EGGRISAPLIERNQTAAHGLAWLATYVESLRQMQGWAERLDADGKFGEIEQLILQITFG
FT                   EYLWQIYGGIPMSQGEILRLQDIGLSQDDQRALMDDAVMTLTASGNTQAARTRLVELMQ
FT                   DRAAEVTVGACGLDEELDMIREQFRRYAVDRVIPNAHDWHLNDELIPMDIIEDLSEMGV
FT                   FGLTIPEEHGGLGMSKASMCVVSEELSRGYIGVGSLATRSEIAAELILAGGTDDQKAKW
FT                   LPGLSSGEILPTAVFTEPNTGSDLGSLRTKATKDGDDWVINGNKTWITHAARTHVMTVL
FT                   ARTIPDTNDYKGLSMFLAEKTPGTDEAPWQDAGISGGEIEVLGYRGMKEYTVNFDDFKV
FT                   KGENLLGGQEGQGFKQLMQTFESARIQTAARAIGVAQSALDAGMQYAQDRKQFGKGLIN
FT                   FPRVSGKLAMMAVEIMVARQLTYFSAREKDNDRRCDLEAGMAKLLGARVAWAAADNALQ
FT                   IHGGNGFALEYGISRILCDARILNIFEGAAEIQAQVIARRLLA"
FT   gene            521629..522402
FT                   /locus_tag="Jann_0531"
FT   CDS_pept        521629..522402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0531"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53448"
FT                   /db_xref="GOA:Q28V14"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V14"
FT                   /protein_id="ABD53448.1"
FT                   /translation="MLGDLMQLMPLWAFAAAFAVTLFAGIVKGAIGFGVPLIITSGLTL
FT                   FLDPLIAISGVVLPALISNLVQVARHPKADVLDAVAEHRRYIVMVCVLILIVSQFVVFV
FT                   PERVFYLILGVPVVVLSVIQLAGVSFEIPQGRRRGAEWTIGGLTGILGGFTGSWGPLTV
FT                   LYLIALDTPKMRQLLVQGVVYSLGALCLLLGHIQSGVMNAATIPFSAFLLVPIFLGMQI
FT                   GFRIGDKLDADLFRKLTLLLLVVAGANLVRRGLLG"
FT   gene            complement(522341..523315)
FT                   /locus_tag="Jann_0532"
FT   CDS_pept        complement(522341..523315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53449"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V13"
FT                   /protein_id="ABD53449.1"
FT                   /translation="MHVGLGQTGTRTIQTTLAKNRPLLKRLGAVYPGDADAHHDLLALV
FT                   HPRGPRHVWYKQQSISPEAAQCLADRQMSAIRAAAATDASIIFLSSEFFQALRAPQFSR
FT                   LDDQIAALGYQLETLCYIRAPLSHTACRIEQGVRLGSARIAQMMDRPYPPLARDHCEAA
FT                   LRSLGRERVHVRRIEDAEEGGLTVDALSVAGLIPEAGTLNDHRDEARLCHDAVYLLDAI
FT                   NGEDTTLGRERPMFRRHAEELFSIEGQPFTLPREVARRVQRQSRPEQDWLFRQFGTCYP
FT                   LQEIEDAPSHWQEIEWAADALFAVSQADHAAQDWPQPPQEAIA"
FT   gene            complement(523414..523986)
FT                   /locus_tag="Jann_0533"
FT   CDS_pept        complement(523414..523986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53450"
FT                   /db_xref="InterPro:IPR024331"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V12"
FT                   /protein_id="ABD53450.1"
FT                   /translation="MRAALLTIRVTLVSLTFAVGAIALASTAMAQDANPRVSPLLDDLA
FT                   YGLYCAQEPERRDPAPETASGVINIVPVIPELRFRQKLVPAEIGIGFGVIVSAPLGVIL
FT                   DPVTVTVTHPPYADSGIETEQWVTDVDAGPNLMGFTFDHPYELVLGEWTFSAVTLDGEE
FT                   VFHISFEVIAPELMPQVISACFGSFLS"
FT   gene            complement(524050..524589)
FT                   /locus_tag="Jann_0534"
FT   CDS_pept        complement(524050..524589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53451"
FT                   /db_xref="InterPro:IPR024331"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V11"
FT                   /protein_id="ABD53451.1"
FT                   /translation="MRVIPCSLVVPLAVLASPLHAQSATIYSSPELNSFSYGILCYYDN
FT                   DNPNVPLTRAQIDEINATTAFFDDVRTDGSTKIPSAAGVTFGVLSNYPEGVTYDVTSTI
FT                   THINRDGVAIEDTVPLVFDDVLEIDGWTFQSHGPENLGTYRFQTFRDGEIIYDLSFEVV
FT                   APEEFAGDLPPCVTLP"
FT   gene            complement(524727..526334)
FT                   /locus_tag="Jann_0535"
FT   CDS_pept        complement(524727..526334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0535"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53452"
FT                   /db_xref="GOA:Q28V10"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V10"
FT                   /protein_id="ABD53452.1"
FT                   /translation="MTHALSGGRVNPAHTLDQQGITGLGSVYYNLLEPALMQAAVERGE
FT                   GRIGKGGTFLVSTGQFTGRSPNDKFVVRTPEVEDHIWWDNNAPMTPDAFDALYSDMLEH
FT                   MKGGDYYVQDLFGGADAEHRLDVRVVSELAWHNLFIRHLLRRPDAEELASFVPEFTIIN
FT                   CPSFKADPARHGTNSETVIALNFERKLILIGNTEYAGENKKSVFTLLNYILPGKGVMAM
FT                   HCSANHAIGNPDDSAVFFGLSGTGKTTLSADPGRTLIGDDEHGWSDSGIFNFEGGCYAK
FT                   TINLREDAEPEIFATTAKFSTVIENMVYDEDTLELDFDDDSLTANMRCAYPIEMISNAS
FT                   ATGLGGSPKNIVMLTCDAFGVLPPIARLSPAQAMYHFLSGFTAKVAGTERGVTEPTPTF
FT                   STCFGAPFMPRRPEVYGDLLRQKIAAHGATCWLVNTGWTGGAFGTGSRMPIRATRALLT
FT                   AALNGTLNAGDFRRDPNFGFDVPVHCHGVADLLLDPRRTWDRPDSYDRQAQRLVDMFSD
FT                   NFAQYVDHIDDDVKAAAI"
FT   gene            526694..527395
FT                   /locus_tag="Jann_0536"
FT   CDS_pept        526694..527395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0536"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53453"
FT                   /db_xref="GOA:Q28V09"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V09"
FT                   /protein_id="ABD53453.1"
FT                   /translation="MARIALVDDDRNILTSVSMTLEAEGFDVETYNDGQSALDAFNRKL
FT                   PDLGVFDIKMPRMDGMDLLQRLRTKSQMPVIFLTSKDDEIDELMGLRMGADDYVRKPFS
FT                   QRLLVERIRSILRRQDAIASDAAGAPEESTVLDRGDLQMDPLRHAVTWKGRDVTLTVTE
FT                   FLLLQALAQRPGFVKSRDQLMDVAYDEQVYVDDRTIDSHIKRLRKKMRSVDNDFSAIET
FT                   LYGIGYRYNEE"
FT   gene            527405..529129
FT                   /locus_tag="Jann_0537"
FT   CDS_pept        527405..529129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0537"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53454"
FT                   /db_xref="GOA:Q28V08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V08"
FT                   /protein_id="ABD53454.1"
FT                   /translation="MPADVSMTNRRAAERADIVLGEDWDRPQSGVESELRAARSRRSWI
FT                   SLNSSPLARKIILFNLIAIMVLGMVFLWLNPVRDSLVIQRERALASEAQLMSDIFEAHL
FT                   PASAPANLVTGDGIDAEGVLSRIGVPDGMEVFVFSTEGVPVTSTQDIARSGVRPVRGLE
FT                   HQAQETLLITDFLVSIYDGLSGFLGNGPRPDATQNGPEAHADLVAAAMGGATILQRGTN
FT                   LSGTVHAASSPIEGAGGIVGVIVVTTAAGEIDQLVRVEQEQLLQMFVVALLVSIVLSLV
FT                   LASTIANPLADLSAAAELGRDKNARKMSPTRVRIPDLTGRPDEIGRLSGALRGMVAALY
FT                   DRIDSNEQFAADVSHEIKNPLASLRSAVGTLEFAKTDDQRKRLIDVIEHDVHRLDRLVS
FT                   DISNASRLDSELVKEEEEEFNLVQTLENLSQYHSEEAGKQGIEFITDLPTERIDIAGLE
FT                   GRLAQVFVNLLSNAISFCEDGDAVRLWTRRRENRVLIVVEDTGPGIPEEALTKVFNRFY
FT                   SERPANQFGNNSGLGLAISKQIVEAHGGVIWAENIRPTEADVTSEPLGARFVVGLPI"
FT   gene            529133..529597
FT                   /locus_tag="Jann_0538"
FT   CDS_pept        529133..529597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0538"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53455"
FT                   /db_xref="GOA:Q28V07"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V07"
FT                   /protein_id="ABD53455.1"
FT                   /translation="MTPPAEPLAERASARDGTRLFFHASAIVVAGKGALILGPSGSGKS
FT                   SLALSLIALGAELISDDGVWVDPDRAQLQRPETPPPLIEARGVGLLRAGPICKSAPLSL
FT                   VIDLSREESQRLPPRRMAALPDQKVELILARGHKTLAPIVFHLLRFGRAD"
FT   gene            529625..530581
FT                   /locus_tag="Jann_0539"
FT   CDS_pept        529625..530581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0539"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53456"
FT                   /db_xref="GOA:Q28V06"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28V06"
FT                   /protein_id="ABD53456.1"
FT                   /translation="MPPPNSAPPAQVVFVTGPSGAGRSTVINALEDLGFEAIDNLPLSL
FT                   LPRLLEGAPPDRPLALCIDPRTRDFDARDLIHAYEKLEQDPAYTADLVFIDCEPATLQR
FT                   RYSETRRRHPLAPDADPADGIAIEREMLAPLRTRADVLIDTTPLTVHRTRDEVIRLFAL
FT                   DRAPAMSIQIMSFSYRRALPISADLVFDCRFLRNPHWAPELRAKDGRQSDVQAYVAQDA
FT                   RFEAFRTQINAMLDLLLPAFKEEGKSHLTVAFGCTGGRHRSVTLAELTARRLAEEGWQV
FT                   SKRHRDVDKDASENSDRDRGASARTAASTDDGEAEQP"
FT   gene            530578..530970
FT                   /locus_tag="Jann_0540"
FT   CDS_pept        530578..530970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0540"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53457"
FT                   /db_xref="GOA:Q28V05"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V05"
FT                   /protein_id="ABD53457.1"
FT                   /translation="MIGIVIVAHGGLAKELKRATEHVVGAQPSMVAIAIGPEDDRSMRT
FT                   REICDAADAVDAGGGVVVVTDMYGGSPSNLSLRACRPSNRKILTGVNLPMLVKLAKSRH
FT                   LTVEEAVSRAAEAGRRYINSFDGAPE"
FT   gene            530986..531267
FT                   /locus_tag="Jann_0541"
FT   CDS_pept        530986..531267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0541"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53458"
FT                   /db_xref="GOA:Q28V04"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V04"
FT                   /protein_id="ABD53458.1"
FT                   /translation="MTDASITRNMKIVNVKGLHARASARFVEVVEEFDASATVRRDGLS
FT                   AAGDSIMGLLMLAASMGTSIEVETNGPEAERLADALDALVADRFGEET"
FT   gene            531280..532209
FT                   /locus_tag="Jann_0542"
FT   CDS_pept        531280..532209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53459"
FT                   /db_xref="GOA:Q28V03"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V03"
FT                   /protein_id="ABD53459.1"
FT                   /translation="MAMRDEGRRGQVTDLSTRNISAPAPTRGAGPDGTYDRRSLTYANS
FT                   FPSPFVRATIKTIEWMTGKLTIIRRIRQFESLGEFKGQAFWPATMRVMGIDLQTPDSQL
FT                   DRIPSDGPVVFVANHPHGLVDGMILADLIGRRRDDYRILTRALLTGIDEAAAGYMISVP
FT                   FPHEPDSQQKMLDMRAAAMEHLKAGGLISLFPSGAVAVADRMMGKPIEGEWNVFTAKMI
FT                   RNSGATIVPCFFTGQNSRAYQIANRISPVIRQGLLIHEVVKSFDKPQAPVIGKPITPDE
FT                   WADRIGKPREFMAWLRERTLSLGDNPDQ"
FT   gene            complement(532303..533181)
FT                   /locus_tag="Jann_0543"
FT   CDS_pept        complement(532303..533181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0543"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53460"
FT                   /db_xref="GOA:Q28V02"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V02"
FT                   /protein_id="ABD53460.1"
FT                   /translation="MDIESIGIVGAGQMGNGIAHVCALAGYEVILSDVSQDALDNAVAL
FT                   IDRNLDRQVSREKISQTVKSEAMARISTTLTLSDIGPTDLIIEAATERETVKQAIFEDL
FT                   LPHIKPNTILTSNTSSISITRLASRTDRPEKFMGFHFMNPVPVMQLVELIRGIATDEPT
FT                   FKACKSVVDRLGKTAATAEDFPAFIVNRILMPMINEAVYTLYEGVGNVTSIDMAMKLGT
FT                   NHPMGPLELADFIGLDTCLAIMNVLHDGLADTKYRPCPLLTKYVEAGWLGRKSQRGFYD
FT                   YRGEGDPVPTR"
FT   gene            533374..534192
FT                   /locus_tag="Jann_0544"
FT   CDS_pept        533374..534192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53461"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V01"
FT                   /protein_id="ABD53461.1"
FT                   /translation="MSFEQRGRMPLDYQPSVLPGSALRFRGPLSADNGPSLVCIGSSET
FT                   FGRFIDSPFATQLDQALDMPVLNLGVMNAGLDVMMNDPAIAAAVADADAVVMQITSAHN
FT                   MTNRFYSVHPRRNDRFLSASAMLRTIYPQVDFTEFHFTRHLLSHLREASEDRFEILRTE
FT                   LESAWVARMRRYLNSLAVPVHLLWLSNRKPDMPEDADLARHPLFVTSKMLEEVREDAAS
FT                   LTIAACDGSDEADAVKGKFYGPKEEAAARLLPGPDLHAMATDGLLKHLRN"
FT   gene            complement(534292..535218)
FT                   /locus_tag="Jann_0545"
FT   CDS_pept        complement(534292..535218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0545"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53462"
FT                   /db_xref="GOA:Q28V00"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q28V00"
FT                   /protein_id="ABD53462.1"
FT                   /translation="MAVLLLAEVNAGELAMDATAKAVTAAAQLGDVTVLCAGASAKAAA
FT                   DEAATIAGVARVLCAEDEALGHRLAEATAALIVSLAGDYSHIVAPATTDAKNVMPRVAA
FT                   LLDVMVISDASGVVDADTFERPIYAGNAIQTVKSADATKVVTFRTSTFDAAPTGGSASV
FT                   EMIDAAGNPGLSSWIEDKFAASDRPELTSAGIVVSGGRGVGSEEQFALIEGLADKLGAA
FT                   VGASRAAVDSGYAPNDWQVGQTGKVVAPDLYVAVGISGAIQHLAGMKDSKVIVAINKDE
FT                   EAPIFQVADYGLVADLFDAVPELTSKL"
FT   gene            complement(535220..535981)
FT                   /locus_tag="Jann_0546"
FT   CDS_pept        complement(535220..535981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0546"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53463"
FT                   /db_xref="GOA:Q28UZ9"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ9"
FT                   /protein_id="ABD53463.1"
FT                   /translation="MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEE
FT                   AIRLKEAGKAEEVIAVSIGVKQNQETLRTALAMGADRAILVIAAEDVHQDIEPLAVAKI
FT                   LKAVVDEEKPGLVLAGKQAIDNDMNATGQMLAALLGWSQGTFASEVDIDGDTAKITREV
FT                   DGGLQTIEVKMPAIVTVDLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEIV
FT                   TTSEPEARAAGVKVASVDELLTKLKDEAGVL"
FT   gene            complement(536100..536759)
FT                   /locus_tag="Jann_0547"
FT   CDS_pept        complement(536100..536759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0547"
FT                   /product="Hly-III related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53464"
FT                   /db_xref="GOA:Q28UZ8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ8"
FT                   /protein_id="ABD53464.1"
FT                   /translation="MAHLRSNRAYSRAEYLSDAVVHGLGIGGALIAGPVLITLAAVWVG
FT                   DPTLIGALAIYTITLLAMWVCSALYNLVQSEDLTPRFRRFDQSAIYFKIAGTYTPFIAL
FT                   ASGSMGFFAGIWTVALAGASVILFSKRSYIWLAIALYLGLGWAGTVAGGPLLSGITPLA
FT                   MSLLIVGGLTYSFGIIFLMWSKLPFHNTIWHICVLAGTSVCYAAIIAELLHNAPHV"
FT   gene            536888..537757
FT                   /locus_tag="Jann_0548"
FT   CDS_pept        536888..537757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53465"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ7"
FT                   /protein_id="ABD53465.1"
FT                   /translation="MAVRTGYKTAELAAQAERIKLQAAALVADLPRQPLQVLELVCACD
FT                   RCIDPPAYDQLIRTPPPQLTTYMVGQYFGGAGAVKVETGMAEQREARIILTHVLAHLGE
FT                   AVCRSREEERKYYRQAYFIEPAYWIEGLFRTGVIDTLSHEVATQIRVYLMEVVTHASAK
FT                   GSARLNDALTYLALATTALPDVLERYRTGPSRRHLRFWTSVAGGLVQRGPDGQNPRGVD
FT                   LYKWFDAMPEPAVETLVLALDHPDTERMMERYALAAQDRDWLTYLSRLMQWREATLAQS
FT                   FFSDRVGR"
FT   gene            complement(537858..538430)
FT                   /locus_tag="Jann_0549"
FT   CDS_pept        complement(537858..538430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0549"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53466"
FT                   /db_xref="GOA:Q28UZ6"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ6"
FT                   /protein_id="ABD53466.1"
FT                   /translation="MVVLNKIYTRTGDAGETALGDGSRVAKFSQRVTAYGTVDELNATL
FT                   GVARLHADGLMAERIAMIQNDLFDLGADLCTPNMEMDADREYPPLRMADAQVARLEAEI
FT                   DEMNPNLEPLRSFILPGGSPLASHLHICRTVCRRAERLSVELGGVESVNPAGVKYLNRL
FT                   SDWFFVAGRIANNNGKDDILWVPGANR"
FT   gene            complement(538435..538644)
FT                   /locus_tag="Jann_0550"
FT   CDS_pept        complement(538435..538644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0550"
FT                   /product="Hypoxia induced protein conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53467"
FT                   /db_xref="GOA:Q28UZ5"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ5"
FT                   /protein_id="ABD53467.1"
FT                   /translation="MTDDPLLIAGLVACVAVLVILLLGINSFRKGGADGAKTSNKLMQW
FT                   RLGAQFLAILLLLAFVYFRRQSGG"
FT   gene            complement(538707..539534)
FT                   /locus_tag="Jann_0551"
FT   CDS_pept        complement(538707..539534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0551"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53468"
FT                   /db_xref="GOA:Q28UZ4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ4"
FT                   /protein_id="ABD53468.1"
FT                   /translation="MTRSILITGSSSGIGHVAAHTLHARGWRVFACVRRDEDLARLETE
FT                   GLESGLLDVSDADSIEAGLADVLDRTGGTLDALFNNAGFGLPGLVEDLPTDALRATFET
FT                   NVFGLHHLTRAVIPTMRRQGHGRIVQHSSGFGRHVMKWRGAYNASKHAVEGLTDTLRLE
FT                   MRGTGIHISTLNTGPVTSKFRLNSIPQFERWIEWEASADPDRYKRELFRHLYEDTGPAP
FT                   FQREPDAVVKRLIHAIEADAPRPRYHITPAVHFAEALRRTLPQRLLDAIAVRL"
FT   gene            complement(539606..540226)
FT                   /locus_tag="Jann_0552"
FT   CDS_pept        complement(539606..540226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0552"
