(data stored in ACNUC10821 zone)

EMBL: CP000266

ID   CP000266; SV 1; circular; genomic DNA; STD; PRO; 4574284 BP.
XX
AC   CP000266;
XX
PR   Project:PRJNA16375;
XX
DT   22-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Shigella flexneri 5 str. 8401, complete genome.
XX
KW   .
XX
OS   Shigella flexneri 5 str. 8401
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Shigella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4574284
RX   DOI; 10.1186/1471-2164-7-173.
RX   PUBMED; 16822325.
RA   Nie H., Yang F., Zhang X., Yang J., Chen L., Wang J., Xiong Z., Peng J.,
RA   Sun L., Dong J., Xue Y., Xu X., Chen S., Yao Z., Shen Y., Jin Q.;
RT   "Complete genome sequence of Shigella flexneri 5b and comparison with
RT   Shigella flexneri 2a";
RL   BMC Genomics 7:173-173(2006).
XX
RN   [2]
RP   1-4574284
RA   Nie H., Jin Q.;
RT   ;
RL   Submitted (22-FEB-2006) to the INSDC.
RL   State Key Laboratory for Moleclular Virology and Genetic Engineering,
RL   Microbial Genome Center of Chinese Ministry of Public Health, 100 YingXin
RL   Street, XuanWu, Beijing, Beijing 100052, China
XX
DR   MD5; 0148b0ab929c6257526f15101758fdb7.
DR   BioSample; SAMN02603604.
DR   EnsemblGenomes-Gn; EBG00001198252.
DR   EnsemblGenomes-Gn; EBG00001198253.
DR   EnsemblGenomes-Gn; EBG00001198254.
DR   EnsemblGenomes-Gn; EBG00001198255.
DR   EnsemblGenomes-Gn; EBG00001198256.
DR   EnsemblGenomes-Gn; EBG00001198257.
DR   EnsemblGenomes-Gn; EBG00001198258.
DR   EnsemblGenomes-Gn; EBG00001198259.
DR   EnsemblGenomes-Gn; EBG00001198260.
DR   EnsemblGenomes-Gn; EBG00001198261.
DR   EnsemblGenomes-Gn; EBG00001198262.
DR   EnsemblGenomes-Gn; EBG00001198263.
DR   EnsemblGenomes-Gn; EBG00001198264.
DR   EnsemblGenomes-Gn; EBG00001198265.
DR   EnsemblGenomes-Gn; EBG00001198266.
DR   EnsemblGenomes-Gn; EBG00001198267.
DR   EnsemblGenomes-Gn; EBG00001198268.
DR   EnsemblGenomes-Gn; EBG00001198269.
DR   EnsemblGenomes-Gn; EBG00001198270.
DR   EnsemblGenomes-Gn; EBG00001198271.
DR   EnsemblGenomes-Gn; EBG00001198272.
DR   EnsemblGenomes-Gn; EBG00001198273.
DR   EnsemblGenomes-Gn; EBG00001198274.
DR   EnsemblGenomes-Gn; EBG00001198275.
DR   EnsemblGenomes-Gn; EBG00001198276.
DR   EnsemblGenomes-Gn; EBG00001198277.
DR   EnsemblGenomes-Gn; EBG00001198278.
DR   EnsemblGenomes-Gn; EBG00001198279.
DR   EnsemblGenomes-Gn; EBG00001198280.
DR   EnsemblGenomes-Gn; EBG00001198281.
DR   EnsemblGenomes-Gn; EBG00001198282.
DR   EnsemblGenomes-Gn; EBG00001198283.
DR   EnsemblGenomes-Gn; EBG00001198284.
DR   EnsemblGenomes-Gn; EBG00001198285.
DR   EnsemblGenomes-Gn; EBG00001198286.
DR   EnsemblGenomes-Gn; EBG00001198287.
DR   EnsemblGenomes-Gn; EBG00001198288.
DR   EnsemblGenomes-Gn; EBG00001198289.
DR   EnsemblGenomes-Gn; EBG00001198290.
DR   EnsemblGenomes-Gn; EBG00001198291.
DR   EnsemblGenomes-Gn; EBG00001198292.
DR   EnsemblGenomes-Gn; EBG00001198293.
DR   EnsemblGenomes-Gn; EBG00001198294.
DR   EnsemblGenomes-Gn; EBG00001198295.
DR   EnsemblGenomes-Gn; EBG00001198296.
DR   EnsemblGenomes-Gn; EBG00001198297.
DR   EnsemblGenomes-Gn; EBG00001198298.
DR   EnsemblGenomes-Gn; EBG00001198299.
DR   EnsemblGenomes-Gn; EBG00001198300.
DR   EnsemblGenomes-Gn; EBG00001198301.
DR   EnsemblGenomes-Gn; EBG00001198302.
DR   EnsemblGenomes-Gn; EBG00001198303.
DR   EnsemblGenomes-Gn; EBG00001198304.
DR   EnsemblGenomes-Gn; EBG00001198305.
DR   EnsemblGenomes-Gn; EBG00001198306.
DR   EnsemblGenomes-Gn; EBG00001198307.
DR   EnsemblGenomes-Gn; EBG00001198308.
DR   EnsemblGenomes-Gn; EBG00001198309.
DR   EnsemblGenomes-Gn; EBG00001198310.
DR   EnsemblGenomes-Gn; EBG00001198311.
DR   EnsemblGenomes-Gn; EBG00001198312.
DR   EnsemblGenomes-Gn; EBG00001198313.
DR   EnsemblGenomes-Gn; EBG00001198314.
DR   EnsemblGenomes-Gn; EBG00001198315.
DR   EnsemblGenomes-Gn; EBG00001198316.
DR   EnsemblGenomes-Gn; EBG00001198317.
DR   EnsemblGenomes-Gn; EBG00001198318.
DR   EnsemblGenomes-Gn; EBG00001198319.
DR   EnsemblGenomes-Gn; EBG00001198320.
DR   EnsemblGenomes-Gn; EBG00001198321.
DR   EnsemblGenomes-Gn; EBG00001198322.
DR   EnsemblGenomes-Gn; EBG00001198323.
DR   EnsemblGenomes-Gn; EBG00001198324.
DR   EnsemblGenomes-Gn; EBG00001198325.
DR   EnsemblGenomes-Gn; EBG00001198326.
DR   EnsemblGenomes-Gn; EBG00001198327.
DR   EnsemblGenomes-Gn; EBG00001198328.
DR   EnsemblGenomes-Gn; EBG00001198329.
DR   EnsemblGenomes-Gn; EBG00001198330.
DR   EnsemblGenomes-Gn; EBG00001198331.
DR   EnsemblGenomes-Gn; EBG00001198332.
DR   EnsemblGenomes-Gn; EBG00001198333.
DR   EnsemblGenomes-Gn; EBG00001198334.
DR   EnsemblGenomes-Gn; EBG00001198335.
DR   EnsemblGenomes-Gn; EBG00001198336.
DR   EnsemblGenomes-Gn; EBG00001198337.
DR   EnsemblGenomes-Gn; EBG00001198338.
DR   EnsemblGenomes-Gn; EBG00001198339.
DR   EnsemblGenomes-Gn; EBG00001198340.
DR   EnsemblGenomes-Gn; EBG00001198341.
DR   EnsemblGenomes-Gn; EBG00001198342.
DR   EnsemblGenomes-Gn; EBG00001198343.
DR   EnsemblGenomes-Gn; EBG00001198344.
DR   EnsemblGenomes-Gn; EBG00001198345.
DR   EnsemblGenomes-Gn; EBG00001198346.
DR   EnsemblGenomes-Gn; EBG00001198347.
DR   EnsemblGenomes-Gn; EBG00001198348.
DR   EnsemblGenomes-Gn; EBG00001198349.
DR   EnsemblGenomes-Gn; EBG00001198350.
DR   EnsemblGenomes-Gn; EBG00001198351.
DR   EnsemblGenomes-Gn; EBG00001198352.
DR   EnsemblGenomes-Gn; EBG00001198353.
DR   EnsemblGenomes-Gn; EBG00001198354.
DR   EnsemblGenomes-Gn; EBG00001198355.
DR   EnsemblGenomes-Gn; EBG00001198356.
DR   EnsemblGenomes-Gn; EBG00001198357.
DR   EnsemblGenomes-Gn; EBG00001198358.
DR   EnsemblGenomes-Gn; EBG00001198359.
DR   EnsemblGenomes-Gn; EBG00001198360.
DR   EnsemblGenomes-Gn; EBG00001198361.
DR   EnsemblGenomes-Gn; EBG00001198362.
DR   EnsemblGenomes-Gn; EBG00001198363.
DR   EnsemblGenomes-Gn; EBG00001198364.
DR   EnsemblGenomes-Gn; EBG00001198365.
DR   EnsemblGenomes-Gn; EBG00001198366.
DR   EnsemblGenomes-Gn; EBG00001198367.
DR   EnsemblGenomes-Gn; EBG00001198368.
DR   EnsemblGenomes-Gn; EBG00001198369.
DR   EnsemblGenomes-Gn; EBG00001198370.
DR   EnsemblGenomes-Gn; EBG00001198371.
DR   EnsemblGenomes-Gn; EBG00001198372.
DR   EnsemblGenomes-Gn; EBG00001198373.
DR   EnsemblGenomes-Gn; EBG00001198374.
DR   EnsemblGenomes-Gn; EBG00001198375.
DR   EnsemblGenomes-Gn; EBG00001198376.
DR   EnsemblGenomes-Gn; EBG00001198377.
DR   EnsemblGenomes-Gn; EBG00001198378.
DR   EnsemblGenomes-Gn; EBG00001198379.
DR   EnsemblGenomes-Gn; EBG00001198380.
DR   EnsemblGenomes-Gn; EBG00001198381.
DR   EnsemblGenomes-Gn; EBG00001198382.
DR   EnsemblGenomes-Gn; EBG00001198383.
DR   EnsemblGenomes-Gn; EBG00001198384.
DR   EnsemblGenomes-Gn; EBG00001198385.
DR   EnsemblGenomes-Gn; EBG00001198386.
DR   EnsemblGenomes-Gn; EBG00001198387.
DR   EnsemblGenomes-Gn; EBG00001198388.
DR   EnsemblGenomes-Gn; EBG00001198389.
DR   EnsemblGenomes-Gn; EBG00001198390.
DR   EnsemblGenomes-Gn; EBG00001198391.
DR   EnsemblGenomes-Gn; EBG00001198392.
DR   EnsemblGenomes-Gn; EBG00001198393.
DR   EnsemblGenomes-Gn; EBG00001198394.
DR   EnsemblGenomes-Gn; EBG00001198395.
DR   EnsemblGenomes-Gn; EBG00001198396.
DR   EnsemblGenomes-Gn; EBG00001198397.
DR   EnsemblGenomes-Gn; EBG00001198398.
DR   EnsemblGenomes-Gn; EBG00001198399.
DR   EnsemblGenomes-Gn; EBG00001198400.
DR   EnsemblGenomes-Gn; EBG00001198401.
DR   EnsemblGenomes-Gn; EBG00001198402.
DR   EnsemblGenomes-Gn; EBG00001198403.
DR   EnsemblGenomes-Gn; EBG00001198404.
DR   EnsemblGenomes-Gn; EBG00001198405.
DR   EnsemblGenomes-Gn; EBG00001198406.
DR   EnsemblGenomes-Gn; EBG00001198407.
DR   EnsemblGenomes-Gn; EBG00001198408.
DR   EnsemblGenomes-Gn; EBG00001198409.
DR   EnsemblGenomes-Gn; EBG00001198410.
DR   EnsemblGenomes-Gn; EBG00001198411.
DR   EnsemblGenomes-Gn; EBG00001198412.
DR   EnsemblGenomes-Gn; EBG00001198413.
DR   EnsemblGenomes-Gn; EBG00001198414.
DR   EnsemblGenomes-Gn; EBG00001198415.
DR   EnsemblGenomes-Gn; EBG00001198416.
DR   EnsemblGenomes-Gn; EBG00001198417.
DR   EnsemblGenomes-Gn; EBG00001198418.
DR   EnsemblGenomes-Gn; EBG00001198419.
DR   EnsemblGenomes-Gn; EBG00001198420.
DR   EnsemblGenomes-Gn; EBG00001198421.
DR   EnsemblGenomes-Gn; EBG00001198422.
DR   EnsemblGenomes-Gn; EBG00001198423.
DR   EnsemblGenomes-Gn; EBG00001198424.
DR   EnsemblGenomes-Gn; EBG00001198425.
DR   EnsemblGenomes-Gn; EBG00001198426.
DR   EnsemblGenomes-Gn; EBG00001198427.
DR   EnsemblGenomes-Gn; EBG00001198428.
DR   EnsemblGenomes-Gn; EBG00001198429.
DR   EnsemblGenomes-Gn; EBG00001198430.
DR   EnsemblGenomes-Gn; EBG00001198431.
DR   EnsemblGenomes-Gn; EBG00001198432.
DR   EnsemblGenomes-Gn; EBG00001198433.
DR   EnsemblGenomes-Gn; EBG00001198434.
DR   EnsemblGenomes-Gn; EBG00001198435.
DR   EnsemblGenomes-Gn; EBG00001198436.
DR   EnsemblGenomes-Gn; EBG00001198437.
DR   EnsemblGenomes-Gn; EBG00001198438.
DR   EnsemblGenomes-Gn; EBG00001198439.
DR   EnsemblGenomes-Gn; EBG00001198440.
DR   EnsemblGenomes-Gn; EBG00001198441.
DR   EnsemblGenomes-Gn; EBG00001198442.
DR   EnsemblGenomes-Gn; EBG00001198443.
DR   EnsemblGenomes-Gn; EBG00001198444.
DR   EnsemblGenomes-Gn; EBG00001198445.
DR   EnsemblGenomes-Gn; EBG00001198446.
DR   EnsemblGenomes-Gn; EBG00001198447.
DR   EnsemblGenomes-Gn; EBG00001198448.
DR   EnsemblGenomes-Gn; EBG00001198449.
DR   EnsemblGenomes-Gn; EBG00001198450.
DR   EnsemblGenomes-Gn; EBG00001198451.
DR   EnsemblGenomes-Gn; EBG00001198452.
DR   EnsemblGenomes-Gn; EBG00001198453.
DR   EnsemblGenomes-Gn; EBG00001198454.
DR   EnsemblGenomes-Gn; EBG00001198455.
DR   EnsemblGenomes-Gn; EBG00001198456.
DR   EnsemblGenomes-Gn; EBG00001198457.
DR   EnsemblGenomes-Gn; EBG00001198458.
DR   EnsemblGenomes-Gn; EBG00001198459.
DR   EnsemblGenomes-Gn; EBG00001198460.
DR   EnsemblGenomes-Gn; EBG00001198461.
DR   EnsemblGenomes-Gn; EBG00001198462.
DR   EnsemblGenomes-Gn; EBG00001198463.
DR   EnsemblGenomes-Gn; EBG00001198464.
DR   EnsemblGenomes-Gn; EBG00001198465.
DR   EnsemblGenomes-Gn; EBG00001198466.
DR   EnsemblGenomes-Gn; EBG00001198467.
DR   EnsemblGenomes-Gn; EBG00001198468.
DR   EnsemblGenomes-Gn; EBG00001198469.
DR   EnsemblGenomes-Gn; EBG00001198470.
DR   EnsemblGenomes-Gn; EBG00001198471.
DR   EnsemblGenomes-Gn; EBG00001198472.
DR   EnsemblGenomes-Gn; EBG00001198473.
DR   EnsemblGenomes-Gn; EBG00001198474.
DR   EnsemblGenomes-Gn; EBG00001198475.
DR   EnsemblGenomes-Gn; EBG00001198476.
DR   EnsemblGenomes-Gn; EBG00001198477.
DR   EnsemblGenomes-Gn; EBG00001198478.
DR   EnsemblGenomes-Gn; EBG00001198479.
DR   EnsemblGenomes-Gn; EBG00001198480.
DR   EnsemblGenomes-Gn; EBG00001198481.
DR   EnsemblGenomes-Gn; EBG00001198482.
DR   EnsemblGenomes-Gn; EBG00001198483.
DR   EnsemblGenomes-Gn; EBG00001198484.
DR   EnsemblGenomes-Gn; EBG00001198485.
DR   EnsemblGenomes-Gn; EBG00001198486.
DR   EnsemblGenomes-Gn; EBG00001198487.
DR   EnsemblGenomes-Gn; EBG00001198488.
DR   EnsemblGenomes-Gn; EBG00001198489.
DR   EnsemblGenomes-Gn; SFV_0185.
DR   EnsemblGenomes-Gn; SFV_0186.
DR   EnsemblGenomes-Gn; SFV_0187.
DR   EnsemblGenomes-Gn; SFV_0188.
DR   EnsemblGenomes-Gn; SFV_0189.
DR   EnsemblGenomes-Gn; SFV_0200.
DR   EnsemblGenomes-Gn; SFV_0284.
DR   EnsemblGenomes-Gn; SFV_0498.
DR   EnsemblGenomes-Gn; SFV_0591.
DR   EnsemblGenomes-Gn; SFV_0592.
DR   EnsemblGenomes-Gn; SFV_0593.
DR   EnsemblGenomes-Gn; SFV_0658.
DR   EnsemblGenomes-Gn; SFV_0659.
DR   EnsemblGenomes-Gn; SFV_0660.
DR   EnsemblGenomes-Gn; SFV_0661.
DR   EnsemblGenomes-Gn; SFV_0662.
DR   EnsemblGenomes-Gn; SFV_0663.
DR   EnsemblGenomes-Gn; SFV_0664.
DR   EnsemblGenomes-Gn; SFV_0729.
DR   EnsemblGenomes-Gn; SFV_0730.
DR   EnsemblGenomes-Gn; SFV_0731.
DR   EnsemblGenomes-Gn; SFV_0732.
DR   EnsemblGenomes-Gn; SFV_0874.
DR   EnsemblGenomes-Gn; SFV_0980.
DR   EnsemblGenomes-Gn; SFV_1043.
DR   EnsemblGenomes-Gn; SFV_1244.
DR   EnsemblGenomes-Gn; SFV_1364.
DR   EnsemblGenomes-Gn; SFV_1365.
DR   EnsemblGenomes-Gn; SFV_1366.
DR   EnsemblGenomes-Gn; SFV_1367.
DR   EnsemblGenomes-Gn; SFV_1538.
DR   EnsemblGenomes-Gn; SFV_1539.
DR   EnsemblGenomes-Gn; SFV_1687.
DR   EnsemblGenomes-Gn; SFV_1688.
DR   EnsemblGenomes-Gn; SFV_1888.
DR   EnsemblGenomes-Gn; SFV_1889.
DR   EnsemblGenomes-Gn; SFV_1890.
DR   EnsemblGenomes-Gn; SFV_1891.
DR   EnsemblGenomes-Gn; SFV_1953.
DR   EnsemblGenomes-Gn; SFV_1954.
DR   EnsemblGenomes-Gn; SFV_1955.
DR   EnsemblGenomes-Gn; SFV_2030.
DR   EnsemblGenomes-Gn; SFV_2031.
DR   EnsemblGenomes-Gn; SFV_2032.
DR   EnsemblGenomes-Gn; SFV_2033.
DR   EnsemblGenomes-Gn; SFV_2044.
DR   EnsemblGenomes-Gn; SFV_2046.
DR   EnsemblGenomes-Gn; SFV_2055.
DR   EnsemblGenomes-Gn; SFV_2058.
DR   EnsemblGenomes-Gn; SFV_2061.
DR   EnsemblGenomes-Gn; SFV_2267.
DR   EnsemblGenomes-Gn; SFV_2416.
DR   EnsemblGenomes-Gn; SFV_2452.
DR   EnsemblGenomes-Gn; SFV_2456.
DR   EnsemblGenomes-Gn; SFV_2457.
DR   EnsemblGenomes-Gn; SFV_2458.
DR   EnsemblGenomes-Gn; SFV_2651.
DR   EnsemblGenomes-Gn; SFV_2652.
DR   EnsemblGenomes-Gn; SFV_2653.
DR   EnsemblGenomes-Gn; SFV_2654.
DR   EnsemblGenomes-Gn; SFV_2700.
DR   EnsemblGenomes-Gn; SFV_2701.
DR   EnsemblGenomes-Gn; SFV_2702.
DR   EnsemblGenomes-Gn; SFV_2703.
DR   EnsemblGenomes-Gn; SFV_2810.
DR   EnsemblGenomes-Gn; SFV_2811.
DR   EnsemblGenomes-Gn; SFV_2812.
DR   EnsemblGenomes-Gn; SFV_2813.
DR   EnsemblGenomes-Gn; SFV_2846.
DR   EnsemblGenomes-Gn; SFV_2893.
DR   EnsemblGenomes-Gn; SFV_2894.
DR   EnsemblGenomes-Gn; SFV_2927.
DR   EnsemblGenomes-Gn; SFV_3026.
DR   EnsemblGenomes-Gn; SFV_3110.
DR   EnsemblGenomes-Gn; SFV_3201.
DR   EnsemblGenomes-Gn; SFV_3204.
DR   EnsemblGenomes-Gn; SFV_3294.
DR   EnsemblGenomes-Gn; SFV_3295.
DR   EnsemblGenomes-Gn; SFV_3296.
DR   EnsemblGenomes-Gn; SFV_3297.
DR   EnsemblGenomes-Gn; SFV_3298.
DR   EnsemblGenomes-Gn; SFV_3299.
DR   EnsemblGenomes-Gn; SFV_3542.
DR   EnsemblGenomes-Gn; SFV_3646.
DR   EnsemblGenomes-Gn; SFV_3647.
DR   EnsemblGenomes-Gn; SFV_3648.
DR   EnsemblGenomes-Gn; SFV_3649.
DR   EnsemblGenomes-Gn; SFV_3704.
DR   EnsemblGenomes-Gn; SFV_3705.
DR   EnsemblGenomes-Gn; SFV_3706.
DR   EnsemblGenomes-Gn; SFV_3707.
DR   EnsemblGenomes-Gn; SFV_3738.
DR   EnsemblGenomes-Gn; SFV_3739.
DR   EnsemblGenomes-Gn; SFV_3740.
DR   EnsemblGenomes-Gn; SFV_3741.
DR   EnsemblGenomes-Gn; SFV_3742.
DR   EnsemblGenomes-Gn; SFV_3743.
DR   EnsemblGenomes-Gn; SFV_3871.
DR   EnsemblGenomes-Gn; SFV_4041.
DR   EnsemblGenomes-Gn; SFV_4042.
DR   EnsemblGenomes-Gn; SFV_4043.
DR   EnsemblGenomes-Gn; SFV_4044.
DR   EnsemblGenomes-Gn; SFV_4048.
DR   EnsemblGenomes-Gn; SFV_4049.
DR   EnsemblGenomes-Gn; SFV_4050.
DR   EnsemblGenomes-Gn; SFV_4051.
DR   EnsemblGenomes-Gn; SFV_4079.
DR   EnsemblGenomes-Gn; SFV_4080.
DR   EnsemblGenomes-Gn; SFV_4081.
DR   EnsemblGenomes-Gn; SFV_4082.
DR   EnsemblGenomes-Gn; SFV_4228.
DR   EnsemblGenomes-Gn; SFV_4290.
DR   EnsemblGenomes-Gn; SFV_4320.
DR   EnsemblGenomes-Gn; SFV_4321.
DR   EnsemblGenomes-Gn; SFV_4322.
DR   EnsemblGenomes-Gn; SFV_4323.
DR   EnsemblGenomes-Gn; SFV_4402.
DR   EnsemblGenomes-Gn; SFV_4403.
DR   EnsemblGenomes-Gn; SFV_4404.
DR   EnsemblGenomes-Tr; EBT00001569223.
DR   EnsemblGenomes-Tr; EBT00001569225.
DR   EnsemblGenomes-Tr; EBT00001569226.
DR   EnsemblGenomes-Tr; EBT00001569227.
DR   EnsemblGenomes-Tr; EBT00001569228.
DR   EnsemblGenomes-Tr; EBT00001569229.
DR   EnsemblGenomes-Tr; EBT00001569230.
DR   EnsemblGenomes-Tr; EBT00001569231.
DR   EnsemblGenomes-Tr; EBT00001569233.
DR   EnsemblGenomes-Tr; EBT00001569235.
DR   EnsemblGenomes-Tr; EBT00001569237.
DR   EnsemblGenomes-Tr; EBT00001569239.
DR   EnsemblGenomes-Tr; EBT00001569240.
DR   EnsemblGenomes-Tr; EBT00001569242.
DR   EnsemblGenomes-Tr; EBT00001569244.
DR   EnsemblGenomes-Tr; EBT00001569246.
DR   EnsemblGenomes-Tr; EBT00001569248.
DR   EnsemblGenomes-Tr; EBT00001569250.
DR   EnsemblGenomes-Tr; EBT00001569252.
DR   EnsemblGenomes-Tr; EBT00001569254.
DR   EnsemblGenomes-Tr; EBT00001569256.
DR   EnsemblGenomes-Tr; EBT00001569258.
DR   EnsemblGenomes-Tr; EBT00001569260.
DR   EnsemblGenomes-Tr; EBT00001569262.
DR   EnsemblGenomes-Tr; EBT00001569266.
DR   EnsemblGenomes-Tr; EBT00001569267.
DR   EnsemblGenomes-Tr; EBT00001569269.
DR   EnsemblGenomes-Tr; EBT00001569271.
DR   EnsemblGenomes-Tr; EBT00001569273.
DR   EnsemblGenomes-Tr; EBT00001569276.
DR   EnsemblGenomes-Tr; EBT00001569278.
DR   EnsemblGenomes-Tr; EBT00001569279.
DR   EnsemblGenomes-Tr; EBT00001569280.
DR   EnsemblGenomes-Tr; EBT00001569282.
DR   EnsemblGenomes-Tr; EBT00001569284.
DR   EnsemblGenomes-Tr; EBT00001569286.
DR   EnsemblGenomes-Tr; EBT00001569287.
DR   EnsemblGenomes-Tr; EBT00001569288.
DR   EnsemblGenomes-Tr; EBT00001569289.
DR   EnsemblGenomes-Tr; EBT00001569291.
DR   EnsemblGenomes-Tr; EBT00001569293.
DR   EnsemblGenomes-Tr; EBT00001569294.
DR   EnsemblGenomes-Tr; EBT00001569295.
DR   EnsemblGenomes-Tr; EBT00001569297.
DR   EnsemblGenomes-Tr; EBT00001569301.
DR   EnsemblGenomes-Tr; EBT00001569303.
DR   EnsemblGenomes-Tr; EBT00001569305.
DR   EnsemblGenomes-Tr; EBT00001569307.
DR   EnsemblGenomes-Tr; EBT00001569308.
DR   EnsemblGenomes-Tr; EBT00001569309.
DR   EnsemblGenomes-Tr; EBT00001569310.
DR   EnsemblGenomes-Tr; EBT00001569311.
DR   EnsemblGenomes-Tr; EBT00001569312.
DR   EnsemblGenomes-Tr; EBT00001569313.
DR   EnsemblGenomes-Tr; EBT00001569315.
DR   EnsemblGenomes-Tr; EBT00001569316.
DR   EnsemblGenomes-Tr; EBT00001569318.
DR   EnsemblGenomes-Tr; EBT00001569320.
DR   EnsemblGenomes-Tr; EBT00001569321.
DR   EnsemblGenomes-Tr; EBT00001569322.
DR   EnsemblGenomes-Tr; EBT00001569324.
DR   EnsemblGenomes-Tr; EBT00001569325.
DR   EnsemblGenomes-Tr; EBT00001569328.
DR   EnsemblGenomes-Tr; EBT00001569330.
DR   EnsemblGenomes-Tr; EBT00001569331.
DR   EnsemblGenomes-Tr; EBT00001569332.
DR   EnsemblGenomes-Tr; EBT00001569334.
DR   EnsemblGenomes-Tr; EBT00001569336.
DR   EnsemblGenomes-Tr; EBT00001569337.
DR   EnsemblGenomes-Tr; EBT00001569338.
DR   EnsemblGenomes-Tr; EBT00001569340.
DR   EnsemblGenomes-Tr; EBT00001569343.
DR   EnsemblGenomes-Tr; EBT00001569345.
DR   EnsemblGenomes-Tr; EBT00001569347.
DR   EnsemblGenomes-Tr; EBT00001569349.
DR   EnsemblGenomes-Tr; EBT00001569352.
DR   EnsemblGenomes-Tr; EBT00001569353.
DR   EnsemblGenomes-Tr; EBT00001569354.
DR   EnsemblGenomes-Tr; EBT00001569355.
DR   EnsemblGenomes-Tr; EBT00001569356.
DR   EnsemblGenomes-Tr; EBT00001569357.
DR   EnsemblGenomes-Tr; EBT00001569359.
DR   EnsemblGenomes-Tr; EBT00001569360.
DR   EnsemblGenomes-Tr; EBT00001569363.
DR   EnsemblGenomes-Tr; EBT00001569365.
DR   EnsemblGenomes-Tr; EBT00001569367.
DR   EnsemblGenomes-Tr; EBT00001569368.
DR   EnsemblGenomes-Tr; EBT00001569371.
DR   EnsemblGenomes-Tr; EBT00001569373.
DR   EnsemblGenomes-Tr; EBT00001569374.
DR   EnsemblGenomes-Tr; EBT00001569376.
DR   EnsemblGenomes-Tr; EBT00001569378.
DR   EnsemblGenomes-Tr; EBT00001569380.
DR   EnsemblGenomes-Tr; EBT00001569383.
DR   EnsemblGenomes-Tr; EBT00001569386.
DR   EnsemblGenomes-Tr; EBT00001569388.
DR   EnsemblGenomes-Tr; EBT00001569389.
DR   EnsemblGenomes-Tr; EBT00001569392.
DR   EnsemblGenomes-Tr; EBT00001569393.
DR   EnsemblGenomes-Tr; EBT00001569396.
DR   EnsemblGenomes-Tr; EBT00001569397.
DR   EnsemblGenomes-Tr; EBT00001569400.
DR   EnsemblGenomes-Tr; EBT00001569402.
DR   EnsemblGenomes-Tr; EBT00001569404.
DR   EnsemblGenomes-Tr; EBT00001569406.
DR   EnsemblGenomes-Tr; EBT00001569408.
DR   EnsemblGenomes-Tr; EBT00001569409.
DR   EnsemblGenomes-Tr; EBT00001569410.
DR   EnsemblGenomes-Tr; EBT00001569412.
DR   EnsemblGenomes-Tr; EBT00001569414.
DR   EnsemblGenomes-Tr; EBT00001569416.
DR   EnsemblGenomes-Tr; EBT00001569417.
DR   EnsemblGenomes-Tr; EBT00001569418.
DR   EnsemblGenomes-Tr; EBT00001569419.
DR   EnsemblGenomes-Tr; EBT00001569420.
DR   EnsemblGenomes-Tr; EBT00001569421.
DR   EnsemblGenomes-Tr; EBT00001569422.
DR   EnsemblGenomes-Tr; EBT00001569423.
DR   EnsemblGenomes-Tr; EBT00001569424.
DR   EnsemblGenomes-Tr; EBT00001569425.
DR   EnsemblGenomes-Tr; EBT00001569426.
DR   EnsemblGenomes-Tr; EBT00001569427.
DR   EnsemblGenomes-Tr; EBT00001569428.
DR   EnsemblGenomes-Tr; EBT00001569429.
DR   EnsemblGenomes-Tr; EBT00001569430.
DR   EnsemblGenomes-Tr; EBT00001569431.
DR   EnsemblGenomes-Tr; EBT00001569432.
DR   EnsemblGenomes-Tr; EBT00001569433.
DR   EnsemblGenomes-Tr; EBT00001569434.
DR   EnsemblGenomes-Tr; EBT00001569435.
DR   EnsemblGenomes-Tr; EBT00001569436.
DR   EnsemblGenomes-Tr; EBT00001569437.
DR   EnsemblGenomes-Tr; EBT00001569438.
DR   EnsemblGenomes-Tr; EBT00001569439.
DR   EnsemblGenomes-Tr; EBT00001569440.
DR   EnsemblGenomes-Tr; EBT00001569441.
DR   EnsemblGenomes-Tr; EBT00001569442.
DR   EnsemblGenomes-Tr; EBT00001569443.
DR   EnsemblGenomes-Tr; EBT00001569444.
DR   EnsemblGenomes-Tr; EBT00001569445.
DR   EnsemblGenomes-Tr; EBT00001569446.
DR   EnsemblGenomes-Tr; EBT00001569447.
DR   EnsemblGenomes-Tr; EBT00001569448.
DR   EnsemblGenomes-Tr; EBT00001569449.
DR   EnsemblGenomes-Tr; EBT00001569450.
DR   EnsemblGenomes-Tr; EBT00001569451.
DR   EnsemblGenomes-Tr; EBT00001569452.
DR   EnsemblGenomes-Tr; EBT00001569453.
DR   EnsemblGenomes-Tr; EBT00001569454.
DR   EnsemblGenomes-Tr; EBT00001569455.
DR   EnsemblGenomes-Tr; EBT00001569456.
DR   EnsemblGenomes-Tr; EBT00001569457.
DR   EnsemblGenomes-Tr; EBT00001569458.
DR   EnsemblGenomes-Tr; EBT00001569459.
DR   EnsemblGenomes-Tr; EBT00001569460.
DR   EnsemblGenomes-Tr; EBT00001569461.
DR   EnsemblGenomes-Tr; EBT00001569462.
DR   EnsemblGenomes-Tr; EBT00001569463.
DR   EnsemblGenomes-Tr; EBT00001569464.
DR   EnsemblGenomes-Tr; EBT00001569465.
DR   EnsemblGenomes-Tr; EBT00001569466.
DR   EnsemblGenomes-Tr; EBT00001569467.
DR   EnsemblGenomes-Tr; EBT00001569468.
DR   EnsemblGenomes-Tr; EBT00001569469.
DR   EnsemblGenomes-Tr; EBT00001569470.
DR   EnsemblGenomes-Tr; EBT00001569471.
DR   EnsemblGenomes-Tr; EBT00001569472.
DR   EnsemblGenomes-Tr; EBT00001569473.
DR   EnsemblGenomes-Tr; EBT00001569474.
DR   EnsemblGenomes-Tr; EBT00001569475.
DR   EnsemblGenomes-Tr; EBT00001569476.
DR   EnsemblGenomes-Tr; EBT00001569477.
DR   EnsemblGenomes-Tr; EBT00001569478.
DR   EnsemblGenomes-Tr; EBT00001569479.
DR   EnsemblGenomes-Tr; EBT00001569480.
DR   EnsemblGenomes-Tr; EBT00001569481.
DR   EnsemblGenomes-Tr; EBT00001569482.
DR   EnsemblGenomes-Tr; EBT00001569483.
DR   EnsemblGenomes-Tr; EBT00001569484.
DR   EnsemblGenomes-Tr; EBT00001569485.
DR   EnsemblGenomes-Tr; EBT00001569486.
DR   EnsemblGenomes-Tr; EBT00001569487.
DR   EnsemblGenomes-Tr; EBT00001569488.
DR   EnsemblGenomes-Tr; EBT00001569489.
DR   EnsemblGenomes-Tr; EBT00001569490.
DR   EnsemblGenomes-Tr; EBT00001569491.
DR   EnsemblGenomes-Tr; EBT00001569492.
DR   EnsemblGenomes-Tr; EBT00001569493.
DR   EnsemblGenomes-Tr; EBT00001569494.
DR   EnsemblGenomes-Tr; EBT00001569495.
DR   EnsemblGenomes-Tr; EBT00001569496.
DR   EnsemblGenomes-Tr; EBT00001569497.
DR   EnsemblGenomes-Tr; EBT00001569498.
DR   EnsemblGenomes-Tr; EBT00001569499.
DR   EnsemblGenomes-Tr; EBT00001569500.
DR   EnsemblGenomes-Tr; EBT00001569501.
DR   EnsemblGenomes-Tr; EBT00001569502.
DR   EnsemblGenomes-Tr; EBT00001569503.
DR   EnsemblGenomes-Tr; EBT00001569504.
DR   EnsemblGenomes-Tr; EBT00001569505.
DR   EnsemblGenomes-Tr; EBT00001569506.
DR   EnsemblGenomes-Tr; EBT00001569507.
DR   EnsemblGenomes-Tr; EBT00001569508.
DR   EnsemblGenomes-Tr; EBT00001569509.
DR   EnsemblGenomes-Tr; EBT00001569510.
DR   EnsemblGenomes-Tr; EBT00001569511.
DR   EnsemblGenomes-Tr; EBT00001569512.
DR   EnsemblGenomes-Tr; EBT00001569513.
DR   EnsemblGenomes-Tr; EBT00001569514.
DR   EnsemblGenomes-Tr; EBT00001569515.
DR   EnsemblGenomes-Tr; EBT00001569516.
DR   EnsemblGenomes-Tr; EBT00001569517.
DR   EnsemblGenomes-Tr; EBT00001569518.
DR   EnsemblGenomes-Tr; EBT00001569519.
DR   EnsemblGenomes-Tr; EBT00001569520.
DR   EnsemblGenomes-Tr; EBT00001569521.
DR   EnsemblGenomes-Tr; EBT00001569522.
DR   EnsemblGenomes-Tr; EBT00001569523.
DR   EnsemblGenomes-Tr; EBT00001569524.
DR   EnsemblGenomes-Tr; EBT00001569525.