FT                   /product="SH3 type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53469"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ3"
FT                   /protein_id="ABD53469.1"
FT                   /translation="MIRLTVTLIVAIYVVLIVVPDADHGEHVTVTRNDGQNWLVAMITD
FT                   AEAGAQRPPTDRTPSVRALRASLTDELIETADGFALETSDGERLDIAAVINPVDLLPDN
FT                   ARTDVSVASVSFAVVPELPAADAPDATLASAPVAAAAPIWRVAATAVNFREGPSTNTAI
FT                   LASLSRGEEVEFLSEAPDNWARLRVVSSGLEGYMAAQFLEPTN"
FT   gene            540378..542705
FT                   /locus_tag="Jann_0553"
FT   CDS_pept        540378..542705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0553"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53470"
FT                   /db_xref="GOA:Q28UZ2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ2"
FT                   /protein_id="ABD53470.1"
FT                   /translation="MSSDDDTQDDRPDPGPGSASISEPLSRAIGSRYLQYALSTIMHRA
FT                   LPDARDGLKPVHRRILYAMRELRLASNGGFRKSAKISGDVMGNYHPHGDAAIYDAMARL
FT                   AQDFVIRYPLVDGQGNFGNIDGDNPAAARYTEARMTAVAEALLEGLSEDAVNFRDNYDG
FT                   TLQEPEVLPAQVPNLLANGSSGIAVGMATNIPPHNLDELIAACLHLIKTPDARDETLLN
FT                   YVQGPDFPTGGVIVEPRESMAETYRTGKGGFRVRATHEIEDLGRGQWQIVVTEIPYQVQ
FT                   KSKLIEKLAELIQLKKMPILADVRDESADDIRIVLEPRSKTVDPDVLMAALYRQSDLEN
FT                   RFSLNMNVLIDGRTPKVCSLKEVLRAFLDHRQDVLMRRSRHRMAQIDHRLEVLEGFLIA
FT                   FLNLDRVIDIIRYDDSPKAALMREDWGQDFVRAMSEADYVSPKPGEGELTEVQVEAILN
FT                   MRLRSLRRLEEMELQAERDRLMEERAGLEDLLAEESLQWGRIAEELREVRKKFGSRADG
FT                   GARRTQFAEAGNIEEVSLEAMIEREPVTIVCSQMGWIRAMKGHVDLSQEMKFRDGDGPR
FT                   FAIHAETTDKLLILGSQGRVYTLGANGLPGGRGLGEPLRLMVDLPNEVQIVDLFVHHPG
FT                   AKRLMASSAGDGFLVAEEDILAQTRSGKQVLNVKDGVTASVCRAVAPEDDHVAVVGENR
FT                   KLLVFPLTELPEMGRGKGVRLQKYKDGGLSDARTFRLEDGLVWLDPAGRTRTEVELGEW
FT                   AAKRAGAGRMAPRGFPRDNQFN"
FT   gene            542847..543524
FT                   /locus_tag="Jann_0554"
FT   CDS_pept        542847..543524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53471"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UZ1"
FT                   /protein_id="ABD53471.1"
FT                   /translation="MFRLARFAPLALITTLVACAAGDPLEEELPPMGDFRLAHNIVVAE
FT                   NMQQVPPSRNATPEEWQEILESEIDRRFRGYEGDRLYHIGVAVDGYALAPPGIPIVLSP
FT                   RSILVLSVNIWDDELGRKLHEEAEQIIVFEGSSPETLLVGSGIARNRNEQMQILARNAA
FT                   RRIQLFMLENPEWFNISEEEAAAAVSGVEALAEAAEAEAAIEAAAAECEPTATAPCPEL
FT                   PNN"
FT   gene            543640..544815
FT                   /locus_tag="Jann_0555"
FT   CDS_pept        543640..544815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0555"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53472"
FT                   /db_xref="GOA:Q28UW7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW7"
FT                   /protein_id="ABD53472.1"
FT                   /translation="MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKQFGDFQDYASI
FT                   DSAPEERARGITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDDEELLELVEMEIRELLSSYEYPGDDI
FT                   PVIPGSALAALEGRDDAIGKDSIDKLMAAVDEYIPTPARAVDQPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVINVGDEISIVGIRDTTKTTCTGVEMFRKLLDRGEAGDNIGALLRGVDR
FT                   EGVERGQVLCKPGSVDPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVN
FT                   LPAGTEMVMPGDNLKFEVELIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            545448..545903
FT                   /locus_tag="Jann_0556"
FT   CDS_pept        545448..545903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0556"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53473"
FT                   /db_xref="GOA:Q28UY9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY9"
FT                   /protein_id="ABD53473.1"
FT                   /translation="MDDTTDDDGFWAQLVPELSVRDLDQSLRFYRDVLGFSEKIRRPED
FT                   RFSYLELGQAQIMIEEVPENTAATWQTGPLEAPFGRGLNLQIEVEHARALHDRIVAAGY
FT                   KVFAPLKVAWYRDGTLEHGQEQFLVQDPDGYLLRFMKHLGTRVASDP"
FT   gene            complement(545995..546264)
FT                   /locus_tag="Jann_0557"
FT   CDS_pept        complement(545995..546264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53474"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY8"
FT                   /protein_id="ABD53474.1"
FT                   /translation="MRSLILILSLALALPMVPTMASADAHSCNQLRQGVVNRAPTNARN
FT                   LPYAALRCSAISELHLLLNRANSYSNSYLTQRIEAVFRREGLIR"
FT   gene            546394..546469
FT                   /locus_tag="Jann_R0006"
FT                   /note="tRNA-Trp1"
FT   tRNA            546394..546469
FT                   /locus_tag="Jann_R0006"
FT                   /product="tRNA-Trp"
FT   gene            complement(546506..546967)
FT                   /locus_tag="Jann_0558"
FT   CDS_pept        complement(546506..546967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0558"
FT                   /product="protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53475"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY7"
FT                   /protein_id="ABD53475.1"
FT                   /translation="MTAILILGAAVWPDGPSPTLRRRTLHGAALFHGGRGDVVIPCGGL
FT                   GRFPPTEAEAMAALLRDAGVPEDRIRLERTSTNTVENIRHALPLLAGERCVLIVSDAYH
FT                   LPRARLIARREGLEVSVSAPPLTGARVWPQAKGWLREIPGLIAVLLRIR"
FT   gene            547082..547273
FT                   /locus_tag="Jann_0559"
FT   CDS_pept        547082..547273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0559"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53476"
FT                   /db_xref="GOA:Q28UY6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY6"
FT                   /protein_id="ABD53476.1"
FT                   /translation="MTNPFQFLQQTRAEVAKVVWPTRKEVITTTAMVFLLALVAAIFFF
FT                   GVDWLIRNALELLLTSFG"
FT   gene            547455..547988
FT                   /locus_tag="Jann_0560"
FT   CDS_pept        547455..547988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0560"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53477"
FT                   /db_xref="GOA:Q28UY5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY5"
FT                   /protein_id="ABD53477.1"
FT                   /translation="MAKRWYSVSVLSNFEKRIAEQIRTAVAEKGLEDVIEEVLVPEEDV
FT                   IEIRRGKKVTVPRRFMPGYVLVRMEMTDVGYHVISSIQRVTGFLGPQGRPMPMRDEEVN
FT                   SILNRVEEGEASPRSTITFDVGEKVKVNDGPFEDFDGMVEEVDEDNQRLKVTVSIFGRA
FT                   TPVELEYTQVSKQM"
FT   gene            complement(548053..548508)
FT                   /locus_tag="Jann_0561"
FT   CDS_pept        complement(548053..548508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53478"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY4"
FT                   /protein_id="ABD53478.1"
FT                   /translation="MTTDHDITGDTLTLRRTYASAKEDVFNAWIDASKTTHWWGCKDTS
FT                   KVVSTIDARVGGTYHHLMSIDGVGDHLIDGTIQTFDPPNRLTYTMSGMPGQSPMRVDVR
FT                   FKEVDGGTEVTLTHAPLPEAFNQMVLAGWTASFERLARFFDGELRVA"
FT   gene            complement(548492..548839)
FT                   /locus_tag="Jann_0562"
FT   CDS_pept        complement(548492..548839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0562"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53479"
FT                   /db_xref="GOA:Q28UY3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY3"
FT                   /protein_id="ABD53479.1"
FT                   /translation="MDSHDLDLVFSALADPIRRGILVKLSDGEQNVRQITAAFDVSQPA
FT                   ISRHLRTLGKAGLIRKDKRGREQFIRVNADPAEEAAAWVGHYTRFWKHHFDQVEDILAQ
FT                   TRKDTEDDNGP"
FT   gene            549119..549571
FT                   /locus_tag="Jann_0563"
FT   CDS_pept        549119..549571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0563"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53480"
FT                   /db_xref="GOA:Q28UY2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UY2"
FT                   /protein_id="ABD53480.1"
FT                   /translation="MAKKLVGSMKLQIPAGQANPSPPVGPALGQRGINIMEFCKAFNAK
FT                   TQEMEQGAPCPTVITYYQDKSFTMDIKTPPASYYLKKAAGLKPVGKRNRPRGAETPGRE
FT                   TVASITSKQLREIAEAKMVDLSANDVEAAMKIILGSAKSMGIEVKG"
FT   gene            549578..550276
FT                   /locus_tag="Jann_0564"
FT   CDS_pept        549578..550276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0564"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53481"
FT                   /db_xref="GOA:Q28UY1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UY1"
FT                   /protein_id="ABD53481.1"
FT                   /translation="MGKMGKRFAAAKAAVEGKENITVEEAVALLKGNSKTKFDETIEIA
FT                   MKLGVDPRHADQMVRGTVNLPNGTGKTVRVAVFARGPKAEEATAAGADIVGAEDLMETV
FT                   QGGTIEFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKIGTVTMDVKEAVEAAKGGQVQF
FT                   KAEKAGVVHAGVGKASFTEAQLVENVRAFVDAVSKAKPSGSKGTYMQKINLTSTMGPGV
FT                   SLSVENATGN"
FT   gene            550303..550629
FT                   /locus_tag="Jann_0565"
FT   CDS_pept        550303..550629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53482"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UY0"
FT                   /protein_id="ABD53482.1"
FT                   /translation="MGHCNGCPIFLPMPWPNEWSFCDMPQSSPLFIGLIVALAGCVPAS
FT                   NIDLVNRCILSQGIEPARAVGGFYSPSGTSIEDAIVFNEQIFDLTPSQRATARACAESR
FT                   RGVN"
FT   gene            550933..551445
FT                   /locus_tag="Jann_0566"
FT   CDS_pept        550933..551445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0566"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53483"
FT                   /db_xref="GOA:Q28UX9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UX9"
FT                   /protein_id="ABD53483.1"
FT                   /translation="MDRAQKEKVVEELGQIFESSGVVVVAHYQGLTVANMQDLRGRVRD
FT                   AGGAVRVAKNKLAKIALDGTDVAGISDLMTGMTVLAYSDDPVAAAKAADEFAKENDNYV
FT                   ILGGAMGENILDADGVKAVAKMPSREELISSIAGCIGAPAANIAGAIGAPASNIASVLS
FT                   TIEEKAA"
FT   gene            551508..551882
FT                   /locus_tag="Jann_0567"
FT   CDS_pept        551508..551882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0567"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53484"
FT                   /db_xref="GOA:Q28UX8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UX8"
FT                   /protein_id="ABD53484.1"
FT                   /translation="MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGP
FT                   ADGAGGAAEEQTEFDVVLKNAGASKINVIKEVRGITGLGLKEAKDLVEAGGKIKEGVDK
FT                   AEAEEIKGKLEAAGAEVELA"
FT   gene            552210..556298
FT                   /locus_tag="Jann_0568"
FT   CDS_pept        552210..556298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0568"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53485"
FT                   /db_xref="GOA:Q28UX7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UX7"
FT                   /protein_id="ABD53485.1"
FT                   /translation="MPNLIEVQKSSYDLFLKSGDQLEPMDGEGIKGVFQSVFPIKDFNE
FT                   TAILEFVKYELETPKFDVEECQQRDLTYAAPLKVTLRLIVFDIDEDTGAKSVKDIKEQD
FT                   VFMGDMPLMTPNGTFVVNGTERVIVSQMHRSPGVFFDHDKGKTHSSGKLLFACRIIPYR
FT                   GSWLDFEFDAKDIVFSRIDRRRKLPVTTLLYALGLDQEGIMDAYYDTVTFKMVKNKGWS
FT                   TKFFPERVRGTRPTTDLVDAKTGEVIAEAGKKVTPRAVKKWIDEGSIENLLVPFDGIVG
FT                   RFAAKDIINEETGAIYVEAGDELTWELDKAGEVSGGTLKELIDAGITEIPVLDIDNVNV
FT                   GPYMRNTLAVDKNLNRESALMDIYRVMRPGEPPTVEAASNLFDQLFFDSERYDLSAVGR
FT                   VKMNMRLDLDAEDTMRTLRKEDIISCIKALVELRDGRGDIDDIDHLGNRRVRSVGELME
FT                   NQYRVGLLRMERAIKERMSSVEIDTVMPQDLINAKPAAAAVREFFGSSQLSQFMDQTNP
FT                   LSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRMCPIETPEGPNIGLINSLATYA
FT                   RVNKYGFIETPYRRVNDAVVSDDVVYMSATEEMRHTVAQANANLDDDGKFVNDMVNTRM
FT                   SGEYTLNPREAIDLIDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLQADA
FT                   PFVGTGIESVVAKDSGAAIMAKRGGVIDQVDAQRIVIRATEDLELGDAGVDIYRLRKFQ
FT                   RSNQNTCINQRPLVKVGDKIGKGEVIADGPSTDIGELALGKNVIVAFMPWNGYNYEDSI
FT                   LISERISRDDVFTSIHIEEFEVAARDTKLGPEEITRDIPNVGEEALRNLDEAGIVYIGA
FT                   EVEPGDILVGKITPKGESPMTPEEKLLRAIFGEKASDVRDTSLRVKPGDYGTIVEVRVF
FT                   NRHGVEKDERALQIEREEVERLARDRDDELVILERNIYARLRGMIMGKTAVKGPKGVKP
FT                   NTVIDEDLLDGQLSRGQWWQLALEDEKDAAHIEALNQQFDTQKRALDHRFEDKVEKVRR
FT                   GDDLPPGVMKMVKVFIAVKRKLQPGDKMAGRHGNKGVISKVVPMEDMPFLADGTPVDFV
FT                   LNPLGVPSRMNVGQILETHMGWAARGMGLQIDEALDEYRRSGDMTPVRDALKIAYGDDV
FT                   YDDAFADRDEESLLEAAGNVTKGVPIATPVFDGAKEADVNDALIRAGFSTSGQSKLFDG
FT                   RTGEQFAREVTVGVKYLLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEME
FT                   VWALEAYGAAYTLQEMLTVKSDDVAGRTKVYESIVKGEDNFEAGVPESFNVLVKEVRGL
FT                   GLNMELLDAEDDEGGIAAE"
FT   gene            556597..560811
FT                   /locus_tag="Jann_0569"
FT   CDS_pept        556597..560811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0569"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53486"
FT                   /db_xref="GOA:Q28UX6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UX6"
FT                   /protein_id="ABD53486.1"
FT                   /translation="MNQELTNNPFNPLTPPKAFDEIKVSLASPERILSWSYGEIKKPET
FT                   INYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYRGVVCEKCGVEVTLQKVRRERM
FT                   GHIELAAPVAHIWFLKSLPSRIGLMLDMTLRDLERILYFENYVVIEPGLTDLTYGQLMG
FT                   EEEFMDAQDAYGADAFQANIGAEAIREMLSQIDLESEANQLREDLKEATGELKPKKIIK
FT                   RLKIVESFLESGNRPEWMVMTVVPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKRLIELRAPDIIIRNEKRMLQESVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGR
FT                   FRQNLLGKRVDFSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYSRLEAKGLSSTVKQ
FT                   AKKLVEKERPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCS
FT                   AFNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNVLSPANGAPIIVPSQDMILGLYYVT
FT                   LAREGMKGEGMIFADVDEVRHALDAGEIHLHSKITARLPQIDEEGNEIMVRFDTTPGRV
FT                   MLGALLPLNAKAPFDLVNRLLRKKEVQQVIDTVYRYCGQKESVIFCDQIMSMGFKEAFK
FT                   AGISFGKDDMVIPDTKWTLVEDARDQVEEFEQQYMDGLITQGEKYNKVIDAWSKVNDKV
FT                   TDAMMGTISASKRDENDAEMEPNSVYMMAHSGARGSVTQMKQLGGMRGLMAKPNGEIIE
FT                   TPIISNFKEGLTVLEYFNSTHGARKGLSDTALKTANSGYLTRRLVDVAQDCIVRMDDCG
FT                   TENTIKAEAAVNDGEVVASLAERILGRTAGEDVFIPGTDEIIVAKGELIDERKADAVEA
FT                   AGVTTMQMRSPLTCEAEEGVCATCYGRDLARGTKVNTGEAVGIIAAQSIGEPGTQLTMR
FT                   TFHIGGVAQGGQQSFQEVNVDGKVEFRNANLLKNANGESVVMGRNMVLAIMDDQGSERA
FT                   SFKLGYGTNVLVEDGKKVVRGDRLFEWDPYTLPIIAEAAGTAKFVDLVSGISIRDETDD
FT                   ATGMTQKIVSDWRTAPKGNELKPEIIIAGEDGEPMRNDQGNPVTYTMSVDAILSIEEGQ
FT                   TVKAGDVIARIPREGAKTKDITGGLPRVAELFEARRPKDHAIIAEIDGYVKFGRDFKNK
FT                   RRIGIVPADESLEPVEYMVPKGKHIPVAEGDFVQVGDYIMDGNPAPHDILAVLGVEALA
FT                   DYMIDEVQDVYRLQGVKINDKHIEVIVRQMLQKWEIQDSGETTLLKGEHVDKAEFDSAN
FT                   AKAVRDGRRPAQGEPILLGITKASLQTRSFISAASFQETTRVLTEASVQGKKDRLVGLK
FT                   ENVIVGRLIPAGTGGATQDVERIAKGRDQVVIDAAQAEAEAAAALAAPVMEDAAPDTDA
FT                   AE"
FT   gene            560929..561285
FT                   /locus_tag="Jann_0570"
FT   CDS_pept        560929..561285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0570"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53487"
FT                   /db_xref="GOA:Q28UX5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UX5"
FT                   /protein_id="ABD53487.1"
FT                   /translation="MASDPSAPIDYIEFTSPDVEATQAFFTEAFGWSYIDYGPDYKDIQ
FT                   GAGLGGGIERGPLRAPLPVLKADDLEAMLDKVKAAGAEITQEIFEFPGGRRFQFKEPGG
FT                   TEMAVWTTADDDHG"
FT   gene            561269..561589
FT                   /locus_tag="Jann_0571"
FT   CDS_pept        561269..561589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53488"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UX4"
FT                   /protein_id="ABD53488.1"
FT                   /translation="MTTMDDLSRIADEVKALAKEIEPGLAFEPKYGGEVMVPDPEAPKA
FT                   FVGGVFVYKDHVSVEFSQGAELEDPKGHLEGKGKARRHLKLHATDDIEGKDLASFLRQV
FT                   LR"
FT   gene            561658..562560
FT                   /locus_tag="Jann_0572"
FT   CDS_pept        561658..562560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53489"