DR   EnsemblGenomes-Tr; EBT00001569526.
DR   EnsemblGenomes-Tr; EBT00001569527.
DR   EnsemblGenomes-Tr; EBT00001569528.
DR   EnsemblGenomes-Tr; EBT00001569529.
DR   EnsemblGenomes-Tr; EBT00001569530.
DR   EnsemblGenomes-Tr; EBT00001569531.
DR   EnsemblGenomes-Tr; EBT00001569532.
DR   EnsemblGenomes-Tr; EBT00001569533.
DR   EnsemblGenomes-Tr; EBT00001569534.
DR   EnsemblGenomes-Tr; EBT00001569535.
DR   EnsemblGenomes-Tr; EBT00001569536.
DR   EnsemblGenomes-Tr; EBT00001569537.
DR   EnsemblGenomes-Tr; EBT00001569538.
DR   EnsemblGenomes-Tr; EBT00001569539.
DR   EnsemblGenomes-Tr; EBT00001569540.
DR   EnsemblGenomes-Tr; EBT00001569541.
DR   EnsemblGenomes-Tr; EBT00001569542.
DR   EnsemblGenomes-Tr; EBT00001569543.
DR   EnsemblGenomes-Tr; SFV_0185-1.
DR   EnsemblGenomes-Tr; SFV_0186-1.
DR   EnsemblGenomes-Tr; SFV_0187-1.
DR   EnsemblGenomes-Tr; SFV_0188-1.
DR   EnsemblGenomes-Tr; SFV_0189-1.
DR   EnsemblGenomes-Tr; SFV_0200-1.
DR   EnsemblGenomes-Tr; SFV_0284-1.
DR   EnsemblGenomes-Tr; SFV_0498-1.
DR   EnsemblGenomes-Tr; SFV_0591-1.
DR   EnsemblGenomes-Tr; SFV_0592-1.
DR   EnsemblGenomes-Tr; SFV_0593-1.
DR   EnsemblGenomes-Tr; SFV_0658-1.
DR   EnsemblGenomes-Tr; SFV_0659-1.
DR   EnsemblGenomes-Tr; SFV_0660-1.
DR   EnsemblGenomes-Tr; SFV_0661-1.
DR   EnsemblGenomes-Tr; SFV_0662-1.
DR   EnsemblGenomes-Tr; SFV_0663-1.
DR   EnsemblGenomes-Tr; SFV_0664-1.
DR   EnsemblGenomes-Tr; SFV_0729-1.
DR   EnsemblGenomes-Tr; SFV_0730-1.
DR   EnsemblGenomes-Tr; SFV_0731-1.
DR   EnsemblGenomes-Tr; SFV_0732-1.
DR   EnsemblGenomes-Tr; SFV_0874-1.
DR   EnsemblGenomes-Tr; SFV_0980-1.
DR   EnsemblGenomes-Tr; SFV_1043-1.
DR   EnsemblGenomes-Tr; SFV_1244-1.
DR   EnsemblGenomes-Tr; SFV_1364-1.
DR   EnsemblGenomes-Tr; SFV_1365-1.
DR   EnsemblGenomes-Tr; SFV_1366-1.
DR   EnsemblGenomes-Tr; SFV_1367-1.
DR   EnsemblGenomes-Tr; SFV_1538-1.
DR   EnsemblGenomes-Tr; SFV_1539-1.
DR   EnsemblGenomes-Tr; SFV_1687-1.
DR   EnsemblGenomes-Tr; SFV_1688-1.
DR   EnsemblGenomes-Tr; SFV_1888-1.
DR   EnsemblGenomes-Tr; SFV_1889-1.
DR   EnsemblGenomes-Tr; SFV_1890-1.
DR   EnsemblGenomes-Tr; SFV_1891-1.
DR   EnsemblGenomes-Tr; SFV_1953-1.
DR   EnsemblGenomes-Tr; SFV_1954-1.
DR   EnsemblGenomes-Tr; SFV_1955-1.
DR   EnsemblGenomes-Tr; SFV_2030-1.
DR   EnsemblGenomes-Tr; SFV_2031-1.
DR   EnsemblGenomes-Tr; SFV_2032-1.
DR   EnsemblGenomes-Tr; SFV_2033-1.
DR   EnsemblGenomes-Tr; SFV_2044-1.
DR   EnsemblGenomes-Tr; SFV_2046-1.
DR   EnsemblGenomes-Tr; SFV_2055-1.
DR   EnsemblGenomes-Tr; SFV_2058-1.
DR   EnsemblGenomes-Tr; SFV_2061-1.
DR   EnsemblGenomes-Tr; SFV_2267-1.
DR   EnsemblGenomes-Tr; SFV_2416-1.
DR   EnsemblGenomes-Tr; SFV_2452-1.
DR   EnsemblGenomes-Tr; SFV_2456-1.
DR   EnsemblGenomes-Tr; SFV_2457-1.
DR   EnsemblGenomes-Tr; SFV_2458-1.
DR   EnsemblGenomes-Tr; SFV_2651-1.
DR   EnsemblGenomes-Tr; SFV_2652-1.
DR   EnsemblGenomes-Tr; SFV_2653-1.
DR   EnsemblGenomes-Tr; SFV_2654-1.
DR   EnsemblGenomes-Tr; SFV_2700-1.
DR   EnsemblGenomes-Tr; SFV_2701-1.
DR   EnsemblGenomes-Tr; SFV_2702-1.
DR   EnsemblGenomes-Tr; SFV_2703-1.
DR   EnsemblGenomes-Tr; SFV_2810-1.
DR   EnsemblGenomes-Tr; SFV_2811-1.
DR   EnsemblGenomes-Tr; SFV_2812-1.
DR   EnsemblGenomes-Tr; SFV_2813-1.
DR   EnsemblGenomes-Tr; SFV_2846-1.
DR   EnsemblGenomes-Tr; SFV_2893-1.
DR   EnsemblGenomes-Tr; SFV_2894-1.
DR   EnsemblGenomes-Tr; SFV_2927-1.
DR   EnsemblGenomes-Tr; SFV_3026-1.
DR   EnsemblGenomes-Tr; SFV_3110-1.
DR   EnsemblGenomes-Tr; SFV_3201-1.
DR   EnsemblGenomes-Tr; SFV_3204-1.
DR   EnsemblGenomes-Tr; SFV_3294-1.
DR   EnsemblGenomes-Tr; SFV_3295-1.
DR   EnsemblGenomes-Tr; SFV_3296-1.
DR   EnsemblGenomes-Tr; SFV_3297-1.
DR   EnsemblGenomes-Tr; SFV_3298-1.
DR   EnsemblGenomes-Tr; SFV_3299-1.
DR   EnsemblGenomes-Tr; SFV_3542-1.
DR   EnsemblGenomes-Tr; SFV_3646-1.
DR   EnsemblGenomes-Tr; SFV_3647-1.
DR   EnsemblGenomes-Tr; SFV_3648-1.
DR   EnsemblGenomes-Tr; SFV_3649-1.
DR   EnsemblGenomes-Tr; SFV_3704-1.
DR   EnsemblGenomes-Tr; SFV_3705-1.
DR   EnsemblGenomes-Tr; SFV_3706-1.
DR   EnsemblGenomes-Tr; SFV_3707-1.
DR   EnsemblGenomes-Tr; SFV_3738-1.
DR   EnsemblGenomes-Tr; SFV_3739-1.
DR   EnsemblGenomes-Tr; SFV_3740-1.
DR   EnsemblGenomes-Tr; SFV_3741-1.
DR   EnsemblGenomes-Tr; SFV_3742-1.
DR   EnsemblGenomes-Tr; SFV_3743-1.
DR   EnsemblGenomes-Tr; SFV_3871-1.
DR   EnsemblGenomes-Tr; SFV_4041-1.
DR   EnsemblGenomes-Tr; SFV_4042-1.
DR   EnsemblGenomes-Tr; SFV_4043-1.
DR   EnsemblGenomes-Tr; SFV_4044-1.
DR   EnsemblGenomes-Tr; SFV_4048-1.
DR   EnsemblGenomes-Tr; SFV_4049-1.
DR   EnsemblGenomes-Tr; SFV_4050-1.
DR   EnsemblGenomes-Tr; SFV_4051-1.
DR   EnsemblGenomes-Tr; SFV_4079-1.
DR   EnsemblGenomes-Tr; SFV_4080-1.
DR   EnsemblGenomes-Tr; SFV_4081-1.
DR   EnsemblGenomes-Tr; SFV_4082-1.
DR   EnsemblGenomes-Tr; SFV_4228-1.
DR   EnsemblGenomes-Tr; SFV_4290-1.
DR   EnsemblGenomes-Tr; SFV_4320-1.
DR   EnsemblGenomes-Tr; SFV_4321-1.
DR   EnsemblGenomes-Tr; SFV_4322-1.
DR   EnsemblGenomes-Tr; SFV_4323-1.
DR   EnsemblGenomes-Tr; SFV_4402-1.
DR   EnsemblGenomes-Tr; SFV_4403-1.
DR   EnsemblGenomes-Tr; SFV_4404-1.
DR   EuropePMC; PMC1550401; 16822325.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC1855764; 17189357.
DR   EuropePMC; PMC2519331; 18539803.
DR   EuropePMC; PMC2580706; 18757531.
DR   EuropePMC; PMC2652037; 18660809.
DR   EuropePMC; PMC2806262; 20042119.
DR   EuropePMC; PMC2808357; 20098708.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3071730; 21483688.
DR   EuropePMC; PMC3218036; 22110755.
DR   EuropePMC; PMC3993495; 24452172.
DR   EuropePMC; PMC4229854; 24907032.
DR   GOA; P0C2L2.
DR   GOA; P0C5Z3.
DR   GOA; P0C888.
DR   InterPro; IPR011720; Thr_lead_pept.
DR   InterPro; IPR030159; LsrB.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00117; C0719.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00125; IS128.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000266.
DR   SILVA-SSU; CP000266.
DR   UniProtKB/Swiss-Prot; P0C2L2; GSID_SHIF8.
DR   UniProtKB/Swiss-Prot; P0C5Z3; LPT_SHIF8.
DR   UniProtKB/Swiss-Prot; P0C888; LSRB_SHIF8.
XX
CC   Strain 8401 is available from the National Institute for
CC   Communicable Disease Control and Prevention, Chinese Center for
CC   Disease Control and Prevention.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4574284
FT                   /organism="Shigella flexneri 5 str. 8401"
FT                   /strain="8401"
FT                   /serotype="5"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /isolation_source="epidemic"
FT                   /db_xref="taxon:373384"
FT   gene            336..2798
FT                   /gene="thrA"
FT                   /locus_tag="SFV_0001"
FT   CDS_pept        336..2798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="SFV_0001"
FT                   /product="aspartokinase I, homoserine dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02290"
FT                   /db_xref="GOA:Q0T8I6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8I6"
FT                   /protein_id="ABF02290.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMS
FT                   RARISVVLITQSSSEYSISFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVCGVANSKALLTSVHGLN
FT                   LENWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYAGFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRYAAEKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELVKFSGI
FT                   LSGSLSYIFGKLDEGMSFSEATTLAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELADIEIEPVLPAEFNAEGDVAAFMANLSQLDDLFAARVAKARDEGKVLRYVGNIDEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2800..3732
FT                   /gene="thrB"
FT                   /locus_tag="SFV_0002"
FT   CDS_pept        2800..3732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="SFV_0002"
FT                   /product="homoserine kinase"
FT                   /note="Code: E; COG: COG0083"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02291"
FT                   /db_xref="GOA:Q0T8I5"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8I5"
FT                   /protein_id="ABF02291.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVAPVDGALLGDVVTVEAAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
FT   gene            3733..5019
FT                   /gene="thrC"
FT                   /locus_tag="SFV_0003"
FT   CDS_pept        3733..5019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="SFV_0003"
FT                   /product="threonine synthase"
FT                   /note="Code: E; COG: COG0498"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02292"
FT                   /db_xref="GOA:Q0T8I4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8I4"
FT                   /protein_id="ABF02292.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDE
FT                   MLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHIADDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVVSVPSGNFGDLTAGLLAKSFGLPVKRFIAATNVNDTVPR
FT                   FLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTM
FT                   RELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKE
FT                   LAERADLPLLSHNLPADFSALRKLMMNHQ"
FT   gene            5242..5529
FT                   /locus_tag="SFV_0004"
FT   CDS_pept        5242..5529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02293"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8I3"
FT                   /protein_id="ABF02293.1"
FT                   /translation="MQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDG
FT                   GHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAPHDHHGGHGPGKHHR"
FT   gene            complement(5682..6458)
FT                   /gene="yaaA"
FT                   /locus_tag="SFV_0005"
FT   CDS_pept        complement(5682..6458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="SFV_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3022"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02294"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8I2"
FT                   /protein_id="ABF02294.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLAADEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEDSSSNGELVFKRYEQR"
FT   gene            complement(6528..8024)
FT                   /pseudo
FT                   /gene="yaaJ"
FT                   /locus_tag="SFV_0006"
FT                   /note="contains in-frame stop codon; original product:
FT                   inner membrane transport protein"
FT   gene            8240..9256
FT                   /gene="talB"
FT                   /locus_tag="SFV_0007"
FT   CDS_pept        8240..9256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="SFV_0007"
FT                   /product="transaldolase B"
FT                   /note="Code: G; COG: COG0176"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02295"
FT                   /db_xref="GOA:Q0T8I1"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8I1"
FT                   /protein_id="ABF02295.1"
FT                   /translation="MISSGQTGYIPLTSCLKRNTIMTDKLTSLRQYTTVVADTGDIAAM
FT                   KLYQPQDATTNPSLILNAAQIPEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGL
FT                   EILKLVPGRISTEVDARLSYDTEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRA
FT                   AEQLEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDP
FT                   GVVSVSEIYQYYKEHGYETVVMGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIE
FT                   RKLSYTGEVKARPARITESEFLWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL"
FT   gene            9368..9958
FT                   /gene="mog"
FT                   /locus_tag="SFV_0008"
FT   CDS_pept        9368..9958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="SFV_0008"
FT                   /product="predicted molybdochelatase"
FT                   /note="Code: H; COG: COG0521"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02296"
FT                   /db_xref="GOA:Q0T8I0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8I0"
FT                   /protein_id="ABF02296.1"
FT                   /translation="MMNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELET
FT                   RLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQM
FT                   RQISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASV
FT                   PYCIQLLEGPYVETAPEVVAAFRPKSARRDVSE"
FT   gene            complement(9993..10559)
FT                   /gene="yaaH"
FT                   /locus_tag="SFV_0009"
FT   CDS_pept        complement(9993..10559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="SFV_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1584"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02297"
FT                   /db_xref="GOA:Q0T8H9"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8H9"
FT                   /protein_id="ABF02297.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
FT   gene            complement(10708..11421)
FT                   /locus_tag="SFV_0010"
FT   CDS_pept        complement(10708..11421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0010"
FT                   /product="putative oxidoreductase"
FT                   /note="Code: S; COG: COG4735"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02298"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8H8"
FT                   /protein_id="ABF02298.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSILMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFVGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSTYRVTIPAV
FT                   LQIACLRRMVSATQV"
FT   gene            complement(11447..11851)
FT                   /gene="yaaI"
FT                   /locus_tag="SFV_0011"
FT   CDS_pept        complement(11447..11851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="SFV_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02299"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8H7"
FT                   /protein_id="ABF02299.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
FT   gene            12228..14144
FT                   /gene="dnaK"
FT                   /locus_tag="SFV_0012"
FT   CDS_pept        12228..14144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SFV_0012"
FT                   /product="chaperone Hsp70"
FT                   /note="DNA biosynthesis; Code: O; COG: COG0443"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02300"
FT                   /db_xref="GOA:Q0T8H6"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8H6"
FT                   /protein_id="ABF02300.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTIPRVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            14233..15363
FT                   /gene="dnaJ"
FT                   /locus_tag="SFV_0013"
FT   CDS_pept        14233..15363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SFV_0013"
FT                   /product="chaperone with DnaK"
FT                   /note="heat shock protein; Code: O; COG: COG0484"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02301"
FT                   /db_xref="GOA:Q0T8H5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8H5"
FT                   /protein_id="ABF02301.1"
FT                   /translation="MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG
FT                   GRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPT
FT                   CHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDT
FT                   GDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIE
FT                   VPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQL
FT                   LQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR"
FT   gene            16206..17372
FT                   /gene="nhaA"
FT                   /locus_tag="SFV_0014"
FT   CDS_pept        16206..17372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="SFV_0014"
FT                   /product="Na+/H antiporter, pH dependent"
FT                   /note="Code: P; COG: COG3004"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02302"
FT                   /db_xref="GOA:Q0T8H4"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8H4"
FT                   /protein_id="ABF02302.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETP
FT                   VQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVKRELMQGSLASLLQAAFPVIAAIGG
FT                   MIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLVLKIFLMALAIID
FT                   DLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGVRRTGVYILVGVVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTL
FT                   DGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKLAHLPEGTTYQQIMVVGILCGIGFT
FT                   MSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRPSV"
FT   gene            17438..18337
FT                   /gene="nhaR"
FT                   /locus_tag="SFV_0015"
FT   CDS_pept        17438..18337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="SFV_0015"
FT                   /product="transcriptional activator of nhaA"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02303"
FT                   /db_xref="GOA:Q0T8H3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8H3"
FT                   /protein_id="ABF02303.1"
FT                   /translation="MSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALEER
FT                   LQGKLFKRKGRGLEPSELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADALS
FT                   KRLVSSVLNAAVVEGEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSV
FT                   RIGECGVSFWCTNPPPEKPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILGEF
FT                   DDAALMKAFGAMHNAIFVAPTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQHPA
FT                   VQRICNTDYSALFSPAVR"
FT   mobile_element  complement(18735..19502)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(18750..19253)
FT                   /gene="insB"
FT                   /locus_tag="SFV_0016"
FT   CDS_pept        complement(18750..19253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0016"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02304"
FT                   /db_xref="GOA:Q0SXE9"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXE9"
FT                   /protein_id="ABF02304.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            19328..19531
FT                   /locus_tag="SFV_0017"
FT   CDS_pept        19328..19531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0017"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02305"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8H1"
FT                   /protein_id="ABF02305.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYLQGLMRRYL"
FT   gene            complement(19836..20099)
FT                   /gene="rpsT"
FT                   /locus_tag="SFV_0018"
FT   CDS_pept        complement(19836..20099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SFV_0018"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /note="Code: J; COG: COG0268"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02306"
FT                   /db_xref="GOA:Q0T8H0"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8H0"
FT                   /protein_id="ABF02306.1"
FT                   /translation="MANIKSAKKRAIQSEKARKIIASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            20428..21369
FT                   /gene="ribF"
FT                   /locus_tag="SFV_0019"
FT   CDS_pept        20428..21369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="SFV_0019"
FT                   /product="putative regulator"
FT                   /note="Code: H; COG: COG0196"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02307"
FT                   /db_xref="GOA:Q0T8G9"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8G9"
FT                   /protein_id="ABF02307.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVKHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
FT   gene            21460..24228
FT                   /gene="ileS"
FT                   /locus_tag="SFV_0020"
FT   CDS_pept        21460..24228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SFV_0020"
FT                   /product="isoleucine tRNA synthetase"
FT                   /note="Code: J; COG: COG0060"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02308"
FT                   /db_xref="GOA:Q0T8G8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8G8"
FT                   /protein_id="ABF02308.1"
FT                   /translation="MRGDLAKREPGMLARWTDDDLYGIIRAAKKGKKTFILHDGPPYAN
FT                   GSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIELKVEQEYGKPGEKFTAA
FT                   EFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEANIIRALGKIIGNGHLH
FT                   KGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDALKAKFAVSNVNGPISLV
FT                   IWTTTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESVMQRIGVTDYTILGTVK
FT                   GAELELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGPDDYVIGQKYGLETANP
FT                   VGPDGTYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKMQHSYPCCWRHKTPIIF
FT                   RATPQWFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVANRPDWCISRQRTWGVPM
FT                   SLFVHKDTEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEILGDEADQYVKVPDTLDV
FT                   WFDSGSTHFSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMISTAMKGKAPYRQVLTH
FT                   GFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYTGEMAVSDEILKRAADS
FT                   YRRIRNTARFLLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKAAQEDILKAYEAYDFHE
FT                   VVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTALYHIAEALVRWMAPILSF
FT                   TADEVWGYLPGEREKYVFTGEWYEGLFGLADSEAMNDAFWDELLKVRGEVNKVIEQARA
FT                   DKKVGGSLEAAVTLYAEPELAAKLTALGDELRFVLLTSGATVADYNDAPADAQQSEVLK
FT                   GLKVALSKAEGEKCPRCWHYTQDVGKVAEHAEICGRCVSNVAGDGEKRKFA"
FT   gene            24228..24722
FT                   /gene="lspA"
FT                   /locus_tag="SFV_0021"
FT   CDS_pept        24228..24722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="SFV_0021"
FT                   /product="prolipoprotein signal peptidase (SPase II)"
FT                   /note="Code: MU; COG: COG0597"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02309"
FT                   /db_xref="GOA:Q0T8G7"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8G7"
FT                   /protein_id="ABF02309.1"
FT                   /translation="MSQSICSTGLRWLWLVVIVLIIDLGSKYLILQNFALGDTVPLFPS
FT                   LNLHASAYYGAAFSFLADSGGWQRWFFAGIAIGISVLLAVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK
FT                   Q"
FT   gene            24809..25258
FT                   /gene="slpA"
FT                   /locus_tag="SFV_0022"
FT   CDS_pept        24809..25258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slpA"
FT                   /locus_tag="SFV_0022"
FT                   /product="probable FKBX-type 16KD peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /note="a rotamase; Code: O; COG: COG1047"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02310"
FT                   /db_xref="GOA:Q0T8G6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8G6"
FT                   /protein_id="ABF02310.1"
FT                   /translation="MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLS
FT                   EGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQYFSRREFMDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALEA"
FT   gene            25260..26210
FT                   /gene="lytB"
FT                   /locus_tag="SFV_0023"
FT   CDS_pept        25260..26210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="SFV_0023"
FT                   /product="penicillin tolerance protein"
FT                   /note="Code: IM; COG: COG0761"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02311"
FT                   /db_xref="GOA:Q0T8G5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8G5"
FT                   /protein_id="ABF02311.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKHAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
FT   gene            26276..27190
FT                   /gene="yaaF"
FT                   /locus_tag="SFV_0024"
FT   CDS_pept        26276..27190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaF"
FT                   /locus_tag="SFV_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: F; COG: COG1957"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02312"
FT                   /db_xref="GOA:Q0T8G4"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8G4"
FT                   /protein_id="ABF02312.1"
FT                   /translation="MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAF
FT                   LAIRDALMRAPEPVTLVAIGPLTNIALLLLQCPECKPYIRRLVIMGGSAGRGNCTPNAE
FT                   FNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLATLPELNRTGKMLHALFSHYR
FT                   SGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANV
FT                   QVALDLNVKGFQQWVAEVLALVP"
FT   gene            27405..28178
FT                   /gene="dapB"
FT                   /locus_tag="SFV_0025"
FT   CDS_pept        27405..28178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="SFV_0025"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="Code: E; COG: COG0289"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02313"
FT                   /db_xref="GOA:Q0T8G3"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8G3"
FT                   /protein_id="ABF02313.1"
FT                   /translation="MGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVT
FT                   VQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD
FT                   IAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIA
FT                   HALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKAS
FT                   SRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL"
FT   gene            28634..29782
FT                   /gene="carA"
FT                   /locus_tag="SFV_0026"
FT   CDS_pept        28634..29782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="SFV_0026"
FT                   /product="carbamoyl-phosphate synthetase, glutamine (small)
FT                   subunit"
FT                   /note="Code: EF; COG: COG0505"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02314"
FT                   /db_xref="GOA:Q0T8G2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8G2"
FT                   /protein_id="ABF02314.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRIDKPAFSFQGHPEASPGPHDAAPLFDHFIKLIEQYRKTAK"
FT   gene            29800..33021
FT                   /gene="carB"
FT                   /locus_tag="SFV_0027"
FT   CDS_pept        29800..33021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="SFV_0027"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="Code: EF; COG: COG0458"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02315"
FT                   /db_xref="GOA:Q0T8G1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8G1"
FT                   /protein_id="ABF02315.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
FT   gene            33178..33678
FT                   /gene="caiF"
FT                   /locus_tag="SFV_0028"
FT   CDS_pept        33178..33678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="SFV_0028"
FT                   /product="transcriptional regulator of cai operon"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02316"
FT                   /db_xref="GOA:Q0T8G0"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8G0"
FT                   /protein_id="ABF02316.1"
FT                   /translation="MKLHTIDIFTILIWPCLIASKRVIARLLICETGVRMCEGYVEKPL
FT                   YLLIAEWMMAENRWVIAREISIHFDIEHSKAVNTLTYILSEVTEISCEVKMIPNKLEGR
FT                   GCQCQRLVKVVDIDEQIYARLRNNSREKLVGVRKTPRIPAVPLTELNREQKWQMMLSKS
FT                   MRR"
FT   gene            complement(33764..34375)
FT                   /gene="caiE"
FT                   /locus_tag="SFV_0029"
FT   CDS_pept        complement(33764..34375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="SFV_0029"
FT                   /product="carnitine operon protein CaiE"
FT                   /note="Code: R; COG: COG0663"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02317"
FT                   /db_xref="GOA:Q0T8F9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8F9"
FT                   /protein_id="ABF02317.1"
FT                   /translation="MERTLTTVSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIG
FT                   PLASLRGDYGRLIVQAGANIQDGCIMHGYCDTDTIVGENGHIGHGAILHGCVIGRDALV
FT                   GMNSVIMDGAVIGEESIVAAMSFVKAGFSGEKRQLLMGTPARAVRSVSDDELHWKRLNT
FT                   KEYQDLVGRCHASLHETQPLRQMEENRPRLQGTTDVTPKR"
FT   gene            complement(34360..35253)
FT                   /gene="caiD"
FT                   /locus_tag="SFV_0030"
FT   CDS_pept        complement(34360..35253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="SFV_0030"
FT                   /product="carnitine racemase"
FT                   /note="Code: I; COG: COG1024"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02318"
FT                   /db_xref="GOA:Q0T8F8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8F8"
FT                   /protein_id="ABF02318.1"
FT                   /translation="MKRQGTTLPANNHALKQYAFFAGMLSSLKKQKWRKGMSESLHLTR
FT                   NGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKA
FT                   AAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIVCADNASF
FT                   ALPEAKLGIVPDSGGVLRLPKILPPTIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELM
FT                   DNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEEAYRYIRSGVLKHYPSVLHSEDAIE
FT                   GPLAFAEKRDPVWKGR"
FT   gene            complement(35274..36806)
FT                   /gene="caiC"
FT                   /locus_tag="SFV_0031"
FT   CDS_pept        complement(35274..36806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="SFV_0031"
FT                   /product="probable crotonobetaine/carnitine-CoA ligase"
FT                   /note="Code: IQ; COG: COG0318"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02319"
FT                   /db_xref="GOA:Q0T8F7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8F7"
FT                   /protein_id="ABF02319.1"
FT                   /translation="MDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSYLELNQ
FT                   EINRTANLFYTLGIRKGNKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLREESEWI
FT                   LQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPAT
FT                   LCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYMTVMP
FT                   AFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQAQKYRATITECIPMMIRTLMVQPP
FT                   SANDRQHRLREVMFYLNLSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPSDKRRWP
FT                   SIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPGKTIFKEYFLNPKATAKVLEADGW
FT                   LHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVELENIIATHPKIQDIVVVGIKDSI
FT                   RDEAIKAFVVLNEGETLSEEEFFRFCDKIWRNLKCPLIWRSEKICHVIARGK"
FT   gene            complement(36880..38097)
FT                   /gene="caiB"
FT                   /locus_tag="SFV_0032"
FT   CDS_pept        complement(36880..38097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="SFV_0032"
FT                   /product="l-carnitine dehydratase"
FT                   /note="Code: C; COG: COG1804"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02320"
FT                   /db_xref="GOA:Q0T8F6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8F6"
FT                   /protein_id="ABF02320.1"
FT                   /translation="MDHLPMPKFGPLAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWQHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGLTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEMC
FT                   PRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGTPEIPEGTQLI
FT                   HRIECPYGPLVEEKLDAWLAAHTIAEVKKRFAELNIACAKVLTVPELESNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGQIWRGMPSHGMDTAAILKNIGYSENDIQELVSKG
FT                   LAKVED"
FT   gene            complement(38226..39368)
FT                   /gene="caiA"
FT                   /locus_tag="SFV_0033"
FT   CDS_pept        complement(38226..39368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="SFV_0033"
FT                   /product="probable carnitine operon oxidoreductase"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02321"
FT                   /db_xref="GOA:Q0T8F5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8F5"
FT                   /protein_id="ABF02321.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNSVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(39399..40913)
FT                   /gene="caiT"
FT                   /locus_tag="SFV_0034"
FT   CDS_pept        complement(39399..40913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="SFV_0034"
FT                   /product="probable carnitine transporter"
FT                   /note="Code: M; COG: COG1292"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02322"
FT                   /db_xref="GOA:Q0T8F4"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8F4"
FT                   /protein_id="ABF02322.1"
FT                   /translation="MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKELGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMEVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILHAICVACGLQKGGRIPSDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNIINIPNLIEQYGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD"
FT   gene            41385..42155
FT                   /gene="fixA"
FT                   /locus_tag="SFV_0035"
FT   CDS_pept        41385..42155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="SFV_0035"
FT                   /product="probable flavoprotein subunit of carnitine
FT                   metabolism"
FT                   /note="Code: C; COG: COG2086"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02323"
FT                   /db_xref="GOA:Q0T8F3"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8F3"
FT                   /protein_id="ABF02323.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAVDAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
FT   gene            42170..43111
FT                   /pseudo
FT                   /gene="fixB"
FT                   /locus_tag="SFV_0036"
FT                   /note="contains in-frame stop codon; original product:
FT                   probable flavoprotein subunit, carnitine metabolism"
FT   gene            43162..44448
FT                   /gene="fixC"
FT                   /locus_tag="SFV_0037"
FT   CDS_pept        43162..44448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="SFV_0037"
FT                   /product="flavoprotein"
FT                   /note="electron transport; Code: C; COG: COG0644"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02324"
FT                   /db_xref="GOA:Q0T8F2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8F2"
FT                   /protein_id="ABF02324.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFADSAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVLLADGVN
FT                   SILAEKLGMAKRVKPTDVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGNPELAVGVARDLFTIDGSAPE
FT                   LMRKKILRHGKKVGFINLIKDGMKGVTVL"
FT   gene            44445..44732
FT                   /gene="fixX"
FT                   /locus_tag="SFV_0038"
FT   CDS_pept        44445..44732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="SFV_0038"
FT                   /product="putative ferredoxin"
FT                   /note="Code: C; COG: COG2440"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02325"
FT                   /db_xref="GOA:Q0T8F1"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8F1"
FT                   /protein_id="ABF02325.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQVLELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
FT   gene            44791..46185
FT                   /gene="yaaU"
FT                   /locus_tag="SFV_0039"
FT   CDS_pept        44791..46185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="SFV_0039"
FT                   /product="putative transport protein"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02326"
FT                   /db_xref="GOA:Q0T8F0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8F0"
FT                   /protein_id="ABF02326.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMCVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGSLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMGLFVQISLFSESILLT
FT                   ISRVNI"
FT   gene            46233..46763
FT                   /gene="yabF"
FT                   /locus_tag="SFV_0040"
FT   CDS_pept        46233..46763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="SFV_0040"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /note="Code: R; COG: COG2249"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02327"
FT                   /db_xref="GOA:Q0T8E9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8E9"
FT                   /protein_id="ABF02327.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVLSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
FT   gene            46756..48618
FT                   /gene="kefC"
FT                   /locus_tag="SFV_0041"
FT   CDS_pept        46756..48618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="SFV_0041"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefC"
FT                   /note="Code: P; COG: COG0475"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02328"
FT                   /db_xref="GOA:Q0T8E8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8E8"
FT                   /protein_id="ABF02328.1"
FT                   /translation="MDSHTLVQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGLWG
FT                   LRLVTDAESILHFAEIGVVLMLFIIGLELDPQRLWKLRAAVFGGGALQMVICGGLLGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAILLV
FT                   AMIPLLAASSASTTMGAFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLIENPLRIVILLLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMANVLEPEWAKSLTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQ
FT                   PRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERE
FT                   TFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMADEPETKPSS"
FT   gene            48809..49288
FT                   /gene="folA"
FT                   /locus_tag="SFV_0042"
FT   CDS_pept        48809..49288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="SFV_0042"
FT                   /product="dihydrofolate reductase type I"
FT                   /note="Code: H; COG: COG0262"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02329"
FT                   /db_xref="GOA:Q0T8E7"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8E7"
FT                   /protein_id="ABF02329.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRH
FT                   TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(49366..50208)
FT                   /gene="apaH"
FT                   /locus_tag="SFV_0043"
FT   CDS_pept        complement(49366..50208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="SFV_0043"
FT                   /product="diadenosine tetraphosphatase"
FT                   /note="Code: T; COG: COG0639"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02330"
FT                   /db_xref="GOA:Q0T8E6"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8E6"
FT                   /protein_id="ABF02330.1"
FT                   /translation="MATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPSNRHKDLGEAAAS"
FT   gene            complement(50215..50592)
FT                   /gene="apaG"
FT                   /locus_tag="SFV_0044"
FT   CDS_pept        complement(50215..50592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="SFV_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: P; COG: COG2967"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02331"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8E5"
FT                   /protein_id="ABF02331.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
FT   gene            complement(50595..51416)
FT                   /gene="ksgA"
FT                   /locus_tag="SFV_0045"
FT   CDS_pept        complement(50595..51416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SFV_0045"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase"
FT                   /note="Code: J; COG: COG0030"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02332"
FT                   /db_xref="GOA:Q0T8E4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8E4"
FT                   /protein_id="ABF02332.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENAPLQES"
FT   gene            complement(51413..52402)
FT                   /gene="pdxA"
FT                   /locus_tag="SFV_0046"
FT   CDS_pept        complement(51413..52402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="SFV_0046"
FT                   /product="pyridoxine biosynthesis"
FT                   /note="Code: H; COG: COG1995"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02333"
FT                   /db_xref="GOA:Q0T8E3"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8E3"
FT                   /protein_id="ABF02333.1"
FT                   /translation="MVKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTD
FT                   RAAMLGLPLTLRPYSPNSPAQPQTTGTLTLLPVALRESVTAGQLAIENGHYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDASIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGEADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(52402..53688)
FT                   /gene="surA"
FT                   /locus_tag="SFV_0047"
FT   CDS_pept        complement(52402..53688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="SFV_0047"
FT                   /product="survival protein"
FT                   /note="Code: O; COG: COG0760"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02334"
FT                   /db_xref="GOA:Q0T8E2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8E2"
FT                   /protein_id="ABF02334.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIA
FT                   KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQ
FT                   VGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSAD
FT                   QQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNIS
FT                   VTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAASWMQEQRASAYVKILSN"
FT   gene            complement(53741..56095)
FT                   /gene="imp"
FT                   /locus_tag="SFV_0048"
FT   CDS_pept        complement(53741..56095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="SFV_0048"
FT                   /product="organic solvent tolerance"
FT                   /note="Code: M; COG: COG1452"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02335"
FT                   /db_xref="GOA:Q0T8E1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8E1"
FT                   /protein_id="ABF02335.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQG
FT                   DTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQ
FT                   AGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYF
FT                   NDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYY
FT                   QNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKFLATHY
FT                   QQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDIEMLAPGYTQTLEPRAQYLYV
FT                   PYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFN
FT                   ISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNV
FT                   ATSNSSIEYRRDEDRLVQLNYHYASPEYIQATLPKYYSTAEQYKNGISQVGAVASRPIA
FT                   DRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIG
FT                   FNIELRGLSSNYGLGTQEMLRSNILPYQNTL"
FT   gene            56350..57165
FT                   /gene="yabH"
FT                   /locus_tag="SFV_0049"
FT   CDS_pept        56350..57165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabH"
FT                   /locus_tag="SFV_0049"
FT                   /product="putative DNA binding protein"
FT                   /note="Code: O; COG: COG1076"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02336"
FT                   /db_xref="GOA:Q0T8E0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8E0"
FT                   /protein_id="ABF02336.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
FT   gene            complement(57282..57941)
FT                   /gene="yabO"
FT                   /locus_tag="SFV_0050"
FT   CDS_pept        complement(57282..57941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="SFV_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: J; COG: COG0564"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02337"
FT                   /db_xref="GOA:Q0T8D9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8D9"
FT                   /protein_id="ABF02337.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDDHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEARAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
FT   gene            complement(57953..60859)
FT                   /gene="hepA"
FT                   /locus_tag="SFV_0051"
FT   CDS_pept        complement(57953..60859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="SFV_0051"
FT                   /product="probable ATP-dependent RNA helicase"
FT                   /note="Code: KL; COG: COG0553"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02338"
FT                   /db_xref="GOA:Q0T8D8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8D8"
FT                   /protein_id="ABF02338.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFA
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQSA
FT                   RQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPERIYQEFEGDNATWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   HMVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTIYDSVYNDLINYLASPDQTEGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTNLIAFAMNLFDIIGINQDDRGDNMIVLTPSDHMLVPDFPG
FT                   LSEDGITITFDREVALAREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELIYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLNAVNRH
FT                   TGSKLVNAVQQDVHAILQLGEAQIEKSARALIDAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELTAIESNRQQVMESLDQAGWRLDALRLIVVTHQ"
FT   gene            complement(61024..63375)
FT                   /gene="polB"
FT                   /locus_tag="SFV_0052"
FT   CDS_pept        complement(61024..63375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="SFV_0052"
FT                   /product="DNA polymerase II"
FT                   /note="Code: L; COG: COG0417"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02339"
FT                   /db_xref="GOA:Q0T8D7"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8D7"
FT                   /protein_id="ABF02339.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFI
FT                   HADQVPRAQHILQGEQGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVY
FT                   EADVRPPERYLMERFITSPVWVEGDMHNGTIVNARLKPHPDYRPPLKWVSIDIETTRHG
FT                   ELYCIGLEGCGQRIVYMLGPENGDASSLDFELEYVASRPLLLEKLNAWFANHDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRLPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEAL
FT                   KSAFWNFSSFSLETVAQELLGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVT
FT                   QIFHKTEIMPFLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHAS
FT                   PGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVTNIWHGRDKAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLAS
FT                   SITMRGHQIMRQTKALIEAQGYDVIYGDTDSTFVWLKGAHSEEEAAKIGRALVQHVNAW
FT                   WAETLQKQRLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLE
FT                   TVRTDWTPLAQQFQQELYLRIFRNEPYQEYVRQTIDKLMAGELDARLVYRKRLRRPLSE
FT                   YQRNVPPHVRAARLADEENQKRGRPLQYQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYL
FT                   TRQLQPVAEGILPFIEDNFATLMTGQLGLF"
FT   gene            complement(63450..64145)
FT                   /gene="araD"
FT                   /locus_tag="SFV_0053"
FT   CDS_pept        complement(63450..64145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="SFV_0053"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="Code: G; COG: COG0235"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02340"
FT                   /db_xref="GOA:Q0T8D6"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8D6"
FT                   /protein_id="ABF02340.1"
FT                   /translation="MLKDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSG
FT                   VDYSVMTADDMVVVSIETGEVVEGTKKPSSDTPTHRLLYQAFPSIGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(64345..65847)
FT                   /gene="araA"
FT                   /locus_tag="SFV_0054"
FT   CDS_pept        complement(64345..65847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="SFV_0054"
FT                   /product="L-arabinose isomerase"
FT                   /note="Code: G; COG: COG2160"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02341"
FT                   /db_xref="GOA:Q0T8D5"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8D5"
FT                   /protein_id="ABF02341.1"
FT                   /translation="MAIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLP
FT                   CKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSW
FT                   MRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTRAVGDLVQVVNSIS
FT                   DGDVNALVDEYESCYTMTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLPVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALN
FT                   LNDMRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR"
FT   gene            complement(65858..67558)
FT                   /gene="araB"
FT                   /locus_tag="SFV_0055"
FT   CDS_pept        complement(65858..67558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="SFV_0055"
FT                   /product="L-ribulokinase"
FT                   /note="Code: C; COG: COG1069"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02342"
FT                   /db_xref="GOA:Q0T8D4"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8D4"
FT                   /protein_id="ABF02342.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCASGEEIATSVEWYPRWQKGQFCDA
FT                   PNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQSAASWIELCDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPILNRHLPSPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADKQSVGERAVKGICGQVDDSVVPGFIGLEAGQSAFGD
FT                   IYAWFGRVLGWPLEQLAAQHPELKAQINASQKQLLPALTEAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDTPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASA
FT                   VEKTLQPRSEQAQHFEQLYRRYQQWAMSAEQHYLPTSAPAQAAQAVATL"
FT   gene            67897..68775
FT                   /gene="araC"
FT                   /locus_tag="SFV_0056"
FT   CDS_pept        67897..68775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="SFV_0056"
FT                   /product="transcriptional regulator for ara operon"
FT                   /note="Code: K; COG: COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02343"
FT                   /db_xref="GOA:Q0T8D3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8D3"
FT                   /protein_id="ABF02343.1"
FT                   /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGCHPEAREWYHQWVYFRPRAYW
FT                   HEWLNWPSIFANTGFFRPDEAHQPYFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
FT                   MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   EKVNDVAVKLS"
FT   gene            68861..69625
FT                   /gene="yabI"
FT                   /locus_tag="SFV_0057"
FT   CDS_pept        68861..69625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="SFV_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG0586"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02344"
FT                   /db_xref="GOA:Q0T8D2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8D2"
FT                   /protein_id="ABF02344.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGV"
FT   gene            complement(69739..70437)
FT                   /gene="yabJ"
FT                   /locus_tag="SFV_0058"
FT   CDS_pept        complement(69739..70437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="SFV_0058"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /note="Code: H; COG: COG3840"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02345"
FT                   /db_xref="GOA:Q0T8D1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8D1"
FT                   /protein_id="ABF02345.1"
FT                   /translation="MLKLTDITWLYHYLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGSLTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   AQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGKTEELLSGKA
FT                   SASAILGITG"
FT   gene            complement(70421..72031)
FT                   /gene="yabK"
FT                   /locus_tag="SFV_0059"
FT   CDS_pept        complement(70421..72031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="SFV_0059"
FT                   /product="putative transport system permease protein"
FT                   /note="Code: P; COG: COG1178"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02346"
FT                   /db_xref="GOA:Q0T8D0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8D0"
FT                   /protein_id="ABF02346.1"
FT                   /translation="MATRRQPLIPGWLIPGVSAATLVVAIALAAFLALWWNAPQGNWVA
FT                   VWQDSYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALE
FT                   NIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALLQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDP
FT                   DDRLHSRICDTVLIVLALLLLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPQSADGIVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLEQALAFACVLSIGDFGVVALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFLLFTVIEKLPGRNVKTD"
FT   gene            complement(72007..72990)
FT                   /gene="tbpA"
FT                   /locus_tag="SFV_0060"
FT   CDS_pept        complement(72007..72990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="SFV_0060"
FT                   /product="thiamin-binding periplasmic protein"
FT                   /note="Code: H; COG: COG4143"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02347"
FT                   /db_xref="GOA:Q0T8C9"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8C9"
FT                   /protein_id="ABF02347.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPKIKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSAP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
FT   gene            complement(73154..74809)
FT                   /gene="yabN"
FT                   /locus_tag="SFV_0061"
FT   CDS_pept        complement(73154..74809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="SFV_0061"
FT                   /product="putative transport protein"
FT                   /note="Code: R; COG: COG4533"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02348"
FT                   /db_xref="GOA:Q0T8C8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8C8"
FT                   /protein_id="ABF02348.1"
FT                   /translation="MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLN
FT                   TMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHITDIVS
FT                   PTPWTLDIHLTQPDRWLPLLLGQVPAMILPCEWETLSNFASHPIGTGPYAVIRNSTNQL
FT                   KIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEKKEIESRLEEGCYYLLF
FT                   DSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTIKSEKPA
FT                   GLESLTLTFYQDHSEHRVIAGIMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSAN
FT                   FTLPLDFSLFAHLCEVPLLQHCIPIDWQADAARWRNGEMNLANWCQQLVASKAMVPLIH
FT                   HWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   gene            75131..76309
FT                   /pseudo
FT                   /gene="yabM"
FT                   /locus_tag="SFV_0062"
FT                   /note="contains in-frame stop codon; original product:
FT                   putative transport protein"
FT   gene            complement(76358..76963)
FT                   /gene="leuD"
FT                   /locus_tag="SFV_0063"
FT   CDS_pept        complement(76358..76963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="SFV_0063"
FT                   /product="isopropylmalate isomerase subunit"
FT                   /note="Code: E; COG: COG0066"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02349"
FT                   /db_xref="GOA:Q0T8C7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8C7"
FT                   /protein_id="ABF02349.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIASYEAKQPAFMN"
FT   gene            complement(76974..78374)
FT                   /gene="leuC"
FT                   /locus_tag="SFV_0064"
FT   CDS_pept        complement(76974..78374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="SFV_0064"
FT                   /product="3-isopropylmalate isomerase (dehydratase)
FT                   subunit"
FT                   /note="Code: E; COG: COG0065"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02350"
FT                   /db_xref="GOA:Q0T8C6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8C6"
FT                   /protein_id="ABF02350.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGIPLIEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
FT   gene            complement(78377..79411)
FT                   /gene="leuB"
FT                   /locus_tag="SFV_0065"
FT   CDS_pept        complement(78377..79411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="SFV_0065"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="Code: CE; COG: COG0473"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02351"
FT                   /db_xref="GOA:Q0T8C5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8C5"
FT                   /protein_id="ABF02351.1"
FT                   /translation="MTQALKVLNAVRNRFAMRITTSHYDVGGAAIDNHGQPLPPATVEG
FT                   CEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFKLFSNLRPAKLYQGLEAFCPL
FT                   RADIAANGFDIQCVRELTGGIYFGQPKGREGSGQYEKAFDTEVYHRFEIERIARIAFES
FT                   ARKRRHKVTSIDKANVLQSSILWREIVNEIATEYPDVELAHMYIDNATMQLIKDPSQFD
FT                   VLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYEPAGGSAPDIAGKNIANPIA
FT                   QILSLALLLRYSLDADDAASAIERAINRALEEGIRTGDLARGAAAVSTDEMGDIIARYV
FT                   AEGV"
FT   gene            complement(79468..81039)
FT                   /gene="leuA"
FT                   /locus_tag="SFV_0066"
FT   CDS_pept        complement(79468..81039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SFV_0066"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="Code: E; COG: COG0119"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02352"
FT                   /db_xref="GOA:Q0T8C4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8C4"
FT                   /protein_id="ABF02352.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARQVKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   TTINIPDTVGYTMPFEFAGIISGLYERVPNIGKAIISVHTHDDLGLAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCSLEEVIMAIKVRKDILNVHTAINHQEIWRTSQLVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MDEMGYKESEYNLDNLYDAFLKLADKKGQVFDYDLEALAFIGKQQEEPEHFRLDYFSVQ
FT                   SGSNDIATAAVKLACGEEVKAEAANGNGPVDAVYQAINRITDYNVELVKYSLTAKGHGK
FT                   DALGQVDIVANYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQHNE
FT                   NNKETV"
FT   gene            81702..82823
FT                   /gene="leuO"
FT                   /locus_tag="SFV_0067"
FT   CDS_pept        81702..82823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="SFV_0067"
FT                   /product="probable transcriptional activator for leuABCD
FT                   operon"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02353"
FT                   /db_xref="GOA:Q0T8C3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8C3"
FT                   /protein_id="ABF02353.1"
FT                   /translation="MTHSTAMDSVFIRTRIFMFSEFYSFCFFLFYMHDKSYSSGLFLCI
FT                   PIRERELSVTVELSMPEVQTDHSETAELSKPQLRMVDLNLLTVFDAVMQEQNITRAAHV
FT                   LGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSG
FT                   FEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETE
FT                   FVISYEDFHRPEFTSVPLFKDEMMLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASF
FT                   SQPWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQVLPLPLK
FT                   QNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR"
FT   gene            83165..84865
FT                   /gene="ilvI"
FT                   /locus_tag="SFV_0068"
FT   CDS_pept        83165..84865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="SFV_0068"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /note="Code: EH; COG: COG0028"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02354"
FT                   /db_xref="GOA:Q0T8C2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8C2"
FT                   /protein_id="ABF02354.1"
FT                   /translation="MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQA
FT                   AVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDA
FT                   FQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNPANK
FT                   LPYVCPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAIMAGCHQQLKETV
FT                   EALNLPVVSSLMGMGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTN
FT                   NLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESAHQPLDEIR
FT                   DWWQQIEQWRALQCLKYDTHSEKIKPQAVIETLWRLTNGDAYVTSDVGQHQMFAALYYP
FT                   FDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQELSTALQYEL
FT                   PVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQISHPHELE
FT                   SKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            84868..85359
FT                   /gene="ilvH"
FT                   /locus_tag="SFV_0069"
FT   CDS_pept        84868..85359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="SFV_0069"
FT                   /product="acetolactate synthase III, valine sensitive,
FT                   small subunit"
FT                   /note="Code: E; COG: COG0440"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02355"
FT                   /db_xref="GOA:Q0T8C1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8C1"
FT                   /protein_id="ABF02355.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   gene            85371..85457
FT                   /gene="fruL"
FT                   /locus_tag="SFV_0070"
FT   CDS_pept        85371..85457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruL"
FT                   /locus_tag="SFV_0070"
FT                   /product="fruR leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02356"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8C0"
FT                   /protein_id="ABF02356.1"
FT                   /translation="MRNLQPNMSRWAFFAKSVGTWNKSSCRS"
FT   gene            85539..86543
FT                   /gene="fruR"
FT                   /locus_tag="SFV_0071"
FT   CDS_pept        85539..86543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="SFV_0071"
FT                   /product="transcriptional repressor of fru operon and
FT                   others"
FT                   /note="Code: K; COG: COG1609"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02357"
FT                   /db_xref="GOA:Q0T8B9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8B9"
FT                   /protein_id="ABF02357.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
FT   gene            complement(86540..86785)
FT                   /locus_tag="SFV_0072"
FT   CDS_pept        complement(86540..86785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0072"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02358"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8B8"
FT                   /protein_id="ABF02358.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYLDVQSRTLRARGKFTWRVFLFAD"
FT   mobile_element  86611..87378
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            86860..87363
FT                   /gene="insB"
FT                   /locus_tag="SFV_0073"
FT   CDS_pept        86860..87363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0073"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02359"
FT                   /db_xref="GOA:Q0T8B7"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8B7"
FT                   /protein_id="ABF02359.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGCP
FT                   LYESRLKGKLHVISKCYTQRIERHNLNLRQHLARLVRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            87922..88380
FT                   /gene="yabB"
FT                   /locus_tag="SFV_0074"
FT   CDS_pept        87922..88380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="SFV_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2001"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02360"
FT                   /db_xref="GOA:Q0T8B6"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8B6"
FT                   /protein_id="ABF02360.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLLSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
FT   gene            88382..89323
FT                   /gene="yabC"
FT                   /locus_tag="SFV_0075"
FT   CDS_pept        88382..89323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="SFV_0075"
FT                   /product="putative apolipoprotein"
FT                   /note="Code: M; COG: COG0275"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02361"
FT                   /db_xref="GOA:Q0T8B5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8B5"
FT                   /protein_id="ABF02361.1"
FT                   /translation="MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEEHFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLNVLAPGGRLSIISFHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQL
FT                   RALGKLMPGEDEVAENPRARSSVLRIAERTNA"
FT   gene            89320..89685
FT                   /gene="ftsL"
FT                   /locus_tag="SFV_0076"
FT   CDS_pept        89320..89685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SFV_0076"
FT                   /product="cell division protein"
FT                   /note="Code: D; COG: COG3116"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02362"
FT                   /db_xref="GOA:Q0T8B4"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8B4"
FT                   /protein_id="ABF02362.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            89701..91467
FT                   /gene="ftsI"
FT                   /locus_tag="SFV_0077"
FT   CDS_pept        89701..91467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="SFV_0077"
FT                   /product="peptidoglycan synthetase"
FT                   /note="Code: M; COG: COG0768"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02363"
FT                   /db_xref="GOA:Q0T8B3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8B3"
FT                   /protein_id="ABF02363.1"
FT                   /translation="MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNSDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERV
FT                   FPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEF
FT                   VINQGEGTGGRS"
FT   gene            91454..92941
FT                   /gene="murE"
FT                   /locus_tag="SFV_0078"
FT   CDS_pept        91454..92941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SFV_0078"
FT                   /product="meso-diaminopimelate-adding enzyme"
FT                   /note="Code: M; COG: COG0769"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02364"
FT                   /db_xref="GOA:Q0T8B2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8B2"
FT                   /protein_id="ABF02364.1"
FT                   /translation="MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHE
FT                   PSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFPASVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNY
FT                   HDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKEN
FT                   DVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGGVA"
FT   gene            92938..94296
FT                   /gene="murF"
FT                   /locus_tag="SFV_0079"
FT   CDS_pept        92938..94296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="SFV_0079"
FT                   /product="D-alanine:D-alanine-adding enzyme"
FT                   /note="Code: M; COG: COG0770"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02365"
FT                   /db_xref="GOA:Q0T8B1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8B1"
FT                   /protein_id="ABF02365.1"
FT                   /translation="MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKG
FT                   ERFDAHDFADQAKAGGAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNN
FT                   DWLNWQSVIGSRKVWRFSPNAANSDFTATNIHVTSHGMEFTLQTPTGSVDVLLPLPGRH
FT                   NIANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSM
FT                   TAAVQVLAEMPGYRVLVVGDMAELGAESEACHVQVGEAAKAAGIDRVLSMGKQSHAIST
FT                   ASGVGEHFADKTALITRLKSLIAEQQVITILVKGSRSAAMEEVVRALQENGTC"
FT   gene            94290..95372
FT                   /gene="mraY"
FT                   /locus_tag="SFV_0080"
FT   CDS_pept        94290..95372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SFV_0080"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /note="Code: M; COG: COG0472"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02366"
FT                   /db_xref="GOA:Q0T8B0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8B0"
FT                   /protein_id="ABF02366.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   AHLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LVGYGVIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNM
FT                   NFASYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            95375..96691
FT                   /gene="murD"
FT                   /locus_tag="SFV_0081"
FT   CDS_pept        95375..96691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SFV_0081"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /note="Code: M; COG: COG0771"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02367"
FT                   /db_xref="GOA:Q0T8A9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8A9"
FT                   /protein_id="ABF02367.1"
FT                   /translation="MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLD
FT                   KLPEAVECHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDDECELYVLELSSFQ
FT                   LETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIR
FT                   GADERCVSFGVNMGDYHLNHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALVALALAD
FT                   AAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLNGDNVRLYCFGRDGAQLAALRPEVAEQTETMEQAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGNEFARLAKELG"
FT   gene            96691..97935
FT                   /gene="ftsW"
FT                   /locus_tag="SFV_0082"
FT   CDS_pept        96691..97935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SFV_0082"
FT                   /product="cell division membrane protein FtsW"
FT                   /note="Code: D; COG: COG0772"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02368"
FT                   /db_xref="GOA:Q0T8A8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8A8"
FT                   /protein_id="ABF02368.1"
FT                   /translation="MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYD
FT                   RTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPM
FT                   EFWQRYSATMLLGSIILLMIVLVVGSAVKGASRWIDLGLLRIQPAELTKLSLFCYIANY
FT                   LVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFVRGSR"
FT   gene            97932..98999
FT                   /gene="murG"
FT                   /locus_tag="SFV_0083"
FT   CDS_pept        97932..98999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SFV_0083"
FT                   /product="UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="Code: M; COG: COG0707"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02369"
FT                   /db_xref="GOA:Q0T8A7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8A7"
FT                   /protein_id="ABF02369.1"
FT                   /translation="MSGQGKRLMVMAGGTGGHVFPGLAVAHYLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGS
FT                   QQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGWSRETLLTMAERARAASIPD
FT                   ATERVANEVSRAARA"
FT   gene            99053..100528
FT                   /gene="murC"
FT                   /locus_tag="SFV_0084"
FT   CDS_pept        99053..100528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SFV_0084"
FT                   /product="L-alanine adding enzyme,
FT                   UDP-N-acetyl-muramate:alanine ligase"
FT                   /note="Code: M; COG: COG0773"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02370"
FT                   /db_xref="GOA:Q0T8A6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8A6"
FT                   /protein_id="ABF02370.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLLNLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHGRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEP
FT                   MRVTLNAPGRHNALNAAAAVAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKSGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLT
FT                   QVDTLLMLEVYPAGEAPIPGADSRSLCRTIRGRGKIDPILVPDPAQVAEMLAPVLTGND
FT                   LILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD"
FT   gene            100521..101441
FT                   /gene="ddlB"
FT                   /locus_tag="SFV_0085"
FT   CDS_pept        100521..101441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="SFV_0085"
FT                   /product="D-alanine-D-alanine ligase B"
FT                   /note="Code: M; COG: COG1181"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02371"
FT                   /db_xref="GOA:Q0T8A5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8A5"
FT                   /protein_id="ABF02371.1"
FT                   /translation="MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEV
FT                   DVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSIDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENAL
FT                   QDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            101443..102273
FT                   /gene="ftsQ"
FT                   /locus_tag="SFV_0086"
FT   CDS_pept        101443..102273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="SFV_0086"
FT                   /product="cell division protein"
FT                   /note="Code: M; COG: COG1589"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02372"
FT                   /db_xref="GOA:Q0T8A4"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8A4"
FT                   /protein_id="ABF02372.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LSWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWVPLPPEESTQQQNQAQAEQQ"
FT   gene            102363..103532
FT                   /gene="ftsA"
FT                   /locus_tag="SFV_0087"
FT   CDS_pept        102363..103532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SFV_0087"
FT                   /product="ATP-binding cell division protein"
FT                   /note="Code: D; COG: COG0849"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02373"
FT                   /db_xref="GOA:Q0T8A3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8A3"
FT                   /protein_id="ABF02373.1"
FT                   /translation="MVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQI
FT                   SSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEY
FT                   AIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSY
FT                   SVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSD
FT                   AEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEI
FT                   LQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYA
FT                   QEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF"
FT   gene            103593..104744
FT                   /gene="ftsZ"
FT                   /locus_tag="SFV_0088"
FT   CDS_pept        103593..104744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SFV_0088"
FT                   /product="cell division protein FtsZ"
FT                   /note="Code: D; COG: COG0206"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02374"
FT                   /db_xref="GOA:Q0T8A2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T8A2"
FT                   /protein_id="ABF02374.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGENRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLGLVEVETVGNT
FT                   IRAFASGNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFVRKQAD"
FT   gene            104845..105762
FT                   /gene="lpxC"
FT                   /locus_tag="SFV_0089"
FT   CDS_pept        104845..105762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="SFV_0089"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /note="Code: M; COG: COG0774"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02375"
FT                   /db_xref="GOA:Q0T8A1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8A1"
FT                   /protein_id="ABF02375.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFKPYNGFSLDFTIDFNH
FT                   PAIDSSNQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEYVTFQDDAELPLAFKAPSAVLA"
FT   gene            105840..106505
FT                   /gene="yacA"
FT                   /locus_tag="SFV_0090"
FT   CDS_pept        105840..106505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="SFV_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02376"
FT                   /db_xref="GOA:Q0T8A0"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T8A0"
FT                   /protein_id="ABF02376.1"
FT                   /translation="MNFIRAIKNGANAVFLSTFTHNLSSFVLWTSGFNDKICALNTFEF
FT                   DRDGNNVSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAKATTRNHEP
FT                   SAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQ
FT                   AQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIRAGPQRLT"
FT   gene            106567..109272
FT                   /gene="secA"
FT                   /locus_tag="SFV_0091"
FT   CDS_pept        106567..109272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SFV_0091"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="Code: U; COG: COG0653"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02377"
FT                   /db_xref="GOA:Q0T899"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T899"
FT                   /protein_id="ABF02377.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   SWQAEVAALENPTAEQIEKIKADWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
FT   gene            109332..109721
FT                   /gene="mutT"
FT                   /locus_tag="SFV_0092"
FT   CDS_pept        109332..109721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="SFV_0092"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /note="Code: LR; COG: COG0494"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02378"
FT                   /db_xref="GOA:Q0T898"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T898"
FT                   /protein_id="ABF02378.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGVPWGKEGQPGEW
FT                   MSLVGLNADDFPPANEPVIAKLKRL"
FT   gene            complement(109821..110018)
FT                   /gene="yacG"
FT                   /locus_tag="SFV_0093"
FT   CDS_pept        complement(109821..110018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="SFV_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3024"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02379"
FT                   /db_xref="GOA:Q0T897"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T897"
FT                   /protein_id="ABF02379.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
FT   gene            complement(110028..110771)
FT                   /gene="yacF"
FT                   /locus_tag="SFV_0094"
FT   CDS_pept        complement(110028..110771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="SFV_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4582"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02380"
FT                   /db_xref="GOA:Q0T896"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T896"
FT                   /protein_id="ABF02380.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELNRQQRKLQTWIGVPGVDQSRIEALIQQLKAAVSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDTENGQVPERLDFELACC"
FT   gene            complement(110771..111391)
FT                   /gene="yacE"
FT                   /locus_tag="SFV_0095"
FT   CDS_pept        complement(110771..111391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacE"
FT                   /locus_tag="SFV_0095"
FT                   /product="putative DNA repair protein"
FT                   /note="Code: H; COG: COG0237"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02381"
FT                   /db_xref="GOA:Q0T895"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T895"
FT                   /protein_id="ABF02381.1"
FT                   /translation="MGYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGENMIAADGTLQRRALRERIFANPEEKNWLNDLLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
FT   gene            111616..112659
FT                   /gene="guaC"
FT                   /locus_tag="SFV_0096"
FT   CDS_pept        111616..112659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="SFV_0096"
FT                   /product="GMP reductase"
FT                   /note="Code: F; COG: COG0516"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02382"
FT                   /db_xref="GOA:Q0T894"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T894"
FT                   /protein_id="ABF02382.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWS
FT                   GVPIIAANMDTVGTFSMASALASFDILTAVHKHFSVEEWQAFINNSSADVLKHVMVSTG
FT                   TSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TTPGDVAKAFGGGADFVMLGGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGG
FT                   VAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVLEQE
FT                   NRIFNNL"
FT   gene            complement(112694..113896)
FT                   /gene="hofC"
FT                   /locus_tag="SFV_0097"
FT   CDS_pept        complement(112694..113896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="SFV_0097"
FT                   /product="Protein transport protein hofC"
FT                   /note="Code: NU; COG: COG1459"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02383"
FT                   /db_xref="GOA:Q0T893"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T893"
FT                   /protein_id="ABF02383.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSVEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEAFPPLYQAMIRTGELTGKLDECCFELARQQKSQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWGWLLVL
FT                   FGFLLAIANKLLMRRPTWLIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(113886..115033)
FT                   /pseudo
FT                   /gene="hofB"
FT                   /locus_tag="SFV_0098"
FT                   /note="frameshift; original product: putative integral
FT                   membrane protein involved in biogenesis of fimbriae,
FT                   protein transport, DNA uptake"
FT   gene            complement(115043..115483)
FT                   /gene="ppdD"
FT                   /locus_tag="SFV_0099"
FT   CDS_pept        complement(115043..115483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="SFV_0099"
FT                   /product="prelipin peptidase dependent protein"
FT                   /note="Code: NU; COG: COG4969"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02384"
FT                   /db_xref="GOA:Q0T892"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T892"
FT                   /protein_id="ABF02384.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSSIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWARNCNIQSDSALQQACEDVFRFDDAN"
FT   gene            complement(115686..116579)
FT                   /gene="nadC"
FT                   /locus_tag="SFV_0100"
FT   CDS_pept        complement(115686..116579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="SFV_0100"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /note="Code: H; COG: COG0157"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02385"
FT                   /db_xref="GOA:Q0T891"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T891"
FT                   /protein_id="ABF02385.1"
FT                   /translation="MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDI
FT                   TAKLLPENSRSHATVITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQPL
FT                   FELEGPSRVLLTGERTALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSAL
FT                   KYAVLCGGGANHRLGLSDAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEEL
FT                   DEALKAGADIIMLDNFETEQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVG
FT                   ALTKHVQALDLSMRFR"
FT   gene            116667..117218
FT                   /gene="ampD"
FT                   /locus_tag="SFV_0101"
FT   CDS_pept        116667..117218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="SFV_0101"
FT                   /product="regulates ampC"
FT                   /note="Code: V; COG: COG3023"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02386"
FT                   /db_xref="GOA:Q0T890"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T890"
FT                   /protein_id="ABF02386.1"
FT                   /translation="MLLEQGWLVGARRVPSPHYDCRLDDETPTLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPQAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSQYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRALIDRYPDIANNMTGHCDIAPDRKT
FT                   DPGPAFDWARFRALVSKETT"
FT   gene            117215..118069
FT                   /gene="ampE"
FT                   /locus_tag="SFV_0102"
FT   CDS_pept        117215..118069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="SFV_0102"
FT                   /product="regulates ampC"
FT                   /note="Code: V; COG: COG3725"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02387"
FT                   /db_xref="GOA:Q0T889"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T889"
FT                   /protein_id="ABF02387.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFHTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
FT   gene            complement(118112..119485)
FT                   /gene="aroP"
FT                   /locus_tag="SFV_0103"
FT   CDS_pept        complement(118112..119485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="SFV_0103"
FT                   /product="aromatic amino acid transport protein"
FT                   /note="Code: E; COG: COG1113"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02388"
FT                   /db_xref="GOA:Q0T888"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T888"
FT                   /protein_id="ABF02388.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFVLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAAVLVIMLMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH"
FT   gene            119993..120790
FT                   /gene="pdhR"
FT                   /locus_tag="SFV_0104"
FT   CDS_pept        119993..120790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="SFV_0104"
FT                   /product="transcriptional regulator for pyruvate
FT                   dehydrogenase complex"
FT                   /note="Code: K; COG: COG2186"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02389"
FT                   /db_xref="GOA:Q0T887"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T887"
FT                   /protein_id="ABF02389.1"
FT                   /translation="MTSASGLRQELMAYSKIRQPKLSAVIEQQLEFLILEGTLRPGEKL
FT                   PPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDH
FT                   PESQYDLLETRHALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGDLDAESNAVLQ
FT                   YQIAVTEAAHNVVLLHLLRCMEPMLAQNVRQNFELLYSRREMLPLVSSHRTRIFEAIMA
FT                   GKPEEAREASHRHLAFIEEILLDRSREESRRERSLRRLEQRKN"
FT   gene            120951..123614
FT                   /gene="aceE"
FT                   /locus_tag="SFV_0105"
FT   CDS_pept        120951..123614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="SFV_0105"
FT                   /product="pyruvate dehydrogenase (decarboxylase component)"
FT                   /note="Code: C; COG: COG2609"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02390"
FT                   /db_xref="GOA:Q0T886"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T886"
FT                   /protein_id="ABF02390.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEAR
FT                   KGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQL
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGD
FT                   AAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQK
FT                   LHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKELSTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSTNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   CSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFNIDADKVNPRLA"
FT   gene            123629..125509
FT                   /gene="aceF"
FT                   /locus_tag="SFV_0106"
FT   CDS_pept        123629..125509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="SFV_0106"
FT                   /product="pyruvate dehydrogenase
FT                   (dihydrolipoyltransacetylase component)"
FT                   /note="Code: C; COG: COG0508"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02391"
FT                   /db_xref="GOA:Q0T885"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T885"
FT                   /protein_id="ABF02391.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGIVKEIKVSVGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAA
FT                   AKDVNVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   VGDKVSTGSLIMVFEVAGEAGAAAPAAKQEATPAATPAPAAGVKEVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNL
FT                   AKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEV
FT                   ELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVF
FT                   IMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIE
FT                   LSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAM
FT                   EPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM"
FT   gene            125831..127258
FT                   /gene="lpdA"
FT                   /locus_tag="SFV_0107"
FT   CDS_pept        125831..127258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SFV_0107"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="Code: C; COG: COG1249"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02392"
FT                   /db_xref="GOA:Q0T884"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T884"
FT                   /protein_id="ABF02392.1"
FT                   /translation="MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGV
FT                   CLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAG
FT                   MAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRI
FT                   WDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKV
FT                   FTKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNL
FT                   DAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKK
FT                   HYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTK
FT                   LIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAE
FT                   VFEGSITDLPNPKAKKK"
FT   gene            complement(127329..129176)
FT                   /gene="yacH"
FT                   /locus_tag="SFV_0108"
FT   CDS_pept        complement(127329..129176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="SFV_0108"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02393"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T883"
FT                   /protein_id="ABF02393.1"
FT                   /translation="MTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVEPQSTQLAV
FT                   SDAAAVTLPATVSAPPVIPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPTNV
FT                   AQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMASMGENPQWVQNLGDAFL
FT                   AQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLTAN
FT                   PVITEPATTVISIEPANPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSFVR
FT                   GFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDSNGWQHNGDNINIDV
FT                   NNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDPDMAKRVHQTDVNGGMSATQLPDPTRD
FT                   SQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFRDFSRRQPLTQQQK
FT                   DAARQRYQSASPEQRQAVREKMQTNPQIQQRREAARQRIQSASPELRQAVREKMQTNPQ
FT                   NQQRREAARERIQSATPEQRQVFKEKVQQRPLNQQQRDNARQRIQSASPEQRQVFREKV
FT                   QESRPQRLNDSNHTVRLNNEQRSAVRERLSERGARRLER"
FT   gene            129510..132134
FT                   /gene="acnB"
FT                   /locus_tag="SFV_0109"
FT   CDS_pept        129510..132134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="SFV_0109"
FT                   /product="aconitate hydrase B"
FT                   /note="Code: C; COG: COG1049"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02394"
FT                   /db_xref="GOA:Q0T882"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T882"
FT                   /protein_id="ABF02394.1"
FT                   /translation="MTMRARRTVVLEEYRKHVADRAAEGIAPKPLDANQMAALVELLKN
FT                   PPAGEEEFLLDLLTNRVPAGVDEAAYVKAGFLAAIAKGEAKSPLLTPEKAIELLGTMQG
FT                   GYNIHPLIDALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAE
FT                   WFLNRPALAEKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQ
FT                   PGVVGPIKQIEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGL
FT                   CLGGKIAPIFFNTMEDAGALPIEVNVSNLNMGDVIDVYPYKGEVRNHETGELLATFELK
FT                   TDVLIDEVRAGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVG
FT                   RACGVKGIRPGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYP
FT                   KPVDVNTHHTLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISF
FT                   PAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEK
FT                   KGKKNIFSGRILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLSSNIVL
FT                   LKWMIAEGYGDRRALERRIQGMEKWLANPELLEADADAEYAAVIDIDLAEIKEPILCAP
FT                   NDPDDARPLSAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMD
FT                   AAQLTEEGYYSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANV
FT                   FLASAELAAVAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFNQLSQYTEKADGVIFQ
FT                   TAV"
FT   gene            132261..132671
FT                   /gene="yacL"
FT                   /locus_tag="SFV_0110"
FT   CDS_pept        132261..132671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="SFV_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3112"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02395"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T881"
FT                   /protein_id="ABF02395.1"
FT                   /translation="MARCDFGALPGAEEHTMDYEFLRDITGVVKVRMSMGHEVVGHWFN
FT                   EEVKENLALLDEVEQAAHALKGSERSWQRAGHEYTLWMDAEEVMVRANQLEFAGDEMEE
FT                   GMNYYDEESLSLCGVEDFLQVVAAYRNFVQQK"
FT   gene            complement(132709..133503)
FT                   /gene="speD"
FT                   /locus_tag="SFV_0111"
FT   CDS_pept        complement(132709..133503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="SFV_0111"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /note="Code: E; COG: COG1586"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02396"
FT                   /db_xref="GOA:Q0T880"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T880"
FT                   /protein_id="ABF02396.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV"
FT   gene            complement(133519..134385)
FT                   /gene="speE"
FT                   /locus_tag="SFV_0112"
FT   CDS_pept        complement(133519..134385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SFV_0112"
FT                   /product="spermidine synthase"
FT                   /note="Code: E; COG: COG0421"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02397"
FT                   /db_xref="GOA:Q0T879"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T879"
FT                   /protein_id="ABF02397.1"
FT                   /translation="MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFQLVIDDGVNFVNQTSQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQD
FT                   ALASQPS"
FT   gene            complement(134491..135009)
FT                   /gene="yacC"
FT                   /locus_tag="SFV_0114"
FT   CDS_pept        complement(134491..135009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="SFV_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02399"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T878"
FT                   /protein_id="ABF02399.1"
FT                   /translation="MHSYFLILKQAKQNQTLSIVLPLTGRSSRRHNLIDNNGRRLARSV
FT                   LTFIFFKPLVEAMKTFFRTVLFGSLIAVCANSYALSESEAEDMADLTAVFVFLKNDCGY
FT                   QNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARD
FT                   SLSLLAYVK"
FT   gene            135004..136554
FT                   /gene="yacK"
FT                   /locus_tag="SFV_0113"
FT   CDS_pept        135004..136554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacK"
FT                   /locus_tag="SFV_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: Q; COG: COG2132"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02398"
FT                   /db_xref="GOA:Q0T877"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T877"
FT                   /protein_id="ABF02398.1"
FT                   /translation="MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDAR
FT                   NRIQLTIGAGQSTFGEKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLAEETTLHWHG
FT                   LEVPGDVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIE
FT                   DDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYP
FT                   QHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERF
FT                   EVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPAL
FT                   PSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHG
FT                   GKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSEN
FT                   GKPPAAHRAGWKDTVKVEGNVSEVLVKFNHNAPKEHAYMAHCHLLEHEDTGMMLGFTV"
FT   gene            complement(136601..139009)
FT                   /gene="gcd"
FT                   /locus_tag="SFV_0115"
FT   CDS_pept        complement(136601..139009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="SFV_0115"
FT                   /product="glucose dehydrogenase"
FT                   /note="Code: G; COG: COG4993"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02400"
FT                   /db_xref="GOA:Q0T876"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T876"
FT                   /protein_id="ABF02400.1"
FT                   /translation="MKWCLFMAINNTGSRRLLVTLTALFAALCGLYLLIGGGWLVAIGG
FT                   SWYYPIAGLVMLGVAWMLWRSKRAALWLYAALLLGTMIWGVWEVGFDFWALTPRSDILV
FT                   FFGIWLILPFVWRRLVIPASGAVAALVVALLISGGILTWAGFNDPQEINGTLSADATPA
FT                   EAISPVADQDWPAYGRNQEGQRFSPLKQIHADNVHKLKEAWVFRTGDVKQPNDPGEITN
FT                   EVTPIKVGDTLYLCTAHQRLFALDAASGKEKWHYDPELKTNESFQHVTCRGVSYHEAKA
FT                   ETASPEVMADCPRRIILPVNDGRLIAINAENGKLCETFANKGVLNLQSNMPDTKPGLYE
FT                   PTSPPIITDKTIVMAGSVTDNFSTRETSGVIRGFDVNTGELLWAFDPGAKDPNAIPSDE
FT                   HTFTFNSPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGK
FT                   LAWSYQTVHHDLWDMDLPAQPTLADITVNGQKVPIIYAPAKTGNIFVLDRRNGELVVPA
FT                   PEKPVPQGAAKGDYVTPTQPFSELSFRPTKDLSGADMWGATMFDQLVCRVMFHQMRYEG
FT                   IFTPPSEQGTLVFPGNLGMFEWGGISVDPNREVAIANPMALPFVSKLLPRGPGNPMEQP
FT                   KDAKGTGTESGIQPQYGVPYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRI
FT                   GTPQDSMPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQG
FT                   RLPAGGQATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDVK"
FT   gene            139134..139733
FT                   /gene="hpt"
FT                   /locus_tag="SFV_0116"
FT   CDS_pept        139134..139733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SFV_0116"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /note="Code: F; COG: COG0634"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02401"
FT                   /db_xref="GOA:Q0T875"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T875"
FT                   /protein_id="ABF02401.1"
FT                   /translation="MLRCQNLPVRSDLFLNHMVRDMKHTVEVMIPEAEIKARIAELGRQ
FT                   ITERYKDSGSDMVLVGLLRGSFMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKIL
FT                   KDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVE
FT                   FIGFSIPDEFVVGYGIDYAQRYRHLPYIGKVILLDE"
FT   gene            complement(139774..140436)
FT                   /gene="yadF"
FT                   /locus_tag="SFV_0117"
FT   CDS_pept        complement(139774..140436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadF"
FT                   /locus_tag="SFV_0117"
FT                   /product="putative carbonic anhdrase"
FT                   /note="Code: P; COG: COG0288"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02402"
FT                   /db_xref="GOA:Q0T874"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T874"
FT                   /protein_id="ABF02402.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGV
FT                   QAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTI
FT                   MQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK"
FT   gene            140620..141471
FT                   /gene="yadG"
FT                   /locus_tag="SFV_0118"
FT   CDS_pept        140620..141471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="SFV_0118"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /note="Code: V; COG: COG1131"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02403"
FT                   /db_xref="GOA:Q0T873"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T873"
FT                   /protein_id="ABF02403.1"
FT                   /translation="MQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSGRVSVFGYDLE
FT                   KDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAGYYGVERKEAYIRSEKYLKQLDLWGK
FT                   RNERARMLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELRRSMWGFLKDLNDKGTT
FT                   IILTTHYLEEAEMLCRNIGIIQHGELVENTSMKALLAKLKSETFILDLAPKSPLPKLDG
FT                   YQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQVLSMRNKANRLEELFVSLVNEKQGD
FT                   RA"
FT   gene            141468..142238
FT                   /gene="yadH"
FT                   /locus_tag="SFV_0119"
FT   CDS_pept        141468..142238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="SFV_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: V; COG: COG0842"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02404"
FT                   /db_xref="GOA:Q0T872"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T872"
FT                   /protein_id="ABF02404.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
FT   gene            142847..144076
FT                   /gene="yadE"
FT                   /locus_tag="SFV_0120"
FT   CDS_pept        142847..144076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="SFV_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: G; COG: COG0726"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02405"
FT                   /db_xref="GOA:Q0T871"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T871"
FT                   /protein_id="ABF02405.1"
FT                   /translation="MYKQAVILLLMLFTASVSAALPARYMQTIENAAVWAQIGDKMVTV
FT                   GNIRAGQIIAVEPTAASYYAFNFGFGKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQN
FT                   LITWKDTPVYNAPSVGSAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALD
FT                   AQPDNGLPVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMAQLEGY
FT                   VKNTINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATVFIVTSRIKRHPQKWNPKSL
FT                   QFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNP
FT                   HVWYLSYPFGGFNDKAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLEKM
FT                   SRLVSNQPQG"
FT   gene            complement(144080..144460)
FT                   /gene="panD"
FT                   /locus_tag="SFV_0121"
FT   CDS_pept        complement(144080..144460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="SFV_0121"
FT                   /product="aspartate 1-decarboxylase"
FT                   /note="Code: H; COG: COG0853"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02406"
FT                   /db_xref="GOA:Q0T870"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T870"
FT                   /protein_id="ABF02406.1"
FT                   /translation="MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPN
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            144734..145636
FT                   /gene="yadD"
FT                   /locus_tag="SFV_0122"
FT   CDS_pept        144734..145636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="SFV_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5464"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02407"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T869"
FT                   /protein_id="ABF02407.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEECLKGHSTDVLYSMQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEAGHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSGSQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGKSMMTLAQWFEEKGIEKGIQQGRQEERQEFALRLLSKGMSRED
FT                   VAEMANLPLAEIDKVINLI"
FT   gene            complement(145710..146561)
FT                   /gene="panC"
FT                   /locus_tag="SFV_0123"
FT   CDS_pept        complement(145710..146561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SFV_0123"
FT                   /product="pantothenate synthetase"
FT                   /note="Code: H; COG: COG0414"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02408"
FT                   /db_xref="GOA:Q0T868"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T868"
FT                   /protein_id="ABF02408.1"
FT                   /translation="MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHNGHMKLVDEAK
FT                   ARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTE
FT                   THTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMV
FT                   ADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDL
FT                   DEIITIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVE
FT                   LA"
FT   gene            complement(146573..147367)
FT                   /gene="panB"
FT                   /locus_tag="SFV_0124"
FT   CDS_pept        complement(146573..147367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SFV_0124"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="Code: H; COG: COG0413"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02409"
FT                   /db_xref="GOA:Q0T867"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T867"
FT                   /protein_id="ABF02409.1"
FT                   /translation="MKPTTIASLQKYKQDKKRFATITAYDYSFAKLFADEGLNVMLVGD
FT                   SLGMTVQGHDSTLPVTVADIAYHTAAVRRGAPNCLLLADLPFMAYATPEQAFENAATVM
FT                   RAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGNEASDRL
FT                   LSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH"
FT   gene            complement(147480..147941)
FT                   /locus_tag="SFV_0125"
FT   CDS_pept        complement(147480..147941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02410"
FT                   /db_xref="GOA:Q0T866"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T866"
FT                   /protein_id="ABF02410.1"
FT                   /translation="MSGSAFAVTHHAFSSGAGRTSDGNGSHASTLKSPSYTKSVSWQHY
FT                   PTKVGTENGQLLGNTLTGNDAAKGVGVLIEGLATSKNPLMTLKPNDSNSVYKDYDPRGK
FT                   DDTTGGVYPDQDTGITYPLHFQATLQQDGTIPIEAGEFKATSTFQVTYP"
FT   mobile_element  147806..148573
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            148055..148558
FT                   /gene="insB"
FT                   /locus_tag="SFV_0126"
FT   CDS_pept        148055..148558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0126"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02411"
FT                   /db_xref="GOA:Q0SXA0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXA0"
FT                   /protein_id="ABF02411.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLVRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(148706..149185)
FT                   /gene="folK"
FT                   /locus_tag="SFV_0127"
FT   CDS_pept        complement(148706..149185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SFV_0127"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /note="Code: H; COG: COG0801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02412"
FT                   /db_xref="GOA:Q0T864"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T864"
FT                   /protein_id="ABF02412.1"
FT                   /translation="MTVAYIAIGSNLASPLEQVNAALKALGDIPESRILAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETSPAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGN
FT                   EVINTERLTVPHYDMKNRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW"
FT   gene            complement(149182..150546)
FT                   /gene="pcnB"
FT                   /locus_tag="SFV_0128"
FT   CDS_pept        complement(149182..150546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="SFV_0128"
FT                   /product="poly(A) polymerase I"
FT                   /note="Code: J; COG: COG0617"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02413"
FT                   /db_xref="GOA:Q0T863"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T863"
FT                   /protein_id="ABF02413.1"
FT                   /translation="MLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLN
FT                   KAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGP
FT                   EIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVAD
FT                   FTVRDYVGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLSMRISPETAEPIPR
FT                   LATLLNDIPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPME
FT                   RIIEQVLKNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMND
FT                   VLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEV
FT                   ERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTT"
FT   gene            complement(150639..151565)
FT                   /gene="yadB"
FT                   /locus_tag="SFV_0129"
FT   CDS_pept        complement(150639..151565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="SFV_0129"
FT                   /product="putative tRNA synthetase"
FT                   /note="Code: J; COG: COG0008"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02414"
FT                   /db_xref="GOA:Q0T862"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T862"
FT                   /protein_id="ABF02414.1"
FT                   /translation="MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARA
FT                   RQGRWLVRIEDIDPPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHDAYREALAWLHE
FT                   QGLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDLLRGIIHAD
FT                   EKLAREDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQISLYQLFGWKV
FT                   PDYIHLPLALNPQGAKLSKQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQIL
FT                   QSAVKNWMLTAVPESAIVNSTFSNASC"
FT   gene            complement(151602..152057)
FT                   /gene="dksA"
FT                   /locus_tag="SFV_0130"
FT   CDS_pept        complement(151602..152057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="SFV_0130"
FT                   /product="dnaK suppressor protein"
FT                   /note="Code: T; COG: COG1734"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02415"
FT                   /db_xref="GOA:Q0T861"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T861"
FT                   /protein_id="ABF02415.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(152235..152939)
FT                   /gene="sfsA"
FT                   /locus_tag="SFV_0131"
FT   CDS_pept        complement(152235..152939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="SFV_0131"
FT                   /product="probable regulator for maltose metabolism"
FT                   /note="Code: R; COG: COG1489"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02416"
FT                   /db_xref="GOA:Q0T860"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T860"
FT                   /protein_id="ABF02416.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGSERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMNVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
FT   gene            complement(152954..153697)
FT                   /gene="yadP"
FT                   /locus_tag="SFV_0133"
FT   CDS_pept        complement(152954..153697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadP"
FT                   /locus_tag="SFV_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: J; COG: COG1514"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02418"
FT                   /db_xref="GOA:Q0T859"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T859"
FT                   /protein_id="ABF02418.1"
FT                   /translation="MPGCASSCSGSQVDFPAPVGALNNTCGAQSRAVSNSGKTAATGND
FT                   DTKRSRGLTFFAPHCSIAVIHNRVPHMSEPQRLFFAIDLPAEIREQIIHWRATHFPPEA
FT                   GRPVAADNLHLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGM
FT                   RQPPRGLIQLANMLRSQAARSGCFQSNRPFHPHITLLRDASEAVTFPPPGFNWSYAVTE
FT                   FTLYASSFARGRTRYTPLKRWALTQ"
FT   gene            153558..155987
FT                   /gene="hrpB"
FT                   /locus_tag="SFV_0132"
FT   CDS_pept        153558..155987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="SFV_0132"
FT                   /product="helicase, ATP-dependent"
FT                   /note="Code: L; COG: COG1643"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02417"
FT                   /db_xref="GOA:Q0T858"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T858"
FT                   /protein_id="ABF02417.1"
FT                   /translation="MSSLPVAAVLPELLTALDCAPQVLLSAPTGAGKSTWLPLQLLAHP
FT                   GINGKIILLEPRRLAARNVAQRLAELLNEKPGDTVGYRMRAQNCVGPNTRLEVVTEGVL
FT                   TRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGLRDDLKLLIMSATLDNDR
FT                   LQQMLPEAPVVISEGRSFPVERRYLPLPAHQRFDEAVAVATAEMVRQESGSLLLFLPGV
FT                   GEIQRVQEQLASRIGSDVVLCPLYGVLSLNDQRKAILPAPQGMRKVVLATNIAETSLTI
FT                   EGIRLVVDCAQERVARFDPRTGLTRLITQRVSQASMTQRAGRAGRLEPGISLHLIAKEQ
FT                   AERAAAQSEPEILQSDLSGLLMELLQWGCSDPAQMSWLDQPPTVNLLAAKRLLQMLGAL
FT                   EGERLSAQGQKMAALGNDPRLAAMLVNAKSDDEAATAAKIAAILEEPPRMGNSDLGVAF
FT                   SRNQPAWQQRSQQLLKRLNVRGGEADSSLIAPLLAGAFADRIAHRRGQDGRYQLANSMG
FT                   AMLDADDALSRHEWLIAPLLLQGSASPDARILLALPVDIDELVQRCPQLVQQSDTVEWD
FT                   DAQGTLKAWRRLQIGQLTVKVQPLAKPSEDELHQAMLNGIRDKGLSVLNWTAEAEQLRL
FT                   RLLCAAKWLPEYDWPAVDDESLLATLETWLLPHMTGVHSLRGLKSLDIYQALRGLLDWG
FT                   MQQRLDSELPAHYTVPTGSRIAIRYHEDNPPALAVRMQEMFGEATNPTIAQGRVPLVLK
FT                   LLSPAQRPLQITRDLGAFWKGAYREVQKEMKGRYPKHVWPDDPANTAPTRRTKKYS"
FT   gene            156183..158717
FT                   /gene="mrcB"
FT                   /locus_tag="SFV_0134"
FT   CDS_pept        156183..158717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SFV_0134"
FT                   /product="penicillin-binding protein 1B"
FT                   /note="Code: M; COG: COG0744"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02419"
FT                   /db_xref="GOA:Q0T857"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T857"
FT                   /protein_id="ABF02419.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
FT   gene            159015..161180
FT                   /gene="fhuA"
FT                   /locus_tag="SFV_0135"
FT   CDS_pept        159015..161180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SFV_0135"
FT                   /product="outer membrane protein receptor for ferrichrome,
FT                   colicin M, and phages T1, T5, and phi80"
FT                   /note="Code: P; COG: COG1629"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02420"
FT                   /db_xref="GOA:Q0T856"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T856"
FT                   /protein_id="ABF02420.1"
FT                   /translation="MSVYAQAAVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTK
FT                   TDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAA
FT                   EGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRP
FT                   TTEPLKEVQFKAGTDSLFQTGFDFSDALDDDGVYSYRLTGLARSANAQQKGSEEQRYAI
FT                   APAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNT
FT                   YSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALA
FT                   PADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFG
FT                   YDDSVPLFNLYNPVNPDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGG
FT                   RYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDG
FT                   NIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRARG
FT                   VEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLS
FT                   GLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDRE
FT                   YVASCFNTYGCFWGAERQVVATATFRF"
FT   gene            161189..162028
FT                   /gene="fhuC"
FT                   /locus_tag="SFV_0136"
FT   CDS_pept        161189..162028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SFV_0136"
FT                   /product="ATP-binding component of hydroxymate-dependent
FT                   iron transport"
FT                   /note="Code: PH; COG: COG1120"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02421"
FT                   /db_xref="GOA:Q0T855"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T855"
FT                   /protein_id="ABF02421.1"
FT                   /translation="MGHGFPCPFHKLAVMQEYTNHSDTTFALRNISFRVPGRTLLHPLS
FT                   LTFPAGKVTGLIGHNGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYL
FT                   PQQLPPAEGMTVRELVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLS
FT                   GGERQRAWIAMLVAQDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDI
FT                   NMAARYCDYLVALRSGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
FT   gene            162028..162918
FT                   /gene="fhuD"
FT                   /locus_tag="SFV_0137"
FT   CDS_pept        162028..162918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="SFV_0137"
FT                   /product="hydroxamate-dependent iron uptake, cytoplasmic
FT                   membrane component"
FT                   /note="Code: P; COG: COG0614"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02422"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T854"
FT                   /protein_id="ABF02422.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSSEMLARIAPGRGFNFSDGKHPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRTGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
FT   gene            162915..164897
FT                   /gene="fhuB"
FT                   /locus_tag="SFV_0138"
FT   CDS_pept        162915..164897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SFV_0138"
FT                   /product="hydroxamate-dependent iron uptake, cytoplasmic
FT                   membrane component"
FT                   /note="Code: P; COG: COG0609"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02423"
FT                   /db_xref="GOA:Q0T853"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T853"
FT                   /protein_id="ABF02423.1"
FT                   /translation="MSKRIALFPALLLALLVIVATALTWMNFSQALPRSQWAQAAWSPD
FT                   IDVIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPSAMASQFAALAGACVVGLIVFGVAWGKRLSPVTLIFAGLVVSLYCGAINQL
FT                   LVIFHHDQLQSMFLWSTGTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALSLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLAS
FT                   LIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRV
FT                   ATERQHVLAFALAGGVLLLMAVVVALSFGRDAHGWTWASGALLEDLMPWRWPRIMAALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSLGA
FT                   AVTLLIIMIAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTY
FT                   NATDAQVWRTGIVMVILLAITPLCRRWLTILPLGGDTARAVGMALTPTRIALLLLAACL
FT                   TATATMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPF
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
FT   gene            complement(164932..166212)
FT                   /gene="hemL"
FT                   /locus_tag="SFV_0139"
FT   CDS_pept        complement(164932..166212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="SFV_0139"
FT                   /product="glutamate-1-semialdehyde aminotransferase
FT                   (aminomutase)"
FT                   /note="Code: H; COG: COG0001"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02424"
FT                   /db_xref="GOA:Q0T852"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T852"
FT                   /protein_id="ABF02424.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYFAVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLLEAAE
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFE
FT                   AGFMSVAHSMEDINNTIDAARRVFAKL"
FT   gene            166437..167858
FT                   /gene="yadQ"
FT                   /locus_tag="SFV_0140"
FT   CDS_pept        166437..167858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadQ"
FT                   /locus_tag="SFV_0140"
FT                   /product="putative channel transporter"
FT                   /note="Code: P; COG: COG0038"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02425"
FT                   /db_xref="GOA:Q0T851"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T851"
FT                   /protein_id="ABF02425.1"
FT                   /translation="MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTL
FT                   VGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEA
FT                   GGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMGLGREGPTVQIGGNISRMVL
FT                   DIFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGV
FT                   IMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLH
FT                   RVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLA
FT                   ASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
FT                   EQLARSKAASASENT"
FT   gene            167940..168284
FT                   /gene="yadR"
FT                   /locus_tag="SFV_0141"
FT   CDS_pept        167940..168284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="SFV_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG0316"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02426"
FT                   /db_xref="GOA:Q0T850"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T850"
FT                   /protein_id="ABF02426.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   gene            complement(168331..168954)
FT                   /gene="yadS"
FT                   /locus_tag="SFV_0142"
FT   CDS_pept        complement(168331..168954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="SFV_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2860"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02427"
FT                   /db_xref="GOA:Q0T849"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T849"
FT                   /protein_id="ABF02427.1"
FT                   /translation="MLVYWLDIVGTAVFAIYGVLLAGKLRMDPFGVLVLGVVTAVGDGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(168992..169819)
FT                   /gene="yadT"
FT                   /locus_tag="SFV_0143"
FT   CDS_pept        complement(168992..169819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadT"
FT                   /locus_tag="SFV_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: P; COG: COG0614"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02428"
FT                   /db_xref="GOA:Q0T848"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T848"
FT                   /protein_id="ABF02428.1"
FT                   /translation="MSHWCRNWHMAKSLFRALVALSFLAPLWLNAAPRVITLSPANTEL
FT                   AFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVD
FT                   QLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYVQLKAQYADKP
FT                   KKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIV
FT                   ITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
FT   gene            complement(169785..170483)
FT                   /gene="pfs"
FT                   /locus_tag="SFV_0144"
FT   CDS_pept        complement(169785..170483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="SFV_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: F; COG: COG0775"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02429"
FT                   /db_xref="GOA:Q0T847"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T847"
FT                   /protein_id="ABF02429.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ESLVQKLAHG"
FT   gene            170567..172084
FT                   /gene="dgt"
FT                   /locus_tag="SFV_0145"
FT   CDS_pept        170567..172084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="SFV_0145"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase"
FT                   /note="Code: F; COG: COG0232"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02430"
FT                   /db_xref="GOA:Q0T846"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T846"
FT                   /protein_id="ABF02430.1"
FT                   /translation="MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTG
FT                   PFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAALRLR
FT                   DGEEPLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGET
FT                   PETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFTVEQLYHHLHEAWGQHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVEQL
FT                   ELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEA
FT                   VSKLPSDSPEFPLWEYYYRCRLLQDYISGMTDLYAWDEYRRLMAVEQ"
FT   gene            172214..173638
FT                   /gene="htrA"
FT                   /locus_tag="SFV_0146"
FT   CDS_pept        172214..173638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="SFV_0146"
FT                   /product="periplasmic serine protease Do"
FT                   /note="heat shock protein HtrA; Code: O; COG: COG0265"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02431"
FT                   /db_xref="GOA:Q0T845"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T845"
FT                   /protein_id="ABF02431.1"
FT                   /translation="MKKNTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPML
FT                   EKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGG
FT                   GQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIA
FT                   LIQIQNPKKLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYE
FT                   NFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV
FT                   EYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLN
FT                   GKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEG
FT                   AEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVL
FT                   ALNIQRGDSTIYLLMQ"
FT   gene            173793..174937
FT                   /pseudo
FT                   /gene="yaeG"
FT                   /locus_tag="SFV_0147"
FT                   /note="frameshift; original product: hypothetical protein"
FT   gene            complement(175026..175412)
FT                   /gene="yaeH"
FT                   /locus_tag="SFV_0148"
FT   CDS_pept        complement(175026..175412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="SFV_0148"
FT                   /product="putative structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02432"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T844"
FT                   /protein_id="ABF02432.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
FT   gene            complement(175726..176550)
FT                   /gene="dapD"
FT                   /locus_tag="SFV_0149"
FT   CDS_pept        complement(175726..176550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="SFV_0149"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /note="Code: E; COG: COG2171"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02433"
FT                   /db_xref="GOA:Q0T843"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T843"
FT                   /protein_id="ABF02433.1"
FT                   /translation="MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEI
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(176581..179253)
FT                   /gene="glnD"
FT                   /locus_tag="SFV_0150"
FT   CDS_pept        complement(176581..179253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="SFV_0150"
FT                   /product="protein PII"
FT                   /note="Code: O; COG: COG2844"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02434"
FT                   /db_xref="GOA:Q0T842"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T842"
FT                   /protein_id="ABF02434.1"
FT                   /translation="MNTLPEQYANTALSTLPGQPQNPCAWPRDELTVCGIKAHIDTFQR
FT                   WLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLI
FT                   ESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPFDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVRNSAITGIYSTTLRQ
FT                   LRHARRHLQQPLCNIPQARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVDVWPRLPSTELIFIAALFHDIA
FT                   KGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEEALHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
FT   gene            complement(179315..180070)
FT                   /gene="map"
FT                   /locus_tag="SFV_0151"
FT   CDS_pept        complement(179315..180070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="SFV_0151"
FT                   /product="methionine aminopeptidase"
FT                   /note="Code: J; COG: COG0024"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02435"
FT                   /db_xref="GOA:Q0T841"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T841"
FT                   /protein_id="ABF02435.1"
FT                   /translation="MRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA
FT                   CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGK
FT                   PTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRG
FT                   FHEEPQVLHYDSRETNVVLKPGMTLTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYE
FT                   HTIVVTDNGCEILTLRKDDTIPAIISHDE"
FT   gene            180279..181202
FT                   /gene="rpsB"
FT                   /locus_tag="SFV_0152"
FT   CDS_pept        180279..181202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="SFV_0152"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /note="Code: J; COG: COG0052"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02436"
FT                   /db_xref="GOA:Q0T840"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T840"
FT                   /protein_id="ABF02436.1"
FT                   /translation="MVSTTYLWYKARRTSDPFRIHRLDGSDNLTLCNNTHVSAHIPGCP
FT                   LGSVIWDTWRHNPNVYIEVLIMATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKV
FT                   HIINLEKTVPMFNEALAELNKIVSRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWL
FT                   GGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGG
FT                   LPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLG
FT                   AVAATVREGRSQDLASQAEESFVEAE"
FT   gene            181460..182311
FT                   /gene="tsf"
FT                   /locus_tag="SFV_0153"
FT   CDS_pept        181460..182311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="SFV_0153"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /note="Code: J; COG: COG0264"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02437"
FT                   /db_xref="GOA:Q0T839"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T839"
FT                   /protein_id="ABF02437.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            182458..183183
FT                   /gene="pyrH"
FT                   /locus_tag="SFV_0154"
FT   CDS_pept        182458..183183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SFV_0154"
FT                   /product="uridylate kinase"
FT                   /note="Code: F; COG: COG0528"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02438"
FT                   /db_xref="GOA:Q0T838"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T838"
FT                   /protein_id="ABF02438.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            183475..184032
FT                   /gene="frr"
FT                   /locus_tag="SFV_0155"
FT   CDS_pept        183475..184032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="SFV_0155"
FT                   /product="ribosome releasing factor"
FT                   /note="Code: J; COG: COG0233"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02439"
FT                   /db_xref="GOA:Q0T837"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T837"
FT                   /protein_id="ABF02439.1"
FT                   /translation="MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKL
FT                   TDAAIKKIEAALADKEAELMQF"
FT   gene            184124..185320
FT                   /gene="yaeM"
FT                   /locus_tag="SFV_0156"
FT   CDS_pept        184124..185320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeM"
FT                   /locus_tag="SFV_0156"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /note="Code: I; COG: COG0743"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02440"
FT                   /db_xref="GOA:Q0T836"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T836"
FT                   /protein_id="ABF02440.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQ
FT                   CLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVSSGQQAACDMAALEEVDQVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQP
FT                   IQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVNSGVKPLDFCKLSALTFAAPDYERYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANASEVARKEVMRLAS"
FT   gene            185509..186267
FT                   /gene="yaeS"
FT                   /locus_tag="SFV_0157"
FT   CDS_pept        185509..186267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeS"
FT                   /locus_tag="SFV_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: I; COG: COG0020"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02441"
FT                   /db_xref="GOA:Q0T835"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T835"
FT                   /protein_id="ABF02441.1"
FT                   /translation="MLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQ
FT                   GNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALNAFANRERRFGGTEPGDETA"
FT   gene            186310..187137
FT                   /gene="cdsA"
FT                   /locus_tag="SFV_0158"
FT   CDS_pept        186310..187137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="SFV_0158"
FT                   /product="CDP-diglyceride synthetase"
FT                   /note="Code: I; COG: COG0575"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02442"
FT                   /db_xref="GOA:Q0T834"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T834"