FT                   /db_xref="InterPro:IPR021466"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UX3"
FT                   /protein_id="ABD53489.1"
FT                   /translation="MSVVNKIIGVCRFSYLGLGGFRINEAGAEEAAKALYAADRMTLRF
FT                   AYFETICLPSLAAQTDSDFTFVALIADTMPLPFRQRLKRLTETYPFLRIAVLESTGPYN
FT                   STRRAFSRGLDGQETDFITGFRLDDDDAVSVDYIARTREAADTLITLGWATKDDPAAVC
FT                   FHRGIYWDMKRPDAPFWDYSEIQPLGLASAMVHHRDSRQNIYRWNHRKLASKVRCWTDP
FT                   SDVMFLRTLHDHNDSGRVMPRDAEQIPDEQARRLLKDRFGLNPKRLLSTMDRVHGGTDA
FT                   ARQWAAETREDPFGKDGDA"
FT   gene            562557..563423
FT                   /locus_tag="Jann_0573"
FT   CDS_pept        562557..563423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0573"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53490"
FT                   /db_xref="GOA:Q28UX2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UX2"
FT                   /protein_id="ABD53490.1"
FT                   /translation="MTPNLKGALFMTGSMASFVLNDVVIKVLSDDLPLFQIVFLRGILT
FT                   TALLTATVAAFGQLSFRVPRGDRGKVVLRTIFEIAAMVTFLTALINMQIANATAILSAL
FT                   PLAVTLGAALLFKEQVGWRRWSAICIGAFGVLLIVQPGADGFNVYSLLALITVVLVAGR
FT                   DLATRGFSTGLPTMTVAVITAAAICVFGGVMSLTDEWVRPALPHLLLLAAASVCIIGGY
FT                   VFSILVMRVGEVAVTAPFRYTSLVFALVLGWLVFAELPNTLALCGAAIVVATGVFTLIR
FT                   ERQVKHG"
FT   gene            563416..564243
FT                   /locus_tag="Jann_0574"
FT   CDS_pept        563416..564243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53491"
FT                   /db_xref="InterPro:IPR021466"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UX1"
FT                   /protein_id="ABD53491.1"
FT                   /translation="MAEGVQVQGLCRFSFPCTGGFKKYHESLEERRTALYAPKRLDERT
FT                   LWFEHIFLPPLHAQTDDDFSLHLLLGEDLPDPWRSRVETAIKDIPQITPHWRAPGDHRA
FT                   ICRDVMWGGRDGSRATVAEFRLDDDDAVAVDYVQQLRRAWGKLSRLTNTHGRVALDHGK
FT                   GMVLEAQPDRSITPHVLNTHCWSAGLAIYLRPDDEAIIMDFPHHKIWSRVPFVNLTDSV
FT                   MFIRGDHAHNDAKTPFGAGLPVPVPDDEIATLIQRRFAIDFPAFQADWRTRGG"
FT   gene            564499..564870
FT                   /locus_tag="Jann_0575"
FT   CDS_pept        564499..564870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0575"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53492"
FT                   /db_xref="GOA:Q28UX0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UX0"
FT                   /protein_id="ABD53492.1"
FT                   /translation="MPTIQQLIRKPRQPKIKRSKSQHMEGCPQKRGVCTRVYTTTPKKP
FT                   NSAMRKVAKVRLTNGYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
FT                   QGVKDRRQRRSKYGAKRPK"
FT   gene            564886..565356
FT                   /locus_tag="Jann_0576"
FT   CDS_pept        564886..565356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0576"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53493"
FT                   /db_xref="GOA:Q28UW9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW9"
FT                   /protein_id="ABD53493.1"
FT                   /translation="MSRRHAAEKRQVLPDAKFGDMVLTKFMNNLMIDGKKAVAERIVYN
FT                   AFDRVEGKLKRAPVEVFHEALENIKPAVEVRSRRVGGATYQVPVDVRPERREALAIRWL
FT                   INASRARNENTMEERLAGELVDAVNMRGSAVKKREDTHKMADANRAFSHYRW"
FT   gene            565452..567572
FT                   /locus_tag="Jann_0577"
FT   CDS_pept        565452..567572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0577"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53494"
FT                   /db_xref="GOA:Q28UW8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW8"
FT                   /protein_id="ABD53494.1"
FT                   /translation="MARDYPLERYRNFGIMAHIDAGKTTCSERILYYTGKSHNIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWERTENGTEPDSEKHRLNIIDTPGHVDFTIEVE
FT                   RSLAVLDGAVCVLDANAGVEPQTETVWRQADRYKVPRMVFVNKMDKIGADFFNCVRMIE
FT                   DRTGARAVPVGIPIGAETELEGLIDLVTMEEWLWQGEDLGASWIKAPIRDSLNDMALEW
FT                   RAKMIEAAVEMDDDAMENYLMDGAEPDVPTLRALLRKGTLAMAFVPVLGGSAFKNKGVQ
FT                   PLLNAVIDYLPSPLDVVDYMGFKPGDETETRNIPRRADDDMAFSGLAFKIMNDPFVGSL
FT                   TFVRIYSGQLRKGDNMINSTKQNNERVGRMMMMHSNNREEIDEAFAGDIIALGGLKNTT
FT                   TGDTLCDKSDPVVLETMTFPEPVIEIAVEPKTKADQEKMAMALQRLSAEDPSFRVETDI
FT                   ESGQTIMRGMGELHLDILVDRMKREFKVEANIGAPQVAYRETIGHEVEHTYTHKKQSGG
FT                   SGQYAEVKLLITPTEPGEGYSFESKIVGGAVPKEYIPGVEKGIKSVMDSGPLAGFPVID
FT                   FKVQLLDGKFHDVDSSVLAFEIAGRMGMREGMRKAGAKLLEPIMKVEVITPEDYTGGII
FT                   GDLTSRRGQVQGQDTRGNAIAIDAFVPLANMFGYINTLRSMSSGRAQFTMQFDHYEPVP
FT                   QNISDEIQAKYA"
FT   gene            567648..568823
FT                   /locus_tag="Jann_0578"
FT   CDS_pept        567648..568823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0578"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53495"
FT                   /db_xref="GOA:Q28UW7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW7"
FT                   /protein_id="ABD53495.1"
FT                   /translation="MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKQFGDFQDYASI
FT                   DSAPEERARGITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDDEELLELVEMEIRELLSSYEYPGDDI
FT                   PVIPGSALAALEGRDDAIGKDSIDKLMAAVDEYIPTPARAVDQPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVINVGDEISIVGIRDTTKTTCTGVEMFRKLLDRGEAGDNIGALLRGVDR
FT                   EGVERGQVLCKPGSVDPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVN
FT                   LPAGTEMVMPGDNLKFEVELIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            complement(569330..569851)
FT                   /locus_tag="Jann_0579"
FT   CDS_pept        complement(569330..569851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0579"
FT                   /product="protein of unknown function DUF892"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53496"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UW6"
FT                   /protein_id="ABD53496.1"
FT                   /translation="MKPVEIIKMTISTLHDVYHDQLQDLYSACKQSLDVTNDLAKAAQN
FT                   EDLTKALVAGAQGISDGMEKIAQLCNDHDINPDGEHCKGMEGLVKEARAHGLDEAIDDA
FT                   DARDAMIITQYQRMTHYAIAGYGCLRAFANRLDLDGDGAVLTECLDAAYEGDRSMTEIA
FT                   TGQVNRAAAA"
FT   gene            570095..570601
FT                   /locus_tag="Jann_0580"
FT   CDS_pept        570095..570601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0580"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53497"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UW5"
FT                   /protein_id="ABD53497.1"
FT                   /translation="MVKNCFIIGGRHVRNLVIVLLMGWAPIAAAEDHADNPYERYTAEV
FT                   IRIIDGDTLEVRVELWPGLTASYSVRVRGIDAPERRGADCEEERAWGEEARQRAERLYD
FT                   PESLVRLQNVEYDVYSGRVVADVLRWRSDRWLSFADEMIERGMAVEWYPDQDNILWCDL
FT                   AQATI"
FT   gene            complement(570598..570840)
FT                   /locus_tag="Jann_0581"
FT   CDS_pept        complement(570598..570840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53498"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UW4"
FT                   /protein_id="ABD53498.1"
FT                   /translation="MGAHRKPSSRLYFGSNGKGRAHGAPRQTAARIGGVAGAGKGHLGP
FT                   RLTHAKTFTMFLACWICDLKIIVDVERLDASWLTD"
FT   gene            570883..571194
FT                   /locus_tag="Jann_0582"
FT   CDS_pept        570883..571194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0582"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53499"
FT                   /db_xref="GOA:Q28UW3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW3"
FT                   /protein_id="ABD53499.1"
FT                   /translation="MAVSQNIRIRLKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPN
FT                   KIEKFTVLRGPHVDKKSRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV"
FT   gene            571210..572082
FT                   /locus_tag="Jann_0583"
FT   CDS_pept        571210..572082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0583"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53500"
FT                   /db_xref="GOA:Q28UW2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW2"
FT                   /protein_id="ABD53500.1"
FT                   /translation="MLRSGVIAKKVGMTRLFMEDGKQIPVTVLQLDKLQVVAKKTSDSD
FT                   GYSAVQLGAGTAKAKRTSAPMRGVFAKASVEPKRKLVEFRVDADNLIEVGEEIIADHYF
FT                   EGQFVDVTGTSIGKGFQGAMKRHNFGGLRASHGVSISHRSHGSTGQCQDPGRVFKGKKM
FT                   AGHMGAARVTTQNLQIVRTDTDRGLIMIKGAVPGSKGGWVTVKDAVKKPFPENAILPAA
FT                   LASAAAEAAKQAEEAAAAAAAEAEAEAARLAEEQAAAEAESLAQAEAEIAAEGSDAAPE
FT                   GDADKKDGE"
FT   gene            572082..572702
FT                   /locus_tag="Jann_0584"
FT   CDS_pept        572082..572702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0584"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53501"
FT                   /db_xref="GOA:Q28UW1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW1"
FT                   /protein_id="ABD53501.1"
FT                   /translation="MKVDVIKLDGKKAGSVDLDEALFGLEPRADILHRVVRWQRNNAQA
FT                   GTHKVKTRREVSYSTKKIYRQKGTGGARHGARSAPIFRGGGVYKGPTPRSHGHELTKKF
FT                   RKLGLRHALSAKAAEGRLVVIESIAMDEAKTSALAKQVKEMGWKRALIIDGSDVDANFA
FT                   QAARNIEGLDVLPTMGANVYDILKRDTLVITKAGVEALEARLK"
FT   gene            572699..572995
FT                   /locus_tag="Jann_0585"
FT   CDS_pept        572699..572995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0585"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53502"
FT                   /db_xref="GOA:Q28UW0"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UW0"
FT                   /protein_id="ABD53502.1"
FT                   /translation="MSADAKHYDVIRKPLITEKTTMASENGAVVFEVAIDSNKPQIKEA
FT                   VEAVFGVKVKAVNTTITKGKVKRFRGQLGTRKDVKKAYVTLEEGNTIDVSTGL"
FT   gene            573124..573588
FT                   /locus_tag="Jann_0586"
FT   CDS_pept        573124..573588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53503"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UV9"
FT                   /protein_id="ABD53503.1"
FT                   /translation="MLDANTAQNPALLTVGYEGTDLRRFLACLEQSGVKTLVDVRERAQ
FT                   SRKKGFSKTALAEALAGIGIRYVHLRDLGDPKPGRDAARAGDYETFRKVFTSHMDTDAA
FT                   KSALSELDTLAKEDRTCILCFERCHTECHRAIVATYLKELSPYDVVHVEV"
FT   gene            573589..574344
FT                   /locus_tag="Jann_0587"
FT   CDS_pept        573589..574344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53504"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UV8"
FT                   /protein_id="ABD53504.1"
FT                   /translation="MSEATTVAIIVKAAPVVGRTHGETVCVAGLDYDGNWHRLYPIPFR
FT                   DLDSEQKFGRWDVVRFTWREPRDDNRPESKNVDSQSLQLIGKVPQRERHAFARSAIVPS
FT                   LDQVKDAGKSFALIRPERPKFIVKRHTKDELEEEGRKREALHAQSDLFSVPIAALEPAP
FT                   YTFSYRFYFDGSERNYRCIDWETEATFFRWRAEYGEEDAIAKMQHRFGTEYPMKGVAFA
FT                   MGTHRVPIFGTWLLSGILRVDEVAQGQLL"
FT   gene            574522..575364
FT                   /locus_tag="Jann_0588"
FT   CDS_pept        574522..575364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0588"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53505"
FT                   /db_xref="GOA:Q28UV7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UV7"
FT                   /protein_id="ABD53505.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKKGGRNN
FT                   TGRITARRRGGGAKRLYRIVDFKRTKFDVSATVERIEYDPNRTAFIALVRYEDGEQNYI
FT                   LAPQRLGVGDKVVASKKADIKPGNAMPFSGLPIGTIVHNIELKPGKGGQIARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRLVRQECMATVGAVSNPDNSNQNLGKAGRVRHMGKRPSVRG
FT                   VAMNPIDHPHGGGEGRTSGGRTPVTPWGKDTKGRRTRDKNKASQKLIIRSRHAKKKGR"
FT   gene            575368..575646
FT                   /locus_tag="Jann_0589"
FT   CDS_pept        575368..575646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0589"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53506"
FT                   /db_xref="GOA:Q28UV6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UV6"
FT                   /protein_id="ABD53506.1"
FT                   /translation="MSRSVWKGPFVDSYVLKKAEKSKESGRNEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGRKHIPVNVTEDMIGQKFGEYSPTRTYYGHAADKKAKRK"
FT   gene            575643..576023
FT                   /locus_tag="Jann_0590"
FT   CDS_pept        575643..576023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0590"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53507"
FT                   /db_xref="GOA:Q28UV5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UV5"
FT                   /protein_id="ABD53507.1"
FT                   /translation="MSKDKNPRRVADNEAMAKLRMLKTSPQKLNLVAGLIRGQKVEKAL
FT                   TDLTFSKKRIAVDVKKCLQSAIANAENNHGLDVDELIVAEAWVGKNLVMKRGRPRARGR
FT                   FGKILKPFSELTITVRQVEETS"
FT   gene            576023..576766
FT                   /locus_tag="Jann_0591"
FT   CDS_pept        576023..576766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0591"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53508"
FT                   /db_xref="GOA:Q28UV4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UV4"
FT                   /protein_id="ABD53508.1"
FT                   /translation="MGHKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDIKIRDYIKK
FT                   GWWEHVAKRDKRPAGDAGISKIIIERPHKKCRVTIHSARPGVIIGKKGADIEGLRKKLA
FT                   EITDSELHLNIVEIRKPELDARLVAESIAQQLERRVSFRRAMKRAVQNAMRMGSLGIRV
FT                   NVAGRLGGAEIARTEWYREGRVPLHTLRADIDYAHAEAETAYGIIGIKTWIFKGEIMEH
FT                   DPSAHDRRQQELQESGGASRPRRDR"
FT   gene            576780..577193
FT                   /locus_tag="Jann_0592"
FT   CDS_pept        576780..577193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0592"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53509"
FT                   /db_xref="GOA:Q28UV3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UV3"
FT                   /protein_id="ABD53509.1"
FT                   /translation="MLQPKRTKFRKMQKGRIRGEAKGGSDLTFGTYGLKALQPERVTAR
FT                   QIEAARRAMTRHMKRQGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDFWACKVKPGRVMF
FT                   EIDGVSEPIAREALRLAAMKLPVKTRTVVREDW"
FT   gene            577329..577964
FT                   /locus_tag="Jann_0593"
FT   CDS_pept        577329..577964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53510"
FT                   /db_xref="GOA:Q28UV2"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UV2"
FT                   /protein_id="ABD53510.1"
FT                   /translation="MDDMTGHDLDAERPYFLIVLGAFGIIGCIIGILGVIVAQAMVPGH
FT                   DWIADTISDLGAGENEIIMDVALYAFAAGIFAVALCAAHTHLGGVGWSGGVVILALLAA
FT                   AVVVIGARNEYGDGDNEGVVVHIYVVYALGVGFFAAPLLLANGFGRDPMMSRRWLIGLA
FT                   ILWAAASPVFFFLPTSVDGLYERGLGLIACAIISLLGWMFVVRGRRAL"
FT   gene            complement(577979..578413)
FT                   /locus_tag="Jann_0594"
FT   CDS_pept        complement(577979..578413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53511"
FT                   /db_xref="InterPro:IPR011463"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UV1"
FT                   /protein_id="ABD53511.1"
FT                   /translation="MMNTALDTAFHRLDTLDLSAIQSTGDWDLGRTFSHLAQGVEFSMT
FT                   GYPQEKPRLFQMTAGKLAFTVFKLRGRMSHGLDEPIPGEVIGEVSADDGLHRLWSSLEQ
FT                   FRDFNGALQPHFAFGALGKDQFAMAHLMHIENHLEEVRPT"
FT   gene            complement(578462..579136)
FT                   /locus_tag="Jann_0595"
FT   CDS_pept        complement(578462..579136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53512"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UV0"
FT                   /protein_id="ABD53512.1"
FT                   /translation="MARADVAPLISMAAAPLFAGVTGNTSEPVGTASGSLFSGNGVGYF
FT                   AALPPRAREEPLIDRPLRDRSPVAQLLSLIARVEAGVAGYDAVQHGARIRPSRPPTQMT
FT                   LGEIHAWIAATPGQPHAIGRYQFIPPTLRRVAQIRGFGPEVRFTPEVQDALALVLLEDA
FT                   GLSTFERDQMPRRQFMHNLARIWAGLPLPNGRSYYEGYAGNSAAMSWETFEQGVERIWP
FT                   RG"
FT   gene            579216..579917
FT                   /locus_tag="Jann_0596"
FT   CDS_pept        579216..579917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53513"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UU9"
FT                   /protein_id="ABD53513.1"
FT                   /translation="MCRSRTGIARIRFQTVATRAHPPYNPPMAQIKSLFVTRLYHARLS
FT                   ELGPDIDADELSATCFSVAEDDDAGQDWCEENGFPGYTSYASLTDLPWRMPIFAEVVKA