FT                   /protein_id="ABF02442.1"
FT                   /translation="MLIPVVIAALFLLPPVGFAIVTLVVCMLAAWEWGQLSGFTTRSQR
FT                   VWLAVLCGLLLALMLFLLPEYHRNIHQPLVEISLWASLGWWIVALLLVLFYPGSAAIWR
FT                   NSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWGADSGAYMFGK
FT                   LFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLDVAPVTLLICSIVAALASV
FT                   LGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLVFRTL"
FT   gene            187149..188501
FT                   /gene="yaeL"
FT                   /locus_tag="SFV_0159"
FT   CDS_pept        187149..188501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="SFV_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: M; COG: COG0750"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02443"
FT                   /db_xref="GOA:Q0T833"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T833"
FT                   /protein_id="ABF02443.1"
FT                   /translation="MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGS
FT                   PLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL"
FT   gene            188531..190963
FT                   /gene="yaeT"
FT                   /locus_tag="SFV_0160"
FT   CDS_pept        188531..190963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="SFV_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: M; COG: COG4775"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02444"
FT                   /db_xref="GOA:Q0T832"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T832"
FT                   /protein_id="ABF02444.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHS
FT                   AEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGW
FT                   TYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQD
FT                   GAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQ
FT                   YSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            191085..191570
FT                   /gene="hlpA"
FT                   /locus_tag="SFV_0161"
FT   CDS_pept        191085..191570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="SFV_0161"
FT                   /product="histone-like protein"
FT                   /note="Code: M; COG: COG2825"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02445"
FT                   /db_xref="GOA:Q0T831"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T831"
FT                   /protein_id="ABF02445.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
FT   gene            191610..192599
FT                   /gene="lpxD"
FT                   /locus_tag="SFV_0162"
FT   CDS_pept        191610..192599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="SFV_0162"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /note="Code: M; COG: COG1044"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02446"
FT                   /db_xref="GOA:Q0T830"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T830"
FT                   /protein_id="ABF02446.1"
FT                   /translation="MDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQAS
FT                   AVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNV
FT                   SIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSG
FT                   TVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVIGNGVIIDNQ
FT                   CQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMR
FT                   PITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD"
FT   gene            192611..193159
FT                   /gene="fabZ"
FT                   /locus_tag="SFV_0163"
FT   CDS_pept        192611..193159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SFV_0163"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /note="Code: I; COG: COG0764"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02447"
FT                   /db_xref="GOA:Q0T829"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T829"
FT                   /protein_id="ABF02447.1"
FT                   /translation="MFAKLYGLSHSYDCGRPCYYCRFLYFDRKSILTTNTHTLQIEEIL
FT                   ELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILEAMAQA
FT                   TGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFKGVAL
FT                   VDGKVVCEATMMCARSREA"
FT   gene            193163..193951
FT                   /gene="lpxA"
FT                   /locus_tag="SFV_0164"
FT   CDS_pept        193163..193951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="SFV_0164"
FT                   /product="UDP-N-acetylglucosamine acetyltransferase"
FT                   /note="Code: M; COG: COG1043"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02448"
FT                   /db_xref="GOA:Q0T828"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T828"
FT                   /protein_id="ABF02448.1"
FT                   /translation="MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNTEGLKRRGFSREAITAIRNAYKLI
FT                   YRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR"
FT   gene            193951..195099
FT                   /gene="lpxB"
FT                   /locus_tag="SFV_0165"
FT   CDS_pept        193951..195099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="SFV_0165"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /note="Code: M; COG: COG0763"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02449"
FT                   /db_xref="GOA:Q0T827"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T827"
FT                   /protein_id="ABF02449.1"
FT                   /translation="MTDQRPLTIALVAGETSGDILGAGLIRALKERVPNARFVGVAGPR
FT                   MQAEGCEAWYEIEELAVMGIVEVLGRLRRLLHIRADLTKRFGELKPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKYNVPCRF
FT                   IGHTMADAMPLDPDKNGARDVLGIPYDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQT
FT                   YPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAAQAVLELAQ"
FT   gene            195096..195692
FT                   /gene="rnhB"
FT                   /locus_tag="SFV_0166"
FT   CDS_pept        195096..195692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="SFV_0166"
FT                   /product="RNAse HII"
FT                   /note="Code: L; COG: COG0164"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02450"
FT                   /db_xref="GOA:Q0T826"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T826"
FT                   /protein_id="ABF02450.1"
FT                   /translation="MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLND
FT                   SKKLSEKRRLALYEEIKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPKLPMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAEYGATEHHRRSFGPVKRALGLAS"
FT   gene            195828..199211
FT                   /gene="dnaE"
FT                   /locus_tag="SFV_0167"
FT   CDS_pept        195828..199211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SFV_0167"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /note="Code: L; COG: COG0587"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02451"
FT                   /db_xref="GOA:Q0T825"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T825"
FT                   /protein_id="ABF02451.1"
FT                   /translation="MGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLG
FT                   DELTHLTVLAANNTGYQNLALLISKAYQRGYGAAGPIIDRDWLIELNEGLILLSGGRMG
FT                   DVGRSLLRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEESYLHAAVELAEARGLPV
FT                   VATNDVRFIDSSDFDAHEIRVAIHDGFTLDDPKRPRNYSPQQYMRSEEEMCELFADIPE
FT                   ALANTVEIAKRCNVTVRLGEYFLPQFPTGDMSTEDYLVKRAKEGLEERLAFLFPDEEER
FT                   LKRRPEYDERLETELQVINQMGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYA
FT                   LKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVIEHVADMYGRDAVSQIIT
FT                   FGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEV
FT                   KALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYAG
FT                   LVKFDFLGLRTLTIINWALEMINKRRAKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVF
FT                   QLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREEISYPDVQW
FT                   QHESLKSVLEPTYGIILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVF
FT                   AEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAV
FT                   MTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGP
FT                   IEAIIEARNKGGYFRELFDLCARTDTKKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGD
FT                   ALKAADQHAKAEAIGQADMFGVLAEEPEQIEQSYASCQPWPEQVVLDGERETLGLYLTG
FT                   HPINQYLKEIERYVGGVRLKDMHPTERGKVITAAGLVVAARVMVTKRGNRIGICTLDDR
FT                   SGRLEVMLFTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLKMTAREVMDIDEAREKYA
FT                   RGLAISLTDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRADARARLRFGATWRVSPSD
FT                   RLLNDLRGLIGSEQVELEFD"
FT   gene            199224..200183
FT                   /gene="accA"
FT                   /locus_tag="SFV_0168"
FT   CDS_pept        199224..200183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SFV_0168"
FT                   /product="acetylCoA carboxylase, carboxytransferase
FT                   component, alpha subunit"
FT                   /note="Code: I; COG: COG0825"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02452"
FT                   /db_xref="GOA:Q0T824"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T824"
FT                   /protein_id="ABF02452.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
FT   gene            200282..202423
FT                   /gene="ldcC"
FT                   /locus_tag="SFV_0169"
FT   CDS_pept        200282..202423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="SFV_0169"
FT                   /product="lysine decarboxylase 2, constitutive"
FT                   /note="Code: E; COG: COG1982"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02453"
FT                   /db_xref="GOA:Q0T823"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T823"
FT                   /protein_id="ABF02453.1"
FT                   /translation="MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALWFFE
FT                   YALGQAEDIAIRMRQYTNEYLDNITPPFTKALFTYVKERQYTFCTPGHMGGTAYQKSPV
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTST
FT                   SNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFT
FT                   RDSIEEKVAATTQAQWPVHAVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGERVAGKVFFETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTT
FT                   SPSYPIVASVETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQ
FT                   VDEAECRPVAPGEQWHGFNDADADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRKHDLSGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETI
FT                   ALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIH
FT                   GAKQDEDGVYRVRVLKMAG"
FT   gene            202480..202869
FT                   /gene="yaeR"
FT                   /locus_tag="SFV_0170"
FT   CDS_pept        202480..202869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="SFV_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: E; COG: COG0346"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02454"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T822"
FT                   /protein_id="ABF02454.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEVYREARDSWK
FT                   GDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLESHNVKCEAIR
FT                   VDPYTQKRFTFFNDPDGLPLELYEQ"
FT   gene            202934..204233
FT                   /pseudo
FT                   /gene="mesJ"
FT                   /locus_tag="SFV_0171"
FT                   /note="frameshift; original product: cell cycle protein"
FT   gene            complement(204282..204542)
FT                   /gene="yaeO"
FT                   /locus_tag="SFV_0172"
FT   CDS_pept        complement(204282..204542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeO"
FT                   /locus_tag="SFV_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: K; COG: COG4568"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02455"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T821"
FT                   /protein_id="ABF02455.1"
FT                   /translation="MSMNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDL
FT                   VSRKNVEYLVVEAAGETRELRLDKITSFSRPEIGTVVVSES"
FT   gene            complement(204529..204729)
FT                   /gene="yaeP"
FT                   /locus_tag="SFV_0173"
FT   CDS_pept        complement(204529..204729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="SFV_0173"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02456"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T820"
FT                   /protein_id="ABF02456.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
FT   gene            204895..205440
FT                   /gene="yaeQ"
FT                   /locus_tag="SFV_0174"
FT   CDS_pept        204895..205440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="SFV_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4681"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02457"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T819"
FT                   /protein_id="ABF02457.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWL
FT                   SDDKNNLEVNLTAWQQPS"
FT   gene            205437..205859
FT                   /gene="yaeJ"
FT                   /locus_tag="SFV_0175"
FT   CDS_pept        205437..205859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="SFV_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: J; COG: COG1186"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02458"
FT                   /db_xref="GOA:Q0T818"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T818"
FT                   /protein_id="ABF02458.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTKEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE"
FT   gene            205873..206583
FT                   /gene="cutF"
FT                   /locus_tag="SFV_0176"
FT   CDS_pept        205873..206583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutF"
FT                   /locus_tag="SFV_0176"
FT                   /product="copper homeostasis protein (lipoprotein)"
FT                   /note="Code: MP; COG: COG3015"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02459"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T817"
FT                   /protein_id="ABF02459.1"
FT                   /translation="MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSW
FT                   RGVLPCADCEGIEISLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSK
FT                   GEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAATFT
FT                   DCATGKRFMVANNAELERSYLAARGHSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTA
FT                   GKFYPNKDCSSLGQ"
FT   gene            complement(206738..207571)
FT                   /gene="yaeF"
FT                   /locus_tag="SFV_0177"
FT   CDS_pept        complement(206738..207571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="SFV_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02460"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T816"
FT                   /protein_id="ABF02460.1"
FT                   /translation="MYKMDKPKAYCRLLLPSFLLLSACTVDISQPDPSATAVDAEAKTW
FT                   AVKFQHQSSFTEQSIKEITAPDLKPGDLLFSSSLGVTSFGIRVFSTSSVSHVAIFLGDN
FT                   NVAEATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATDITAFANKIKDSGYNYRGIV
FT                   EFIPFMVTRQMCSLNPFSEDFRQQCVSDLAKAQLSSVCEGDKKSWFCSEFVTDAFAKSG
FT                   HPLTLAQSGWISPADLMHMRIGDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTQ"
FT   gene            complement(207615..209258)
FT                   /gene="proS"
FT                   /locus_tag="SFV_0178"
FT   CDS_pept        complement(207615..209258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SFV_0178"
FT                   /product="proline tRNA synthetase"
FT                   /note="Code: J; COG: COG0442"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02461"
FT                   /db_xref="GOA:Q0T815"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T815"
FT                   /protein_id="ABF02461.1"
FT                   /translation="MLRAGMIRKLASGLYTWLPTGVRVLKKVENIVREEMNNAGAIEVS
FT                   MPVVQPADLWQESGRWEQYGPELLRFVDRGERPFVLGPTHEEVITDLIRNELSSYKQLP
FT                   LNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHTSQESLQETYDAMYAAYSKIFSRM
FT                   GLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVVFSDTSDYAANIELAEAIAPKEPRAA
FT                   ATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTLLVKAVEGSSFPLVALLVRGDHELNE
FT                   VKAEKLPQVASPLTFATEEEIRAVVKAGPGSLGPVNMPIPVVIDRTVAAMSDFAAGANI
FT                   DGKHYFGINWDRDVATPEVADIRNVVAGDPSPDGQGTLLIKRGIEVGHIFQLGTKYSEA
FT                   LKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQNYDERGIVWPDAIAPFQVAILPMNM
FT                   HKSFRVQELAEKLYSELRAQGIEVLLDDRKERPGVMFADMELIGIPHTIVLGDRNLDND
FT                   DIEYKYRRNGEKQLIKTGDIVEYLVKQIKG"
FT   gene            complement(209444..210151)
FT                   /gene="yaeB"
FT                   /locus_tag="SFV_0179"
FT   CDS_pept        complement(209444..210151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="SFV_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1720"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02462"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T814"
FT                   /protein_id="ABF02462.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIASYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKGSVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
FT   gene            complement(210148..210552)
FT                   /gene="rcsF"
FT                   /locus_tag="SFV_0180"
FT   CDS_pept        complement(210148..210552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="SFV_0180"
FT                   /product="regulator in colanic acid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02463"
FT                   /db_xref="GOA:Q0T813"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T813"
FT                   /protein_id="ABF02463.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKQMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNITAK"
FT   gene            complement(210670..211485)
FT                   /gene="yaeC"
FT                   /locus_tag="SFV_0181"
FT   CDS_pept        complement(210670..211485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeC"
FT                   /locus_tag="SFV_0181"
FT                   /product="putative lipoprotein"
FT                   /note="Code: P; COG: COG1464"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02464"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T812"
FT                   /protein_id="ABF02464.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(211525..212163)
FT                   /gene="yaeE"
FT                   /locus_tag="SFV_0182"
FT   CDS_pept        complement(211525..212163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="SFV_0182"
FT                   /product="putative transport system permease protein"
FT                   /note="Code: P; COG: COG2011"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02465"
FT                   /db_xref="GOA:Q0T811"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T811"
FT                   /protein_id="ABF02465.1"
FT                   /translation="MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANA
FT                   KLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVE
FT                   NALLEIPTGLIEASRAMGATPMQIVCKVLLPEALPGLVNAATITLITLVGYSAMGGAVG
FT                   AGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
FT   gene            complement(212171..213202)
FT                   /gene="abc"
FT                   /locus_tag="SFV_0183"
FT   CDS_pept        complement(212171..213202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abc"
FT                   /locus_tag="SFV_0183"
FT                   /product="ATP-binding component of a transporter"
FT                   /note="Code: P; COG: COG1135"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02466"
FT                   /db_xref="GOA:Q0T810"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T810"
FT                   /protein_id="ABF02466.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSRHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQTEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   gene            213390..213965
FT                   /gene="yaeD"
FT                   /locus_tag="SFV_0184"
FT   CDS_pept        213390..213965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeD"
FT                   /locus_tag="SFV_0184"
FT                   /product="putative phosphatase"
FT                   /note="Code: E; COG: COG0241"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02467"
FT                   /db_xref="GOA:Q0T809"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T809"
FT                   /protein_id="ABF02467.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKM
FT                   GFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFR
FT                   QVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP
FT                   EAENAADWVLNSLADLPQAIKKQQKPAQ"
FT   gene            214329..215870
FT                   /gene="rrsH"
FT                   /locus_tag="SFV_0185"
FT   rRNA            214329..215870
FT                   /gene="rrsH"
FT                   /locus_tag="SFV_0185"
FT                   /product="16S ribosomal RNA"
FT   gene            215956..216031
FT                   /locus_tag="SFV_0186"
FT   tRNA            215956..216031
FT                   /locus_tag="SFV_0186"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            216225..219128
FT                   /gene="rrlH"
FT                   /locus_tag="SFV_0187"
FT   rRNA            216225..219128
FT                   /gene="rrlH"
FT                   /locus_tag="SFV_0187"
FT                   /product="23S ribosomal RNA"
FT   gene            219223..219341
FT                   /gene="rrfH"
FT                   /locus_tag="SFV_0188"
FT   rRNA            219223..219341
FT                   /gene="rrfH"
FT                   /locus_tag="SFV_0188"
FT                   /product="5S ribosomal RNA"
FT   gene            219394..219470
FT                   /locus_tag="SFV_0189"
FT   tRNA            219394..219470
FT                   /locus_tag="SFV_0189"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            219633..220436
FT                   /gene="yafB"
FT                   /locus_tag="SFV_0190"
FT   CDS_pept        219633..220436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafB"
FT                   /locus_tag="SFV_0190"
FT                   /product="putative aldose reductase"
FT                   /note="Code: R; COG: COG0656"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02468"
FT                   /db_xref="GOA:Q0T808"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T808"
FT                   /protein_id="ABF02468.1"
FT                   /translation="MAIPAFGLGTFRLKDDVVISSVKTALELGYRAIDTAQIYDNEAAV
FT                   GQAIAESGVPRHELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDE
FT                   VSVEEFMQALLEAKKQGLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRK
FT                   VVAWAKQHGIHITSYMTLAYGKALKDEVIARIAAKHNAIPAQVILAWAMGEGYSVIPSS
FT                   TKRKNLESNLKAQNLQLDAEDKKAIAALDCNDRLVSPEGLAPEWD"
FT   mobile_element  complement(220461..221888)
FT                   /mobile_element_type="insertion sequence:IS4"
FT   gene            complement(220475..221821)
FT                   /locus_tag="SFV_0191"
FT   CDS_pept        complement(220475..221821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0191"
FT                   /product="IS4 ORF"
FT                   /note="Code: L; COG: COG3385"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02469"
FT                   /db_xref="GOA:Q0T4W1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T4W1"
FT                   /protein_id="ABF02469.1"
FT                   /translation="MFPDSFMHIGQALDLVSRYDSLRNPLTSLGDYLDPELISRCLAES
FT                   GTVTLRKRRLPLEMMVWCIVGMALERKEPLHQIVNRLDIMLPGNRPFVAPSAVIQARQR
FT                   LGSEAVRRVFTKTAQLWHNATPHPHWCGLTLLAIDGVFWRTPDTPENDAAFPRQTHAGN
FT                   PALYPQVKMVCQMELTSHLLTAAAFGTMKNSENELAEQLIEQTGDNTLTLMDKGYYSLG
FT                   LLNGWSLAGEHRHWMIPLRKGAQYEELRKLGKGDHLVKLKTSPQARKKWPGLGNEVTAR
FT                   LLTVTRKGKVCHLLTSMTDAMRFPGGEMADLYSNRWEIELGYREIKQTMQLSRLTLRSK
FT                   KPELVEQELWGVLLAYNLVRYQMIKMAEHLKGYWPNQLSFSESCGMVMRMLMTLQGASP
FT                   GRIPELMRDLASMGQLVKLPTRRGRAFPRVVKERPWKYPTAPKKSQSVA"
FT   gene            complement(221871..222785)
FT                   /gene="yafC"
FT                   /locus_tag="SFV_0192"
FT   CDS_pept        complement(221871..222785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="SFV_0192"
FT                   /product="putative transcriptional regulator LYSR-type"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02470"
FT                   /db_xref="GOA:Q0T806"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T806"
FT                   /protein_id="ABF02470.1"
FT                   /translation="MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVV
FT                   LHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSY
FT                   RKIIASPDYISRYGKPETIDDLKQHVCLGFTEPASLNTWPIACSDGQLHEVKYGLSSNS
FT                   GETLKQLCLSGNGIACLSDYMIDKEIARGELVELMADKVLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEHVKTAPGGVMPIS"
FT   gene            223026..223826
FT                   /gene="yafD"
FT                   /locus_tag="SFV_0193"
FT   CDS_pept        223026..223826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="SFV_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3021"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02471"
FT                   /db_xref="GOA:Q0T805"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T805"
FT                   /protein_id="ABF02471.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
FT   gene            223904..224674
FT                   /gene="yafE"
FT                   /locus_tag="SFV_0194"
FT   CDS_pept        223904..224674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="SFV_0194"
FT                   /product="putative biotin synthesis protein"
FT                   /note="Code: QR; COG: COG0500"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02472"
FT                   /db_xref="GOA:Q0T804"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T804"
FT                   /protein_id="ABF02472.1"
FT                   /translation="MTTQSHHDHVEKQFSSQACEYLTSTVHASGRDLQRLAVRLADYPG
FT                   ASVLDMGCGAGHASFVAAQNVSAVVAYDLSAQMLDVVAQAAEARQLKNITTRQGYAESL
FT                   PFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRMIVMDVMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYASGEWLRLINEANLIVDNLITDKLPLEFCSWVARMRTPEALVDAIRI
FT                   YQQSASTEVRTYFALQNDGSFTSDIIMVEAHKAA"
FT   gene            complement(224722..226080)
FT                   /gene="dniR"
FT                   /locus_tag="SFV_0195"
FT   CDS_pept        complement(224722..226080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dniR"
FT                   /locus_tag="SFV_0195"
FT                   /product="transcriptional regulator for nitrite reductase
FT                   (cytochrome c552)"
FT                   /note="Code: M; COG: COG0741"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02473"
FT                   /db_xref="GOA:Q0T803"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T803"
FT                   /protein_id="ABF02473.1"
FT                   /translation="MKAKAILLASVLLVGCQSTGNVQQHAQSLSAAGQGEAAKFTSQAR
FT                   WMDDGTSIAPDGDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYW
FT                   IAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDAR
FT                   RDVVASTTAALNMMQRLNKMFDDDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLP
FT                   LPQETKQYVPKMLALSDILKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGIS
FT                   VSKLKTFNAGVKGSTLGASGPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNS
FT                   RVYTVRSGDTLSSIASRLGVSTKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDS
FT                   ITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVKNNNMPDS"
FT   gene            complement(226152..226907)
FT                   /gene="gloB"
FT                   /locus_tag="SFV_0196"
FT   CDS_pept        complement(226152..226907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="SFV_0196"
FT                   /product="probable hydroxyacylglutathione hydrolase"
FT                   /note="Code: R; COG: COG0491"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02474"
FT                   /db_xref="GOA:Q0T802"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T802"
FT                   /protein_id="ABF02474.1"
FT                   /translation="MNLNSIPAFDDNYIWVLNDEAGRCLIVDPGDAEPVLNAITANNWQ
FT                   PEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSV
FT                   ITTPGHTLGHICYFSKPYLFCGDTLFSGGCGRLFEGTALQMYQSLKKLSALPDDTLVCC
FT                   AHEYTLSNMKFALSIFPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDI
FT                   DLINGINEETLLQQPEERFAWLRSKKDRF"
FT   gene            226941..227663
FT                   /gene="yafS"
FT                   /locus_tag="SFV_0197"
FT   CDS_pept        226941..227663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="SFV_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: QR; COG: COG0500"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02475"
FT                   /db_xref="GOA:Q0T801"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T801"
FT                   /protein_id="ABF02475.1"
FT                   /translation="MKPARVPQTVVAPDCWGDLPWGELYRKALERQLNPWFTKMYGFHL
FT                   LKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADPLHLPFADKSVDICLLAHTLPWCT
FT                   DPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHASRFHVLPWNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNK
FT                   PRIRQAVGATRQCRKPQA"
FT   gene            complement(227660..228238)
FT                   /gene="rnhA"
FT                   /locus_tag="SFV_0199"
FT   CDS_pept        complement(227660..228238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="SFV_0199"
FT                   /product="RNase HI"
FT                   /note="degrades RNA of DNA-RNA hybrids, participates in DNA
FT                   replication; Code: L; COG: COG0328"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02477"
FT                   /db_xref="GOA:Q0T800"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T800"
FT                   /protein_id="ABF02477.1"
FT                   /translation="MVSVSRTIWRVIAVLIAVIYVRLVVLQFDSITGSLPEMLKQVEIF
FT                   TDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVIL
FT                   STDSQYVRQGITQWLHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAG
FT                   HPENERCDELARAAAMNPTLEDTGYQVEV"
FT   gene            228183..228923
FT                   /gene="dnaQ"
FT                   /locus_tag="SFV_0198"
FT   CDS_pept        228183..228923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="SFV_0198"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /note="Code: L; COG: COG0847"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02476"
FT                   /db_xref="GOA:Q0T7Z9"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z9"
FT                   /protein_id="ABF02476.1"
FT                   /translation="MTAMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRR
FT                   LTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAA
FT                   FDIGFMDYEFSLLKRDIPKTNTFCKVTDSLVVARKMFPGKRNSLDALCARYEIDNSKRT
FT                   LHGALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATD
FT                   EELAAHEARLDLVQKKGGSCLWRA"
FT   gene            229056..229132
FT                   /locus_tag="SFV_0200"
FT   tRNA            229056..229132
FT                   /locus_tag="SFV_0200"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            complement(229263..230309)
FT                   /gene="safA"
FT                   /locus_tag="SFV_0201"
FT   CDS_pept        complement(229263..230309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safA"
FT                   /locus_tag="SFV_0201"
FT                   /product="putative cytoplasmic protein"
FT                   /note="Code: S; COG: COG3515"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02478"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z8"
FT                   /protein_id="ABF02478.1"
FT                   /translation="MEIFLSDPISAECPCGPDLEYDPEYLLLFTRAAPREEAQYGDFVS
FT                   TPENINWAELERDAHRLLMRSKDIRILVVLLRCRIQQAGARGLSEALTLLETLCSTYPD
FT                   AIHPQLLATEDITAEDAAVARSNALAALLDHEGVMADIRGITLSNNAAMRLQVRDVERS
FT                   LSALRPADALAPESVRQQLADLEARGTLPLDAFRQAAETTERLQRHARETLNDQAPDFS
FT                   RLTQLLALLPGAVQSTTPEILPQPQAEQPENATIVHTEQMQAEQIALPVHIAEEISPMT
FT                   GAEPRQIRDRNDALERLRVIRRWFEHSEPSSPTIPLLRQAEGLVGKRVSEVINEIPVEL
FT                   LEKWDALE"
FT   gene            complement(230320..230832)
FT                   /locus_tag="SFV_0202"
FT   CDS_pept        complement(230320..230832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02479"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z7"
FT                   /protein_id="ABF02479.1"
FT                   /translation="MPDHARLAASAHLVRESRNPDGLATTLAHYFGVPFRIQEYVLHWI
FT                   AVADDEITRLGMPAPSSVIGNGALIGQAVPDMQYKFRLVIGPLTLEDYRRFLPGSNNLP
FT                   VLTELVRAFSGYEYCWEIELQLKPHAAPPAVTGGPYQLGWTAWAGKAMHDNPVTGMIFE
FT                   PEQYLAH"
FT   gene            complement(230987..231304)
FT                   /gene="safB"
FT                   /locus_tag="SFV_0203"
FT   CDS_pept        complement(230987..231304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safB"
FT                   /locus_tag="SFV_0203"
FT                   /product="periplasmic chaperone of fimbral assembly
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02480"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z6"
FT                   /protein_id="ABF02480.1"
FT                   /translation="MSNDFTQAQAPPWRYGFLNLMRRVDVQLCTVPAGNTWQPRMEKFR
FT                   LGQTPALTFAPREIASVGWQEGRLHISLYSLGLWGRTVHCRCTTPNWRVTGLKADAAPF
FT                   F"
FT   gene            complement(231301..233080)
FT                   /pseudo
FT                   /gene="safC"
FT                   /locus_tag="SFV_0204"
FT                   /note="frameshift; original product: outer membrane usher
FT                   protein"
FT   gene            complement(233200..233694)
FT                   /locus_tag="SFV_0205"
FT   CDS_pept        complement(233200..233694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0205"
FT                   /product="putative cytoplasmic protein"
FT                   /note="Code: S; COG: COG3518"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02481"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z5"
FT                   /protein_id="ABF02481.1"
FT                   /translation="MSASRQRPGNHLLPTLFDRLCDDAPNQKRDHGISVSPVQIKEIIR
FT                   RDLSFLLNTVSHEDDIDAARYPYAAASVLNYGLPPLAGSFLYEHKWDDIRRAILRTITR
FT                   FEPRLKASTLQIIPLQDERRQSGHNTLQFEIRGEILTQPYPTAFRVRSALDMEQSRITF
FT                   F"
FT   gene            complement(233889..234521)
FT                   /gene="sat1"
FT                   /locus_tag="SFV_0206"
FT   CDS_pept        complement(233889..234521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sat1"
FT                   /locus_tag="SFV_0206"
FT                   /product="putative cytoplasmic protein"
FT                   /note="Code: R; COG: COG4455"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02482"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z4"
FT                   /protein_id="ABF02482.1"
FT                   /translation="MTNNNELPITLSALLRDYSVVEGIQMAEQQVRMHPAQASRRHSLF
FT                   QLLCVAGDWSRALQQIQLCARMDANYTREAQVFGELIRCEIYRHACFQGEQRPGVILPP
FT                   PAWMEDLLTALACNARGEAQEADAHRSRALEAITDTSGQWNGGAFDWISDSDSRTGPVL
FT                   ELIAGGAYIWLPFSQICSLKSPRPAHLIDLIWKPVNVTLNNGDTHSA"
FT   gene            complement(234508..234885)
FT                   /gene="sat2"
FT                   /locus_tag="SFV_0207"
FT   CDS_pept        complement(234508..234885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sat2"
FT                   /locus_tag="SFV_0207"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02483"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z3"
FT                   /protein_id="ABF02483.1"
FT                   /translation="MLSPEQDLNRHADPFPFNEEPSSQDLDSLRDLVTEAETLQDMVTG
FT                   GLSIDAILNVLDATGEDETIWPVEKTPPDILHLLSPEYAPETAHNTVLPDLTRKEHRII
FT                   GIDSHYRINPAQHGEIYHDKQ"
FT   mobile_element  235429..236759
FT                   /mobile_element_type="insertion sequence:IS2"
FT   gene            235520..235885
FT                   /locus_tag="SFV_0208"
FT   CDS_pept        235520..235885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0208"
FT                   /product="IS2 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02484"
FT                   /db_xref="GOA:Q0SXX5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXX5"
FT                   /protein_id="ABF02484.1"
FT                   /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQ
FT                   LFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMKNELLKEAVEYG
FT                   RAKKWIAHAPLLPGDGE"
FT   gene            235909..236748
FT                   /locus_tag="SFV_0209"
FT   CDS_pept        235909..236748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0209"
FT                   /product="IS2 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02485"
FT                   /db_xref="GOA:Q0T7Z1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z1"
FT                   /protein_id="ABF02485.1"
FT                   /translation="MSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYG
FT                   YRRVWALLRRQAELDDMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRVAVKESN
FT                   QRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAGTTGGFNSETVQDVMLGAVERRFG
FT                   NDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDY
FT                   ISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLEI"
FT   gene            complement(236805..237323)
FT                   /locus_tag="SFV_0210"
FT   CDS_pept        complement(236805..237323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02486"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Z0"
FT                   /protein_id="ABF02486.1"
FT                   /translation="MPSMIEIILLIILHIWLCRQGGDHFWSESRLNISLLMLKVEHLAR
FT                   GKGLRLDKSQSSQTPGFSLAFAGLFIATKVKTMDEEYRKDLQLWFGLTHASFCVMPRVF
FT                   MEAMPPEWQEKMAQLLFEYSDTIKTDVCGVHSCFVTAKDGNNRFMRMPEDILNYRHPRR
FT                   EFIESFLKK"
FT   gene            complement(237311..237778)
FT                   /locus_tag="SFV_0211"
FT   CDS_pept        complement(237311..237778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0211"
FT                   /product="endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02487"
FT                   /db_xref="GOA:Q0T7Y9"
FT                   /db_xref="InterPro:IPR004929"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Y9"
FT                   /protein_id="ABF02487.1"
FT                   /translation="MSRVTAIISALVICIIVCLSWAVNHYRDNAITYKEQRDKNAGELK
FT                   LANATITDMQQRQRDADALDAKYTKELADAKAENDALRRKLDNGGRVLVKGKCPVPSSA
FT                   ETSSASGMGNDATVELSPVAGRNVLGIRDGIIRDQTALRTLQEYIRTQCLR"
FT   gene            complement(237775..238308)
FT                   /locus_tag="SFV_0212"
FT   CDS_pept        complement(237775..238308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0212"
FT                   /product="putative lysozyme"
FT                   /note="Code: R; COG: COG3772"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02488"
FT                   /db_xref="GOA:Q0T1M2"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T1M2"
FT                   /protein_id="ABF02488.1"
FT                   /translation="MSAKIKYGLSAAVLALIAAGASAPQILDQFLNEKEGNHTTAYRDG
FT                   SGIWTICRGATMVDGKPVIPGMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAG
FT                   IASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAIRWWIKDVGRDCRIRSNNCYGQVIR
FT                   RDQESALACWEIDQ"
FT   gene            complement(238374..238934)
FT                   /locus_tag="SFV_0213"
FT   CDS_pept        complement(238374..238934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0213"
FT                   /product="hypothetical bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T1M3"
FT                   /protein_id="ABF02489.1"
FT                   /translation="MSALVSSEDENKRRDEHYAAIYDYCHKVAHETFMKFLQEKFLPAA
FT                   LSEKEAAYLRPEYVITVNSAGEEEHKSDFIASAPDKDQEPHRPFRVSCEEGEFVVYENG
FT                   KPVRASHHHCLKIINLAIRCLKDENTRVMKRIGRCMGYLQVAAEIEALASGADMDAAVR
FT                   EALLRDFNTPPLRKSLMTGSSRG"
FT   gene            complement(239008..239223)
FT                   /locus_tag="SFV_0214"
FT   CDS_pept        complement(239008..239223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02490"
FT                   /db_xref="GOA:Q0T1M4"
FT                   /db_xref="InterPro:IPR007054"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T1M4"
FT                   /protein_id="ABF02490.1"
FT                   /translation="MKSMDKISTGIAYGTSAGSAGYWFLQWLDQVRPSQWAAIGVLGSL
FT                   LLGLLTYLTNLYFKIREDKRKAARGE"
FT   gene            complement(239978..241117)
FT                   /locus_tag="SFV_0215"
FT   CDS_pept        complement(239978..241117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Y5"
FT                   /protein_id="ABF02491.1"
FT                   /translation="MSITNQINKASSLASLRQPQRDKDGQIIKGSIWGTDISRTDYVQM
FT                   TNGQDAQVLNVGFTDRSGRPMAFGNDSHDFVQALEDSLDETFNDGDFRTAVMENVFPCE
FT                   FRPYGTDPTPIRRQALQNRTVRFKHNGAFNPAKDAPSTTAIKGASVTVTPVLNPETNKT
FT                   GILCSATTHVSDFDMMGGWTEGALIQTVGDMQVQYCRQMFAAVVDVLKDTPDLQIIEAA
FT                   PLSGKPSDQAEDLLDTLALNLPVELGNTLSDYAVLVPERLEAILDRAAQRAGHEDISEL
FT                   LGCTVCSYAGDDTGIYLLPKRFASISFRSTKDAKTVDVKVTRNSNTAGYDLELISVVDV
FT                   LATGSVKVKAGEFDVEKDASFPLIHVIRFTTPRVTINPE"
FT   gene            complement(241219..241629)
FT                   /locus_tag="SFV_0216"
FT   CDS_pept        complement(241219..241629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Y4"
FT                   /protein_id="ABF02492.1"
FT                   /translation="MSISYRKLDIALSADKETVLVFGQELSTKYFTEIVVTTMLNSTGS
FT                   DMANSNRILNDIHAAGLDAGDYGKYSRWWAQSNAQERQEAERRRKEAKAHQERMAAIHA
FT                   TPEEIAKAVAERKAREEALIKRFGNKGAAFGL"
FT   mobile_element  242290..243539
FT                   /mobile_element_type="insertion sequence:IS911"
FT   gene            242362..242664
FT                   /locus_tag="SFV_0217"
FT   CDS_pept        242362..242664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0217"
FT                   /product="IS911 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02493"
FT                   /db_xref="GOA:Q0T2D7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T2D7"
FT                   /protein_id="ABF02493.1"
FT                   /translation="MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQ
FT                   LRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEILKKATALLMSDSLNSSR"
FT   gene            242965..243531
FT                   /locus_tag="SFV_0218"
FT   CDS_pept        242965..243531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0218"
FT                   /product="IS911 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02494"
FT                   /db_xref="GOA:Q0T2D8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T2D8"
FT                   /protein_id="ABF02494.1"
FT                   /translation="MNMLLSLTTLKGSSPVTEPNQVWCGDVTYIWTGKRWAYLAVVLDL
FT                   FARKPVGWAMSFSPDSRLTMKALEMAWETRGKPGGVMFHSDQGSHYTSRQFRQLLWRYQ
FT                   IRQSMSRRGNCWDNSPMERFFRSLKNEWMPVVGYVSFSEAAHAITDYIVGYYSALRPHE
FT                   YNGGLPPNESENRYWKNSNSVASFC"
FT   gene            243525..244589
FT                   /locus_tag="SFV_0219"
FT   CDS_pept        243525..244589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0219"
FT                   /product="putative terminase large subunit"
FT                   /note="Code: R; COG: COG5565"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02495"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Y1"
FT                   /protein_id="ABF02495.1"
FT                   /translation="MLTTSATSPFFPNLVDHLLVKHHTADGVEDGISICYFKPYSQGRA
FT                   RWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTKFLKNPSKS
FT                   QKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEETIKCQPF
FT                   ECPDHFYVIGGMDFGWDHPQAQVQLWWDKEADTIYVSRVWKAKEKTAVQAWGAVKSWAH
FT                   KVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELRDMMLD
FT                   GRFKVFNTCEPFFEEFRLYHRDENGKIVKLNDDVLSAVRYAYMMRRFAKMMRDIKKPKE
FT                   KKIPAPIRPIARRT"
FT   gene            244590..246755
FT                   /locus_tag="SFV_0220"
FT   CDS_pept        244590..246755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0220"
FT                   /product="putative packaging glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02496"
FT                   /db_xref="InterPro:IPR032427"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Y0"
FT                   /protein_id="ABF02496.1"
FT                   /translation="MADENRLNSILCKFDADWMASDEARTEATNDLYFSRVSQWDDWLS
FT                   NYTTLQYRGQFDVVRPEVRKLVAEMRRNPVDVLFRPKDGANPDAADVLMGMYRTDMRHN
FT                   TAKIAVNVGVREQIESGVGAWRLVTQYEDNDPTSNNQVIRRLPIHEACSHVIWDANSKQ
FT                   MDKSDAKHCTVINALSRNGWKEFAEDYGIDPDTLPSFQNPNDTWLFPWVSNDVVYVAEY
FT                   YEVEEEKEKVFIYRDPLTGEPVSYYQQDIKDVIDDLANRGFIKVAERKVKRRRVYKSII
FT                   TCTQILKDREKIAGEHIPIVPVYGEWSFAGDKECYEGVVRLTKDGQRLRNMIMSFNADI
FT                   VARSPKKKPTFFPEQIEGYEYMYGGNDDYPYYLQNRTDENGNDLPIGPISYMENPEVPQ
FT                   ANAYMLEAATNAVKEVASLGVDAQAANGQVAFDTVNQLNMRADLETYVFQDNLATAMRR
FT                   DGEIYASMVNDIYDVPRHVTLTLEDGSEKDVQLYAQVVDYQSGNVVTLNDIRGRYECYT
FT                   DVGPSFQSMKEQNRAEIQELLTKVPQGTPEFQMLMLQYFTLLDGKGVEMMREYANKQLV
FT                   MMGLKKPETPEEMEMVQQAQQQPQQPSAEQIQAQGILLQGQAELLKAENQQAQIQVEAA
FT                   KVEAQNQLNAAKIAEIFNNMDLDKQAELREYLRLVGQFQQQRSKDARANAELLLKDADQ
FT                   THSQRMDFANLMRQVQIPSGGVAETPQ"
FT   gene            246769..247680
FT                   /locus_tag="SFV_0221"
FT   CDS_pept        246769..247680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0221"
FT                   /product="putative scaffolding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02497"
FT                   /db_xref="InterPro:IPR015385"
FT                   /db_xref="InterPro:IPR027393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X9"
FT                   /protein_id="ABF02497.1"
FT                   /translation="MDQTTDIQASEELTLPGNHAAASADGLVVDNANDSAGQEEGFEIV
FT                   LKDDEKPKQDPATNAEFARRRIERKRQRELEQQMEAVKRGELPEHLRVNPELPKQPDPN
FT                   DYLSEDALAKYDYDQSRALAAFQQANSEWQIKAMDARSQAVAEQGRKTQEFTQQSAQYV
FT                   EAARKHYDAAEKLNIPDYQEKEDAFMQLVPPAVGADIMRLFPEKSAALMYHLGANPEKT
FT                   RQLLAMDGQSALIELTRLSERLTLKPRAKPVSEAPLPDEPIQGHAVAANISAIEKQMEA
FT                   AANKGDVETYRKLKAQLNKGIR"
FT   gene            247680..248975
FT                   /locus_tag="SFV_0222"
FT   CDS_pept        247680..248975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0222"
FT                   /product="putative coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02498"
FT                   /db_xref="InterPro:IPR024659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X8"
FT                   /protein_id="ABF02498.1"
FT                   /translation="MALNEGQLVTYALDEIIETVQNLTPMASKVTKYTPPAESMQRSSN
FT                   TVWMPVEQEAPTQTGWDLTGNATGILELSVKCNMGDPDNDFFELRADDLRDERSYRRRI
FT                   QASAKKLANNIESAIAKQATEMGSLVVHDTRAIGPSTGLPGWDFVSDAERLMFSRELNR
FT                   DMGISYFLNPDDYRKAGRNLVDGDIFGRVPEEAYRNGTIQRQIAGFDEILRSPKLPAVT
FT                   KSTATGVTVSGAQKFKPQAYTLDTDGNKENVDNRVATVTVSSTTGFKRGDKISFTGVKF
FT                   LSQMAKNVLTDDATFSITRVIDGTHIEITPKPIALDDASLTKEEKAYANVNTSLADTTP
FT                   VNVLNVATTTANVFWADDSIRLLSQPIPVTHELFAGMKTSSFSIPGIGVNGIFATQGDI
FT                   NTLSGKCRIAVWYSACAVRPEAIGVGLPNQTA"
FT   gene            248972..249244
FT                   /locus_tag="SFV_0223"
FT   CDS_pept        248972..249244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0223"
FT                   /product="hypothetical bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02499"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X7"
FT                   /protein_id="ABF02499.1"
FT                   /translation="MITRGSFGSRFYLETSMTHMIFRHGDMKKWKGVGYDFEIVKAEEL
FT                   QEYLDAGWFSHPDDLLKDVAEPEEKQRKKPGRKPKAAADEPDNEG"
FT   gene            249222..249722
FT                   /locus_tag="SFV_0224"
FT   CDS_pept        249222..249722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0224"
FT                   /product="putative DNA stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02500"
FT                   /db_xref="InterPro:IPR020362"
FT                   /db_xref="InterPro:IPR038258"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X6"
FT                   /protein_id="ABF02500.1"
FT                   /translation="MNLTTKGDLVLAALRKLGVASNATLTDVEPQSMEDGVNDLEMMMA
FT                   EWLGGDASPGINVGYIFADADVAPDPGDEHGLSNNAINAVIFNLACRIAPDYALEASAK
FT                   LITTARYGKERLVKLSAMDRAKAAKCKSGYPNRMPVGSGNQLAKWNGWNYFHRKEPCDN
FT                   GSE"
FT   gene            249723..251141
FT                   /locus_tag="SFV_0225"
FT   CDS_pept        249723..251141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0225"
FT                   /product="putative packaged DNA stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02501"
FT                   /db_xref="InterPro:IPR021098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X5"
FT                   /protein_id="ABF02501.1"
FT                   /translation="MPIQQLPLMKGVGKDFRNADYIDYLPVNMLATPKEILNSSGYLRS
FT                   FPGIAKRSDVNGVSRGVEYNMAQNAVYRVCGGKLYKGESEVGDVAGSGRVSMAHGRTSQ
FT                   AVGVNGQLVEYRYDGTVKTVSNWPADSGFTQYELGSVRDITRLRGRYAWSKDGTDSWFI
FT                   TDLEDESHPDRYSAQYRAESQPDGIIGIGTWRDFIVCFGSSTIEYFSLTGATTVGAALY
FT                   VAQPSLMVQKGIAGTYCKTPFADSYAFISNPATGAPSVYIIGSGQVSPIASASIEKILR
FT                   SYTADELADGVMESLRFDAHELLIIHLARHVLVYDASSSANGPQWCVLKTGLYDDVYRA
FT                   IDFIYEGNQITCGDKLESVTGKLQFDISSQYDKQQEHLLFTPLFKADNARVFDLEVESS
FT                   TGVAQYADRLFLSATTDGINYGREQMIEQNEPFVYDKRVLWKRVGRIRKNVGFKLRVIT
FT                   KSPVTLSGAQIRIE"
FT   gene            251141..251989
FT                   /locus_tag="SFV_0226"
FT   CDS_pept        251141..251989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0226"
FT                   /product="putative packaged DNA stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02502"
FT                   /db_xref="InterPro:IPR032395"
FT                   /db_xref="InterPro:IPR038681"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X4"
FT                   /protein_id="ABF02502.1"
FT                   /translation="MADSNLNVPVIIQATRLDTSVLPRNIFSQSYLLYVIAQGTDVGNV
FT                   ANKANEAGQGAYDAQVRNDEQDVILADHEQRISAAEATLVNHEERISQAESTLQEHETR
FT                   IAQNESDIASLDTRVQSLESQVSDHETRIDALEYATTRKKSEVVYSGVSVTIPTAPTNL
FT                   VSLLKTLTPSSGSLTPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSGTANRSMQLTFSG
FT                   AVPDTLVSSRNSATTTDNILLATFFSVDKDGFLAANGSTLTIQSNGAAFTATTIKIIAE
FT                   Q"
FT   gene            251989..252444
FT                   /locus_tag="SFV_0227"
FT   CDS_pept        251989..252444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0227"
FT                   /product="putative head assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02503"
FT                   /db_xref="InterPro:IPR022568"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X3"
FT                   /protein_id="ABF02503.1"
FT                   /translation="MIQFKPTRNIDLIEAVGNHPDIIAGSNNGDGYDYKPDCRYFEVNV
FT                   HGQFGGIVYYQEIQPLAFDCHAMYLPEIRGFSKEIGLSFWRYILTNTTVQCVTSFAARK
FT                   FRHGQMYCAMVGLKRVGTIKKYFKGVDDVTFYSATREELIDFLNHGR"
FT   gene            252447..253139
FT                   /locus_tag="SFV_0228"
FT   CDS_pept        252447..253139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0228"
FT                   /product="putative DNA transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02504"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X2"
FT                   /protein_id="ABF02504.1"
FT                   /translation="MLYAFKLGRKLRGEEPYCPEKGGKGGSSDKSAKYAAEAQKYAADL
FT                   QNQQWQTIMKNLAPFTPLAEQYVNQLQNLSSLEGQGQALNQYYNSQQYKDLAGQARYQS
FT                   LAAAEATGGLGSTATSNQLATIAPTLGQSWLSNQMSNYNNLANVGLGALQGQANAGQTY
FT                   ANNMSSIAQQSAALAAANANKPSSLQTAISGGTSGAIAGAGLASLLGTSTPWGAGIGAG
FT                   IGLLGSLF"
FT   gene            253149..254480
FT                   /locus_tag="SFV_0229"
FT   CDS_pept        253149..254480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0229"
FT                   /product="putative prophage DNA injection protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02505"
FT                   /db_xref="InterPro:IPR031619"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X1"
FT                   /protein_id="ABF02505.1"
FT                   /translation="MATWQGSNGGLLAGIGGVNSNAPNVNDIGNTLQLIRQNNDIERSG
FT                   ANNVGLTALQGLSGIAGVFQQEKQAQRQKEFQQAYANAYASGDRGALRQLATQYPDQIE
FT                   SVRKGMGFIDEDQRNSIGTLAAGARLASSSPEAMQSWLQNNAGELARVGVNPQDVAQMY
FT                   QQNPRQFGEFVDHLGMNSLGPEKYFDLQDKMQGRQVTMRGQDLDSQTAARNQAITMRGQ
FT                   DIQANLGQQRINLDAETNRINNENKRLDRMLSAETNDLKRQEIQSRIAANNQQLQQKQQ
FT                   ALNDGYKDGINTLTTSMFTLNDIVSSPSLKSITGLRGVIPNVPGSQAADTQARLDTFKS
FT                   QAYLTAVQAMRGMGALSDAEGKKLDQAVGSLQNSQSEESFRRNAGVILNTLNQKRNEAV
FT                   GKYVQQNGIKRVEAPQASIDYLKQHPELSIDFINRYGYLPSLGQ"
FT   gene            254481..256211
FT                   /locus_tag="SFV_0230"
FT   CDS_pept        254481..256211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0230"
FT                   /product="putative DNA transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02506"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7X0"
FT                   /protein_id="ABF02506.1"
FT                   /translation="MANYRDLLEQAGARYGVPEGLMTALGAKESSYNPAAVSSAGAVGL
FT                   TQVMPGTWRDMGYTDEQMQNPEYQADAGARYLAKMYQQFGNWRDALQAYHDGPGNVMKA
FT                   KRGEYTPGPEGRGYVDDRFAQWAGDPVTDSTVEQRATSAKVHPQQDPNNPFAQLEVQSS
FT                   EQVSASGVQSDPNNPFAQIEQQAASQQPPQPVSSVAPKPVQQQTVNQANNAPTREEPSL
FT                   MQQAGDWLTGGQSAGQIAEQAGRGLVNIPFDVLQGGASLINAISQGLGGPKVLDDVYRP
FT                   VDRPTDPYAQAGESIGGYLVPGAGVAGNMVIGSLADAANQRGDFAENAAINAGLSIATH
FT                   GLINGVTRGVRGASNIISGNKTSAQRATTAPTETSPFSGDAAAATNPAVHAAEARVAQG
FT                   VPMTPATKNPEEVVRTVAAQKRPNLASSLDELDINPQAEVLESAERLNVDSLLPSHFSG
FT                   NEQYKAVEQAIKSRAGSALQVQENEAIRQLAQGAGEIIDRVSGAKDALGMSDKFIDTVN
FT                   GRMSALMKRSDQLYRNVEKAMPAGAKIDAPSTRSMLKQVEEDLGGMKNLDPIEKRVEVA
FT                   "
FT   mobile_element  256283..257592
FT                   /mobile_element_type="insertion sequence:IS629"
FT   gene            256337..256663
FT                   /locus_tag="SFV_0231"
FT   CDS_pept        256337..256663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0231"
FT                   /product="IS629 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02507"
FT                   /db_xref="GOA:Q0T7W9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W9"
FT                   /protein_id="ABF02507.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTPE
FT                   TLRVRVRQHERDTGGGDGGLTTAERQRLKEPERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            256663..257550
FT                   /locus_tag="SFV_0232"
FT   CDS_pept        256663..257550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0232"
FT                   /product="IS629 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02508"
FT                   /db_xref="GOA:Q0T7K5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K5"
FT                   /protein_id="ABF02508.1"
FT                   /translation="MPLLDKLREQYGVGPLCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKKEIQRVYDENHKVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGD
FT                   SYDNAMAESINGLYKAKVIHRKSWKNRAEVELATLTWVDWYNNRRLLERLGHTPPAEAE
FT                   KAYYASIGNDDLAA"
FT   gene            complement(257596..258033)
FT                   /locus_tag="SFV_0233"
FT   CDS_pept        complement(257596..258033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0233"
FT                   /product="IS600 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02509"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W7"
FT                   /protein_id="ABF02509.1"
FT                   /translation="MCQVFGVSRSGYYNWVQHEPSDRKQSDERLKLEIKVAHIRTRETY
FT                   GTRRLQTELAENGIIVGRDRLACLRKELRLRCKQKRKFRATTNPNHNLPVAPNLLNQTF
FT                   APTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCEIVGYAM"
FT   mobile_element  complement(257599..258435)
FT                   /mobile_element_type="insertion sequence:IS600"
FT                   /note="partial"
FT   gene            complement(258069..258371)
FT                   /locus_tag="SFV_0234"
FT   CDS_pept        complement(258069..258371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0234"
FT                   /product="IS600 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02510"
FT                   /db_xref="GOA:Q0SX79"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SX79"
FT                   /protein_id="ABF02510.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            258523..258855
FT                   /locus_tag="SFV_0235"
FT   CDS_pept        258523..258855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0235"
FT                   /product="putative terminase"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02511"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W5"
FT                   /protein_id="ABF02511.1"
FT                   /translation="MSHDLADEDLNPITIIQNYTNMSDPMKELEAAIESGRFHHDGNPI
FT                   MTWCIGNVVGKTIPGNDDVVKPVKEQAENKIDGAVALIMAVGRAMLYEKEDTLSDYIES
FT                   YGIRSL"
FT   gene            258867..259049
FT                   /gene="ymfR"
FT                   /locus_tag="SFV_0236"
FT   CDS_pept        258867..259049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymfR"
FT                   /locus_tag="SFV_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02512"
FT                   /db_xref="GOA:Q0T7W4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W4"
FT                   /protein_id="ABF02512.1"
FT                   /translation="MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLV
FT                   VRYLDRTQLSVGGGK"
FT   gene            259049..260290
FT                   /locus_tag="SFV_0237"
FT   CDS_pept        259049..260290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0237"
FT                   /product="putative portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02513"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W3"
FT                   /protein_id="ABF02513.1"
FT                   /translation="MFFSGLFQRKSDAPVTTPAELADAIGLSYDTYTGKQISSQRAMRL
FT                   TAVFSCVRVLAESVGMLPCNLYHLNGSLKQRATGERLHKLISTHPNSYMTPQELWELVV
FT                   TCLCLRGNFYAYKVKAFGEVAELLPVDPGCVVPKLNSSWEPVYQVTFPDGSTDVLSQED
FT                   IWHVRTLTLDGLVGLNPIAYAREAISLAAATEEHGARLFSNGAVTSGVLRTEQTLSDQA
FT                   YERLKKDFEERHTGLGNAHRPMILEMGRDWKSMALNAEDSQFLETRKFQLEEICRLFRV
FT                   PLHMVQNTDRATFNNIEELGLGFINYSLVPYLTRIEQRINTGLVRKSKQGVYYAKFNAG
FT                   ALLRGDMKSRFEAYATGINWGIYSPNDCRDLEDMNPRPGGNVYLTPMNMTTKPSDGSKA
FT                   GKQKDNANADETTS"
FT   gene            260268..260918
FT                   /locus_tag="SFV_0238"
FT   CDS_pept        260268..260918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0238"
FT                   /product="putative prohead protease"
FT                   /note="Code: R; COG: COG3740"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02514"
FT                   /db_xref="GOA:Q0T7W2"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W2"
FT                   /protein_id="ABF02514.1"
FT                   /translation="MQTKQRLDVPLSLKSVSDSGEFEGYGSVFGVKDSHDDVVMSGAFA
FT                   ASLRAWSDRKALPALLWQHRMDEPIGVYTEMKEDDVGLYVRGRLLIDDDPLAKRAHAHM
FT                   KAGSLTGLSIGYVLKDWEYDRTKEAFLLKEIDLWEVSLVTFPSNDEARISDVKNALARG
FT                   EIPEQKKIERVLRDVGLSRTQAKAFMAGGYGALSLRDAEDVGSALDALKNLNF"
FT   gene            260933..262138
FT                   /locus_tag="SFV_0239"
FT   CDS_pept        260933..262138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0239"
FT                   /product="putative bacteriophage protein"
FT                   /note="Code: R; COG: COG4653"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02515"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W1"
FT                   /protein_id="ABF02515.1"
FT                   /translation="MAVDIKDVEQVAQELQQKFDDFKAKNDKRVDAIEQEKGKLAGQVE
FT                   TLNGKLSELENLKSDLEKELLELKRPAGGAQNKLATEHKEAFVGFLRKGREDGLRDLER
FT                   KALQVGTDEDGGYAVPEALDRNILTLLKDEVVMRQEATVITVGGSDYKKLVNLGGTASG
FT                   WVGETDARSQTATSKLGLIEPFMGEIYGNPQATQKMLDDAFFNVEAWINSELATEFAEQ
FT                   EEIAFTTGDGTKKPKGFLAYESTDETDKVRAFGKLQHIVSGDATAVTADAIIKLIYTLR
FT                   KAHRTGAKFMMNNNSLFAIRLLKDTEGNYLWRPGLELGQPSSLAGYGIAENEQMPDIAA
FT                   DAKAIAFGNFKRGYTIVDRIGTRILRDPYTNKPFVGFYTTKRTGGMLVDSQAIKLLKIA
FT                   AA"
FT   gene            262188..262388
FT                   /locus_tag="SFV_0240"
FT   CDS_pept        262188..262388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0240"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7W0"
FT                   /protein_id="ABF02516.1"
FT                   /translation="MILKQDLKWSPDGMRVEVIRAGEYDDGALPARVQEIALQAGLAER
FT                   GISAKSSKAAKEKKATTSKEG"
FT   gene            262391..262714
FT                   /locus_tag="SFV_0241"
FT   CDS_pept        262391..262714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0241"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02517"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V9"
FT                   /protein_id="ABF02517.1"
FT                   /translation="MLLTMEEIKAQLRLDEDFDVDDRHLQLLACAAQKRTETYLNRKLY
FT                   APDETIPDSDPDGLHLPDDIRLGMLMLISHFYENRSSVTEVEKLDMPQSFGWLVGPYRY
FT                   FPQ"
FT   gene            262711..263121
FT                   /locus_tag="SFV_0242"
FT   CDS_pept        262711..263121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0242"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02518"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V8"
FT                   /protein_id="ABF02518.1"
FT                   /translation="MKIRQAQTSATYILPDPGELNKRVLIRQRVDMPADNFGVEPQYPV
FT                   TFRTWAKVIQTSATTWQETAQTGDAITHYITIRYRRGITADYEVVCGDSVYRVKRQRDL
FT                   NGARRFLLLECTELGEFTQSHGGSNGDFLFAR"
FT   gene            263096..263602
FT                   /locus_tag="SFV_0243"
FT   CDS_pept        263096..263602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0243"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02519"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V7"
FT                   /protein_id="ABF02519.1"
FT                   /translation="MATSFLHVDFQQPAEMRFNRARVRRAFVTIGQRHMRDARRLVMRR
FT                   ARSAPGENPGYQTGRLARSIGYMVPRASKHRPGFMARIAPNQRNGEGNRRITGDFYPAF
FT                   LFYGVRRGAKRRRSHHRGASGGSGWRLAPRNNFMVETLEKNRSWTRYFLARELRKSLKP
FT                   ERRHR"
FT   gene            263599..264159
FT                   /locus_tag="SFV_0244"
FT   CDS_pept        263599..264159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0244"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02520"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V6"
FT                   /protein_id="ABF02520.1"
FT                   /translation="MKLTPVIAALRARCPYFENRVAGAAQFKNLPEVGKLKLPAAYVVP
FT                   GDDSPGENKSQTDYWQELKEGFSVVVILSNGRDERGQFASYDVVDDVRQMLFKALLGWN
FT                   PEACGNPITYDGGTLLDLNRHELIYQFDFSVISELTEDDTRQQDDLNSLDELQTLAIDV
FT                   DYLEPGNGPDGDIEHHTEITLPS"
FT   gene            264322..265818
FT                   /locus_tag="SFV_0245"
FT   CDS_pept        264322..265818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0245"
FT                   /product="putative sheath protein"
FT                   /note="Code: R; COG: COG4386"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02521"
FT                   /db_xref="InterPro:IPR007067"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V5"
FT                   /protein_id="ABF02521.1"
FT                   /translation="MTISFNTIPSNTLVPLFYAEMDNQAANTAQDSGASLLIGHANNGA
FT                   EIVANSLVLMPSADYARQICGAGSQLARMVEAYRQTDPFGELYVIAVPEATGAAATVTL
FT                   TVTGEATESGTVNVYVGRTRVQAPVTNGDNVTTIASSIKDAINAVPTLPFTASSSAGVV
FT                   TLTARHKGLCGNEIPVSLNYYGFGGGEVLPAGVQIAVATGTAGTGAPVLTGAVAAMADE
FT                   PFDYIGLPFNDTASVNTLVTEMNDTSGRWSYARQLYGHVYTAKTGTLSELVNAGDQFNQ
FT                   QHITLAGYEKETQTPADELAASRTARAAVFIRNDPARPTQTGELVGMLPAPKGKRFTMT
FT                   EQQTLLSHGVATAYVESGVLRIQRDVTTYRKNAYGVADNSYLDSETLHTSAYVLRKLKS
FT                   VITSKYGRHKLASDGTRFGPGQAIVTPAVIKGELLATYRQLERAGIVENYELFKQYLVV
FT                   ERDASDPNRLNTLFPPDYVNQLRVFAVVNQFRLQYSEESA"
FT   gene            265818..266174
FT                   /locus_tag="SFV_0246"
FT   CDS_pept        265818..266174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0246"
FT                   /product="hypothetical bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02522"
FT                   /db_xref="InterPro:IPR019596"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V4"
FT                   /protein_id="ABF02522.1"
FT                   /translation="MARIGGTCYFKIDGQQLSLTGGIEVPMNRTVNDDIIGLDGSVDRK
FT                   ETHRAPYVKGTFKVPKNFPVNKITSSDEMTITAELANGQVYVLSSAWLHGEANHNAEEG
FT                   TVDLEFHGEEGDYQ"
FT   gene            266174..266443
FT                   /locus_tag="SFV_0247"
FT   CDS_pept        266174..266443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0247"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02523"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V3"
FT                   /protein_id="ABF02523.1"
FT                   /translation="MKELELKKPITAHGETLSVLEFDEPTGKDVRELGYPYQMNQDESV
FT                   RLLAHVVSKYIVRLAKVPQSSVDQMSPADLNAAAWLVAGFFLQA"
FT   gene            266585..268420
FT                   /locus_tag="SFV_0248"
FT   CDS_pept        266585..268420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0248"
FT                   /product="putative tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02524"
FT                   /db_xref="GOA:Q0T7V2"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V2"
FT                   /protein_id="ABF02524.1"
FT                   /translation="MAEFELKALITGVDRLSPALSKMQKKIRGFKRQAEEASQGGLALG
FT                   GGLAAGLTLSLKSYADQENAATGLKVAMMDANGEVGKSFQDINKLAIGLGNQLPGTTAD
FT                   FQNMMQMLVRQGIQAENILGGVGKATAYLAVQLKKTPEAAAEFAAKMQDATGTASEDMM
FT                   GLFDTIQKAFYLGVDDTNMLSFFTKTSSVLKMVNKDGLQAAQSLAPISVMMDQMGMNGE
FT                   SAGNALRKVIQSGLSVKKIRDVNKVMARQKLGVQLDFTDGKGSFGGLDNMFKQLAKLRK
FT                   LTDVKRTGVLKAIFGDDAETLQVVNALIDKGKDGYDQIQQKMNKQASLNKRVQAQLGTL
FT                   SNLWEAMTGTATNGLAAIGGAFSGDAKNITQWLGELGEKFTKFADENPRVIRGVVGLAA
FT                   GLAILKLGLMGVGSAISIVSRIMSMTPIGMIATAIALAAGLIITNWDVVGPYFKKLWET
FT                   ISPYFEAGWELLKKVFAWSPLGMVINNWGPVVKWFQDMWDKLKPIIEWFTDSSGDTVDA
FT                   INSAQWGAGAYDAYGTGIPARGYTPYQAVDPAQSNNASDATGPNPFMINKASAPKVDGE
FT                   IKVSFVNSPPGMRVMETRSSGFDVSHDVGYTRFGR"
FT   gene            268481..269809
FT                   /locus_tag="SFV_0249"
FT   CDS_pept        268481..269809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0249"
FT                   /product="tail/DNA circulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02525"
FT                   /db_xref="InterPro:IPR009826"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V1"
FT                   /protein_id="ABF02525.1"
FT                   /translation="MTWKDRLQDASFRGVPFKVEEESAGTGRRVETHEYPNRDKPYTED
FT                   LGKITFRPSITAYVVGDDCFDQRDRLIDALNKPGPGTLVHPTYGELKVCVDGEVRVSTS
FT                   KSEGRIVRFDLKFVEAGELSYPTSGAATAQTLMSSCSALDDCISDSFSGFSIDGVADFV
FT                   QNDVVGNASTMLGYVSDAMKVVDSAVSDAARLLQGDISVLLPPPSSGKNFVEQVQKMWR
FT                   TGKRLYGNASDLVTMIKTLSGVSLGSDLQPRGVWKTDSKTTATATQQRNMVASTLRTTA
FT                   ISEAAYAVTRLPAPTTSAVMQNAAVGQATTPAQSTGWPSVTHPALNNAPAVKNTVDLPT
FT                   WEELTDIRDTLNTAIDKELSRTTSDALFLALRRVKADLNADINTRLEQSARIIQRTPDE
FT                   VLPALVLAATWFDNAARDADIIRRNAITHPGFVPVIPLKVPVQ"
FT   gene            269806..270885
FT                   /locus_tag="SFV_0250"
FT   CDS_pept        269806..270885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0250"
FT                   /product="tail protein"
FT                   /note="Code: R; COG: COG4379"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02526"
FT                   /db_xref="InterPro:IPR023399"
FT                   /db_xref="InterPro:IPR026276"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7V0"
FT                   /protein_id="ABF02526.1"
FT                   /translation="MNDNVTLRVNGREWNGWTSVRIGVGIERLARDFSVEITRQWPGDE
FT                   GITTLQPRIKNGSKVEVLIGDELVITGWVEATPVRYDARSVSTGIAGRSLTADLIDCAA
FT                   EPTQFNGRSLVQIAQALAAPFGIEVVNSGAPSGVIPDVQPDHGETVIEVINKILGQQQA
FT                   LAYDDPHGRLVIGGIGSTRAHTALVLGENILSCDTEKSIRERFSVYQVAGQRAGNDDDF
FT                   GEATTTALRARTEDAFIDRYRPMYIRQTGQATGAGCIARADFEARQRAARTDETTYVVQ
FT                   GWRQGNGTLWQPNQRVIVFDPVCGFDNTELLVSEVTFTQDQNGTLTEIRVGPPDAYLPE
FT                   PEAPGARKKKKARVQEDPF"
FT   gene            270885..271433
FT                   /locus_tag="SFV_0251"
FT   CDS_pept        270885..271433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0251"
FT                   /product="tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02527"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR014462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U9"
FT                   /protein_id="ABF02527.1"
FT                   /translation="MRTIEAMQRQLLGLIGRAVVKSISAATKCQTVDVSLIAGEPKAGI
FT                   EHLEPYGFTARANSGAEAVVLFPDGDRSHAVVVTVSDRRYRLKGLQTGEVAVYDDRGQS
FT                   VTLTREGIVVDGAGKTITFRNAPRARFEMDLEVTGQVKDLCDSGGTTMSAMRLAYNGHR
FT                   HRENGQGSNTDKPDKAMEA"
FT   gene            271433..271858
FT                   /locus_tag="SFV_0252"
FT   CDS_pept        271433..271858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0252"
FT                   /product="tail protein"
FT                   /note="Code: S; COG: COG4381"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02528"
FT                   /db_xref="InterPro:IPR010877"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U8"
FT                   /protein_id="ABF02528.1"
FT                   /translation="MELWLTVNGKRTCASAQLDPLTRAVVISLFTWRRAEPDDNADVPM
FT                   GWWGDTWPAVQNDRYGSRLWLLQRSKLTNQLVQTVRGYIRECLQWMIDDGVVSRIDLDI
FT                   RRTGINELGNSITLWRRDGPVMISFDDLWSAITHGGQ"
FT   gene            271845..272903
FT                   /locus_tag="SFV_0253"
FT   CDS_pept        271845..272903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3299"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02529"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U7"
FT                   /protein_id="ABF02529.1"
FT                   /translation="MADSEFQRPTLAENISMLRNDLFARLDVSDTLRRMDEDVRAKVYA
FT                   AALHTVYGYIDYLAMNMLPDLCDESWLARHAAMKRCPRKGATAASGYMRWEGVSDGLKV
FT                   TAGSVIQRDDLVQYTTTDDATSTGGVLRVPIACSSAGAVGNADDGTALILVTPVNGLPS
FT                   SGVADTLTGGFDTEELETWRARVIERYYWTPQGGADGDYVVWAKEVPGITRAWTYRHWM
FT                   GTGTVGVMIASSDLINPIPEESTETAARQHIEPLAPVAGSDLYVFRPVAHMVDFHIRVT
FT                   PDTPEIRAAITAELRSFLLRDGYPQGKLKVSRISEAISGANGEYSHQLLAPADNISIAK
FT                   NELAVLGTISWT"
FT   gene            272894..273478
FT                   /locus_tag="SFV_0254"
FT   CDS_pept        272894..273478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3778"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02530"
FT                   /db_xref="InterPro:IPR018755"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U6"
FT                   /protein_id="ABF02530.1"
FT                   /translation="MDVTNDDYIRLLSALLPPGPAWSASDPSIAGAAPSLTRVHQRADA
FT                   LMRELDPRTTTELINRWERLCGLPDECIPAGTQTLRQRQQRLDAKVNLAGGINENFYLA
FT                   QLAALGRPDATITRYDKSTFTCSSACTDAVNVPEWRYYWQVNMPAATNTTWMTCGDPCD
FT                   SALRIWGDTVVECVLNKLCPSHTYVIFKYPE"
FT   gene            274041..274544
FT                   /locus_tag="SFV_0255"
FT   CDS_pept        274041..274544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02531"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U5"
FT                   /protein_id="ABF02531.1"
FT                   /translation="MSITLDLILQCRPVQDMVHLLMRITLQWDINEMSYFYSASTNGFY
FT                   STEFHGTNIPDDAVEISESEWKTLINSQSVTKMITCGENGHPVIVDRPSPTPEQLALIN
FT                   NEKKSALIAEATNVIAPLQDAVDLDMATDDETKLLLAWKKYRVLLMRVDIKNIEWPKKP
FT                   EENK"
FT   gene            complement(274667..275920)
FT                   /gene="gtrV"
FT                   /locus_tag="SFV_0256"
FT   CDS_pept        complement(274667..275920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrV"
FT                   /locus_tag="SFV_0256"
FT                   /product="serotype-specific glucosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02532"
FT                   /db_xref="GOA:Q0T7U4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U4"
FT                   /protein_id="ABF02532.1"
FT                   /translation="MKSLKTSYVKKLFFLIAVFFIAVILMYLRRPDIIRTPQFWAEDGH
FT                   VWYAMAYNNGIFTSMIFPQNGYYQTISKLIASISLNFNLMYAPLIFNISAIIVRALLVS
FT                   FILSGRFSYVNITPRIFTALFIIIMPEVSEVHANVTNDHWYLSLYLLLVMLAPKPTNNY
FT                   QKAHDYIAIIICGLSGPFIVFMAPMVGINILIQKRLSTKKITTHEYVFIAICFIQFISI
FT                   IMTSSETRVDMALGANFATLCKILTTKVFLGLWANGDFLSPLWNHDSICIAITMICLSI
FT                   TIFTFIVSNYPMRSAIVFAILTLTFSLAKPMLSSTSEQWPLLIHGGGRYSVIPTIIWYS
FT                   VLVYFLNYISHLHFKFLPWMLYTTSLISCLYFFNLTPLPDYGWKEQVKKFESLAPGESY
FT                   SFKFNPAGWTMTLIKKQP"
FT   gene            complement(275917..276840)
FT                   /gene="gtrB"
FT                   /locus_tag="SFV_0257"
FT   CDS_pept        complement(275917..276840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrB"
FT                   /locus_tag="SFV_0257"
FT                   /product="bactoprenol glucosyl transferase"
FT                   /note="Code: M; COG: COG0463"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02533"
FT                   /db_xref="GOA:Q0T7U3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U3"
FT                   /protein_id="ABF02533.1"
FT                   /translation="MKISLVVPVFNEEEAIPVFYKTVREFQELKPYEVEIVFINDGSKD
FT                   ATESIINALAVSDPLVVPLSFTRNFGKEPALFAGLDHASGDAVIPIDVDLQDPIEVIPH
FT                   LIEKWQAGADMVLAKRSDRSTDGRLKRKTAEWFYKLHNKISTPKIEENVGDFRLMSREV
FT                   VENIKLLPERNLFMKGILSWVGGQTDVVEYVRAERVAGISKFNGWKLWNLALEGITSFS
FT                   TFPLRVWTYIGLFVASISFLYGAWMIIDTLVFGNPVRGYPSLLVSILFLGGVQLIGIGV
FT                   LGEYIGRIYIESKHRPKYIIKNEKQK"
FT   gene            complement(276837..277199)
FT                   /gene="gtra"
FT                   /locus_tag="SFV_0258"
FT   CDS_pept        complement(276837..277199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtra"
FT                   /locus_tag="SFV_0258"
FT                   /product="bactoprenol-linked glucose translocase"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02534"
FT                   /db_xref="GOA:Q0T7U2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR016480"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U2"
FT                   /protein_id="ABF02534.1"
FT                   /translation="MLKLFVKYTSIGVLNTLIHWVVFGVCIYAAHTSQALANFTGFVVA
FT                   VSFSFFANARFTFKASTTAMRYMLYVGFMGILSVIVGWAADKCSLPPIVTLITFSAISL
FT                   VCGFVYSKFIVFRDAK"
FT   gene            complement(277461..278621)
FT                   /locus_tag="SFV_0259"
FT   CDS_pept        complement(277461..278621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0259"
FT                   /product="putative integrase"
FT                   /note="Code: L; COG: COG0582"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02535"
FT                   /db_xref="GOA:Q0T7U1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U1"
FT                   /protein_id="ABF02535.1"
FT                   /translation="MSIKLRGGTWHCDFVAPDGSRVRRSLETSDKRQAQELHDRLKAEA
FT                   WRVKNLGESPKKLFKEACIRWLREKSDKKSIDDDKSIISFWMLHFREAILSDITTEKIM
FT                   EAVDGMENRRHRLNWEMSRDRCLRLGNPVPEYKPKLASKGTKTRHLAILRAILNMAVEW
FT                   GWLDRAPKISTPRVKNGRIRWLTEEESKRLFAEIAPHFFPVVMFAITTGLRRSNVTDLE
FT                   WSQVDLDKKMAWMHPDETKAGNAIGVPLNETACQILRKQQGLHKRWVFVHTKPAYRSDG
FT                   TKTAAVRKMRTDSNKAWKGALKRAGISNFRFHDLRHTWASWLVQSGVSLLALKEMGGWE
FT                   TLEMVQRYAHLSAGHLTEHASKIDAIISRNGTNTAQEENVVYLNAR"
FT   gene            complement(279662..280501)
FT                   /locus_tag="SFV_0260"
FT   CDS_pept        complement(279662..280501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0260"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02536"
FT                   /db_xref="InterPro:IPR007539"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7U0"
FT                   /protein_id="ABF02536.1"
FT                   /translation="MTTITKERLLTIKQWRETYGPGSNVVLPAEEAEELARIALASLEA
FT                   EPVAYIFKHPAGKLFWALTDESNKEQADVIPVYAAAPASVVPDNASEPLAYAYKELTPE
FT                   IMRNHLAVFERYGIAPNDSSTTIQALRIALDGIERSDAMLHGAEPVSQTYKLPPLSSNE
FT                   VNDAAWKLHNMLTEHGPLNGRQFNNLKGCFYEALKVAMRNYPVTPDGWISCSERMPEDT
FT                   KMLLAFSQGQIVAAYWNWVMSPIDYKKYRAFTYLSGNILDDVTHWMPLLEPPEQDGE"
FT   gene            complement(280503..281159)
FT                   /locus_tag="SFV_0261"
FT   CDS_pept        complement(280503..281159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0261"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02537"
FT                   /db_xref="InterPro:IPR025153"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T9"
FT                   /protein_id="ABF02537.1"
FT                   /translation="MSKIDYQALREAAEKATWGDWDSYKPHRGARGYEVRLSSQAIAQH
FT                   VLKNNAEFIAAFNPKIALALLDERERNQQYIKSRDQENEDIALTVGKLRVELEGKDSKI
FT                   ANLTAERDALREGEMGDARYSNTRAAADIYFQLVEECEIPAGGSLVEYVDDMREKLESA
FT                   EKRIAELEEREILLPERSSMLHRTDFHEDYQTVMAYKVSEVIDAIRATGIRIKGE"
FT   gene            complement(281146..281463)
FT                   /locus_tag="SFV_0262"
FT   CDS_pept        complement(281146..281463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02538"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T8"
FT                   /protein_id="ABF02538.1"
FT                   /translation="MTITKQRLEEIISRIEMYGHGAGYTADEVYDLAVLALNLSNIANL
FT                   KRYELDMDGCDSFGQDCGADMTEDSDGDYVLFDDVVKLFEFDTTTQKLEGQAKETTSEQ
FT                   D"
FT   gene            complement(281566..281922)
FT                   /locus_tag="SFV_0263"
FT   CDS_pept        complement(281566..281922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0263"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02539"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T7"
FT                   /protein_id="ABF02539.1"
FT                   /translation="MKQMSLIEMDGFLKGKCIPRDLKVNETNTEYLVRKFGELESKLET
FT                   ALRECRSAGITIDNLEAKCAKMAAENTSLKQSEKEFNDFCREEFSEWEDDVTETPATDA
FT                   FLAEIETRRNPQVH"
FT   gene            complement(282426..282908)
FT                   /locus_tag="SFV_0264"
FT   CDS_pept        complement(282426..282908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02540"
FT                   /db_xref="InterPro:IPR008840"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T6"
FT                   /protein_id="ABF02540.1"
FT                   /translation="MSKLYEIANEYAKLMDSDLEPEMIADTIEGMEGEFTDKIEQLLSV
FT                   IKNETGYAERLKEEAKSLNERAAVIQNKINSIMAYIASSLEMVGKKKIRAGIHQVTIRK
FT                   SSETVEIFDSSALPPEYVEFETTIKPDKLAIKHQLKAGINIPGAQLKVGKPSLLIK"
FT   gene            complement(282892..283794)
FT                   /locus_tag="SFV_0265"
FT   CDS_pept        complement(282892..283794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0265"
FT                   /product="putative phage-related DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02541"
FT                   /db_xref="GOA:Q0T7T5"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T5"
FT                   /protein_id="ABF02541.1"
FT                   /translation="MSNIVEFVKQQEQLFCGALTEQTVTWAKESQFAIQYFQKNDYLAK
FT                   TALANPTSAQNAIINVAAIGITLNPASKLAYLVPRDGMVCLDISYMGLLHLAQSTGSIK
FT                   WGQCKLVYSNDTYESNGLDSAPTHKYNAFGERGSIVGGYCTVKTADGDYLTEEMSLAEI
FT                   KAVEATSKAKNGPWKTFWEEMARKTIIKRASKYWPKAQRLDNAIHLLNEDEGMHQEPVM
FT                   PHKSEEDIREDERKRQQEIMDKAQLLCDEMAQAENMDDLKRYFAEAYRLTSGMKLQQNV
FT                   QAIYIECKAKLEVASEQTV"
FT   gene            complement(283791..284099)
FT                   /locus_tag="SFV_0266"
FT   CDS_pept        complement(283791..284099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02542"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T4"
FT                   /protein_id="ABF02542.1"
FT                   /translation="MILTLNDKREISQIIASFTDEDYERINSEVDRLCKRCDPISEMLR
FT                   SYKPDEHTKDAIDWLEDDDCNYQEKAAEWFWDAITERVKAEYAFAIFKRRHIYGEAA"
FT   gene            complement(284251..284493)
FT                   /locus_tag="SFV_0267"
FT   CDS_pept        complement(284251..284493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0267"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02543"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T3"
FT                   /protein_id="ABF02543.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYPPFQPDFIGTAFTKKYFNRSRL"
FT   mobile_element  284319..285086
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            284568..285071
FT                   /gene="insB"
FT                   /locus_tag="SFV_0268"
FT   CDS_pept        284568..285071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0268"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02544"
FT                   /db_xref="GOA:Q0SXA0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXA0"
FT                   /protein_id="ABF02544.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLVRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(286308..286631)
FT                   /locus_tag="SFV_0269"
FT   CDS_pept        complement(286308..286631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0269"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02545"
FT                   /db_xref="InterPro:IPR020952"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T1"
FT                   /protein_id="ABF02545.1"
FT                   /translation="MDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPK
FT                   SRVESALNPIDLTVLAEYHEQIESNLQRIERKNQRTWYSKPGERGITCSGRQKIKGKSI
FT                   PLT"
FT   gene            complement(287337..287969)
FT                   /locus_tag="SFV_0270"
FT   CDS_pept        complement(287337..287969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0270"
FT                   /product="putative prophage repressor CI"
FT                   /note="Code: KT; COG: COG1974"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02546"
FT                   /db_xref="GOA:Q0T7T0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7T0"
FT                   /protein_id="ABF02546.1"
FT                   /translation="MSISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRF
FT                   LPELASALGVSVDWLLNGTSDSNVRFVGHVEPKGKYPLISMVRAGSWCEACEPYDIKDI
FT                   DEWYDSDVNLLGDGFWLKVEGDSMTSPVGQSIPEGHMVLVDTGREPVNGSLVVAKLTDA
FT                   NEATFKKLVIDGGQKYLKGLNPSWPMTPINGNCKIIGVVVEARVKFV"
FT   mobile_element  complement(288356..289782)
FT                   /mobile_element_type="insertion sequence:IS4"
FT   gene            complement(288369..289715)
FT                   /locus_tag="SFV_0271"
FT   CDS_pept        complement(288369..289715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0271"
FT                   /product="IS4 ORF"
FT                   /note="Code: L; COG: COG3385"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02547"
FT                   /db_xref="GOA:Q0SYU8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SYU8"
FT                   /protein_id="ABF02547.1"
FT                   /translation="MFPDSFMHIGQALDLVSRYDSLRNPLTSLGDYLAPELISRCLAES
FT                   GTVTLRKRRLPLEMMVWCIVGMVLERKEPLHQIVNRLDIMLPGNRPFVAPSAVIQARQR
FT                   LGSEAVRRVFTKTAQLWHNATPHPHWCGLTLLAIDGVFWRTPDTPENDAAFPRQTHAGN
FT                   PALYPQVKMVCQMELTSHLLTAAAFGTMKNSENELAEQLIEQTGDNTLTLMDKGYYSLG
FT                   LLNGWSLAGEHRHWMIPLRKGAQYEELRKLGKGDHLVKLKTSPQARKKWPGLGNEVTAR
FT                   LLTVTRKGKVCHLLTSMTDAMRFPGGEMADLYSHRWEIELGYREIKQTMQLSRLTLRSK
FT                   KPELVEQELWGVLLAYNLVRYQMIKMAEHLKGYWPNQLSFSESCGMVMRMLMTLQGASP
FT                   GRIPELMRDLASMGQLVKLPTRRGRAFPRVVKERPWKYPTAPKKSQSVA"
FT   gene            290308..291132
FT                   /locus_tag="SFV_0272"
FT   CDS_pept        290308..291132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0272"
FT                   /product="replication protein O"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02548"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S8"
FT                   /protein_id="ABF02548.1"
FT                   /translation="MGVVKLADYRHNPVQHQEASSMGYVSIHRQFMDSRLYKDSQAVHL
FT                   WLHLILKANHESTVVNTDIGPITVDRGQMITGRPSLVRETFIPDNKVRSLLRTFESKGM
FT                   LNICSMGKKFSLFTIVKYDDFQAKNCPTVVQRLSINNNINNISNTDVLESATADKKSNK
FT                   KKPSVSCQDVVDAYHEILPEAPRIRALNDKRKNQIRTFWRKAGVITRQLDGHGFTMQDW
FT                   RNYLSYVGENCRWMFEERPNHQRGTVWHKKGFDFLLNDNTYLKVREGEHDDR"
FT   gene            291122..292558
FT                   /locus_tag="SFV_0273"
FT   CDS_pept        291122..292558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0273"
FT                   /product="replication protein P"
FT                   /note="Code: L; COG: COG0305"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02549"
FT                   /db_xref="GOA:Q0T7S7"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019889"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S7"
FT                   /protein_id="ABF02549.1"
FT                   /translation="MTDNFYAPPHSIEAEQAVIGGLLLDDDSSERVQKVLAMLKPDSFY
FT                   SRPHKIIFEEITRMHREQKPVDGLTLFDELERKSLTASVGGFAYIAEIAKNTPSAANIV
FT                   AYAMQVRETAMERYAINRMTEATELLYSRNGMTATQKYEAIQAIFTQLTDHAKTGSRRG
FT                   LRSFGEVMEDWVSDLEKRFDPSGEQRGMSTGIPSLDRMLSPKGLVKGSLFVIGARPKMG
FT                   KTTLYSQMAINCAVHEKKPALMFSLEMPGDQILEKLVGQKSGVNPNIFYLPATNDADDG
FT                   YQGDYDGDFNRAIETANRLSEIDLLYIDDTPGLSLAQIVSESRRIKREKGCVGMILVDY
FT                   LTLMTAEKADRNDLAYGMITKGLKNLAKELDCVVVLLTQLNRALESRTNKRPLPSDSRD
FT                   TGQIEQDCDYWVGIHREGAFDDSVPPGETELILRLNRHGNTGTVYCIQANGAIYDTDQQ
FT                   SAEMRRREREEPQSKKKGGF"
FT   gene            293591..293821
FT                   /locus_tag="SFV_0274"
FT   CDS_pept        293591..293821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02550"
FT                   /db_xref="InterPro:IPR008712"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S6"
FT                   /protein_id="ABF02550.1"
FT                   /translation="MKQNETLMLTSDFLMVKAMLSPSQSIQYQKESVERALTCANCGQK
FT                   LHVLEVHVCEHCCTELMSDPNSSMYEEEDDE"
FT   gene            293814..294536
FT                   /locus_tag="SFV_0275"
FT   CDS_pept        293814..294536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0275"
FT                   /product="putative DNA-binding protein Roi of bacteriophage
FT                   BP-933W"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02551"
FT                   /db_xref="GOA:Q0T7S5"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S5"
FT                   /protein_id="ABF02551.1"
FT                   /translation="MNELINGNVIKMTSIEIAELVGKRHDNVKRTIETLAKNGVIRLPQ
FT                   IEDCGRINGLGLNQSFCVYVFEGEQGKRDSIVVVAQLSPEFTARLVDRWRELEESAVNI
FT                   PKTLPEALRLAADLAEQKMQLENQLAIAAPKVEFADRVGEASGILIGNFAKVVGIGPNK
FT                   LFAWMRDHKILIASGTRRNVPMQEYMDRGYFTVKETAVNTNHGIQISFTTKITGRGQQW
FT                   LTRKLLDNGMLKVTGEAA"
FT   gene            294823..295185
FT                   /locus_tag="SFV_0276"
FT   CDS_pept        294823..295185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0276"
FT                   /product="putative crossover junction
FT                   endodeoxyribonuclease"
FT                   /note="Code: L; COG: COG4570"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02552"
FT                   /db_xref="GOA:Q0T7S4"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR016281"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S4"
FT                   /protein_id="ABF02552.1"
FT                   /translation="MNEYRFVLPYPPSVNTYWRRRGSQYYISDKGQKYRKDVQQIIRQL
FT                   KLDIFTKSRLRIKVIADVPDSRRRDLDNILKGLLDSLIHAGFAEDDEQFDDIRVIRGVK
FT                   VPGGRLGIKITELENV"
FT   gene            295367..295990
FT                   /locus_tag="SFV_0277"
FT   CDS_pept        295367..295990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0277"
FT                   /product="putative antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02553"
FT                   /db_xref="GOA:Q0T7S3"
FT                   /db_xref="InterPro:IPR003222"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S3"
FT                   /protein_id="ABF02553.1"
FT                   /translation="MRLESVAKFHSPKSPMMSDSPRATASDSLSGTDVMAAMGMAQSQA
FT                   GFGMAAFCGKHELSQNDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLATFAY
FT                   ADYCRSAATPGARCRDCHGTGRAVDIAKTEQWGRVVEKECGRCKGVGYSRMPASAAYRA
FT                   VTMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADNILNAVTR"
FT   gene            296659..296982