FT                   LDAHVAAFAEDLEFDLEGRKLVLEDIWINILPEGGTHSSHIHPHSVISGTTYVQIPPGA
FT                   RSIKLEDPRHAMMMAAPARKTDARDEMRAFVYPGPEAGDVLLWESWLRHEVPMNMDEDD
FT                   RVSVSFNYRWE"
FT   gene            579990..580646
FT                   /locus_tag="Jann_0597"
FT   CDS_pept        579990..580646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53514"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UU8"
FT                   /protein_id="ABD53514.1"
FT                   /translation="MAANPIDYLTDASKVESFQHFKEHMEQSMLFRNKNRNREYAIKRA
FT                   ISNRTATGLFVELGVAGGEGCRLFGEVLAPHGLELTGFDSFEGLEEDWTGMQSGRESGA
FT                   FTQAGQLPDVPGNVTLVKGWVQDTLPGYLKQTGKRPFAFVHMDMDTYTPTAFAMGAIKS
FT                   RLRKGTVILFDELYGYPGWRHHEYKALQETLGEGDYRYLSFSTEAVAIEILRKPK"
FT   gene            580665..581198
FT                   /locus_tag="Jann_0598"
FT   CDS_pept        580665..581198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53515"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UU7"
FT                   /protein_id="ABD53515.1"
FT                   /translation="MKRLLAAIAAIFAGPAAADPIAEVEGWLREHRPDYYEGLNPGVDE
FT                   AALDAFEARFDIVLPEAFRRLYLWRDGHGAYLAPSLIHNLMFPPLASVADTKAFLDDMI
FT                   GYDFPDSGFWERHWIPFLDNGGGDYLTIVTDGTAQGGAVIMFYHDDPYRRERATSFSQW
FT                   LSGLRAALEDSTDE"
FT   gene            581343..581552
FT                   /locus_tag="Jann_0599"
FT   CDS_pept        581343..581552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0599"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53516"
FT                   /db_xref="GOA:Q28UU6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UU6"
FT                   /protein_id="ABD53516.1"
FT                   /translation="MSAQELRDKTPDQLRDELTALKKEAFNLRFQQATGQIENTARMRQ
FT                   VRRDAARVKTILNEKAAAAANAEA"
FT   gene            581558..581788
FT                   /locus_tag="Jann_0600"
FT   CDS_pept        581558..581788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0600"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53517"
FT                   /db_xref="GOA:Q28UU5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UU5"
FT                   /protein_id="ABD53517.1"
FT                   /translation="MPKRILTGTVTSDANEQTVTVSVERRFKHPVMQKTIRKSKKYRAH
FT                   DPQNSFKTGDQVRIQECAPVSKSKRWEVIVG"
FT   gene            581866..582234
FT                   /locus_tag="Jann_0601"
FT   CDS_pept        581866..582234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0601"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53518"
FT                   /db_xref="GOA:Q28UU4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UU4"
FT                   /protein_id="ABD53518.1"
FT                   /translation="MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDVIVVSVKE
FT                   AIPRGRVKKGDVRKAVVVRTAKEVRREDGTAIRFDRNAAVILNNNNEPMGTRIFGPVVR
FT                   ELRAKNFMKIISLAPEVL"
FT   gene            582236..582541
FT                   /locus_tag="Jann_0602"
FT   CDS_pept        582236..582541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0602"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53519"
FT                   /db_xref="GOA:Q28UU3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UU3"
FT                   /protein_id="ABD53519.1"
FT                   /translation="MAAKLKKGDKVVVLTGKDKGKQGEISSVNPSAGKAIVDGVNIAIR
FT                   HTKQSQSNQGGRIPQPMPIQLSNLALLDANGKATRVGFKIEDGKKVRVAKTTGDVI"
FT   gene            582541..583101
FT                   /locus_tag="Jann_0603"
FT   CDS_pept        582541..583101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0603"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53520"
FT                   /db_xref="GOA:Q28UU2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UU2"
FT                   /protein_id="ABD53520.1"
FT                   /translation="MLDTANYTPRLKAAFSETIKAAMKEEFGYKNDMQIPRLEKIVLNI
FT                   GSGAESVRDTKKAKSAQEDLTAIAGQHAVVTKAKKSIAGFRLREEHPVGAKVTLRGDRM
FT                   YDFLDRLTTIAMPRIRDFRGVKPSFDGRGNFAMGMKEHIVFPEINFDKIDVAWGMDIII
FT                   VTTANTDAEAKSLLAHFNMPFNA"
FT   gene            583120..583425
FT                   /locus_tag="Jann_0604"
FT   CDS_pept        583120..583425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0604"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53521"
FT                   /db_xref="GOA:Q28UU1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UU1"
FT                   /protein_id="ABD53521.1"
FT                   /translation="MAKEAMIERQKKRERLVAKYADKRAALKEIARDEDLPMEDRFKAR
FT                   LKLAKLPRNSSATRLNNRCQLTGRPRAYYRKLKMSRIKLRDLASNGQIPGMVKSSW"
FT   gene            583440..583832
FT                   /locus_tag="Jann_0605"
FT   CDS_pept        583440..583832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0605"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53522"
FT                   /db_xref="GOA:Q28UU0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UU0"
FT                   /protein_id="ABD53522.1"
FT                   /translation="MNDPISDMLTRIRNSQMRGKSTVETPASKARARVLDVLADEGYIR
FT                   GYEAKTGKDGHPAFEISLKYYEGTPVIRELKRVSKPGRRVYMSVGDIPQVRQGLGVSIV
FT                   STSKGVMSDANARSQNVGGEVLCTIF"
FT   gene            583846..584379
FT                   /locus_tag="Jann_0606"
FT   CDS_pept        583846..584379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0606"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53523"
FT                   /db_xref="GOA:Q28UT9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UT9"
FT                   /protein_id="ABD53523.1"
FT                   /translation="MSRIGKRPVELPGGVEASVSGQTVEVKGPKGTRSFKATDDVTVSV
FT                   DGNVISVEPRGKSKRARQQWGMSRTMVQNLVTGVTDGFKKELEITGVGYRAQMQGNVLK
FT                   LSLGYSHDVDFTVPEGVTVTCPKNTEVIIEGNDQQLVGQVAANIREWRAPEPYKGKGIR
FT                   YKGEYIFRKEGKKK"
FT   gene            584391..584750
FT                   /locus_tag="Jann_0607"
FT   CDS_pept        584391..584750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0607"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53524"
FT                   /db_xref="GOA:Q28UT8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UT8"
FT                   /protein_id="ABD53524.1"
FT                   /translation="MALSKRELFQKRRLRNRNKMRKMANGRARLSVHRSNKNISVQLID
FT                   DLNGVTLASASSLEPSLGVVGKNNVEASAKIGEAIAERAKKAGVEECYFDRGGFLFHGR
FT                   VKALADAAREGGLKF"
FT   gene            584867..585460
FT                   /locus_tag="Jann_0608"
FT   CDS_pept        584867..585460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0608"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53525"
FT                   /db_xref="GOA:Q28UT7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UT7"
FT                   /protein_id="ABD53525.1"
FT                   /translation="MAERENRGRGRGRNREEETPEFADRLVAINRVSKTVKGGKRFGFA
FT                   ALVVVGDQRGRVGFGKGKAKEVPEAIRKATEQAKRQLIRVPLKEGRTLHHDVKGHHGAG
FT                   KVVMRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKSTGSQNPYNMIRATLDGLRNESSPR
FT                   QVASRRGKKVADILPKRDDHPQIDGEQAPVSEEA"
FT   gene            585464..585649
FT                   /locus_tag="Jann_0609"
FT   CDS_pept        585464..585649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0609"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53526"
FT                   /db_xref="GOA:Q28UT6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UT6"
FT                   /protein_id="ABD53526.1"
FT                   /translation="MATIVVKQIGSPIRRPEIQRKTLIGLGLNKMHRTRELEDTPSVRG
FT                   MINKIPHLVEIVEERG"
FT   gene            585736..586236
FT                   /locus_tag="Jann_0610"
FT   CDS_pept        585736..586236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53527"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UT5"
FT                   /protein_id="ABD53527.1"
FT                   /translation="MHYSSTLPIPRFAIWTSAVPIEFSTCLEHDLVYARWFGAVDFDQF
FT                   GANFVRYVGDAHYRPGRPELIDHSEITTFEGDPNLLRTMLRQVNAQSPALVVETHTVIY
FT                   SPQDTLFGLGRMYQILAELAEGIRVEVFQDEREALAALGLGHDSIADLLAQETFLPATP
FT                   RGG"
FT   gene            586533..587006
FT                   /locus_tag="Jann_0611"
FT   CDS_pept        586533..587006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0611"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53528"
FT                   /db_xref="GOA:Q28UT4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UT4"
FT                   /protein_id="ABD53528.1"
FT                   /translation="MKLHELSDNPGATKKRKRVGRGPGSGTGKMGGRGIKGQKSRSGVA
FT                   INAYEGGQMPLYQRLPKRGFNKPNRKKFAVVNLGLIQKFIDAGKLDGKADITEDALVAS
FT                   GLVRRKLDGVRVLAKGDVSGKLNITVTGASKAAIDAVSAAGGALTVSAPAAAE"
FT   gene            587144..588514
FT                   /locus_tag="Jann_0612"
FT   CDS_pept        587144..588514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0612"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53529"
FT                   /db_xref="GOA:Q28UT3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UT3"
FT                   /protein_id="ABD53529.1"
FT                   /translation="MSSAAEQMAANMSWSAFGKATELRQRIWFTLGLLIIYRIGTYIPV
FT                   PGIDAVELRAFFDSAAAGLGGVLNMFTGGALSRMGVFALGIMPYISASIIVQLMSAMVP
FT                   AMEALKKEGESGRKKLNQYTRYGTVALATAQAYGLAVSMESGGLASDPGWFFRAACVIT
FT                   LVGGTMFLMWLGEQITNRGIGNGISLIIFVGIIAEIPAALAQFFETGRSGALSTPAILG
FT                   VILMLIATLFFVVFMERSLRKIHIQYPRRQVGMKVYDGGSSHLPIKVNPAGVIPAIFAS
FT                   SLLLLPTTLTTFGGTEGSGPVLGWILANFGPGQPLYLVFFASMIVFFTYFYTLNVSFKT
FT                   EDVADNLKNQNGFIPGIRPGARTAEYLEYVVRRILVLGAGYLALVCMMPEIVRTNLSIT
FT                   AYFGGTSILIIVSVGMDTVQQIQSHLLAHQYEGLLEKSQLRGRKSGSKKPRKGPARR"
FT   gene            588511..589086
FT                   /locus_tag="Jann_0613"
FT   CDS_pept        588511..589086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0613"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53530"
FT                   /db_xref="GOA:Q28UT2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UT2"
FT                   /protein_id="ABD53530.1"
FT                   /translation="MNIILLGPPGAGKGTQAGILVKDRGMVQLSTGDMLRAARTSGTEM
FT                   GNLVAGVMDRGELVTDEIVIGLIREQLEAGGSGFIFDGFPRTLAQADALADLLAEVGQT
FT                   LDHVIAMEVNDEALVGRIVNRAKEAAAAGQPVRADDNEESLKIRLMEYYKKTSPLLGYY
FT                   HAKEQLRWVPGLGAIDDVAKGIADVLDA"
FT   gene            589173..589736
FT                   /locus_tag="Jann_0614"
FT   CDS_pept        589173..589736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53531"
FT                   /db_xref="GOA:Q28UT1"
FT                   /db_xref="InterPro:IPR031876"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UT1"
FT                   /protein_id="ABD53531.1"
FT                   /translation="MTNTILLPLQVSSAAEGFPAAFRFLWIPLMAALVSALTAFWVSSR
FT                   TIRANQDIARKRATLDLIERSVSTEYYLLIYSTFREVLDSPSGFEQITDPQMPALVEQR
FT                   RKVIAFLNQYELIAIGIEQGILDEELYRDYMRGTVVRHWARAEGLVNHLRADTPDSRAP
FT                   KAFEKFEALALKWETAKEAERRTG"
FT   gene            589931..590299
FT                   /locus_tag="Jann_0615"
FT   CDS_pept        589931..590299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0615"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53532"
FT                   /db_xref="GOA:Q28UT0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UT0"
FT                   /protein_id="ABD53532.1"
FT                   /translation="MARIAGVNIPTAKRVPIALTYVTGIGHTSAAAICEAVGIDVTRRV
FT                   NELSDAEVLAIREHIDANYAVEGDLRRETQMNIKRLMDLGCYRGLRHRRNLPVRGQRTH
FT                   TNARTRKGPAKAIAGKKK"
FT   gene            590315..590704
FT                   /locus_tag="Jann_0616"
FT   CDS_pept        590315..590704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0616"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53533"
FT                   /db_xref="GOA:Q28US9"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28US9"
FT                   /protein_id="ABD53533.1"
FT                   /translation="MARDRRPAKKKVSKNIAAGVAHVNSSFNNTKILISDVQGNAIAWS
FT                   SAGTMGFKGSRKSTPFAAQMAAEDAGKKAQDHGVRTLEVEVQGPGSGRESALRALAALG
FT                   FQISSIRDVTPMAHNGCRPPKRRRV"
FT   gene            590815..591831
FT                   /locus_tag="Jann_0617"
FT   CDS_pept        590815..591831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0617"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53534"
FT                   /db_xref="GOA:Q28US8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28US8"
FT                   /protein_id="ABD53534.1"
FT                   /translation="MIHKNWQELIKPTQLVVQPGTDPARKATVVAEPLERGFGLTLGNA
FT                   LRRVLMSSLQGAAITSVQIDGVLHEFSSVAGVREDVTDIVLNLKGVAIRMDAEGPKRVS
FT                   ISAKGPRVVTAGDISESAGIDVLNKDHVICHLDDGADLYIELTVNTGKGYVAADKNRPE
FT                   DAPIGLMPIDAIYSPVKKVSYDVQPTREGQVLDYDKLTLKLETDGSLSPDDAVAYAARI
FT                   IQDQLSIFVNFDEPESATRQDDEDDLEFNPLLLKKVDELELSVRSANCLKNDNIVYIGD
FT                   LIQKTEAEMLRTPNFGRKSLNEIKEVLSGMGLHLGMDIVDWPPDNIEELAKKYEDNF"
FT   gene            592005..592421
FT                   /locus_tag="Jann_0618"
FT   CDS_pept        592005..592421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0618"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53535"
FT                   /db_xref="GOA:Q28US7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28US7"
FT                   /protein_id="ABD53535.1"
FT                   /translation="MRHARGYRRLNRTHEHRKAMFSNMCGSLIEHEQIKTTVPKAKELR
FT                   PIIEKMITLAKRGDLHARRQAASQLKQDKDVAKLFEVLGPRYAERQGGYVRIMKAGFRY
FT                   GDMAPMAIIEFVDRDVDAKGAADRARVEAEADAE"
FT   gene            592762..593373
FT                   /locus_tag="Jann_0619"
FT   CDS_pept        592762..593373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0619"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53536"
FT                   /db_xref="GOA:Q28US6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q28US6"
FT                   /protein_id="ABD53536.1"
FT                   /translation="MTKAPVLDLLLHELSLAAPAGFAVGLHIRYVSPLIMVNTYPDVWQ
FT                   EVYTSKLYGLRDPTLAWGLSHTGTRRWSQIGLPDPFGILQESADYGLRYGMIASIGPMS
FT                   SRTVAGASRADREFTDDEMELVYRIVHRMHDLSEPPARLSKAQADALKCIAEGDRHAAA
FT                   AAKLGISESAFKARLTSARQKLMARTTAEAVQRAKEYGLI"
FT   gene            593454..594041
FT                   /locus_tag="Jann_0620"
FT   CDS_pept        593454..594041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0620"
FT                   /product="N-acyl-L-homoserine lactone synthetase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53537"
FT                   /db_xref="GOA:Q28US5"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q28US5"
FT                   /protein_id="ABD53537.1"
FT                   /translation="MQMTTLSFENFHTHGPLFSNMLKARHRTFIEEMGWEIPSEGNMEF
FT                   DQYDTAQSRWVCVHDGTRVLAGVRLTPTTASCGIYSYMVRDAQRGLLDAIPANLLDDDA
FT                   PIASHIWDANRLFVAEGVETDIRREVQLSLMGHMVRSARELGATTLLGLLPIGIPRLGR
FT                   RLGIDMEPGGPIMKIGGVAHRCYFVTMASKMH"
FT   gene            594204..595514
FT                   /locus_tag="Jann_0621"
FT   CDS_pept        594204..595514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0621"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53538"
FT                   /db_xref="GOA:Q28US4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q28US4"
FT                   /protein_id="ABD53538.1"
FT                   /translation="MADLFDTSAAQAETARGPRPLADRLRPATLDAVIGQGHLLGSEGS
FT                   LRVMLDSGALSSLIFWGPPGVGKTTIARLLADETALNFVQISAIFTGMPDLRKVFEAAK
FT                   IRRTNGQGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAAVMSRSQ
FT                   VMVLERLSDDDLDALLQRAEAELDRKLPLLPDARVALREMADGDGRAMLNLVEQVAAWK
FT                   VAPLDTQALGQRLQRRAAQYDKSGDAHYNLISALHKSVRGSDPDAALYWFARMLEGGED
FT                   PRYLARRITRMAVEDIGLADPQAQRFCLEAWEIYERLGSPEGELALSQAVTYLALAPKS
FT                   NASYVAYKAARASAKSTGSAMPPKNILNAPTSMMKDQGYGKGYEYDHDSEDGFSGANYF
FT                   PDTMSRPKFYEPKERGFERDLRKRVEWFENLRKKRKG"
FT   gene            complement(595566..595892)
FT                   /locus_tag="Jann_0622"
FT   CDS_pept        complement(595566..595892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53539"
FT                   /db_xref="UniProtKB/TrEMBL:Q28US3"
FT                   /protein_id="ABD53539.1"
FT                   /translation="MTMSLTSKRNCTYVACGQSVKMNANPVKNPNLLSETVEELFVNFG
FT                   ARRVLFEVTARVFRKFHPPDRVRSTDLDEVSLSAHLRKDIGLPFECDEPRRVDPVTFHV
FT                   LNRP"
FT   gene            596455..596772