FT                   /locus_tag="SFV_0278"
FT   CDS_pept        296659..296982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0278"
FT                   /product="cell lysis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02554"
FT                   /db_xref="GOA:Q0T7S2"
FT                   /db_xref="InterPro:IPR006481"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S2"
FT                   /protein_id="ABF02554.1"
FT                   /translation="MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTV
FT                   IDATMCAIIAWFIRDLLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDG
FT                   GNQ"
FT   gene            296966..297292
FT                   /locus_tag="SFV_0279"
FT   CDS_pept        296966..297292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0279"
FT                   /product="putative endolysin"
FT                   /note="Code: G; COG: COG4678"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02555"
FT                   /db_xref="GOA:Q0T7S1"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S1"
FT                   /protein_id="ABF02555.1"
FT                   /translation="MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDY
FT                   SDHPRKLVTLNPKLKSTAAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGA
FT                   LADD"
FT   gene            297440..297877
FT                   /locus_tag="SFV_0280"
FT   CDS_pept        297440..297877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0280"
FT                   /product="putative endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02556"
FT                   /db_xref="GOA:Q0T7S0"
FT                   /db_xref="InterPro:IPR004929"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7S0"
FT                   /protein_id="ABF02556.1"
FT                   /translation="MSRVTAIISALVICIIVCLSWAVNHYRDNAMTYKEQRDKAASTIA
FT                   DMQKRQRDVAELDARYTKELADANATIESLRDDVSAGRKRLQVAASCAKSKTGASGMGD
FT                   GESPGLTADAELNYYRLRSGIDKITAQVNYLQEYIRTQCLK"
FT   gene            298079..298600
FT                   /locus_tag="SFV_0281"
FT   CDS_pept        298079..298600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0281"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02557"
FT                   /db_xref="GOA:Q0T7R9"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR018877"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7R9"
FT                   /protein_id="ABF02557.1"
FT                   /translation="MNIVPLNYKGEIVSFNTDGWINVTGVAERFGKRIDNWMSLAETLE
FT                   YVRALDEALTGKESQILHPSQSRYVKTSKARKDRGGGTWLHPKLSVAFARWCDARFAVW
FT                   CDLHIDSLLRGELTEQQKYEQACRIRDDRKSKASNGAREMARWRWDKPVIEANVEYWRE
FT                   QLQLTLDIAC"
FT   mobile_element  299053..300316
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            299117..299419
FT                   /locus_tag="SFV_0282"
FT   CDS_pept        299117..299419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0282"
FT                   /product="IS600 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02558"
FT                   /db_xref="GOA:Q0SX79"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SX79"
FT                   /protein_id="ABF02558.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   gene            299560..300273
FT                   /locus_tag="SFV_0283"
FT   CDS_pept        299560..300273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0283"
FT                   /product="IS600 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02559"
FT                   /db_xref="GOA:Q0T1L4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T1L4"
FT                   /protein_id="ABF02559.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLACLRKELRLRCKQK
FT                   RKFRATTNPNHNLPVAPNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   gene            complement(300690..300765)
FT                   /locus_tag="SFV_0284"
FT   tRNA            complement(300690..300765)
FT                   /locus_tag="SFV_0284"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACG"
FT   gene            complement(300880..302133)
FT                   /gene="proA"
FT                   /locus_tag="SFV_0285"
FT   CDS_pept        complement(300880..302133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SFV_0285"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /note="Code: E; COG: COG0014"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02560"
FT                   /db_xref="GOA:Q0T7R6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7R6"
FT                   /protein_id="ABF02560.1"
FT                   /translation="MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNA
FT                   NAQDVADARANGLSEAMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGGVLDSGLR
FT                   LERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVAVIQDAL
FT                   KSCGLPAGAVQAIDNPDRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIYVDESAEIAEALKVIVNAKTQRPSTCNTVETLLVNKNIADSFLPALSKQMAESG
FT                   VTLHADAAALTQLQAGPAKVVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQH
FT                   SDAILTRDMRNAQRFVNEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   EALTTYKWIGIGDYTIRA"
FT   gene            complement(302145..303248)
FT                   /gene="proB"
FT                   /locus_tag="SFV_0286"
FT   CDS_pept        complement(302145..303248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SFV_0286"
FT                   /product="gamma-glutamate kinase"
FT                   /note="Code: E; COG: COG0263"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02561"
FT                   /db_xref="GOA:Q0T7R5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7R5"
FT                   /protein_id="ABF02561.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
FT   mobile_element  complement(303424..304191)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(303439..303942)
FT                   /gene="insB"
FT                   /locus_tag="SFV_0287"
FT   CDS_pept        complement(303439..303942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0287"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02562"
FT                   /db_xref="GOA:Q0T7R4"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7R4"
FT                   /protein_id="ABF02562.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLTTLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            304017..304211
FT                   /locus_tag="SFV_0288"
FT   CDS_pept        304017..304211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0288"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02563"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7R3"
FT                   /protein_id="ABF02563.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYPFSEYH"
FT   gene            304312..305367
FT                   /gene="phoE"
FT                   /locus_tag="SFV_0289"
FT   CDS_pept        304312..305367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="SFV_0289"
FT                   /product="outer membrane pore protein E (E,Ic,NmpAB)"
FT                   /note="Code: M; COG: COG3203"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02564"
FT                   /db_xref="GOA:Q0T7R2"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7R2"
FT                   /protein_id="ABF02564.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNASKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DTVAVGMTYQF"
FT   gene            complement(305406..305807)
FT                   /gene="crl"
FT                   /locus_tag="SFV_0290"
FT   CDS_pept        complement(305406..305807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="SFV_0290"
FT                   /product="transcriptional regulator of cryptic csgA gene
FT                   for curli surface fibers"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02565"
FT                   /db_xref="GOA:Q0T7R1"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7R1"
FT                   /protein_id="ABF02565.1"
FT                   /translation="MTLPSGHPKSRLIKKFTALGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFH
FT                   EKLRELLTTLNLKLEPADDFRDEPVKLTA"
FT   gene            complement(305865..307109)
FT                   /gene="yafA"
FT                   /locus_tag="SFV_0291"
FT   CDS_pept        complement(305865..307109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafA"
FT                   /locus_tag="SFV_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG1073"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02566"
FT                   /db_xref="GOA:Q0T7R0"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7R0"
FT                   /protein_id="ABF02566.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACTEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITGWIEKRLC"
FT   gene            complement(307201..307659)
FT                   /gene="gpt"
FT                   /locus_tag="SFV_0292"
FT   CDS_pept        complement(307201..307659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="SFV_0292"
FT                   /product="guanine-hypoxanthine phosphoribosyltransferase"
FT                   /note="Code: F; COG: COG0503"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02567"
FT                   /db_xref="GOA:Q0T7Q9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7Q9"
FT                   /protein_id="ABF02567.1"
FT                   /translation="MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR"
FT   gene            307921..309378
FT                   /gene="pepD"
FT                   /locus_tag="SFV_0293"
FT   CDS_pept        307921..309378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="SFV_0293"
FT                   /product="aminoacyl-histidine dipeptidase (peptidase D)"
FT                   /note="Code: E; COG: COG2195"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02568"
FT                   /db_xref="GOA:Q0T7Q8"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q8"
FT                   /protein_id="ABF02568.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGF
FT                   HVERDQVGNILIRQPATAGMENRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADENVVHGPLEVLLTMTEEAGMDGAFGLQSNWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLHLDREAVPAGFETFKLTLKGLKGGHSGGEIHV
FT                   GLGNANKLLVRFLAGHAEELDLRLIDFNGGTLRNAIPREAFATIAVAADKVDALKSLVN
FT                   TYQEILKNELAEKEKNLALLLDSVANDKAALIAKSRDTFIRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMTDNNVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGW
FT                   QPDANSPVMHLVHETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKEIPAK"
FT   gene            complement(309435..309995)
FT                   /pseudo
FT                   /gene="prfH"
FT                   /locus_tag="SFV_0294"
FT                   /note="contains in-frame stop codon; original product:
FT                   probable peptide chain release factor"
FT   gene            complement(310111..311181)
FT                   /locus_tag="SFV_0295"
FT   CDS_pept        complement(310111..311181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1690"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02569"
FT                   /db_xref="GOA:Q0T7Q7"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q7"
FT                   /protein_id="ABF02569.1"
FT                   /translation="MTSLFTEWYMGNYIRPLSDAVFTIASDDLWIESLAIQQLHTTANL
FT                   PNMQRVVGMPDLHPGRGYPIGAAFFSAGRFYPALVGNDIGCGMALWQTDILARKYNADK
FT                   FEKRLSALDDVAEESWLEENLPSAFAQHPWRSSLGSIGGGNHFAELQQVDQIINAELFA
FT                   LAGLDAQHLQLLVHSGSRGLGQSILQRHIASFSHHGLPEGSDDALAFARFNRHLIALRI
FT                   MQQVKATGSPVLDVAHNFVSACRIGDQQGVLHRKGATPDDCGLVVIPGSRGDYSRLVQP
FT                   VRSEETLHSLAHGAGRKWGRTECKGRLAAKYTATQLSRTELGSRVICRDKQLIFEEAPQ
FT                   AYKSAESVVQCLGRPD"
FT   gene            complement(311400..311852)
FT                   /gene="yafP"
FT                   /locus_tag="SFV_0296"
FT   CDS_pept        complement(311400..311852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="SFV_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: KR; COG: COG0454"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02570"
FT                   /db_xref="GOA:Q0T7Q6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q6"
FT                   /protein_id="ABF02570.1"
FT                   /translation="MNNIQIRDYQPGDFQQLCAIFIRAVTMTVSQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVRVAVINAKLVGFITCVEHYIDMLFVDPEYTRRGVASALLKPFIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFINFYMRYKPQH"
FT   gene            complement(311862..312260)
FT                   /gene="yafO"
FT                   /locus_tag="SFV_0297"
FT   CDS_pept        complement(311862..312260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafO"
FT                   /locus_tag="SFV_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02571"
FT                   /db_xref="InterPro:IPR020353"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q5"
FT                   /protein_id="ABF02571.1"
FT                   /translation="MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYD
FT                   DSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRTNDEAHLVYCQGAFDEQAWLLIAIL
FT                   KPEPHKLARDNNQMHKIGKMAEAFRMRF"
FT   gene            complement(312263..312556)
FT                   /gene="yafN"
FT                   /locus_tag="SFV_0298"
FT   CDS_pept        complement(312263..312556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafN"
FT                   /locus_tag="SFV_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: D; COG: COG2161"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02572"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q4"
FT                   /protein_id="ABF02572.1"
FT                   /translation="MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASA
FT                   FEALMDMLAEQEEKKPIKARFRPSAARLEEITRRAKQYLNDMTDDDFNDFKE"
FT   gene            complement(312608..313612)
FT                   /gene="dinP"
FT                   /locus_tag="SFV_0299"
FT   CDS_pept        complement(312608..313612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="SFV_0299"
FT                   /product="damage-inducible protein P"
FT                   /note="putative tRNA synthetase; Code: L; COG: COG0389"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02573"
FT                   /db_xref="GOA:Q0T7Q3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q3"
FT                   /protein_id="ABF02573.1"
FT                   /translation="MRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMA
FT                   LKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATL
FT                   IAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLEK
FT                   IPGVGKVSAAKLEAMGLRTCGDVQKCDLVILLKRFGKFGRILWERSQGIDERDVNSERL
FT                   RKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQT
FT                   TQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL"
FT   gene            complement(313734..314519)
FT                   /gene="mbhA"
FT                   /locus_tag="SFV_0301"
FT   CDS_pept        complement(313734..314519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="SFV_0301"
FT                   /product="putative motility protein"
FT                   /note="Code: N; COG: COG1360"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02575"
FT                   /db_xref="GOA:Q0T7Q2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q2"
FT                   /protein_id="ABF02575.1"
FT                   /translation="MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHP
FT                   PKPATVAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHMEANLEMEIV
FT                   PQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLYNKIIITGHTDAMAYKN
FT                   NIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMV
FT                   LTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRMR"
FT   gene            314464..316203
FT                   /gene="fhiA"
FT                   /locus_tag="SFV_0300"
FT   CDS_pept        314464..316203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhiA"
FT                   /locus_tag="SFV_0300"
FT                   /product="flagellar biosynthetic protein FlhA"
FT                   /note="Code: NU; COG: COG1298"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02574"
FT                   /db_xref="GOA:Q0T7Q1"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q1"
FT                   /protein_id="ABF02574.1"
FT                   /translation="MLSRSDLLTLLTINFIVVTKEAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLSGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPYLPFLLFSALLGFTGWRMSKRPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIEADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GIPVTRIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSTVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNVVNQAQQAGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALM"
FT   gene            complement(316420..316917)
FT                   /gene="yafM"
FT                   /locus_tag="SFV_0302"
FT   CDS_pept        complement(316420..316917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="SFV_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: L; COG: COG1943"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02576"
FT                   /db_xref="GOA:Q0T7Q0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7Q0"
FT                   /protein_id="ABF02576.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLRNRRSHLLTTQFQTLHNAIINVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPESDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIR
FT                   NTKDYRHHVDYIYINPEKHGWVKQVSDWPFSTFHRDVARGLYPIDWAGDITDLSAGERI
FT                   IL"
FT   gene            complement(317093..317647)
FT                   /gene="yafL"
FT                   /locus_tag="SFV_0303"
FT   CDS_pept        complement(317093..317647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="SFV_0303"
FT                   /product="putative lipoprotein"
FT                   /note="Code: M; COG: COG0791"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02577"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P9"
FT                   /protein_id="ABF02577.1"
FT                   /translation="MRFAPFTRQRHHNREQIKQHPEWFPAPLKASDRRWQALAENNHFL
FT                   SSDHLHNITEVAIHRLEQQLGKPYVWGGTRPDQGFDCSGLVFYAYNKILEAKLPRTANE
FT                   MYHYRRATIVANNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIELLRTGETIRVSRLA
FT                   EPFWQDHFLGARRILTEEMIL"
FT   gene            317998..318738
FT                   /gene="yafK"
FT                   /locus_tag="SFV_0304"
FT   CDS_pept        317998..318738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="SFV_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3034"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02578"
FT                   /db_xref="GOA:Q0T7P8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P8"
FT                   /protein_id="ABF02578.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVANGRYV
FT                   VSKPLSHEVVQTQLASNYTLPEAK"
FT   gene            complement(318709..319476)
FT                   /gene="yafJ"
FT                   /locus_tag="SFV_0305"
FT   CDS_pept        complement(318709..319476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="SFV_0305"
FT                   /product="putative amidotransferase"
FT                   /note="Code: R; COG: COG0121"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02579"
FT                   /db_xref="GOA:Q0T7P7"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P7"
FT                   /protein_id="ABF02579.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRAKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
FT   gene            complement(319682..320422)
FT                   /gene="gmhA"
FT                   /locus_tag="SFV_0306"
FT   CDS_pept        complement(319682..320422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="SFV_0306"
FT                   /product="phosphoheptose isomerase"
FT                   /note="Code: G; COG: COG0279"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02580"
FT                   /db_xref="GOA:Q0T7P6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P6"
FT                   /protein_id="ABF02580.1"
FT                   /translation="MCLQYNYNKAHIVAVFIRTSGQKVLVIAPARTSRFWRYPVHCILS
FT                   ITFMLKDILMYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSC
FT                   GNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRYVEAVG
FT                   REGDVLLGLSTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHSGYA
FT                   DRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            320500..322944
FT                   /gene="yafH"
FT                   /locus_tag="SFV_0307"
FT   CDS_pept        320500..322944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafH"
FT                   /locus_tag="SFV_0307"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02581"
FT                   /db_xref="GOA:Q0T7P5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P5"
FT                   /protein_id="ABF02581.1"
FT                   /translation="MMILSILATVVLLGALFYHRVSLFISSLILLAWTAALGVAGLWSA
FT                   WVLVPLTIILVPFNFAPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTDEQK
FT                   DHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWSKRYIT
FT                   LAPIATVLGLAFKLSDPEKLLGGAEDLGITCALIPTTTPGVEIGRRHFPLNVPFQNGPT
FT                   RGKDVFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYSHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQQSIIDAMDITGGKGIMLGQSNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMEAAKNNDVNAFDKLLFKHIGHVGSNKVRSFWLGLTRGLTSSTPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMALLGGSLKRRERISARLGDILSQLYLASAVLKRYDDEGRNE
FT                   ADLPLVHWGVQDALYQAEQAMDNLLQNFPNRVVAGLLNVVIFPTGRHYLAPSDKLDHKV
FT                   AKILQVPNATRSRIGRGQYLTPSEHNPVGLLEEALVDVIAADPIHQRICKELGKNLPFT
FT                   RLDELAHNALTKGLIDKDEAAILVKAEESRLRSINVDDFDPEELATKPVKLPEKVRKVE
FT                   AA"
FT   gene            complement(322987..323460)
FT                   /gene="ykfE"
FT                   /locus_tag="SFV_0308"
FT   CDS_pept        complement(322987..323460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfE"
FT                   /locus_tag="SFV_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02582"
FT                   /db_xref="GOA:Q0T7P4"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P4"
FT                   /protein_id="ABF02582.1"
FT                   /translation="MGRISSGGMMFKAITTVAALVIATSAMAQDDLTISSLAKGETTKA
FT                   AFNQMVQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSN
FT                   QMTGLFSAIDEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK"
FT   gene            323617..324387
FT                   /gene="yafV"
FT                   /locus_tag="SFV_0309"
FT   CDS_pept        323617..324387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="SFV_0309"
FT                   /product="putative amidase-type enzyme"
FT                   /note="Code: R; COG: COG0388"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02583"
FT                   /db_xref="GOA:Q0T7P3"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P3"
FT                   /protein_id="ABF02583.1"
FT                   /translation="MPSLKITLLQQPLVWVDGPANLRHFDRQLEGITGRDVIVLPEMFT
FT                   SGFAMEAAASSLAQDEVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHF
FT                   YDKRHLFRMADEHLHYKAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLALYVA
FT                   NWPAPRSLHWQALLTARAIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADA
FT                   HKATRIDAELSMVALREYREKFPAWRDADEFRLW"
FT   gene            complement(325436..326230)
FT                   /locus_tag="SFV_0310"
FT   CDS_pept        complement(325436..326230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0310"
FT                   /product="putative Rhs-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02584"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P2"
FT                   /protein_id="ABF02584.1"
FT                   /translation="MDNRLPGYGRDRYRYNEWGELTERRDQQLEWNAQGQLTRVISSNS
FT                   ETRYQYDALGRRISKATSNLHTDRGERSRTTFVWEGFRLLQETTWQGKRTYLYDAEQPY
FT                   TPVAAITGRGESQKIWYYHTDLTGTVHEVTAPDGTLVWAGYQAGFGENRGDISNSGAYF
FT                   EQPQRLPGQYFDEETGLHYNLFRYYAPECGRFVSQDPIGLNGGLNLYAYAPNPLGWIDP
FT                   LGLNSLGIDSNNIFRGDGNYKGGGIGQPKSGTISAQDIIDHL"
FT   gene            complement(326422..328734)
FT                   /locus_tag="SFV_0311"
FT   CDS_pept        complement(326422..328734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0311"
FT                   /product="putative Rhs-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02585"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P1"
FT                   /protein_id="ABF02585.1"
FT                   /translation="MGSKFGTKCAAKFIGGEMVGMAISDTVMGLFSNPVDVTTGQKILL
FT                   PETDFTLPGRLPVTCSRFYASHLETEGLLGRGWQLNWEINLREDETYITFIGVQGRELS
FT                   YPKEMLIPGHQIFDPEEQFYLSRLHDGCYVLHYTDRSYYVFDEFDDHGVAPLLFMETPY
FT                   RQRIAFGRENGRLVRVASSSGHHLLLHRTMTQAGERLSHIELVKGGRPGNLVEYRYDDN
FT                   GQLTGVVNRAGVTVRQFAYENGLMTEHRNATGFTCTYHWEEIEGFPRVVEHTTSDGEDY
FT                   RFHYDFAGGQTVVTGRPEQKWQWWFDEETYVTAHRTPGGGMYRFTYNENHFPVAVELPG
FT                   ERRVTLEYDTLSRVVKETDPAGRVTQTQWNGSFAEITRRALDDDHVWKADYNEHGQVIR
FT                   ETDPEGRVTRYGYDEQGLAVSRTDARGGEVAMAHDARGQLRRYTDCSGCATGYEYDEDG
FT                   NLTAVTDAEGKTVRISYNRQGLPETVCHPGKQQDRYTWNALGLLSSHRRITGSVQSWQY
FT                   TPRGMLARHTDEEKRETRWQYTPEGLVASLSNGNGAQYRFSYDGDGRLTGEQRPDGLIR
FT                   MFALNADGFPVIIPTQGTEGGVRNEQQERDALGRLLRSDTQHSTRTFSYNRLDQITEVT
FT                   LTPTEEGERLHHMQADTVRFAYDRSGWLTAEHSVHGSIKYRRDALGNPTDITLPDGQHL
FT                   SHLYYGSGHLLQTALDGITVSEYERDSLHRQVIRTQGKLATFSGYNADNRLSWQLSLPG
FT                   GSQNPQQAVLPRRRTTA"
FT   gene            complement(328896..329303)
FT                   /locus_tag="SFV_0312"
FT   CDS_pept        complement(328896..329303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0312"
FT                   /product="putative Rhs-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02586"
FT                   /db_xref="GOA:Q0T7P0"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7P0"
FT                   /protein_id="ABF02586.1"
FT                   /translation="MYEAARVDDPIYHTSALAGFLIGAIIGIAIIAVASFAFFTCGFLA
FT                   GLILSFLADQIASGVLQLGEAIGRSIHSTVGKILTGSDNVSTNSRPAARAVLSTVICED
FT                   HSPEIRIAQGSGNIYINSQLPVRMTTLSVMQ"
FT   gene            complement(329325..329771)
FT                   /locus_tag="SFV_0313"
FT   CDS_pept        complement(329325..329771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0313"
FT                   /product="putative cytoplasmic protein"
FT                   /note="Code: S; COG: COG5435"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02587"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N9"
FT                   /protein_id="ABF02587.1"
FT                   /translation="MTSLYRIQEGCFALPETFLDRTVNIFVPSGNERATPSLNISRDTL
FT                   RPDENLTTYIGRQIALMKKKNLGQHRVLSRGTALAGTGEAAMTGEQILATHRSGKTEVY
FT                   QRQAGFITGPAKVLMLTLTTQRPFDDHTDQLWTAWLTSFQPAKS"
FT   gene            complement(329794..332007)
FT                   /locus_tag="SFV_0314"
FT   CDS_pept        complement(329794..332007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0314"
FT                   /product="putative Rhs-family protein"
FT                   /note="Code: S; COG: COG3501"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02588"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N8"
FT                   /protein_id="ABF02588.1"
FT                   /translation="MSFVSTGNKPVGNGGPVITTPPIAGESGGMSTGSAVTDVSGAAEE
FT                   MAEQAAADLFGALPEPSGLVKAAVAAAQAAAAAAGISDMAGAVQDAAASLAAGAPGAHN
FT                   VTVSGSAVPPQMLLFAGMNGSEGLGNLFSYTVQLKTLDALNLGYVSPAANLPLQLMVGK
FT                   DLCVSIELDGGGKRYISGLVTAARVVGHEGRSVTYELRIEPWLKLLTHTSDYKAFQNKT
FT                   VVDILDEVLDEYSFPVEKRLVENYPPRAWQVQYGETDFDFIQRLMQEWGIYWWFEHSEN
FT                   SHTLVLVDAINGHKACPDSPLVEWHQEGLKLDKEFIHTITASERLRTGKWVMDDFDFMK
FT                   PRSLLKSTVASPRDTGHAEYEHYEWPGDYFTTGEGEMLTRIRMEAQRSPGSRAHGAGHI
FT                   RTLMTGYTFTLMNHPTAEINQEYLLVQTTLFLRDNAQHSGQDQHFTYVTTFELHPTSEV
FT                   YRPQRTLSKPHTKGPQSAIVTGPAGQEIWTDKYGRVKVQFGWDRYGKNDENSSCWIRVS
FT                   YPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGLPGMASQSGIF
FT                   SHSLQGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRIKTIVKNETI
FT                   SVGEDRNATITKNDGLSVKLAQTINVGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCG
FT                   KQLLLHTSDVMQLIGSGIDMNPDGGTAMTADDIAPLPTPDVSE"
FT   mobile_element  complement(333070..333837)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(333085..333588)
FT                   /gene="insB"
FT                   /locus_tag="SFV_0315"
FT   CDS_pept        complement(333085..333588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0315"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02589"
FT                   /db_xref="GOA:Q0SXA0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXA0"
FT                   /protein_id="ABF02589.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLVRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            333663..333878
FT                   /locus_tag="SFV_0316"
FT   CDS_pept        333663..333878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0316"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02590"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N6"
FT                   /protein_id="ABF02590.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYQNSDYYLIRDYCR"
FT   gene            334201..334920
FT                   /gene="ykgE"
FT                   /locus_tag="SFV_0317"
FT   CDS_pept        334201..334920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="SFV_0317"
FT                   /product="putative dehydrogenase subunit"
FT                   /note="Code: C; COG: COG0247"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02591"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N5"
FT                   /protein_id="ABF02591.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVVHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
FT   gene            334931..336358
FT                   /gene="ykgF"
FT                   /locus_tag="SFV_0318"
FT   CDS_pept        334931..336358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="SFV_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: C; COG: COG1139"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02592"
FT                   /db_xref="GOA:Q0T7N4"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N4"
FT                   /protein_id="ABF02592.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GHWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDSVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
FT   gene            336351..337046
FT                   /gene="ykgG"
FT                   /locus_tag="SFV_0319"
FT   CDS_pept        336351..337046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="SFV_0319"
FT                   /product="putative transporter"
FT                   /note="Code: S; COG: COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02593"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N3"
FT                   /protein_id="ABF02593.1"
FT                   /translation="MDNRSEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAENISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESS
FT                   LFILRKSTILPRVAQLAEKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
FT   gene            complement(337001..337213)
FT                   /locus_tag="SFV_0320"
FT   CDS_pept        complement(337001..337213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02594"
FT                   /db_xref="GOA:Q0T7N2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N2"
FT                   /protein_id="ABF02594.1"
FT                   /translation="MDACLFHCKYPGITNAWIFTEEQHNHDGTGLSQVVLNAIFNLVCL
FT                   LQVYVQISYLSQQSSIIRYTAFTGP"
FT   gene            complement(337289..337957)
FT                   /gene="ykgH"
FT                   /locus_tag="SFV_0321"
FT   CDS_pept        complement(337289..337957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgH"
FT                   /locus_tag="SFV_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02595"
FT                   /db_xref="GOA:Q0T7N1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7N1"
FT                   /protein_id="ABF02595.1"
FT                   /translation="MSEQIKQDIDLIEILFHLKKKIRVILFIMAICMAMVLLFLYINKD
FT                   NTKVIYSLKINQTTPGILVSCDSNNNFACQTTMTEDVIQRITTFFQTSPDIKNREIRLE
FT                   WSGDKRDLPTAEEEISRVQASIIKWYASEYHNGRQVLDEIQTPSAINSELYTKMIYLTR
FT                   NWSLYPNGDGCVTISSPEIKNKYPAAICLALGFFLSIVISVMFCLVKKMVDEYQQNSGQ
FT                   "
FT   gene            complement(338171..339841)
FT                   /gene="betA"
FT                   /locus_tag="SFV_0322"
FT   CDS_pept        complement(338171..339841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="SFV_0322"
FT                   /product="choline dehydrogenase"
FT                   /note="a flavoprotein; Code: E; COG: COG2303"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02596"
FT                   /db_xref="GOA:Q0T7N0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7N0"
FT                   /protein_id="ABF02596.1"
FT                   /translation="MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRT
FT                   QMPAALAFPLQGKRYNWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNALDL
FT                   DNWAQEPGLENWSYLDCLPYYRKAETRDVGENDYHGGDGPVSVTTSKPGVNPLFEAMIE
FT                   AGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMT
FT                   DHIIFDGKRAVGVEWLEGDSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEF
FT                   DIPLVHELPGVGENLQDHLEMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGAS
FT                   NHFEAGGFIRSREEFAWPNIQYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRI
FT                   KSRDPHQHPAILFNYMSHEQDWQEFRDAIRITREIMHQPALDQYRGREISPGVECQTDE
FT                   QLDEFVRNHAETAFHPCGTCKMGYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLN
FT                   ATTIMIGEKIADMIRGQEALSRSTAGYFVANGMPVRAKK"
FT   gene            complement(339855..341327)
FT                   /gene="betB"
FT                   /locus_tag="SFV_0323"
FT   CDS_pept        complement(339855..341327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="SFV_0323"
FT                   /product="NAD+-dependent betaine aldehyde dehydrogenase"
FT                   /note="Code: C; COG: COG1012"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02597"
FT                   /db_xref="GOA:Q0T7M9"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7M9"
FT                   /protein_id="ABF02597.1"
FT                   /translation="MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGRED
FT                   VDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTV
FT                   DIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGGGAETGQYLTEHPGI
FT                   AKVSFTGGVASGKKVMANSAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFS
FT                   SGQVCTNGTRVFVPAKCKAAFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRY
FT                   IAKGKEEGARVLCGGDVLKGDGFDNGAWVAPTVFTDCRDEMTIVREEIFGPVMSLLTYE
FT                   SEDEVIRRANDTDYGLAAGIVTADLNRAHRVMHQLEAGICWINTWGESPAEMPVGGYKH
FT                   SGIGRENGVMTLQSYTQVKSIQVEMAKFQSIF"
FT   gene            complement(341341..341928)
FT                   /gene="betI"
FT                   /locus_tag="SFV_0324"
FT   CDS_pept        complement(341341..341928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="SFV_0324"
FT                   /product="probably transcriptional repressor of bet genes"
FT                   /note="Code: K; COG: COG1309"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02598"
FT                   /db_xref="GOA:Q0T7M8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7M8"
FT                   /protein_id="ABF02598.1"
FT                   /translation="MPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGI
FT                   ISHYFRDKNGLLEATMRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDETQVSSA
FT                   AMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPRQQAQEAGYGLAALIDG
FT                   LWLRAALSGKPLDKPLAHSLTRHFITQHLPTD"
FT   gene            342056..344089
FT                   /gene="betT"
FT                   /locus_tag="SFV_0325"
FT   CDS_pept        342056..344089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="SFV_0325"
FT                   /product="high-affinity choline transport"
FT                   /note="Code: M; COG: COG1292"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02599"
FT                   /db_xref="GOA:Q0T7M7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7M7"
FT                   /protein_id="ABF02599.1"
FT                   /translation="MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAESVTQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTILSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLLDIPDSMAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPR
FT                   PLGLQDRLSWKKRLSRLMNYPGTRYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPP
FT                   EEGQQLGHLDLLVHMGEEQNFVYQIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGHSVMFPDA"
FT   gene            complement(344232..344423)
FT                   /locus_tag="SFV_0326"
FT   CDS_pept        complement(344232..344423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0326"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7M6"
FT                   /protein_id="ABF02600.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYHKIVN"
FT   mobile_element  344249..345016
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            344498..345001
FT                   /gene="insB"
FT                   /locus_tag="SFV_0327"
FT   CDS_pept        344498..345001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0327"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02601"
FT                   /db_xref="GOA:Q0SXE9"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXE9"
FT                   /protein_id="ABF02601.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(345115..347208)
FT                   /locus_tag="SFV_0328"
FT   CDS_pept        complement(345115..347208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0328"
FT                   /product="putative phage transposase"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02602"
FT                   /db_xref="GOA:Q0T7M4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7M4"
FT                   /protein_id="ABF02602.1"
FT                   /translation="MQSYVTVNDLLGVPGMPATAKGIRQALQRFSRALGDVSRRRAGTK
FT                   AIEYHIDCLPEVTQKALRERYVEQLVATENNVSEVKTVTRTARNPDAVQAVEAYRGSPQ
FT                   LMEERLNALTENQRRVSEARAALAVEVLKLESAGNLGRLKAINFLVEKARKGELPERLQ
FT                   QAAINANAKRGTNRTISRDPLYQWVLKYNRSQNAAEQLLLLAPGKRDEIKPEEISWLPE
FT                   FLAQYRQANGRPMSEAYEDFVTEWQRRYADEPYMLEVMPSYDVVRYAMKKLPEVVKQKG
FT                   RVTGSEYRQLEGFTRRDWTAMPVNYVWIGDGHGMKLKCAHPIHGRPFSPEVTFVIDGGT
FT                   RFVVGWSLDLAENVFAVAGAIQHGIRNHGKPFLYYSDNGSGETADMLDKEIVGILPRLG
FT                   INPPTGIAGNPQGRGIIERLNRTLPMRIARRYRTYFGKGADRETLRVLNRDLRSAFNAL
FT                   QQDKPLNARQKSAMRELPSWSELIEAIREGVEWYNNRPHSELPMKPNGKHYSPAEFRKK
FT                   RLAEENTEIEWLSDLELRDMFCPMVERPVRRCEIKWLGNIYYAPELRDEHGRKVLISYD
FT                   IHDAERITVRRKDGSFICEAIWNGNKRAAFPVSADYYKQQQRIKGMHKRAEEKIRDAVD
FT                   EGIQVIEQKTTEPRLDNVYRPVGNVMTVQQQEYEEEHDEESERNFRRGLQKLIAMQDDD
FT                   PLA"
FT   gene            348610..349380
FT                   /gene="tauA"
FT                   /locus_tag="SFV_0329"
FT   CDS_pept        348610..349380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="SFV_0329"
FT                   /product="taurine transport system periplasmic protein"
FT                   /note="Code: P; COG: COG4521"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02603"
FT                   /db_xref="GOA:Q0T7M3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7M3"
FT                   /protein_id="ABF02603.1"
FT                   /translation="MRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGNSEALV
FT                   VKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGLVEIVNLQPPAIIAAWQRG
FT                   DIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFAKS
FT                   AIDAQQPYIANPDAWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAELTGPV
FT                   NKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
FT   gene            349393..350160
FT                   /gene="tauB"
FT                   /locus_tag="SFV_0330"
FT   CDS_pept        349393..350160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="SFV_0330"
FT                   /product="taurine ATP-binding component of a transport
FT                   system"
FT                   /note="Code: P; COG: COG4525"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02604"
FT                   /db_xref="GOA:Q0T7M2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7M2"
FT                   /protein_id="ABF02604.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSDGQRQRVGIARALAANPQLLLLDEPFGAQDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSSGPGRVLERLRLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
FT   gene            350157..350984
FT                   /gene="tauC"
FT                   /locus_tag="SFV_0331"
FT   CDS_pept        350157..350984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="SFV_0331"
FT                   /product="taurine transport system permease protein"
FT                   /note="Code: P; COG: COG0600"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02605"
FT                   /db_xref="GOA:Q0T7M1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7M1"
FT                   /protein_id="ABF02605.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVVIGIPVGIA
FT                   MGLSPTVRGILDPVIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
FT   gene            350981..351832
FT                   /gene="tauD"
FT                   /locus_tag="SFV_0332"
FT   CDS_pept        350981..351832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="SFV_0332"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent"
FT                   /note="Code: Q; COG: COG2175"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02606"
FT                   /db_xref="GOA:Q0T7M0"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7M0"
FT                   /protein_id="ABF02606.1"
FT                   /translation="MSERLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVV
FT                   FLRDQAITPQQQRALAQRFGELHIHPVYPHAEGVDEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IETPPAGAILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSWLRAEHDFRKSFPEYK
FT                   YRKTEEEHQRWREAVAKNPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALL
FT                   GFLFAHITKPEFQVRWRWQPNDIAIWDNRVTQHYANADYLPQRRIMHRATILGDKPFYR
FT                   AG"
FT   gene            complement(351938..352945)
FT                   /gene="hemB"
FT                   /locus_tag="SFV_0333"
FT   CDS_pept        complement(351938..352945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="SFV_0333"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /note="Code: H; COG: COG0113"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02607"
FT                   /db_xref="GOA:Q0T7L9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L9"
FT                   /protein_id="ABF02607.1"
FT                   /translation="MHLNSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLP
FT                   IFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAW
FT                   REDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAV
FT                   VAAAAGADFIAPSAAMDGQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSA
FT                   LKGDRKSYQMTPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAY
FT                   QVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR"
FT   gene            353439..356566
FT                   /pseudo
FT                   /gene="yaiU"
FT                   /locus_tag="SFV_0334"
FT                   /note="IS2 insertion; original product: putative flagellin
FT                   structural protein"
FT   mobile_element  353808..354990
FT                   /mobile_element_type="insertion sequence:IS2"
FT                   /note="partial"
FT   gene            353899..354264
FT                   /locus_tag="SFV_0335"
FT   CDS_pept        353899..354264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0335"
FT                   /product="IS2 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02608"
FT                   /db_xref="GOA:Q0SXN8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXN8"
FT                   /protein_id="ABF02608.1"
FT                   /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQ
FT                   LFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYG
FT                   RAKKWIAHAPLLPGDGE"
FT   gene            354288..355001
FT                   /locus_tag="SFV_0336"