FT                   /locus_tag="Jann_0623"
FT   CDS_pept        596455..596772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0623"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53540"
FT                   /db_xref="GOA:Q28US2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28US2"
FT                   /protein_id="ABD53540.1"
FT                   /translation="MLRVFGHGTVGGAFPLPILTVNVLGSFLMGVFVVAAAHRGLTHLS
FT                   PLVMTGLLGGFTTFSAFSLETVTLYERGDVGQAALYVALSVGLSIAGLMAGLWLARGVF
FT                   A"
FT   gene            596769..597833
FT                   /locus_tag="Jann_0624"
FT   CDS_pept        596769..597833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0624"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53541"
FT                   /db_xref="GOA:Q28US1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q28US1"
FT                   /protein_id="ABD53541.1"
FT                   /translation="MSGVQTLEIGPDDGDQRLDRWFRRIFPHVPQGRIEKMCRKGEIRV
FT                   DGGRVKSNTRLEVGQMVRVPPLPDAADPKADPANWVNNASRISDADEKMIRAAVIYRDD
FT                   HIIAINKPAGLPTQGGTGQSRHVDGLAEALKFGLEDKPRLVHRLDKDTSGVLLMARTRM
FT                   GAKALTDAFRLRSTRKIYWAAVAGSPLPRMGTIKLGLVKAPGHGRGGENEKMRAVPVDE
FT                   IAQVDGAKRAETDYAVMSNLGGRVCWCALVPITGRTHQLRAHMAEIGHPIIGDGKYGGS
FT                   GQENLGDGWGAQLGGEISRKLHLHARSLSFRHPMTGAQVNLVAPLPEHMAKTWDTLGWD
FT                   PRDVPADPFEDDAF"
FT   gene            597830..598495
FT                   /locus_tag="Jann_0625"
FT   CDS_pept        597830..598495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0625"
FT                   /product="HAD-superfamily hydrolase subfamily IA variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53542"
FT                   /db_xref="GOA:Q28US0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q28US0"
FT                   /protein_id="ABD53542.1"
FT                   /translation="MTLKLVIFDVDGTLVDSIAQIETVVNRAFAARGYAPPPPGAVRGL
FT                   VGISLPELMAALKPDLDAPAIGALVEAYKRTFVQSATREASPLFPGTLEMLSRLAGRDD
FT                   LLLGIATGKSRRGLDRILRENGLERHFVTRQVADDHPSKPHPSMVLSALAETGIEAEGA
FT                   VLIGDTTFDLQMAQAAGVRGIGVAWGNHAAEDLQPLANHMLGDWTALDPCLDTLWEAR"
FT   gene            598492..599205
FT                   /locus_tag="Jann_0626"
FT   CDS_pept        598492..599205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0626"
FT                   /product="ATP12 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53543"
FT                   /db_xref="GOA:Q28UR9"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR9"
FT                   /protein_id="ABD53543.1"
FT                   /translation="MTEWKAKRFWTEATVAEADGGFKVLLDGRGVNTPGKLPLVMPTRA
FT                   MALAVAAEWNAQEGEIAPLTMPHTRSANSAIERVTPQLADVSDMLLGYAETDLLCYRAE
FT                   GPDALTQRQAAEWDPMLDWGAEALDARLEPRTGVMWVSQEPTAIKALDTDLRQIGPFPM
FT                   TALHDLVTLTGSLILGLAVARGRISAKEAWRLSRIDETWQMEQWGADEEAEDAAAIKEA
FT                   QLRHAEAFWDLCFDK"
FT   gene            599442..600458
FT                   /locus_tag="Jann_0627"
FT   CDS_pept        599442..600458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0627"
FT                   /product="L-glutamine-binding protein / L-glutamate-binding
FT                   protein / L-asparagine-binding protein /
FT                   L-aspartate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53544"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR8"
FT                   /protein_id="ABD53544.1"
FT                   /translation="MKKSVFLGTLAVAGLSAGFVSAQTLGEVQERGTLNCGVSTGLTGF
FT                   SAPDANGEWQGFDVSVCRAVAAAVLGDAGAVEFVPTTGQTRFTALSSGEIDMLARNTTW
FT                   TFSRDVDLAFEFVGVNYYDGQGFMVPRELGVSSALELDGATVCIQTGTTTELNLADYFS
FT                   SNNMSYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRATFEDPSAHVVLPEIVSKE
FT                   PLGPLVRHGDNEFGDVVRWTLNALIAAEELGVTSANVGEIGGTTENPEIRRLLGTEGNL
FT                   GEMLGLDAGWAAAAIGAGGNYGEIFDRHIGESTPIGLARGLNAQWTDGGLLYAPPFR"
FT   gene            600603..601892
FT                   /locus_tag="Jann_0628"
FT   CDS_pept        600603..601892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0628"
FT                   /product="L-aspartate ABC transporter membrane protein /
FT                   L-asparagine ABC transporter membrane protein / L-glutamine
FT                   ABC transporter membrane protein / L-glutamate ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53545"
FT                   /db_xref="GOA:Q28UR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR7"
FT                   /protein_id="ABD53545.1"
FT                   /translation="MATMTDPPREAFRLSQLIYDTRYRSMTIQVVAFILIMLGLWYLGR
FT                   NAIQNLSDLGKDFDFGFLGNRAGYDINQRLIEYSNDSTHGRAAIVGILNTLLVAFLGCI
FT                   TATILGVAAGVLRLSNNWIVGRLMTVYVEGFRNIPLLLWIIVIFAIMTEAMPQPRDFRG
FT                   DNPEASMSLGGSVAVTNRGVYIPNVVFTRSLGGNEMSDAADGVPAAIIPAASFGDWALF
FT                   LAVLIAGVLGSGAIARWAKAKQEATGVRPPGLFWMRAAAIVVPAAIVLIALGATLDYPE
FT                   LRGFNFSGGIHLRNALIALWFALSLYTGAFIAEIVRAGILSVSKGQTEASSALGMRASW
FT                   TMNLVVLPQALRVIIPPLISQFLNLTKNSSLALAVGYMDVRSTLGGITINQTGRELEGM
FT                   LLLGAFYLITSLLISAVMNVYNNSVKLQER"
FT   gene            601894..603231
FT                   /locus_tag="Jann_0629"
FT   CDS_pept        601894..603231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0629"
FT                   /product="L-aspartate ABC transporter membrane protein /
FT                   L-glutamate ABC transporter membrane protein / L-glutamine
FT                   ABC transporter membrane protein / L-asparagine ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53546"
FT                   /db_xref="GOA:Q28UR6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR6"
FT                   /protein_id="ABD53546.1"
FT                   /translation="MSEMHSETSVHTAYVRTEMLPEQTPPVAVAGPVKWVRENLFSSVP
FT                   NALMTLVSIYVVYVVLAGILPWMINGIWDADSLSECREIRDARFGPSDGHGGGVACWAV
FT                   LVDRWDQLMFGFYPPELYWRAILAFALFLGAIAPVLYDTLPRKLLLLTAAMPFLCAWLL
FT                   WGGSIWTPLLVAAGFGLGYAVIKFGSVALGAMTSTILAIVVPLLYWLFLLGPLVSVMDS
FT                   ILPIGIQAVQSREFGGFLLAFVIGASGIILSMPLGVMLALGRQSDLFIINKFSVIFIEV
FT                   IRGVPLIVWLFTAQLLLGYFLPPGTNFDLMVRVIIMVTLFSAAYIAEVIRGGLAALPRG
FT                   QYEGADSLGLNYWQSMQLIVLPQALKISIPGIVSSFIGLFKDTTLVVFIGLFDPIGFSN
FT                   AIRADTDWNGIYWELFIFIGLCFFICCFGMSRYSQWLERKLATDHR"
FT   gene            603243..604034
FT                   /locus_tag="Jann_0630"
FT   CDS_pept        603243..604034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0630"
FT                   /product="L-glutamine ABC transporter ATP-binding protein /
FT                   L-glutamate ABC transporter ATP-binding protein /
FT                   L-aspartate ABC transporter ATP-binding protein /
FT                   L-asparagine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53547"
FT                   /db_xref="GOA:Q28UR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR5"
FT                   /protein_id="ABD53547.1"
FT                   /translation="MANTAEDRAIDRSQMKVSDEVAIEIDGMNKWYGTFHVLRDINLTV
FT                   NQGERIVICGPSGSGKSTLIRCINALEEHQQGSIVVDGTLLSNDLKNIDKIRSEVGMCF
FT                   QHFNLFPHLTILENCTLAPIWVRKTPKKEAEETAMHFLEKVKIPEQADKYPGQLSGGQQ
FT                   QRVAIARSLCMRPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFARQ
FT                   VANRVIFMDAGQIVEQNEPEEFFTNPKSERTQLFLSQILGH"
FT   gene            complement(604332..604838)
FT                   /locus_tag="Jann_0631"
FT   CDS_pept        complement(604332..604838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0631"
FT                   /product="putative phosphohistidine phosphatase SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53548"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR4"
FT                   /protein_id="ABD53548.1"
FT                   /translation="MSRTLILIRHCKSDWTTDAPTDHDRVLNPRGRRDAPRIGAWLAAR
FT                   DLIPDTVLCSDAQRTQETWERIATRLPSQPPVSLSHALYLAEPAAMLHAIRKAAGKTVA
FT                   LVGHCPGILTLAWDLAAMPVADPDFGAYPTGAVTVFDFDDATWGAVEQGEIRAFVTPRS
FT                   LPDPA"
FT   gene            complement(604835..605482)
FT                   /locus_tag="Jann_0632"
FT   CDS_pept        complement(604835..605482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53549"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR3"
FT                   /protein_id="ABD53549.1"
FT                   /translation="MDYETIDATAARRHLGIVGAFHPGPEDNAPDGTGTLVLLAPRTND
FT                   FWTFFQSEPEAQDGAADPLDRWSTRTVGAIARVLKADALFPFGGPPWHPFISWARQSGS
FT                   IHASPVSLLVHNDQGLMISFRGALALKETIPLTPPRLTPCLLCAAPCETACPVDALSEE
FT                   GYDTGACHAFLDTPAGADCLENGCKARRACPVSQSFDRDPAQSAYHMGQFHK"
FT   gene            complement(605486..606343)
FT                   /locus_tag="Jann_0633"
FT   CDS_pept        complement(605486..606343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0633"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53550"
FT                   /db_xref="GOA:Q28UR2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UR2"
FT                   /protein_id="ABD53550.1"
FT                   /translation="MKTQMTRDNLATARTLSEALPYLQRFNDAVVVVKFGGNAMGDDAE
FT                   MASFARDMVLLRQVGVNPVVVHGGGPMINDMLAKLGIESTFLNGKRVTDAATVDVVEMV
FT                   LSGRVNKRIVQAINAQGGKAVGLSGKDANLITCVPADPELGFVGDPSQVDPSVINTLFE
FT                   DDIIPVIAPLGQGAEGETYNINGDTAAGAIASALQADRLLLLTNVSGVKNAAGDVVTEL
FT                   TAADVDAMVADGTIAGGMIPKTETALQAVRTGVRACIIVDGRVPNAVLLELFTEHGAGS
FT                   MIRA"
FT   gene            complement(606486..607142)
FT                   /locus_tag="Jann_0634"
FT   CDS_pept        complement(606486..607142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0634"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53551"
FT                   /db_xref="GOA:Q28UR1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UR1"
FT                   /protein_id="ABD53551.1"
FT                   /translation="MTTLPFPLAEAPDALTEERGRKLFAGNTDFLKGVVAMDGLPPADR
FT                   IEVCFAGRSNVGKSTLINALTGRKGLARASNTPGRTQEINYFTLLDSHYLVDLPGYGYA
FT                   EAPLHVVQQWQALLKSYLQGRATLRRAFVLIDARHGVKAVDEEIMKLLDIAAVPFQTVL
FT                   TKSDKVKGRDRDASLARTRKALANHPAAYPEIILTSSEKGDGIPTLRATIATIET"
FT   gene            complement(607139..607783)
FT                   /locus_tag="Jann_0635"
FT   CDS_pept        complement(607139..607783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0635"
FT                   /product="transferase hexapeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53552"
FT                   /db_xref="GOA:Q28UR0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UR0"
FT                   /protein_id="ABD53552.1"
FT                   /translation="MTGPDPATLAPMLPTYAGTVFLKPLAEGLGNVTVGDYTYYDDRDE
FT                   TRDFFTRNVLHHYDFIGDHLHIGPFCAIAHGVRIFMNGGTHAMDGFSTFPFNIFGHGWE
FT                   DGFDPATWKAVHKGDTRIGPDVWIGNSATIMPGVTIGAGAIIAANATVTKDVAPYTIAA
FT                   GNPAQTVKHRFDADTVARLLEIAWWDWPADKITRNLNAIRGADLPALEAAT"
FT   gene            complement(607780..608517)
FT                   /locus_tag="Jann_0636"
FT   CDS_pept        complement(607780..608517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0636"
FT                   /product="MOSC"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53553"
FT                   /db_xref="GOA:Q28UQ9"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ9"
FT                   /protein_id="ABD53553.1"
FT                   /translation="MTWALDQIWRYPIKGIGAERLRAIDLAPGLPLPLDRAWAVLEEGG
FT                   DASDGWRSCRNFLRGAKGPSLMAVTCRVDGDVIHLSHPDQTDISVTPGGDMDAFFDWLA
FT                   PIYPENRPKAAALVASPPEGMSDAPFASISILNPSSLRALGQKLDQPLDERRFRGNLWV
FT                   DGLAPWEEFDLVGKTLVIGDAHLDVVERITRCRATEANPATGKRDANTLRALEDGWGHQ
FT                   DFGVYAMVRQGGQIKAGDTVAVA"
FT   gene            complement(608514..610394)
FT                   /locus_tag="Jann_0637"
FT   CDS_pept        complement(608514..610394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0637"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53554"
FT                   /db_xref="GOA:Q28UQ8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UQ8"
FT                   /protein_id="ABD53554.1"
FT                   /translation="MDDQNRNLILATGLSFVVILVWFLLFPPPEMVEDPNAIPPAAETG
FT                   GVETDTGIALTPPVTVADAPAGADTTAPSEVALSEAARIDIDTPAVEGSISLLGGRIDD
FT                   LSLRNYFTEVDGDQIVRLLSPVGSDDPYYALYGWTPSGDLGYADVPTSDTPWELESGTI
FT                   LTPDSPITLAWDNGSGLIFRRTIEIDDRFMFQVTQSVENTGGAEVNLAPYGIVARHGLP
FT                   SDLQNFFILHEGVVRKVDGELSELGYSDLPDLDIIAREGVPAEVMEVETNGWIGFTDKY
FT                   WMTTLIPGENQSFVSVVKYVPSAEIYQTEARLPYMSIAPGETAEVTTQLFAGAKEAEAI
FT                   RDYENAEPGLIASLFGAEQDASRGEIPRFIDSIDWGWFYFLTKPLFWLLHWLNGAIGNM
FT                   GLAIISLTLIVKAVLFPLAYRSYVSMAKMKELQPEIEKLKESAGDDRQKLQQGMMELYK
FT                   KNKVNPAGGCLPILLQIPIFFSLYKVIFVTLELRHAPFFGWLNDLSAPDSSSIINLYGL
FT                   LPNPAPEPESIMALIFIGILPLLLGISMWLQQKLNPAPTDAMQAQIFAWLPWVFMFMLG
FT                   SFASGLLVYWIANNTLTFTQQYLIMRSQGFKPDVFGNIRSSFKKKAKEEK"
FT   gene            complement(610827..612371)
FT                   /locus_tag="Jann_0638"
FT   CDS_pept        complement(610827..612371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0638"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53555"
FT                   /db_xref="GOA:Q28UQ7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ7"
FT                   /protein_id="ABD53555.1"
FT                   /translation="MARIRTDHEDRGRLGVLARRIRMALGRVEVLALFPLIAISATALG
FT                   FDDLALVTAIGLSALLAIGGVGARAAQPVATSDRPTANGRGALVAMLDRVADLPGRDTA
FT                   CILLQIDDWALLHDRWGHDTREDLAARVEDRLQTALRNGDLLTRLGDARFGIVLSPLPS
FT                   ARLGLRDTITTRLADAVADPLPMRGTALRLTASIGHSAMIKQGVDPADTTFKAAEAALG
FT                   EATANGPGTIRAYAPGMGRARALQSSLSEEVEAAIHDGAITAWFQPQIHARTGTLAGME
FT                   TLARWQHPNHGVLGPKEFFSAVEASGHMPLLGQTLLHQALKALQDWDAMSAHIPLITIN
FT                   FSATELRDQNLAATLASEVARYGLAPERVVVEISETVATQVEDDAIVATLQAMRHAGHR
FT                   LDLDGFGLGAASLPTLQRFAVSRVKIDRSFVLDIDLDHGKRQSVTAIVAMAKAMGIETI
FT                   ANGVETQTEQDALLALGCDYLQGFGVARPMGLDNVADWARAHGAAGKTIRLDDRRA"
FT   gene            612523..613050
FT                   /locus_tag="Jann_0639"
FT   CDS_pept        612523..613050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53556"
FT                   /db_xref="InterPro:IPR024409"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ6"
FT                   /protein_id="ABD53556.1"
FT                   /translation="MLKRLLILSALVALTACGRPSLNDPTLSGRELNLEEFFDGHLSAY
FT                   GQFQDVFGEVRRRFEVDIHGTWDGQTLRLVEDFRYDDGSTEQRIWTLQQTGNGGWQGTA
FT                   PGVIGVATGQEQGDTFNWHYTIDLPLPDREPLRVTFDDWMWMLSADRVLNRAYMSRFGV
FT                   PIGEVIITFERR"
FT   gene            complement(613063..613284)
FT                   /locus_tag="Jann_0640"
FT   CDS_pept        complement(613063..613284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0640"
FT                   /product="protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53557"
FT                   /db_xref="GOA:Q28UQ5"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UQ5"
FT                   /protein_id="ABD53557.1"
FT                   /translation="MNPAAFLISLPIRFYRLVISPMIASNCRYTPTCSSYAMEALRKHG
FT                   AIKGTWLAARRVSRCHPWGGSGIDNVPD"
FT   gene            complement(613281..613679)
FT                   /locus_tag="Jann_0641"
FT   CDS_pept        complement(613281..613679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0641"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53558"
FT                   /db_xref="GOA:Q28UQ4"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ4"
FT                   /protein_id="ABD53558.1"
FT                   /translation="MSVASQTPPPSSASPGAFCHVPSLVTLTKRADFLLAARAARVPTP
FT                   AFLLQARNRDDGTSDIRIGFTCSKKVGNAVARNRAKRRLREIARAVLPTEGTPGWDYVL
FT                   IGRKDATATHDFKAMQADLARALRKAHR"
FT   gene            complement(613685..613822)
FT                   /locus_tag="Jann_0642"
FT   CDS_pept        complement(613685..613822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0642"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53559"
FT                   /db_xref="GOA:Q28UQ3"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ3"
FT                   /protein_id="ABD53559.1"
FT                   /translation="MSKRTFQPSNLVRKHRHGFRARMATKAGRKILNARRARGRKSLSA
FT                   "
FT   gene            complement(613943..614446)
FT                   /locus_tag="Jann_0643"
FT   CDS_pept        complement(613943..614446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0643"
FT                   /product="protein of unknown function DUF523"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53560"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ2"
FT                   /protein_id="ABD53560.1"
FT                   /translation="MEKIFVSACLMGAPVRYDGRAKTIDDQLLATWRAEGRLVTLCPEM
FT                   AAGLPTPRPPAEIAPGATAEAVLRGRAGIYDNNGLDMTHEFTTGADLALELAREQDCRF
FT                   ALLADGSPSCGSTFIYSGNFDGQRHEGQGVVAARLRAAGVAVFAPSQLRDLARALEEAE
FT                   NTRA"
FT   gene            614618..615352
FT                   /locus_tag="Jann_0644"
FT   CDS_pept        614618..615352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53561"
FT                   /db_xref="GOA:Q28UQ1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ1"
FT                   /protein_id="ABD53561.1"
FT                   /translation="MSDSVNQPSNTQITRYLPLLAVLIGAGVGWFLFRDYLSFQALADN
FT                   REALLAFRDANYLLTVGLFIGAYALIVAFSLPGATIATLTGGFLFATFPGAFFNVFGAT
FT                   LGATAIFLAAQTSFGARFGATLEGSEGVTKKFKDAIDENQWSALFLLRLVPAVPFFVAN
FT                   LLPAFFEVPLRRYVISTFLGILPGAIVYTSVGAGLGEVFERGETPNLGIIFEPQILLPI
FT                   LGLCALATLPIILKAVRGKKGL"
FT   gene            615356..616774
FT                   /locus_tag="Jann_0645"
FT   CDS_pept        615356..616774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0645"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53562"
FT                   /db_xref="GOA:Q28UQ0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UQ0"
FT                   /protein_id="ABD53562.1"
FT                   /translation="MSTIETDICVIGAGSGGLSVAAGAVQMGAKVVLLEGHLMGGDCLN
FT                   FGCVPSKALLAAGHKAHETSEAAFGVAGHEPSPDYAAAKDHVQAVIDEIAPVDSQERFE
FT                   GLGVHVIREFGRFISESEVQAGAHTIKARRFVIATGSRPFVPPIPGLDTVEYHTNETIF
FT                   DLRERPDHLIIIGGGPIGMEMAQAHRRLGSRVTVLEGAKAMGKDDPEAAAIVLDNLRAE
FT                   GIEIVEGALASQIKGSDGSVTVETKDGASYEGSHLLMAVGRAVNVDKLDLEKAGVEYDR
FT                   SGVKVGDDLRSTNKRVYAVGDVAGGAQFTHVAGYHAGVIIRPMLFGLPAKARKDHIPWA
FT                   TYTSPELAQVGLTEAEAKEQHGDNVFIAKAEFEHNDRGIATGQTKGFVKVMVVKGKPVG
FT                   ATIVGPQAGELIGIWSLAIANKLKMSAVANMIAPYPTLGEINKRAASAYFTPKLFDSAL
FT                   VKKVVRFVQRFGRP"
FT   gene            616749..618203
FT                   /locus_tag="Jann_0646"
FT   CDS_pept        616749..618203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0646"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53563"
FT                   /db_xref="GOA:Q28UP9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP9"
FT                   /protein_id="ABD53563.1"
FT                   /translation="MCKGSVGLRLGDSPGSGTKKEPFVANSLSGRFLILTIIFVMLAEV
FT                   FIFVPSIARFREEYLLARLERAQIASLALLATDGMIDDDLEYELLENAEVLNVVLARNS
FT                   MRQLILSTEGMEPISGSYDLRYATAWDLIRDASMRIFETENQNIRVIGRPVRNAGDSIE
FT                   VTMETAPLRMAMLDYGLRVLILSAVISIFTAILLFVAVRVLMVNPIKRVVGAMMTYAEA
FT                   PADANRIITPRGTVRELRNAEDALHAMQTQLTSLLRQRERLAQLGEAVAKISHDLRNML
FT                   SVATLVADRLETVQDPTVKRIAPKLINSLSRAINLTEATLAFGRAEEPAPKLDRVPLEP
FT                   LVDDVLDNDNLAQGDGEVSYDAEIAHGMVVRADPEQLHRVLSNLVRNARQAIAATGAPG
FT                   EVTIRGGEHEGGWRIEVCDTGPGLPGKAQESLFKPFSSTDKVGGTGLGLAICAEILRGH
FT                   GGQLKLLSTGPEGTTFALYLPGGMAA"
FT   gene            618250..618326
FT                   /locus_tag="Jann_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            618250..618326
FT                   /locus_tag="Jann_R0007"
FT                   /product="tRNA-Arg"
FT   gene            618614..619465
FT                   /locus_tag="Jann_0647"
FT   CDS_pept        618614..619465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53564"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP8"
FT                   /protein_id="ABD53564.1"
FT                   /translation="MKALYLASSALALSTASVWADGHAAPVSGYALAGGGSTLLVMTDV
FT                   SAPTDIASFDLGASLDAIAWRPVTGDLLGLADGAIYLIDPTSGEMTDLEASFADDAMLS
FT                   GDATAFDFNNQIDAVRAVSSAGENLVYFPDGFGDGDDRAGSVLRFTDLAYGEGDAHEGT
FT                   TPMIFANAYTNAVNGMTASETFQYAIDAETDALVSLANNAGTLTTIAAISVDGQAVDLA
FT                   PMGGFDIVSPGEGDNTALAILQMSGSESAGLYTLDLETGAATLNADLGTGGITGFAASL
FT                   GM"
FT   gene            619601..620143
FT                   /locus_tag="Jann_0648"
FT   CDS_pept        619601..620143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0648"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53565"
FT                   /db_xref="GOA:Q28UP7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP7"
FT                   /protein_id="ABD53565.1"
FT                   /translation="MTGPDHIEGLILQVSLGNRDAFSDLYDATSGKLFSICLKVLKNRS
FT                   EAEDALQDAYMRIWNKADHYAVTGHSPMTWLITLTRNLAIDRLRKRRAVEVDLDEVGDI
FT                   TESRPGPEAAAIAASEAGRIRACLEELPGDRAAAVRAAYLEGAAYKDLARHHDVPLNTM
FT                   RTWLRRSLLSLKECLSR"
FT   gene            620140..620823
FT                   /locus_tag="Jann_0649"
FT   CDS_pept        620140..620823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53566"
FT                   /db_xref="GOA:Q28UP6"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP6"
FT                   /protein_id="ABD53566.1"
FT                   /translation="MSDAPDMNDDDALAAEYVLHLLDPAEVDAFEGRLASDPALRARVT
FT                   RWEAHFAPMAEALTDIEPSPRIKTALMADIASSRPARRWGWGWLALPSVLAMAAAAFFF
FT                   LSPFLWAPIFDPILHASLASEDGQLMIEAGYSENGTLFRVIREAGGPRPGRDLELWVIA
FT                   EGVSAPVSLGLVPTEEAQITFEITPEIAALIDGGILAVSDEPSGGSPTGAPTGDVLATG
FT                   AFFDV"
FT   gene            621182..622387
FT                   /locus_tag="Jann_0650"
FT   CDS_pept        621182..622387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0650"
FT                   /product="3-oxoadipyl-CoA thiolase"
FT                   /EC_number="2.3.1.174"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53567"
FT                   /db_xref="GOA:Q28UP5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP5"
FT                   /protein_id="ABD53567.1"
FT                   /translation="MAEAFICDYIRTPIGRFGGALAKVRADDLGAVPLAALMARNSGVD
FT                   WAAVDDIYYGCANQAGEDNRNVARMSALLAGLPEAVPGTTINRLCGSGMDAIIAAARAI
FT                   KAGETELMIAGGVESMSRAPFVMPKADTAFSRKAEIYDTTIGWRFVNPVMKAQYGIESM
FT                   PETAENVAEDYTVSRADQDAFAARSQAKAGAAMASGRLAEEITPVTIPRRKGEPVVVSE
FT                   DEHPRPDTDVAALSKLRAPFRDGGSVTAGNASGVNDGAAALVIASEAAAVTHGLTPIAR
FT                   IVGGAVAGVAPRIMGIGPLPASQKLMARLGLTISDFDVIELNEAFAAQGLAVTRGLGIA
FT                   DDDARVNPNGGAIALGHPLGMSGARIAGSAALEMKLRGGTRALATMCIGVGQGIAVALE
FT                   AV"
FT   gene            complement(622466..623527)
FT                   /gene="paaK"
FT                   /locus_tag="Jann_0651"
FT   CDS_pept        complement(622466..623527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="Jann_0651"
FT                   /product="phenylacetic acid degradation oxidoreductase
FT                   PaaK"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53568"
FT                   /db_xref="GOA:Q28UP4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP4"
FT                   /protein_id="ABD53568.1"
FT                   /translation="MAKFIPLTVTRIHRTTSDAVSVQLAPQDGSTLPFTQGQYLTFRQE
FT                   IDGVELRRAYSISAGITDGTLEVGIKKVQGGAFSTWANETLQEGDTIDALSPMGTFHTP
FT                   LRPEARTHYLGFAIGSGITPVLSILRSTLAVEPESRFTLIYANRTARDVMFREELEDLK
FT                   NENLTRLNIVHILKNDPTGIDLFTGRIDAKKLDAMFAQWVDVDTADAAFICGPEAAMET
FT                   IADRLAHHGMASDAIKYELFAASQQGQLPQTHAPDDTSASTTATIIVDGTAQDVDVAPN
FT                   ETILAAALRAGLDAPYACRAGVCSTCMCRVVDGEAQMITNHALEDYEVARGMVLSCQAL
FT                   PVGPSITVEYQDH"
FT   gene            complement(623532..624005)
FT                   /locus_tag="Jann_0652"
FT   CDS_pept        complement(623532..624005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0652"
FT                   /product="Phenylacetate-CoA oxygenase PaaJ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53569"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP3"
FT                   /protein_id="ABD53569.1"
FT                   /translation="MVTPATKPSTDQIWTWLDAVPDPEIPVISVVDLGIVRDVAWTGDT
FT                   LEVTLTPTYSGCPATAVIELSVREALHTKGIDALTLKRQIAPPWTTDWLSDKGRAKLED
FT                   YGIAPPNPAGGPSHCPLCQSTNLERISQFGSTPCKAQWRCTDCLEPFDYFKCI"
FT   gene            complement(623999..624757)
FT                   /locus_tag="Jann_0653"
FT   CDS_pept        complement(623999..624757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0653"
FT                   /product="Phenylacetate-CoA oxygenase PaaI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53570"
FT                   /db_xref="GOA:Q28UP2"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP2"
FT                   /protein_id="ABD53570.1"
FT                   /translation="MPDVIQDRADKALFEFLLRMGDNTLILGHRLSEWCGKGPVLEEDI
FT                   ALANTALDFIGQTQMWLGLAGEVEGKGRSADDLAMLRDAWDFRCCLLVQQPNGHFGQTL
FT                   MRQFLFDNWHLSMLLNLEQHSNDQIAAIAAKSAKEATYHVERSSDLVIRLGDGTDESRA
FT                   RMQASLDLLYPYVGELFTEDTSLPGIDPAPLRPAFDATIGAVLDEATLSVPESRFAHQG
FT                   GYTGARHSEHLGHLLTQMQWLQRAYPGAQW"
FT   gene            complement(624757..625047)
FT                   /locus_tag="Jann_0654"
FT   CDS_pept        complement(624757..625047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0654"
FT                   /product="phenylacetic acid degradation B"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53571"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP1"
FT                   /protein_id="ABD53571.1"
FT                   /translation="MTDKREWPLWEIFIRGQHGASHRHVGSLHAPDAEMAILNARDVYT
FT                   RRKEGVSIWAVPASAIAASSPSKKGPMFDPADDKTYRHPTFFDIPKDVGPM"
FT   gene            complement(625167..626144)
FT                   /locus_tag="Jann_0655"
FT   CDS_pept        complement(625167..626144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0655"
FT                   /product="Phenylacetate-CoA oxygenase PaaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53572"
FT                   /db_xref="GOA:Q28UP0"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UP0"
FT                   /protein_id="ABD53572.1"
FT                   /translation="MYAQMVKSEASTDDPAKLAEFQARIDAGEKIEPKDWMPEGYRKTL
FT                   IRQIGQHAHSEIVGQLPEGNWITRAPTLERKAILLAKVQDEAGHGLYLYCAAETLGISR
FT                   DEMTEMLLDGRMKYSSIFAYPTLTWADMGAVGWLVDGAAIMNQVPLQRTSFGPYARAMI
FT                   RVCKEESFHQRQGFDIMMKMCNGTESQKRMAQDALNRLWFPSLMMFGPSDANSTHSEQS
FT                   MAWKIKMNTNDELRQKFVDQTVPQAEYLGLTVPDETLAWNDEKQGYDFAEPDWDEFFDV
FT                   LKGNGPCSADRIATRQKAWDDGAWVRDGLMAHAAKTQAAKVAAE"
FT   gene            complement(626342..627646)
FT                   /gene="paaF"
FT                   /locus_tag="Jann_0656"
FT   CDS_pept        complement(626342..627646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaF"
FT                   /locus_tag="Jann_0656"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53573"
FT                   /db_xref="GOA:Q28UN9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN9"
FT                   /protein_id="ABD53573.1"
FT                   /translation="MRDLTPPRDTLDPIEIASRDEIAALQLSRLKWSLQHAYDNVPFYR
FT                   AQFDAASVHPSDLHSLEDLAKFPFTVKSDLRDNYPFGLFAVPRDRISRIHASSGTTGKP
FT                   TVVGYTKSDITMWSNMVARSMRASGTAPGDLVHIAYGYGLFTGGLGAHYGAEALGCTVV
FT                   PVSGGMTARQVTLIEDFQPTTIMVTPSYMLNLLEEYHRQGLDPRSTSLEVGIFGAEPWT
FT                   NKMRAEVESAFDMHAVDIYGLSEVMGPGVANECVETKDGLHIWEDNFYPEIIDPQTGEV
FT                   LPDGEMGELVFTTLTKEGMPIIRYRTRDLTRLLPGTARSMRRMEKITGRSDDMIILRGV
FT                   NVFPTQIEEQVLTVDGLAPYYQIELVKNGQMDAMRVHVESLPNHGDGEAQAVQAATLAH
FT                   RIKEVVGISTDVQVALPGSVERSEGKARRVVDNRG"
FT   gene            complement(627643..628074)
FT                   /locus_tag="Jann_0657"
FT   CDS_pept        complement(627643..628074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0657"
FT                   /product="Phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53574"
FT                   /db_xref="GOA:Q28UN8"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN8"
FT                   /protein_id="ABD53574.1"
FT                   /translation="MHPKERAQRSANTMWASDRASAWVGMEIADVDEGTATLTLTIRED
FT                   HCNGHGIGHGGVTFMLADSAFAFACNSRNVSTVAQHNTISFLAPVRLGDVLTATAVETT
FT                   LKGRSGITDVTVTNQTGETVALFRGASRAIGGHLFEEKI"
FT   gene            628157..630151
FT                   /locus_tag="Jann_0658"
FT   CDS_pept        628157..630151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0658"
FT                   /product="Phenylacetic acid degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53575"
FT                   /db_xref="GOA:Q28UN7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR011966"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN7"
FT                   /protein_id="ABD53575.1"
FT                   /translation="MQHVGSFAKGIWVPAGDGAREIADAATGQVIALAGSDSLDVQGMI
FT                   AYARDVGGPALRALDFHDRARMLKALALHLNAHKERLYELSYTTGATRKDHGFDVDGGI
FT                   GTLFVFASKGRREMPEGHVLIDGGFEPLGRTGAFGGQHIYTPKLGVAFHINAFNFPVWG
FT                   MLEKIAPAILAGVPSIVKPATATCHVTELCVRIMLEAGVLPDGALQLITGGVGDALGHL
FT                   GPQDAVTFTGSAATAGIVRGALGSGVPFTAEQDSLNASILGPDAEPGTPEFDLFLKEVC
FT                   REMTTKAGQKCTAIRRVLAPQPLLQPLIEGLSARLSRVVVGDPREEGTGMGPVVSASQR
FT                   DDVLEKAAAIGAEAECVFEGNHAMDQGAFVAPRLFHCADPDAAQAVHATEAFGPVSTVM
FT                   GYRDLDHAVALANRGEGSLVASLITHDTDVARQVVQGIGAWHGRVYINDRDSMGEATGH
FT                   GAPMPHLTHGGPGRAGGGEELGGIRAVKHYMQRVAVQGSPTMLSAVTGRWVPGAARTPT
FT                   DGHPFQVRFGDLAPGRTLRTDPRTITLDDIAQFAEFTGDTFYAHMDEAAAKRNPFFPGR
FT                   VAHGYLILSFAAGLFVEPNEGPVLANTGLDNLRFLKPVSPGDSIAVDLTVMDRKSRNDD
FT                   YGEVRWHAEVSNQDGDAVAEYELLTMVAK"
FT   gene            630190..630987
FT                   /locus_tag="Jann_0659"
FT   CDS_pept        630190..630987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0659"
FT                   /product="PaaX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53576"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3L09"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN6"
FT                   /protein_id="ABD53576.1"
FT                   /translation="MADASDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGV
FT                   ALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYG
FT                   PGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGR
FT                   GLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSP
FT                   AAEAALGGARAEISCRARVHQLLDQLGSVEPDWDLPATEDAAS"
FT   gene            complement(630927..631454)
FT                   /locus_tag="Jann_0660"
FT   CDS_pept        complement(630927..631454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0660"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53577"
FT                   /db_xref="GOA:Q28UN5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN5"
FT                   /protein_id="ABD53577.1"
FT                   /translation="MSMTEIYTMPGHLIRRLQQISISVFSDRMRRLGHDLTAPQFATLS
FT                   VLARAPGIDQATLAGLIAHDRPTIGGVVERLEAKGLVTRHQSEKDRRAKVLALSDDGTA
FT                   LLEALLPHVREIQPDILPGLSSDERTEFIRLATKVAHAGNATARAPYAARAPHDAASSV
FT                   AGKSQSGSTEPS"
FT   gene            631686..632711
FT                   /locus_tag="Jann_0661"
FT   CDS_pept        631686..632711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0661"
FT                   /product="TRAP dicarboxylate transporter DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53578"
FT                   /db_xref="GOA:Q28UN4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN4"
FT                   /protein_id="ABD53578.1"
FT                   /translation="MKTKLLMTTVAAGAMVASGALAQEVTLRLHQFLPAQANVPALVLD
FT                   VWADQVEEASGGRIEIERYPSMQLGGSPPELMDQAVDGVADIVWTVVGYTPGRFPSTEV
FT                   FELPFMVADARAASCAYWTMYEEGMQEEFSSVHLLGTWVHGPGMFHTADPVEVPSDLEG
FT                   MQIRGGSRLVNQLLELTGATPVGMPVPAVPEALSRGTIDGTTIPWEVTAALRVPELVEN
FT                   HTGFEGNGLYTLTFVLAMNNDAYDAMPEDLQQILDDNSGLEFSIFAGGTQADADGPARE
FT                   LAVDAGNNIIMIDAATAEAEWLPVVGPIYDTWIADVAESGLDGQALIDRARELMSGQCA
FT                   G"
FT   gene            632785..633369
FT                   /locus_tag="Jann_0662"
FT   CDS_pept        632785..633369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0662"
FT                   /product="TRAP dicarboxylate transporter DctQ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53579"
FT                   /db_xref="GOA:Q28UN3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN3"
FT                   /protein_id="ABD53579.1"
FT                   /translation="MHRALTYLSRLMAILGGVMLSIVILLTVFSIVMRLFDRLFHWMVQ
FT                   AGFLAGLGQWMIDAGVGPILGTFELIEAGIGFVIFAFLPICQITGGHATVDIFTSAMSE
FT                   GANRILRGVTEVVFAAVLVLIAVQLYGGLMTKFSSGQTTLELQFPVWYSYAIGLAGAAL
FT                   AAVVSVYLAVVRLIEMVTGRVMLPADLGAEH"
FT   gene            633366..634967
FT                   /locus_tag="Jann_0663"
FT   CDS_pept        633366..634967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0663"
FT                   /product="TRAP dicarboxylate transporter DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53580"
FT                   /db_xref="GOA:Q28UN2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN2"
FT                   /protein_id="ABD53580.1"
FT                   /translation="MSDQLIGILSFPLLLTMIFLRVPIGLSMFVTGLIGLIMVTDGTQV
FT                   PFGRLKSETFTTFSSYSLSIIPMFLLMGHFATLGGMSQALFKAAEGWLGHRKGGVAMAA
FT                   VGACAGFGAICGSSLATAATMGRVALPEMRRYGYDGGFSTAVLAAGGTLGILIPPSIVL
FT                   VIYAILVEQNIAKLFLAAFIPGIIAALGYVLAISIYVRLFPKRAGTMPRVPYGQRFAAM
FT                   VKIWPVLVVFGAVVGGIYAGWFTPTEGAAVGALGTGLIAWFNGGLTRVTLVESFTVTAR
FT                   ATAMIFFIILGAAFYNGFLALTQVPQGIAEWVSASGFSPYTILIMILIFYLILGCFMDS
FT                   LSMILLTIPIFWPVMQGLDFGFVSMVDLHSARAMEALLAVPDMTAQTIEGMLASYREGV
FT                   ELTLAQTVQFDAIRAHFDADIVALDGAFQALAAGEELTRDQTRALELRRVNQGALNRIN
FT                   SELVAIWFGILVLIVVEVGLITPPVGMNLFIINAMDKATKMTATYKAVLFFVASDLLRV
FT                   VLLAAFPVITLVFIVW"
FT   gene            635059..635823
FT                   /locus_tag="Jann_0664"
FT   CDS_pept        635059..635823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0664"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53581"
FT                   /db_xref="GOA:Q28UN1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN1"
FT                   /protein_id="ABD53581.1"
FT                   /translation="MQLDGQAAIVTGGASGLGEATARYLAERGCDVTILDFNGDRAREV
FT                   AAEIGGYSQQCDVTDPEHAATAVTSAMARFGQAPRICVNCAGVGLAARIVGREGKTSLD
FT                   VFRKVIEVNLIGTYNVMTYAVQAMMDLPPLEGGERGVVINTASAAYQDGQVGQSAYAAS
FT                   KGAIAAMCLPLARELARPGIRVNAIAPGLFNTPMMESLPEETTQAIVANVPFPARLGHP
FT                   AEFGQMVASIVENPYLNGEVIRLDGATRLPPK"
FT   gene            635820..636572
FT                   /locus_tag="Jann_0665"
FT   CDS_pept        635820..636572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0665"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53582"
FT                   /db_xref="GOA:Q28UN0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UN0"
FT                   /protein_id="ABD53582.1"
FT                   /translation="MSLLVEIDGRIATLTLNRPEKRNAMNDALMAELSAFCDAPPEGVR
FT                   VIILTGAGGHFCAGLDLAEQHDRDPAEAMAHSRGWHRALERVQFGGLPVVAAMSGAVIG
FT                   GGLEVACAAHVRVAGPDMRYQLPEGQRGFFVGGGATVRVGRIIGPDRLTEMMLTGRSYG
FT                   AEEGLALGLSHYVDDDPMARARVLAEQIASNAQMSNYFAIHGVARINAMAPEEGFFAEA
FT                   MCSALAQTSPDAKEGFAAFLEKRAPRFG"
FT   gene            636544..637053
FT                   /locus_tag="Jann_0666"
FT   CDS_pept        636544..637053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0666"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53583"
FT                   /db_xref="GOA:Q28UM9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM9"
FT                   /protein_id="ABD53583.1"
FT                   /translation="MRKERPGLADRDADLRALVSYNVKRANSALMGDVERLVGRFGLRR
FT                   TTFSALSVIAANGGIRQSDVAEVLAIERPNLVQILDEVQRAGWIERVRDGADKRVYLLN
FT                   ATPAGLARLAEADAVLRAYDARLTRGMSDAERATLIAALRRVEESGEEAWEGLQSEPEI
FT                   EDVSTT"
FT   gene            637055..638776
FT                   /locus_tag="Jann_0667"
FT   CDS_pept        637055..638776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0667"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53584"
FT                   /db_xref="GOA:Q28UM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM8"
FT                   /protein_id="ABD53584.1"
FT                   /translation="MIREDRDDGAILLRARADMGPVAERTTDWLDHWAEVTPEAVFLAE
FT                   RDGPGWREVSYAAARDEARAIAVGLTDMDLGPGRPVMVVTGNSVAHGLLALACQYAGAP
FT                   VVPVAEQYAALPAARGQLDHIATLIQPAAVFAETPMEEVFTRDSLAAARPLTGQSLDAL
FT                   ARVGGRLEARIGPDTVAKILMTSGSTSAPKGVLTTHRMMCVNQAQIAACLPFLRDRPPV
FT                   LVDWLPWNHVFGGSHNFNLVLANGGSLYIDGGKPVPALVGQTIENNRLKQGTISFNVPV
FT                   GFAALRDAMLGDRDFARAFFQDLDMLFYAGASLPQDVWTDLDRMAREVRDDLPLFTSSW
FT                   GLTETAPAALLQHEPTDRSGVVGVPLPGVDVKLVPAETRYEVRVRGPSVFKGYHGNAAK
FT                   TDEAFDEDGYFRTGDAMAFVDPSDMNQGLRFDGRISEDFKLMSGTWVRAAALRLHLLDG
FT                   LKGIAQDVVLVGEERADVGVLIVPTADMRESARDDGAALLANDPTPIIEVLSAMKGGSA
FT                   ARVTRALILSQPPSIADGEITAKGNLNFARIRAGRADLIARLYDPSDPASITLGEL"
FT   gene            638776..639957
FT                   /locus_tag="Jann_0668"
FT   CDS_pept        638776..639957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0668"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53585"
FT                   /db_xref="GOA:Q28UM7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM7"
FT                   /protein_id="ABD53585.1"
FT                   /translation="MAYIPYGAYWSTPFARWQGSLAHLNSVQFAAHVGRGELTRMGLLA
FT                   DSFDFAAFGQTVIQKGSFFGGPWFTAMLGAEGLAAPMVSQACATGARLVATAVGEIAQG
FT                   ATQALIVSGDRTSNGPHVYFPAPGGPGGTGVAEDVVMDNFGHDPWACNAMIQTGENVAA
FT                   RDGISTEEQHDLVACRRAQYDDALADGRAFQRRYMRVLDVPDARFRKTVAVLEGDEGVE
FT                   PLDAEKLTRLKPVVPGGTITFAGQTHPADGNAGMVVVADRAQALEIGDGPVVEVLAVGQ
FT                   AREEKGFMPAAPIKATRVALGRADLGIEDVDAIKSHNPFAVNDIAFARAFDLDWRGMNN
FT                   FGSSLIWGHPQGPTGLRGMIELVEELALRGGGVGLFQGCAAGDSAMAVVLKVG"
FT   gene            639999..641510
FT                   /locus_tag="Jann_0669"
FT   CDS_pept        639999..641510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0669"
FT                   /product="benzoate-CoA ligase"
FT                   /EC_number="6.2.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53586"
FT                   /db_xref="GOA:Q28UM6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM6"
FT                   /protein_id="ABD53586.1"
FT                   /translation="MANAATFFVDRHMAEGRADKPAFVEADGKERVLTYGQLHVESGRF
FT                   AGALGRHGVRREERIAMIVRDQIEWPVVFWGAMKAGAIPVPLNTLLSSDVYETILTDSR
FT                   ASILVVSEEMWEVVEPATRDNAFLRAILVIGDAPEMTESYRDFTDGAPEVETVAANDDE
FT                   LAFWLYSSGSTGQPKGVRHVHGALKATCETFGDQVLGIREDDVVYSVAKMFFAYGLGNA
FT                   VSFPQSVGATTVLFGGRPTPPVVFDILAKHRPSILCAVPTLFAALVQAADGAPKHGLRL
FT                   CTSAGEALPRDVGEGWDRLTGVEIVDGVGSTEMLHIFLSNAPGDCVYGTSGTAVPGYEL
FT                   RLVNEHDEELADGEVGELLVRGPSSADGYWNRRAKSQATFEGMWTRTGDKYERKDGRYI
FT                   YCGRTDDMFKVSGIWVSPFEVESALVDHASVLEAAVVARADEAGLDKPAAFVVLTEGAE
FT                   VPEAEALKAFVKDKIGMWKYPRWVEIVEDLPKTATGKIQRFKLRA"
FT   gene            641510..642286
FT                   /locus_tag="Jann_0670"
FT   CDS_pept        641510..642286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0670"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53587"
FT                   /db_xref="GOA:Q28UM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM5"
FT                   /protein_id="ABD53587.1"
FT                   /translation="MWGAGHVTAGGKRLEYRCWGDAPEDGRCVVLLHEGLGCVALWKGF
FT                   PAALHEALGLPVIAYSRAGYGGSEADDLPRPLDWMTREAEVLPEVLEALGIGAPVLIGH
FT                   SDGATIAAIAAGQPLLRQGVLAVVLIAPHFFTEDMGLTQIAKANAGFEASGLRERMANY
FT                   HQDADATFRGWADAWLSDGFRDWNVEAALDGICAPVLVIQGREDQYGTLAQVEAVTARC
FT                   RTAQAPIVDDCKHVPHLEQPDLVLAEVVKFVHYNAN"
FT   gene            642376..644025
FT                   /gene="boxC"
FT                   /locus_tag="Jann_0671"
FT   CDS_pept        642376..644025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="boxC"
FT                   /locus_tag="Jann_0671"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoyl-CoA ring
FT                   cleavage enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53588"
FT                   /db_xref="GOA:Q28UM4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017633"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM4"
FT                   /protein_id="ABD53588.1"
FT                   /translation="MGKVIDFRTDPSKYRHWSVTYDGPVATLTMDVDEDGGLFDGYQLK
FT                   LNSYDLGVDIELNDIVQRMRFEHPEVRVVVMQSGKDKVFCAGANIRMLGGAEHSHKVNF
FT                   CKFTNETRNAYEAAEEESGQTYVAAIKGACAGGGYELALACNHIMLVDDATSSVSLPEV
FT                   PLLAVLPGTGGLTRVTDKRRVRRDLADVFCATEEGVKGKRAVDWRLVDEVVPNSKFDAV
FT                   VAERAAEFAAKDPRDVTGITLGPLERTIAEDGSVAYTHVEVAVDRAARTAVITLKGPEE
FT                   AAPADMQALQAQGDQAYMLKLAREFEDAILHLRLNEMDCGLWTLRTQGDAELLAAHEAV
FT                   LREDHWLATEIRTYWKRTLKRLDVTSRSLVTLVEHGSCFAGVLAELIWAADRSYMMEDE
FT                   FEGDNRPMATITLTEDNFGTYPMGNGLTRLQTRFLADPEAVEAMRDQIGEALEAEDADR
FT                   HGLVTMIMDDIDWEDEIRIILEERASFSPDAMTGMEANLRFAGPETMETRIFGRLTAWQ
FT                   NWIFNRPNAVGENGALQRYGSGIRGEYDMERV"
FT   gene            644135..645583
FT                   /gene="boxB"
FT                   /locus_tag="Jann_0672"
FT   CDS_pept        644135..645583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="boxB"
FT                   /locus_tag="Jann_0672"
FT                   /product="benzoyl-CoA oxygenase, component B"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53589"
FT                   /db_xref="GOA:Q28UM3"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM3"
FT                   /protein_id="ABD53589.1"
FT                   /translation="MSALDVEYDTQIPNNVGLGQDRKVLKALEKWHPGYLDWWNRLIPQ
FT                   NFQESMVYLRTAVSVDPKGWAKFDYVKMPEYRWGVLLAPEVEGRTIPCGEHAGQPAWQE
FT                   VPGEYRNMLKRLIVIQGDTEPGSVEQQRFLGLTAPSLYDMRNLFQVNVEEGRHLWAMVY
FT                   LLQKYFGKDGREEADDMLRRSSGSDEAPRMLGAFNEETPDWLSFFMFTYFTDRDGKMQL
FT                   ESLAQSGFDPLSRTCRFMLTEEAHHMFVGETGVGRIVQRTCEAMVEAGISDPYDIGRVR
FT                   DLGVIDLPTIQKKLNMHYSLSLDLFGQEVSTNAANAFNAGVKGRYMEQRIDDDHKLTDA
FT                   TYTVKLIEDGKILDKEVPALTAINMRLRDDYIRDASGGLRRWNKMIQRTGIEFALKLPD
FT                   QAFHRQIGVFSAIKADPEGNLISQADWDAKAHDWLPTTDDAAFITSLMMPCFEPGKFAS
FT                   WIAPPKVGIDNKPGDFEYVKLHMA"
FT   gene            645645..646103
FT                   /locus_tag="Jann_0673"
FT   CDS_pept        645645..646103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0673"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53590"
FT                   /db_xref="GOA:Q28UM2"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM2"
FT                   /protein_id="ABD53590.1"
FT                   /translation="MNIHFLFGTETGSAEMLCEDIRDDLGDGFECEITSLGEVDPTTLD
FT                   ADTFYVFVSSTYGNGDLPVTAQPFYDKIVETGQDLSHVRFAIFGLGDMVFAETFAFGSK
FT                   ILMEKLVEQGATMVGERCVHDASSPEMPEDLGIPWAHDVLAQCKAQAA"
FT   gene            646103..646534
FT                   /locus_tag="Jann_0674"
FT   CDS_pept        646103..646534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0674"
FT                   /product="thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53591"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="PDB:2OAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM1"
FT                   /protein_id="ABD53591.1"
FT                   /translation="MQPRPDSAFVHDVRVTWGDCDPAKIAYTGHLPRFALEAIDAWWSE
FT                   YHGPGGWYHLELDTNVGTPFVRLEMDFKSPVTPRHILKCHTWPTRLGTKSITFRVDGVQ
FT                   DGVTCFVGAFTCVFTIADQFKSQPAPDHLRALIEPHIPA"
FT   gene            646538..647431
FT                   /locus_tag="Jann_0675"
FT   CDS_pept        646538..647431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0675"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53592"
FT                   /db_xref="GOA:Q28UM0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UM0"
FT                   /protein_id="ABD53592.1"
FT                   /translation="MSSEDRHPPVAIDAAILALQARVGDRVRAARASKRISRRVLSETS
FT                   GVSPRYLAQLEGGDGNISIGLLFRVADALDVSLEALVSACDLPADARRVGQAFADADPV
FT                   IQARVRDLLSETTSRDSRLCLIGLRGAGKSTLGAAAAKALDVPFIELNRAIEAAGSMPI
FT                   AEIMALYGAEGYRQLEADALDKIVAEQDRAIVAVAGGIVGEAKTFDRLLDRFHTVWVKT
FT                   SPEEHMSRVRAQGDTRPMEGNPQAMAQLRLILTSREADYSRANAVLDTGGQSVDASLAG
FT                   LLSLIEHHNFITKDLP"
FT   gene            647428..649491
FT                   /locus_tag="Jann_0676"
FT   CDS_pept        647428..649491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0676"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53593"
FT                   /db_xref="GOA:Q28UL9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL9"
FT                   /protein_id="ABD53593.1"
FT                   /translation="MSVTMIRDGLTGFVTLDNPSVNAIGRAMREGLMDAVAWAETEMLD
FT                   RVIVTGAGRAFAAGADAKEFDGAALEPYLPDVLDAIERSFVPWIAAINGVALGGGAEIA
FT                   LACRMRIMGPRAQIGLPEVTLGVIPGAGGTQRAMRLCGLDTALEMIAYGKPLGAKAALA
FT                   TGLVHAVEEDPVDAADMVNSEELLCIVPTWELPAPDMNADAFAKIREGLAKRSKGQVAP
FT                   LKAVEVIEAGLSMEFADAMALERAAFLELKAGDQSRALRHMFFSERAAKAPNDLPKAPE
FT                   ISKIAIVGGGTMGAGIAYACLSVGLPVVLLETDADAIARAQHNIDTLIGAGLKRGRLDD
FT                   SGAAALRDRLTLTEDYAAASDATLVIEAAFESMDVKKDIFAKLDAAVSPDTVLATNTSY
FT                   LDVDVLAASTRDPSRILGLHFFAPAHIMRLLEIVTGAETSDRALATGYALAKLLKKVPV
FT                   LAGVCDGFIGNRIFSRYKEEADILLMDGAVPWEVDDAMEAFGYAMGPFEVGDLSGLDIG
FT                   FANRRRQDATRDPNRRYIPIADRMVNEGRLGRKASVGWYRYPGGGGKVIDPLIEDLIAE
FT                   EAHFAGATRTEIADEVVVERLLLAMINEAADILGEGIARSAADIDLVTVFGYGFPRWRG
FT                   GLMHYADTRGVAQIVEKLRSLEAVDPVIWKVSPVLLDCAQTGTKLADWQRTT"
FT   gene            complement(649494..650702)
FT                   /locus_tag="Jann_0677"
FT   CDS_pept        complement(649494..650702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0677"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53594"
FT                   /db_xref="GOA:Q28UL8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL8"
FT                   /protein_id="ABD53594.1"
FT                   /translation="MLDIAQFDLNQIDAAFIEDPYSTLAALRRTSPVHPNADGSVYLTR
FT                   HDDCLATYRSRDMLSDKTEAFGQKFGECPLKVHHTTSLIFNDPPYHTVVRKLIAGAFTP
FT                   RKLKEMERAIERIVSRLLDRVEDLGELDVIADFGMMLPTEIISIMLGVPEAYRAQLRGY
FT                   STAILGALDPVVSSSQMEAGNRAVEEFGAVLDDLINHRRANPDAAAEGEVLESLIFGEH
FT                   DGRTLTQEELVQNCIFLLNAGHETTTSLVGNAVAVLLANPSEHRRLIDDPTLIGTAVEE
FT                   ILRVESPLQIGNRLAGEDIALPSGPTIPKGTYIHTSIAAANRDPEVFADPDRFDVSRKP
FT                   NPHIAFITGIHVCLGASLARMEGKIAIGGFVKRFPKLAATGEGERLGLARFRGWTSLPI
FT                   RVR"
FT   gene            650930..651775
FT                   /locus_tag="Jann_0678"
FT   CDS_pept        650930..651775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53595"
FT                   /db_xref="GOA:Q28UL7"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL7"
FT                   /protein_id="ABD53595.1"
FT                   /translation="MTVTQRPSRLHHPAQRGLVPDAQAIRAEDPIVRLAREAVAKIVAQ
FT                   AQIPVPRPKADGQQSSPQITELAQALVDTDRARVDEMIADLLGSDLGVRDLCLDHLAPA
FT                   ARVLGAFWERDQLQFADVSLATARIQAIVRTMPTTPVRAATGRDDRTLFAAVPGETHTL
FT                   GVVMAADHFRRLGWDVSLLIGMDHSDICRRARTDDCNVIGLSCAGRHAVPALSRLIQEI
FT                   RHLRPDMGIVLAGHIVTDREAVDALPQLDGLVEELDGAEQVLRDAMAAVPEDRRALQAS
FT                   "
FT   gene            complement(651786..652499)
FT                   /locus_tag="Jann_0679"
FT   CDS_pept        complement(651786..652499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0679"
FT                   /product="Helix-turn-helix type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53596"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL6"
FT                   /protein_id="ABD53596.1"
FT                   /translation="MRRADRLFRLIDRLRPGKLTTARALADAMEVSERTIYRDIAHLQG
FT                   SGVPIEGEAGLGYMMRDGYNLPPLMFTEEEIVALSVGARMLQTWGGTSMARGADSALDK
FT                   ITAVLPDATRTRAERLRFEAWTTNPLDAKTRATIDTVEAAIQAAERLSIDYRDDKGNPT
FT                   ERILRPLGLWFWGSVWTLVAWCELRDAYRMFRLDRILDARNLGAFTPHPDQTLENFYAT
FT                   QFDRDHRAMRTCKDV"
FT   gene            complement(652671..653045)
FT                   /locus_tag="Jann_0680"
FT   CDS_pept        complement(652671..653045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0680"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53597"
FT                   /db_xref="GOA:Q28UL5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL5"
FT                   /protein_id="ABD53597.1"
FT                   /translation="MSEQPQNCACWFEIAVSDLDASMAFYGAVLQQDLSMDDSGPNPLV
FT                   MLPYNDDTTGIGGHLYPGKPSREGSTIHLVVADSLDAARERIIAAGGEVESPDIQIPPG
FT                   HFFYARDIDGNSLGMFKLNG"
FT   gene            complement(653156..653614)
FT                   /locus_tag="Jann_0681"
FT   CDS_pept        complement(653156..653614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53598"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL4"
FT                   /protein_id="ABD53598.1"
FT                   /translation="MPDAVKHYLERSGALLDIVAQHADADRLLSDRIAPDMFDAGLNLA
FT                   IAIRFAARALCPPAQIAVPEIPESFTMATLRPYHSKITRHIAPITGGDLIHTVTHNAGN
FT                   ATLTQAPMDYIARFALPNQIFHLTATYAALRGAGVALGKADFDGLHVY"
FT   gene            complement(653626..654186)
FT                   /locus_tag="Jann_0682"
FT   CDS_pept        complement(653626..654186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0682"
FT                   /product="protein of unknown function DUF1285"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53599"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="InterPro:IPR023361"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL3"
FT                   /protein_id="ABD53599.1"
FT                   /translation="MTPATDQLLKAAQDAAKQGKLPPVHLWNPDFCGDLDMEIRRDGTW
FT                   FYEGTPIGRKPLVRLFSTILKLEDGKYFLVTPVEKVGIRVVDAPFVALDIERDGDGIVF
FT                   TTNVGDTVIAGEGHAIRVERDEAGEPSPYVHIRAGLEALIDRKSFYRLVDMGEAHDVDG
FT                   TDMFGVWSRGVFFPIIPLAELDL"
FT   gene            654345..655352
FT                   /locus_tag="Jann_0683"
FT   CDS_pept        654345..655352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0683"
FT                   /product="AAA_3 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53600"
FT                   /db_xref="GOA:Q28UL2"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL2"
FT                   /protein_id="ABD53600.1"
FT                   /translation="MTEPDTLVSEIEALGAKLGEAKASIAQRIIGQDEVVDLALAAMLS
FT                   GGHALLMGLPGLGKTLLVDTLSTVMGLSANRVQFTPDLMPADILGSEVLETSDDGSRNF
FT                   RFLEGPIFCQLLMADEINRASPRTQSALLQAMQEKEVTIAGEHRPLPAPFHVLATQNPI
FT                   EQEGTYPLPEAQLDRFLVKIDVPYPDRETERDILIATTGTQEAVSTEVFTPEELIRAQS
FT                   VVRQMPVGEAVVEVILDLVRACRPEEADAPDVVKNTVAWGPGPRAAQALMLTARARALL
FT                   DGRLAPSVDDVAALARPVLGHRMALSFAARAEGAVLEQVIDEVTARATRIEAAA"
FT   gene            655349..656236
FT                   /locus_tag="Jann_0684"
FT   CDS_pept        655349..656236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53601"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL1"
FT                   /protein_id="ABD53601.1"
FT                   /translation="MSELTLHTPDSLRSRSESVAASLPPLMADAQHLAATVLLGVHGRK
FT                   RAGTGDEFWQYRPAEQGDSYRSIDWRRSARSDGHFLRQTEWQAAQSVMIGVDDAASMTY
FT                   SGAKTRPSKLRRAQTLAMALAVIAVRGGERVGLTHLAEPPRGGQAQLLRMATELMDSVD
FT                   RPEYGAPKPQAMPAGARAVFFSDFLGDPKAIETVLGRAADRGVQGALVQILDPDEEAFP
FT                   FDGRTLFESMSGAIRFETLKAKSLREEYLARLTARKDALRDMTRRTGWSFHVHHTDQPA
FT                   EPALLWLYQALERR"
FT   gene            656236..658995
FT                   /locus_tag="Jann_0685"
FT   CDS_pept        656236..658995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0685"
FT                   /product="Double-transmembrane region-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53602"
FT                   /db_xref="GOA:Q28UL0"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UL0"
FT                   /protein_id="ABD53602.1"
FT                   /translation="MFSALGFATPLLLLALIALPLLWWLLRAVPPAPIKRRFPGIALLL
FT                   GLTDDESQTDKTPWWLLLLRMAAIAAAIIGFAGPVLNPQEDRAAGDGPLLIVMDSSWAS
FT                   ARDWDARLDRVQVLLDDAARTGREVAVVQLTDLPPGPPSFQAANAWAPRVPTLEPAPYD
FT                   PDMEAAALWAASLDSGVEVFWFSDGLAYAARPDVADAFADIGTLSVFQGDRDLIALAPP
FT                   RFEDGMVRGDLSRLGTTTPRDVTIVAHGLDPAGLPRDLARGTATFDAGEIVAQVEFDLP
FT                   PELRNRITRFEISAERHAGAIALTDDALQRRQVALISAGADDEQQALLSPLHYLRQALE
FT                   PTADLMEGALSDILLASPDVIMLADIATLSEEEEAGLTAWVENGGLLVRFAGPRMAASD
FT                   IARDDVGPLMPVRLRVGGRTVGGAMSWGEPKELRPFEEGSPFFGLTIPDDVQVTSQVVA
FT                   QPDPTLSERTIASLSDGTPLVTRANLGQGSVILFHVTANAEWSTLPLSGLFVQMLERLA
FT                   ISTRPVAPEAADLEGTIWTPEQVLDGFGVLRDAGTRPGVAGEDLASAPLSADILPGLYS
FT                   GDDRRLARNVMVQHAALVAAEWPADVPVEGMSVTLPTYLMASFLTAALTLLLIDALAAL
FT                   WLAGRLGGLTRSAAVLAAALILAPQAEAQMTPAEELALLATSEATLAYVLTGDLAVDET
FT                   SRAGLQGLSNTLYQRTSVEPAPPIGVDLELDELAFFPMIYWPITPDQDIPSANAYRRLN
FT                   DYLRGGGMIVFDTRDAHVGGFGSGTPEGRRLQIIAAPLDIPPLEPIPEDHVVTRTFYLL
FT                   QDFPGRHLSRDVWVEAAPPDAEQIEGMPFRNLNDGVTPVVIGGNDWAAAWAQDERGRPL
FT                   YPIGRGQTGERQREIALRFGVNLVMHVLSGNYKSDQVHVPALLDRLGQ"
FT   gene            658998..661064
FT                   /locus_tag="Jann_0686"
FT   CDS_pept        658998..661064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53603"
FT                   /db_xref="GOA:Q28UK9"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK9"
FT                   /protein_id="ABD53603.1"
FT                   /translation="MANQILFDPLLDWPLLYGLGAALVLIIALSIWRGLSGWPYRLLAG
FT                   AALLAALINPSLQTEDREPLSDIVLLVVDESASQRISDRPSQTADALEALEAEVEALGM
FT                   ETRVARVGDADDNSGTLLMTELQRLMAEEPRARIAGALIITDGRLHDPELVPDMPAPIH
FT                   ALITGLETDWDRRLVIETAPAFGIIGEELLLTIRLEDQGAVPAGLEGRSQIVIAVDGGP
FT                   PQTYVVPVGESLELPLTLEHAGQNVIQFTVPEAEGELTTRNNAAVVQINGIRDRLRVLL
FT                   VSGEPHPGQRTWRNLLKSDPSVDLVHFTILRPPDRQDGVPVGELSLIAFPTRELFMEAV
FT                   DEFDLIIFDRYQRRGILPMVYIDNIRRYVEDGGALLLAAGPDFAGASSLYRTPLSDILP
FT                   GRPTARVIEEPYVPLISELGARHPVTTGLEGEHTPLPGSDDPWGRWLRQIELTEQGGQT
FT                   VMEGAGGAPLLMLDRVGQGRVALLASDHAWLWDRGYEGGGPQLELLRRLAHWMMGEPDL
FT                   EEEALVADVDGQTITITRRTLADEVGSVIVTTPDGEQLEVMLEETAPGAFTAQIEGLEQ
FT                   GLYRLVESDLERVIALGPAAPREFEVTIAGAERIDPLLDAEGGRSVRLEDGLPDLRRVS
FT                   EGRTAHGRGWLGLTTREAYVTTDVTVTPFIQAWVFLLLAAGLMLAGWLREGRQ"
FT   gene            complement(661201..661566)
FT                   /locus_tag="Jann_0687"
FT   CDS_pept        complement(661201..661566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53604"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK8"
FT                   /protein_id="ABD53604.1"
FT                   /translation="MGMKHLIPVLLIALSTTPVRADPAEVVEITATDSASGWRFNVTLA
FT                   HGDTGWDDYADGWRVELADGTVIGERPLAHPHVEEQPFTRSTSGVMIPEGTEQVFIRAR
FT                   TNVDGWAETTTAFDLPG"
FT   gene            complement(661612..662214)
FT                   /locus_tag="Jann_0688"
FT   CDS_pept        complement(661612..662214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53605"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK7"
FT                   /protein_id="ABD53605.1"
FT                   /translation="MPRQMRPDIADIRTGADLRQWYWRKDELVAHARTLGLKRSGAKFT
FT                   ILDRIAHFLDTGARDLPEAPAPKPTSDFDWHSAKLTPDTILTDSYKNTQNVRRFFKAQL
FT                   GPRFAFSIPLMAWLKENSGKTLSDACAVWRDLQAERRRPGWQSDIKGHNQFNQYTRDFL
FT                   AAHPDLGMDDVRRVWARKIQQPSPDGRHIYEPSDLDL"
FT   gene            complement(662214..662705)
FT                   /locus_tag="Jann_0689"
FT   CDS_pept        complement(662214..662705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53606"
FT                   /db_xref="GOA:Q28UK6"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK6"
FT                   /protein_id="ABD53606.1"
FT                   /translation="MAVWQLFSPCSDAASCGPPHSRPEVGPMEWVKVLHLLCVLGWMTG
FT                   IFAAPRAIIFWKREWAAQGTFGPTGDLTIRIYRFSLGLGVIAILSGLYLAHLWGWPAWT
FT                   HAKITVVALLAAHYGWTGRLVLRARKGIFTESDRWLRVYNEISVLGAIGVLILVVYKPF
FT                   "
FT   gene            662764..664209
FT                   /locus_tag="Jann_0690"
FT   CDS_pept        662764..664209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0690"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53607"
FT                   /db_xref="GOA:Q28UK5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK5"
FT                   /protein_id="ABD53607.1"
FT                   /translation="MQMPTPDARVLARKARIVERLLTVLPKTAVIHEDAETKAYECDAL
FT                   TAYRCPPLAAILPSSTEEVAAALKICHEEGVPVVPRGAGTSLAGGSLPTADSVILGVAR
FT                   MNQVLETDYENRVIRVQSGRTNLSVTGAVEAEEFFYAPDPSSQLACAIAGNIAMNSGGA
FT                   HCLKYGVTTNNLLGVKLVTMEGDVLEIGGAHLDSGNYDLLGLICGSEGQLGVVTEATLR
FT                   ILRKPEGARPVLIGFDSNEVAGACVSDIIKAGVLPVAIEFMDRPILEIAENHAKAGYPD
FT                   CEAVLIVEVEGSPSEIDAQLGLIKQIARSHNPVDLREAETAEEAARIWLGRKSAFGAVG
FT                   QVADYMCLDGTIPVGELPRVLTGIKEIGDKYGLKVGNVFHAGDGNMHPLIMFDANKPGD
FT                   LELCEACGADILRLCVEVGGCLTGEHGVGVEKRDLMGAQFTDADMEAQMRVKDVFDPAW
FT                   LLNPAKVFPLETSQGRRERNFAA"
FT   gene            664348..665493
FT                   /locus_tag="Jann_0691"
FT   CDS_pept        664348..665493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0691"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53608"
FT                   /db_xref="GOA:Q28UK4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK4"
FT                   /protein_id="ABD53608.1"
FT                   /translation="MLSPASEAELAGLVKGAQGPLRVVGGGTRSIGGVGPGEVLSLSDM
FT                   VGIEMYDPGAMTLVAKAGTPLEDIEAALAAENQMLAFEPADMRALLGRDGASTIGGVVA
FT                   ANAAGPRRLQAGACRDALLGVRFVDGRGEILKNGGRVMKNVTGYDLVKLMAGSYGTLGV
FT                   ISEVALRVLPKLNGATLTVRGGDALAIMTEAMMSPFDVSGAAAVPGEGTFLRLEGLEVS
FT                   VQYRVEQLSALLGKMGVVEVISDPDASAALWTRLRDVTDFADGTSAVWRVSMKPSDLMT
FT                   RRVPDLGGDLDVQYDWAGGLAWMRMADGAEDAQIVERHGAIQAAVTANGGGHATLFKAP
FT                   DAVHAHVCAFQPEPPGVAALSKGLRVQFDPRGILNPGLMGA"
FT   gene            665493..665822
FT                   /locus_tag="Jann_0692"
FT   CDS_pept        665493..665822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53609"
FT                   /db_xref="GOA:Q28UK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK3"
FT                   /protein_id="ABD53609.1"
FT                   /translation="MWDIFAIMGVTCALCAVGLSLIMTSHGQGAAIMSVFTVAALVGLF
FT                   ALDGRPGMLLAFGAGAGVFGCAAAIGTFRFWHGGTPLARAGLTLAILAGLAATLGLAAY
FT                   LAIPR"
FT   gene            665889..667229
FT                   /locus_tag="Jann_0693"
FT   CDS_pept        665889..667229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0693"
FT                   /product="protein of unknown function DUF224"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53610"
FT                   /db_xref="GOA:Q28UK2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK2"
FT                   /protein_id="ABD53610.1"
FT                   /translation="MQTTFTPEQLKDPATARSNEILRTCVHCGFCTATCPTYQVLGDEL
FT                   DSPRGRIYLIKDMMENDRPADEKTVKHIDRCLSCLACMTTCPSGVHYMHLVDHAREYIE
FT                   QTYKRPWFERVLRWTLARILPYPTRFRLALLGAKIGRPFARLMPDARLRAMLDMAPDYI
FT                   PPVSRNDDPQTFPVSGPAAQKKMRVALMTGCAQKALNTDINDATIRILTRLGAEVVVAE
FT                   GAGCCGALTHHMGKTSESHGTAAKNIRAWANEMRGEGLDAIVINTSGCGTTVKDYGHMF
FT                   REDAKLAEDAKAVAGLAKDISEVLIDLMPEDAVQKNGDGLRVAYHAACSLQHGQQIKTY
FT                   PKDLLKRAGFKVLEPADSHLCCGSAGTYNLMQPEISGQLKERKVQTLEATRPDIISAGN
FT                   IGCMMQIGGGTDVPIVHTVELLDWATGGPRPPALDRHRDAPAVPMLR"
FT   gene            667320..668174
FT                   /locus_tag="Jann_0694"
FT   CDS_pept        667320..668174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0694"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53611"
FT                   /db_xref="GOA:Q28UK1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK1"
FT                   /protein_id="ABD53611.1"
FT                   /translation="MKRGFVWGVVCALSVVFGVNGAQAQGLPQVQMTEGHGALRAVNGG
FT                   TEAQLWRAVGRLDTGASFCSATLIRDDLVLTAAHCVFHPETSRPFEASDLTFLAGLRNG
FT                   HAEAIRAVRRIMVLPEYRPESGPDFDMIGRDIALLQLALPISMTSIVPISVARTPWREG
FT                   RVTVVSYGREREEFASIEEGCEILDRQGTVRSLSCEVVSGASGSPVLRVNQGRAEVVAV
FT                   MSASAEMRTGGDISLAVTLDRHLTTLMAQAQGAATGNLGGVRSFITPGEGARDDIGARF
FT                   IRP"
FT   gene            668341..668802
FT                   /locus_tag="Jann_0695"
FT   CDS_pept        668341..668802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0695"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53612"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UK0"
FT                   /protein_id="ABD53612.1"
FT                   /translation="MRTYDFSPLYRATVGFDRVADMLDRVLTQDASQSTYPPYNIEKLD
FT                   ENSYRISVAVAGFSDADLNVEQREHQLVVSAKREKDEDARTYLHRGIATRVFEKRFQLA
FT                   DHVRVTGAVAEHGMLHIDLMREVPEALKPRRIEIGNSNAKAIEGDTVDA"
FT   gene            complement(668951..669829)
FT                   /locus_tag="Jann_0696"
FT   CDS_pept        complement(668951..669829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53613"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UJ9"
FT                   /protein_id="ABD53613.1"
FT                   /translation="MNFETLSSFKAAPAASFGKGPFAVLIAEDRVELASTLDHLRSLGF
FT                   AAIFLLAPDEMKVPDAPPDDPCTQHIIRHPSRQPGAAQAIVNALIEKAPGAWIHYCYNG
FT                   EYLFYPFCEDRTVGELVTWVMEERRASVLTYVVDLYAGDLAAHPNAVDLDGALLDSSGY
FT                   YAETRRGGGEAKEVMERQLNFYGGLRWRFEEHVATPKRRIDRVGLFQAAPGLALRDDHT
FT                   LSDEELNTYTCPWHHSLSASICSFRVAKALRTNPGSRHDIPDFRWHKSVQFHWSSMQLM
FT                   ELGLMEPGQWF"
FT   gene            669900..671288
FT                   /locus_tag="Jann_0697"
FT   CDS_pept        669900..671288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0697"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53614"
FT                   /db_xref="GOA:Q28UJ8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q28UJ8"
FT                   /protein_id="ABD53614.1"
FT                   /translation="MIEVSAVAGYTPSVEISLTPREAPQMTKKLFVKTYGCQMNVYDSE
FT                   RMAEALGGEGYEQVNTPEGADMILLNTCHIREKAAEKMYSELGRLRPLRDANPDLKIGV
FT                   AGCVAQAEGEEIMRRQPLVDLVVGPQTYHRLPKMMEAVNAGEKALDTDFPEEDKFLNLP
FT                   KARATRGPTAFLTVQEGCDKFCAFCVVPYTRGAEVSRSAERLMAEARDLVDRGVREITL
FT                   LGQNVNAYHGAGDGGTWGLARLIREMAKIDGLDRIRFTTSHPNDMEDDLIAAHGDCPEL
FT                   MPYLHLPVQAGSDKILKAMNRKHTAADYIRLIDRIRDARPDLHLSGDFIVGFPGETEED
FT                   FQATLDLVETVGYGTAYSFKYSARPGTPAAERTGQVSEAEASDRLQRLQALLTQQQRAA
FT                   QDAMVGRRVKVLFEKPGRNPGQMIGKSEYLHSVHVDGPDTLRGQIAEVEIAESKTNSLT
FT                   GRLV"
FT   gene            671646..672233
FT                   /locus_tag="Jann_0698"
FT   CDS_pept        671646..672233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0698"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53615"
FT                   /db_xref="GOA:Q28UJ7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UJ7"
FT                   /protein_id="ABD53615.1"
FT                   /translation="MINALTRGLARVFAGSLGMTALGVGAFVVTATPAAAQQQIIITGQ
FT                   VQPGLWVDPDGCLHWVADGGIEGYMEGRVNPENGMPVCLDVNPCGVANTDTMFQSGSAR
FT                   LTGSGRQYLQQFFAGAGAYAYAIYGHTDSRASDEYNMRLSERRAAAVANVARSVGARVA
FT                   REIGYGERRPVAPNDSAANMQRNRRVEIVCYR"
FT   gene            672254..672619
FT                   /locus_tag="Jann_0699"
FT   CDS_pept        672254..672619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53616"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UJ6"
FT                   /protein_id="ABD53616.1"
FT                   /translation="MTVFKRPLLIAAPLALMGCVESFEGAVAPRVGPNGEPPVVAIGED
FT                   QGRDAGSLSRLEAGIYIDPDGCHIWMIDDGLEGYWSRRLDPRSGLPVCTEPAPRGSIIG
FT                   DYSSGSPGIRDRVPRLN"
FT   gene            672758..673879
FT                   /locus_tag="Jann_0700"
FT   CDS_pept        672758..673879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0700"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABD53617"
FT                   /db_xref="GOA:Q28UJ5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28UJ5"
FT                   /protein_id="ABD53617.1"
FT                   /translation="MACGQVPRRGPDSGLQAPRVIRAASARPEKSLAINTLPPSDPSDT
FT                   TSATPESLEHTIEFSNNRLLIELCGEYDRNLAQVEQLLSVQINRRGNLLAILGEARDRA
FT                   AEVLQVLYERLEQGKSVEPGDIDAAVRMGGSADGTGVRDGDQIEMFKGGTLEIGTRKKT
FT                   VEPRTQAQQDYVRALYDNELAFGIGPAGTGKTYIAVAVAVNQMMSGHVDKIILSRPAVE
FT                   AGERLGFLPGDMKDKVDPYMQPLYDALNDFLPGKQLAKLLEEKTIEIAPLAFMRGRTLS
FT                   NAYVVLDEAQNATSMQMKMFLTRLGQGSRMVITGDRTQVDLPRGVTSGLSDAERILKAV
FT                   PGISFNYFTAKDVVRHHMVAKIIQAYDKDGPVG"
FT   gene            complement(673883..674359)
FT                   /locus_tag="Jann_0701"
FT   CDS_pept        complement(673883..674359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Jann_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Jann_0701"
FT