FT   CDS_pept        354288..355001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0336"
FT                   /product="IS2 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02609"
FT                   /db_xref="GOA:Q0T7L7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L7"
FT                   /protein_id="ABF02609.1"
FT                   /translation="MSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYG
FT                   YRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRVAVKESN
FT                   QRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFG
FT                   NDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDY
FT                   ISIMPKPDGLTAVPG"
FT   gene            355207..356019
FT                   /locus_tag="SFV_0337"
FT   CDS_pept        355207..356019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0337"
FT                   /product="ISEhe3 orfB"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02610"
FT                   /db_xref="GOA:Q0T7L6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L6"
FT                   /protein_id="ABF02610.1"
FT                   /translation="MLDVHPSGFYAWLQQPHSQRHQADLRLTGQIKQFWLESGCVYGYR
FT                   KIHLDLRDSGQQCGVNRVWRLMKRVGIKAQVGYRSPRARKGEASIVSPNRLQRQFNPDA
FT                   PDERWVTDITYIRTHEGWLYLAVVVDLFSRKIIGWSMQSRMTKDIVLNALLMAVWRRNP
FT                   EKQVLVHSDQGSQYTSHEWQSFLKSHGLEGSMSRRGNCHDNAVAESFFQLLKRERIKKK
FT                   IYGTREEARSDIFDYIEMFYNSKRRHGSSEQMSPTEYENQYYQRLGSV"
FT   gene            356609..357157
FT                   /gene="yaiV"
FT                   /locus_tag="SFV_0338"
FT   CDS_pept        356609..357157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="SFV_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02611"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L5"
FT                   /protein_id="ABF02611.1"
FT                   /translation="MPVKDLTGITAKDAQMLSVVKPLQEFGKLDKCLSRYGTRFEFNNE
FT                   KQVIFSSDVNNEDTFVILEGVISLRREENVLIGITQAPYIMGLADGLMKNDIPYKLISE
FT                   GNCTGYHLPAKQTRATLLSMIDWNEELRSRIGVMNYIHQRTRISRSVVAEVLAALRKGG
FT                   YIEMNKGKLVAINRLPSEY"
FT   gene            complement(357158..358315)
FT                   /gene="yaiH"
FT                   /locus_tag="SFV_0339"
FT   CDS_pept        complement(357158..358315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiH"
FT                   /locus_tag="SFV_0339"
FT                   /product="putative enzyme"
FT                   /note="Code: V; COG: COG1680"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02612"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L4"
FT                   /protein_id="ABF02612.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITHPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPRIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
FT   gene            358667..359887
FT                   /gene="sbmA"
FT                   /locus_tag="SFV_0340"
FT   CDS_pept        358667..359887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="SFV_0340"
FT                   /product="sensitivity to microcin B17, possibly envelope
FT                   protein"
FT                   /note="Code: I; COG: COG1133"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02613"
FT                   /db_xref="GOA:Q0T7L3"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L3"
FT                   /protein_id="ABF02613.1"
FT                   /translation="MFKYFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFAFFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
FT   gene            359900..360994
FT                   /gene="yaiW"
FT                   /locus_tag="SFV_0341"
FT   CDS_pept        359900..360994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="SFV_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02614"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L2"
FT                   /protein_id="ABF02614.1"
FT                   /translation="MSRVNHLSSLSLLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPVSVKDRDAWAKDLATTFESQGLAPTLENVYSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSAIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFTDFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAGKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
FT   gene            complement(361053..361361)
FT                   /locus_tag="SFV_0342"
FT   CDS_pept        complement(361053..361361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02615"
FT                   /db_xref="GOA:Q0T7L1"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L1"
FT                   /protein_id="ABF02615.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLAGCLIFAVVALWLHWRHRRQ"
FT   gene            361489..361833
FT                   /locus_tag="SFV_0343"
FT   CDS_pept        361489..361833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02616"
FT                   /db_xref="GOA:Q0T7L0"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7L0"
FT                   /protein_id="ABF02616.1"
FT                   /translation="MNLRCESQNGNLKLNLLTITKMLSTPQTVVTEYARMLFFVNGAAM
FT                   NLPVKIRRDWHYYAFAIGLIFILNGVVGVLGFEAKGWQTYAVGLVTWVISFWLAGLIIR
FT                   RRDEETENAQ"
FT   gene            complement(361857..362897)
FT                   /gene="ddlA"
FT                   /locus_tag="SFV_0344"
FT   CDS_pept        complement(361857..362897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="SFV_0344"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /note="Code: M; COG: COG1181"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02617"
FT                   /db_xref="GOA:Q0T7K9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K9"
FT                   /protein_id="ABF02617.1"
FT                   /translation="MSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLNADD
FT                   PAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRV
FT                   ANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGLP
FT                   LFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
FT                   ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMA
FT                   RVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADN
FT                   ALKTTM"
FT   gene            363414..363674
FT                   /gene="yaiB"
FT                   /locus_tag="SFV_0345"
FT   CDS_pept        363414..363674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="SFV_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02618"
FT                   /db_xref="GOA:Q0T7K8"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7K8"
FT                   /protein_id="ABF02618.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPCQ"
FT   gene            363775..365190
FT                   /gene="phoA"
FT                   /locus_tag="SFV_0346"
FT   CDS_pept        363775..365190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="SFV_0346"
FT                   /product="alkaline phosphatase"
FT                   /note="Code: P; COG: COG1785"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02619"
FT                   /db_xref="GOA:Q0T7K7"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K7"
FT                   /protein_id="ABF02619.1"
FT                   /translation="MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGAR
FT                   RLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTG
FT                   QYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGL
FT                   ATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARA
FT                   DVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVNDAASLNSVTEANQQKPLLGLF
FT                   ADGNMPVRWLGPKATYHGNIDKPAVTYTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFF
FT                   LQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQVV
FT                   APDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQT
FT                   DLFYTMKAALGLK"
FT   gene            365291..365629
FT                   /gene="psiF"
FT                   /locus_tag="SFV_0347"
FT   CDS_pept        365291..365629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="SFV_0347"
FT                   /product="induced by phosphate starvation"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02620"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K6"
FT                   /protein_id="ABF02620.1"
FT                   /translation="MKRDGAMKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQ
FT                   ATAQALKGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFM
FT                   SACLKKAA"
FT   mobile_element  complement(365638..366947)
FT                   /mobile_element_type="insertion sequence:IS629"
FT   gene            complement(365680..366567)
FT                   /locus_tag="SFV_0348"
FT   CDS_pept        complement(365680..366567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0348"
FT                   /product="IS629 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02621"
FT                   /db_xref="GOA:Q0T7K5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K5"
FT                   /protein_id="ABF02621.1"
FT                   /translation="MPLLDKLREQYGVGPLCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKKEIQRVYDENHKVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGD
FT                   SYDNAMAESINGLYKAKVIHRKSWKNRAEVELATLTWVDWYNNRRLLERLGHTPPAEAE
FT                   KAYYASIGNDDLAA"
FT   gene            complement(366567..366893)
FT                   /locus_tag="SFV_0349"
FT   CDS_pept        complement(366567..366893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0349"
FT                   /product="IS629 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02622"
FT                   /db_xref="GOA:Q0SYJ3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SYJ3"
FT                   /protein_id="ABF02622.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            367044..368159
FT                   /gene="yaiC"
FT                   /locus_tag="SFV_0350"
FT   CDS_pept        367044..368159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiC"
FT                   /locus_tag="SFV_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02623"
FT                   /db_xref="GOA:Q0T7K3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K3"
FT                   /protein_id="ABF02623.1"
FT                   /translation="MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPR
FT                   AVGLAGMFLPIVSTLVSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKT
FT                   DAVLAGMWVGVMGVNVLPSTAMLMILCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGI
FT                   TVSFNSAPLEWWLSLPIIVVYPLMFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRR
FT                   HWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVVLTRQLQITLRG
FT                   SDVIGRFGGDEFAVIMSGTPAESAITAMLRVREGLNTLRLPNTPQVTLRISVGVAPLNP
FT                   QMSHYREWLKSADLALYKAKKAGRNRTEVAA"
FT   gene            complement(368176..368985)
FT                   /gene="proC"
FT                   /locus_tag="SFV_0351"
FT   CDS_pept        complement(368176..368985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SFV_0351"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="Code: E; COG: COG0345"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02624"
FT                   /db_xref="GOA:Q0T7K2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K2"
FT                   /protein_id="ABF02624.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDQFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPALVNAGMTSVTPNALVTPEDTADALNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHP
FT                   GALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKLSKS"
FT   gene            368985..369563
FT                   /gene="yaiI"
FT                   /locus_tag="SFV_0352"
FT   CDS_pept        368985..369563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="SFV_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1671"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02625"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7K1"
FT                   /protein_id="ABF02625.1"
FT                   /translation="MPHSCREIHCFDNRWQKHKQNYAGRQKRDTIEDYPTKDDFMTIWV
FT                   DADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFIRTLRVAAGFDVADNEIVRQ
FT                   CEAGDLVITADIPLAAEAIEKGAAALNSRGERYTPATIRERLTMRDFMDTLRASGIQTG
FT                   GPDSLSQRDRQAFAAELEKWWLEVQRSRG"
FT   gene            369746..370270
FT                   /gene="aroL"
FT                   /locus_tag="SFV_0353"
FT   CDS_pept        369746..370270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="SFV_0353"
FT                   /product="shikimate kinase II"
FT                   /note="Code: E; COG: COG0703"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02626"
FT                   /db_xref="GOA:Q0T7K0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7K0"
FT                   /protein_id="ABF02626.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
FT   gene            370320..370511
FT                   /gene="yaiA"
FT                   /locus_tag="SFV_0354"
FT   CDS_pept        370320..370511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="SFV_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02627"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J9"
FT                   /protein_id="ABF02627.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
FT   gene            370769..371446
FT                   /gene="aroM"
FT                   /locus_tag="SFV_0355"
FT   CDS_pept        370769..371446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="SFV_0355"
FT                   /product="protein of aro operon, regulated by aroR"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02628"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J8"
FT                   /protein_id="ABF02628.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNQLAHVSRRKVERDLQGVVEVLDNQGYDVILLMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEDMLPVQAQKWQILQKSPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFHQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
FT   gene            371518..371802
FT                   /gene="yaiE"
FT                   /locus_tag="SFV_0356"
FT   CDS_pept        371518..371802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="SFV_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3123"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02629"
FT                   /db_xref="GOA:Q0T7J7"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7J7"
FT                   /protein_id="ABF02629.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   gene            372011..372292
FT                   /locus_tag="SFV_0357"
FT   CDS_pept        372011..372292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02630"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J6"
FT                   /protein_id="ABF02630.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPASLLTTLTEPQDRSLAINNPQLAAD
FT                   VKTAWLKEDPSLLLFVEQPDLSQLRDLVKTGATRKIRSEARHRLEEKQ"
FT   gene            372289..372744
FT                   /locus_tag="SFV_0358"
FT   CDS_pept        372289..372744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02631"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J5"
FT                   /protein_id="ABF02631.1"
FT                   /translation="MTQRPWSKLQREIYDLLTPTINLQIHCTRYPMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNAGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKIIARRSE"
FT   gene            complement(372822..373805)
FT                   /gene="yaiD"
FT                   /locus_tag="SFV_0360"
FT   CDS_pept        complement(372822..373805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiD"
FT                   /locus_tag="SFV_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: L; COG: COG2974"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02633"
FT                   /db_xref="GOA:Q0T7J4"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J4"
FT                   /protein_id="ABF02633.1"
FT                   /translation="MAMQGRRQFVIMPAKFNDKAVEIIMLWFKNLMVYRLSREISLRAE
FT                   EMEKQLASMAFTPCGSQDMAKMGWVPPMGSHSDALTHVANGQIVICARKEEKILPSPVI
FT                   KQALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRAFSRFSQTMMWLDTVNGLIMV
FT                   DCASAKKAEDTLALLRKSLGSLPVVPLSMENPIELTLTEWVRSGSAAQGFQLLDEAELK
FT                   SLLEDGGVIRAKKQDLTSEEITNHIEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCD
FT                   ELRDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLGGEAQR"
FT   gene            373720..374766
FT                   /gene="yajF"
FT                   /locus_tag="SFV_0359"
FT   CDS_pept        373720..374766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajF"
FT                   /locus_tag="SFV_0359"
FT                   /product="possible NAGC-like transcriptional regulator"
FT                   /note="Code: KG; COG: COG1940"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02632"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J3"
FT                   /protein_id="ABF02632.1"
FT                   /translation="MNHSMIISTALSLNLAGMITNCRRPCIANPVVRLYAIDIEKNKES
FT                   TVRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRG
FT                   TVGMGIPGSISPYTGVVKNVNSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDG
FT                   AAAGAQTVFAVIIGTGCGAGVAFNGRTHIGGNGTAGEWGHNPLPWMDEDELRYREEVPC
FT                   YCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKS
FT                   LAHVVNILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVSKAKHGDSSGVRG
FT                   AAWLWPQE"
FT   gene            complement(374909..376186)
FT                   /gene="araJ"
FT                   /locus_tag="SFV_0361"
FT   CDS_pept        complement(374909..376186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="SFV_0361"
FT                   /product="involved in either transport or processing of
FT                   arabinose polymers"
FT                   /note="Code: G; COG: COG2814"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02634"
FT                   /db_xref="GOA:Q0T7J2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J2"
FT                   /protein_id="ABF02634.1"
FT                   /translation="MNYLLALLVVILQAITLLATVIGSRSGGCDGGMKKVILSLALGTF
FT                   GLGMAEFGIMSVLTELAHNVGISIPAAGHMISYYALVVVVGAPIIALFSSRYSLKHILL
FT                   FLVALCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFGVGAIVLSKIIKPGKVTAAVAG
FT                   MVSGMTVANLLGIPLGTYLSQECWRYTFLLIAVFNIAVMASVYFWVPDIRDEAKGNLRE
FT                   QFHFLRSPAPWLIFAATMFGNAGVFAWFSYVKPYMMFISGFSETAMTFIMMLVGLGMVL
FT                   GNMLSGRISGRYSPLRIAAVTDFIIVLALLMLFFCGGMKTTSLIFAFICCAGLFALSAP
FT                   LQILLLQNAKGGELLGAAGGQIAFNLGSAVGAYCGGMMLTLGLAYNYVALPAALLSFAA
FT                   MSSLLLYGRYKRQQAADSPVLAKPLG"
FT   gene            complement(376216..379359)
FT                   /gene="sbcC"
FT                   /locus_tag="SFV_0362"
FT   CDS_pept        complement(376216..379359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="SFV_0362"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /note="Code: L; COG: COG0419"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02635"
FT                   /db_xref="GOA:Q0T7J1"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J1"
FT                   /protein_id="ABF02635.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQ
FT                   PDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKPKERAELLEELTGTEIYGQISAMVFEQHKSARTELEKLQAQASGVTLLTPEQVQSLT
FT                   ASLQVLTDEEKQLITAQQQEQQSLNWLTRQDELQQEASRRQQALQQALAEEEKAQPQLA
FT                   ALSLAQPARNLRPHWERIAEHSAALAHIRQQIEEVNTRLQSTMALRASIRHHAAKQSAE
FT                   LQQQQQSLNTWLQEHDRFRQWNNELAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNAL
FT                   AAITLTLTADEVATALAQHAEQRPLRQRLVALHGQIVPQQKRLAQLMVTIQNVTLEQTQ
FT                   RNVALNEMRQRYKEKTQQLADVKTICEQEARIKTLEAQRAQLQAGQPCPLCGSTSHPAV
FT                   EAYQALEPGVNQSRLLALENEVKKLGEEGAALRGQLDALTKQLQRDENEAQSLRQDEQA
FT                   LTQQWQAVTASLNITLQPQDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQY
FT                   QQQIEQRQQQLLTALAGYALTLPQEDEEESWLATRQQEAQSWQQRQNELTALQNRIQQL
FT                   TPILETLPQSDDLPHSEETVALDNWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQ
FT                   FDTALQASVFDDQQAFLAALMDEQTLTQLEQLKQNLENQRRQAQTLVTQTAETLAQHQQ
FT                   HRPDGLALTVTVEQIQQELAQTHQKLRENTTSQGEIRQQLKQDADNRQQQQTLMQQIAQ
FT                   MTQQVEDWGYLNSLIGSKEGDKFRKFAQRLTLDNLVHLANQQLTRLHGRYLLQRKASEA
FT                   LEVEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLD
FT                   SETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLESTFAVK"
FT   gene            complement(379356..380558)
FT                   /gene="sbcD"
FT                   /locus_tag="SFV_0363"
FT   CDS_pept        complement(379356..380558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="SFV_0363"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /note="Code: L; COG: COG0420"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02636"
FT                   /db_xref="GOA:Q0T7J0"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7J0"
FT                   /protein_id="ABF02636.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQTHQVDAIIV
FT                   AGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDIMAFLNTTV
FT                   VASAGHAPQILPRRDGTPGAVLCPIPFLRPRDIISSQAGLNGIEKQQHLLAAITDYYQQ
FT                   HYADACKLRGDQPLPIIATGHLTTVGSSKSDAVRDIYIGTLDAFPAQNFPPADYIALGH
FT                   IHRAQIIGGMEHVRYCGSPIPLSFDECGKSKYVHLVTFSNGKLESVENLNVPVTQPMAV
FT                   LKGDLASITAQLEQWRDVSQEPPVWLDIEITTDEYLHDIQRKIQALTESLPVEVLLVRR
FT                   SREQRERVLASQQRETLSELSVEEVFNRRLALEELDESQQQRLQHLFTTTLRTLAGEHE
FT                   A"
FT   gene            380748..381437
FT                   /gene="phoB"
FT                   /locus_tag="SFV_0364"
FT   CDS_pept        380748..381437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="SFV_0364"
FT                   /product="positive response regulator for pho regulon"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02637"
FT                   /db_xref="GOA:Q0T7I9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I9"
FT                   /protein_id="ABF02637.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIKMQGLSLNPTSHRVMAGEEPLEMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            381495..382790
FT                   /gene="phoR"
FT                   /locus_tag="SFV_0365"
FT   CDS_pept        381495..382790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="SFV_0365"
FT                   /product="positive and negative sensor protein for pho
FT                   regulon"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02638"
FT                   /db_xref="GOA:Q0T7I8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I8"
FT                   /protein_id="ABF02638.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIAKNSD"
FT   gene            383197..384516
FT                   /gene="brnQ"
FT                   /locus_tag="SFV_0366"
FT   CDS_pept        383197..384516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SFV_0366"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /note="Code: E; COG: COG1114"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02639"
FT                   /db_xref="GOA:Q0T7I7"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I7"
FT                   /protein_id="ABF02639.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VVAIVWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFCLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
FT   gene            384592..385965
FT                   /gene="proY"
FT                   /locus_tag="SFV_0367"
FT   CDS_pept        384592..385965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="SFV_0367"
FT                   /product="proline permease transport protein"
FT                   /note="Code: E; COG: COG1113"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02640"
FT                   /db_xref="GOA:Q0T7I6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I6"
FT                   /protein_id="ABF02640.1"
FT                   /translation="MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGIAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVLFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTT
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVP
FT                   GGVATTIGGLIFLLFIIGLIGYHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ"
FT   gene            386124..387938
FT                   /gene="malZ"
FT                   /locus_tag="SFV_0368"
FT   CDS_pept        386124..387938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="SFV_0368"
FT                   /product="maltodextrin glucosidase"
FT                   /note="Code: G; COG: COG0366"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02641"
FT                   /db_xref="GOA:Q0T7I5"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I5"
FT                   /protein_id="ABF02641.1"
FT                   /translation="MLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNEE
FT                   MSVPMHKQRSQPQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPAR
FT                   LEQFAVDVPDIGPQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWDE
FT                   PVTAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDPQ
FT                   FGGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNLGTGGACHNSESPWRDWY
FT                   SFSDDGTALDWLGYASLTKLDYQSESLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVHM
FT                   LGEAGGARNNMQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTFP
FT                   LWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGR
FT                   DIARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDPFCRKPFPWQVEKQDTALFALYRRM
FT                   IVLRKKSQALRRGGCQVLYAEDNVVVFVRVLNQQRVLVAINRGEASEVVLPASPFLNAV
FT                   QWQCKEGHGQLTDGILALPAISATVWMN"
FT   gene            complement(387943..388516)
FT                   /pseudo
FT                   /gene="yajB"
FT                   /locus_tag="SFV_0369"
FT                   /note="frameshift; original product: putative glycoprotein"
FT   gene            388609..389679
FT                   /gene="queA"
FT                   /locus_tag="SFV_0370"
FT   CDS_pept        388609..389679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="SFV_0370"
FT                   /product="probably S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="Code: J; COG: COG0809"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02642"
FT                   /db_xref="GOA:Q0T7I4"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7I4"
FT                   /protein_id="ABF02642.1"
FT                   /translation="MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESINATMTARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQ
FT                   IFIYPGFQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDA
FT                   MFITYNPQAINERVGE"
FT   gene            389734..390861
FT                   /gene="tgt"
FT                   /locus_tag="SFV_0371"
FT   CDS_pept        389734..390861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SFV_0371"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /note="Code: J; COG: COG0343"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02643"
FT                   /db_xref="GOA:Q0T7I3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7I3"
FT                   /protein_id="ABF02643.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRERFDSLGNKNALFGIIQGSIYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD"
FT   gene            390884..391216
FT                   /gene="yajC"
FT                   /locus_tag="SFV_0372"
FT   CDS_pept        390884..391216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SFV_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: U; COG: COG1862"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02644"
FT                   /db_xref="GOA:Q0T7I2"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I2"
FT                   /protein_id="ABF02644.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            391277..393091
FT                   /gene="secD"
FT                   /locus_tag="SFV_0373"
FT   CDS_pept        391277..393091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="SFV_0373"
FT                   /product="SecD"
FT                   /note="protein secretion; membrane protein, part of the
FT                   channel; Code: U; COG: COG0342"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02645"
FT                   /db_xref="GOA:Q0T7I1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I1"
FT                   /protein_id="ABF02645.1"
FT                   /translation="MLIVVIVIGLLYALPNLFGEDPAVQITGARGVAASEQTLIQVQKT
FT                   LQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALNLAPATPRWLAA
FT                   IHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNY
FT                   GLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEAREYAVQQNINI
FT                   LRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAA
FT                   AASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGN
FT                   IMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITG
FT                   INNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACLAGLLVSILFMI
FT                   IFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERI
FT                   KEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVA
FT                   TSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   gene            393102..394073
FT                   /gene="secF"
FT                   /locus_tag="SFV_0374"
FT   CDS_pept        393102..394073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="SFV_0374"
FT                   /product="protein secretion, membrane protein"
FT                   /note="Code: U; COG: COG0341"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02646"
FT                   /db_xref="GOA:Q0T7I0"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7I0"
FT                   /protein_id="ABF02646.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALTHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   gene            394202..394549
FT                   /gene="yajD"
FT                   /locus_tag="SFV_0375"
FT   CDS_pept        394202..394549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="SFV_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02647"
FT                   /db_xref="GOA:Q0T7H9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H9"
FT                   /protein_id="ABF02647.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
FT   gene            complement(394726..395610)
FT                   /gene="tsx"
FT                   /locus_tag="SFV_0376"
FT   CDS_pept        complement(394726..395610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="SFV_0376"
FT                   /product="Tsx"
FT                   /note="nucleoside channel; receptor of phage T6 and colicin
FT                   K; Code: M; COG: COG3248"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02648"
FT                   /db_xref="GOA:Q0T7H8"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H8"
FT                   /protein_id="ABF02648.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   NAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
FT   gene            complement(395908..396507)
FT                   /gene="yajI"
FT                   /locus_tag="SFV_0377"
FT   CDS_pept        complement(395908..396507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="SFV_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02649"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H7"
FT                   /protein_id="ABF02649.1"
FT                   /translation="MLSLLLPSTIRLIATRKGRPMNTNVFRLLLLGSLFSLSACVQQSE
FT                   VRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLLGAKTPARLESQIGTLR
FT                   MSLVNITPDTDGTTLTLRIQGESNDPLPAFSGTVEYWQIQGTIDNFQEINVQNQLINAP
FT                   ASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQ"
FT   gene            396598..397047
FT                   /gene="ybaD"
FT                   /locus_tag="SFV_0378"
FT   CDS_pept        396598..397047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="SFV_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: K; COG: COG1327"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02650"
FT                   /db_xref="GOA:Q0T7H6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7H6"
FT                   /protein_id="ABF02650.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDYVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
FT   gene            397069..398154
FT                   /gene="ribD"
FT                   /locus_tag="SFV_0379"
FT   CDS_pept        397069..398154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SFV_0379"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /note="Code: H; COG: COG1985"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02651"
FT                   /db_xref="GOA:Q0T7H5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H5"
FT                   /protein_id="ABF02651.1"
FT                   /translation="MARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHA
FT                   EVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPNPQVAGR
FT                   GLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAMASGESQ
FT                   WITSPQARRDVQRQRAQSHAILTSSATVLADDPALTVRWSELDEQTQALYPQQNLRQPV
FT                   RIVIDSQNRVTPEHRIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDLVVLMMQ
FT                   LGKQQINSIWVEAGPTLAGVLLQAGLVDELIVYIAPKLLGSDARGLCSLPGLEKLADAP
FT                   QFKFKEIRHVGPDVCLHLVGA"
FT   gene            398189..398713
FT                   /gene="ribH"
FT                   /locus_tag="SFV_0380"
FT   CDS_pept        398189..398713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SFV_0380"
FT                   /product="riboflavin synthase, beta chain"
FT                   /note="Code: H; COG: COG0054"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02652"
FT                   /db_xref="GOA:Q0T7H4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H4"
FT                   /protein_id="ABF02652.1"
FT                   /translation="MMLKSAPLRGHTRTRRKKMNIIEANVATPDARVAITIARFNNFIN
FT                   DSLLEGAIDALKRIGQVKDENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGG
FT                   TAHFEYVAGGASNGLAHVAQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTAL
FT                   EMINVLKAIKA"
FT   gene            398733..399152
FT                   /gene="nusB"
FT                   /locus_tag="SFV_0381"
FT   CDS_pept        398733..399152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SFV_0381"
FT                   /product="transcription termination L factor"
FT                   /note="Code: K; COG: COG0781"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02653"
FT                   /db_xref="GOA:Q0T7H3"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7H3"
FT                   /protein_id="ABF02653.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            399230..400207
FT                   /gene="thiL"
FT                   /locus_tag="SFV_0382"
FT   CDS_pept        399230..400207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SFV_0382"
FT                   /product="thiamin-monophosphate kinase"
FT                   /note="Code: H; COG: COG0611"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02654"
FT                   /db_xref="GOA:Q0T7H2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H2"
FT                   /protein_id="ABF02654.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVEPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVSFTCIGQMTADIEGLCFIRDGEPVTFDWKGYDHFVTP"
FT   gene            400194..400703
FT                   /gene="pgpA"
FT                   /locus_tag="SFV_0383"
FT   CDS_pept        400194..400703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="SFV_0383"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /note="Code: I; COG: COG1267"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02655"
FT                   /db_xref="GOA:Q0T7H1"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H1"
FT                   /protein_id="ABF02655.1"
FT                   /translation="MSRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPF
FT                   WYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPT
FT                   NDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHW
FT                   PLGILS"
FT   gene            complement(400757..401731)
FT                   /gene="yajO"
FT                   /locus_tag="SFV_0384"
FT   CDS_pept        complement(400757..401731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="SFV_0384"
FT                   /product="putative NAD(P)H-dependent xylose reductase"
FT                   /note="Code: C; COG: COG0667"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02656"
FT                   /db_xref="GOA:Q0T7H0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7H0"
FT                   /protein_id="ABF02656.1"
FT                   /translation="MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFARREDVIVATKVFHRVGDLPEGLSRAQ
FT                   ILRSINDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALELQKQHCWAQFVSMQDHYNLIYREEEREMLPLCYQEGVVVIPWSPLARGRLTRP
FT                   WGETTARLVSDEVGKNLYKESDENDAQIAERLTGVSEELGATRAQVALAWLLSKPGIAA
FT                   PIIGTSREEQLDELLNAVDITLKPEQIAELETPYKPHAVVGFK"
FT   gene            complement(401786..403582)
FT                   /gene="dxs"
FT                   /locus_tag="SFV_0385"
FT   CDS_pept        complement(401786..403582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="SFV_0385"
FT                   /product="1-deoxyxylulose-5-phosphate synthase"
FT                   /note="Code: HI; COG: COG1154"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02657"
FT                   /db_xref="GOA:Q0T7G9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7G9"
FT                   /protein_id="ABF02657.1"
FT                   /translation="MPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVY
FT                   NTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTS
FT                   ISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSI
FT                   SENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFE
FT                   ELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHAVPK
FT                   FDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDR
FT                   YFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRA
FT                   GIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGN
FT                   AVGVELTPLEKLPIGKGIVKRRGEKLVILNFGTLMPEAAKVAESLNATLVDMRFVKPLD
FT                   EALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQE
FT                   EMRAELGLDAAGMEAKIKAWLA"
FT   gene            complement(403673..404572)
FT                   /gene="ispA"
FT                   /locus_tag="SFV_0386"
FT   CDS_pept        complement(403673..404572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="SFV_0386"
FT                   /product="geranyltranstransferase (farnesyldiphosphate
FT                   synthase)"
FT                   /note="Code: H; COG: COG0142"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02658"
FT                   /db_xref="GOA:Q0T7G8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7G8"
FT                   /protein_id="ABF02658.1"
FT                   /translation="MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGK
FT                   RLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVK
FT                   FGEANAILAGDALQTLAFSILSDANMPEVSDRDRISMISELASASGIAGMCGGQALDLD
FT                   AEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQS
FT                   PDTSALEALADYIIQRNK"
FT   gene            complement(404572..404814)
FT                   /gene="xseB"
FT                   /locus_tag="SFV_0387"
FT   CDS_pept        complement(404572..404814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SFV_0387"
FT                   /product="exonuclease VII, small subunit"
FT                   /note="Code: L; COG: COG1722"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02659"
FT                   /db_xref="GOA:Q0T7G7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7G7"
FT                   /protein_id="ABF02659.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
FT   gene            405020..406468
FT                   /gene="yajK"
FT                   /locus_tag="SFV_0388"
FT   CDS_pept        405020..406468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajK"
FT                   /locus_tag="SFV_0388"
FT                   /product="putative oxidoreductase"
FT                   /note="Code: H; COG: COG0301"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02660"
FT                   /db_xref="GOA:Q0T7G6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7G6"
FT                   /protein_id="ABF02660.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLTIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEG
FT                   KTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTEQEVVEVE
FT                   TVNGFGPNDVILDIRSVDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNKTWLLWCER
FT                   GVMSRLQALYLREQGFNNVKVYRP"
FT   gene            complement(406522..407112)
FT                   /gene="thiJ"
FT                   /locus_tag="SFV_0389"
FT   CDS_pept        complement(406522..407112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="SFV_0389"
FT                   /product="4-methyl-5(beta-hydroxyethyl)-thiazole
FT                   monophosphate synthesis"
FT                   /note="Code: R; COG: COG0693"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02661"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7G5"
FT                   /protein_id="ABF02661.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTINLLVRGGIKVTTASVASDGNLAI
FT                   TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLQVGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(407075..407986)
FT                   /gene="apbA"
FT                   /locus_tag="SFV_0390"
FT   CDS_pept        complement(407075..407986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="SFV_0390"
FT                   /product="alternative pyrimidine biosynthesis"
FT                   /note="Code: H; COG: COG1893"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02662"
FT                   /db_xref="GOA:Q0T7G4"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7G4"
FT                   /protein_id="ABF02662.1"
FT                   /translation="MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETD
FT                   GSIFNESLTANDPDFLATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIE
FT                   ELQNIQQPLLMGTTTHAARRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDV
FT                   AWHNNIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHT
FT                   SAEDLRDYVMQVIDATAENISSMLQDIRALRHTEIDYINGFLLRRARAHGIAVPENTRL
FT                   FEMVKRKESEYERIGTGLPRPW"
FT   gene            408154..408645
FT                   /gene="yajQ"
FT                   /locus_tag="SFV_0391"
FT   CDS_pept        408154..408645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="SFV_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1666"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02663"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7G3"
FT                   /protein_id="ABF02663.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
FT   gene            complement(408705..410435)
FT                   /locus_tag="SFV_0392"
FT   CDS_pept        complement(408705..410435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02664"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7G2"
FT                   /protein_id="ABF02664.1"
FT                   /translation="MKAKSTLLLMILSVFYSHQVLSSEPTQPDVYSVVEKKLNSALPLE
FT                   ENTTFRSQAEWFNLQYELLVSGYPERAYNLLSKLETESKNAKYYLDLTASRVAEEEAPE
FT                   TALTFLSKIGLNKPATLTSFESYINSWIKSKQPEKAMQLLSLDENALNYYLPTVLVAYQ
FT                   IVPDKAISIYNSVYGDNVVIPYQQVTMLLTVAEGYQTKGDIKNAIHYADKALNMFDKAI
FT                   AVDSSRESHYSDEYLKLMNIYAANGNKEKAVVLSQRLHKAITESQSNYLSTLEGILLFY
FT                   RNNDMQQDYQNSLSNYIVFIDKIFAFSPSTRSELSLINLLNSLNEVELMRKRLAFLMTA
FT                   PEYACYDSQYCYEDKVSALKILYRHHDNELMDKYFTTLLKEISNQPLEDWDIIISNTGE
FT                   KFSEVGLTKYAQHLASFAEEFYIKEQKSHSESEMRGLFSSLAELYSFGNDTASANRVFH
FT                   QHVPAFNTDHMIQYFINAKEWNNARELLIKEEMLGMHNLILLENICMQKNAECMAHITF
FT                   TLNKLTTQPAITKIDSVGNEQLYQIGKIYHKLEIKPEPEQQVLIQSLYDRASGSASATQ
FT                   "
FT   gene            complement(410488..412641)
FT                   /locus_tag="SFV_0393"
FT   CDS_pept        complement(410488..412641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2849"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02665"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7G1"
FT                   /protein_id="ABF02665.1"
FT                   /translation="MYKSLFTIIILLYSASSYAKSESPPASTITFIAQIDHVELNKTAL
FT                   SHDMKLVLADRFYFKTSNPCETNSISARPESMDITDKAYADKLKKLETPFLDDRYFFMT
FT                   INQCDGNGTPMLTDIKVCTTELCGAEYTKKMSTVWLDETLKPTAKRLAIYFIQSPLPYD
FT                   EEKKQWKVTGWYISSTDNQSSTKQIAFEGYTDTDNFSDSKFISSFKSWFESGKIKNIAN
FT                   YNPKGERDGKYESYYNSNGNVYESLSFSNGLINGEFITYYENGAIESKRHFNNDKIKDG
FT                   ECPHFYEDGKIKQQHSYLNSKLDGPAYEYYPDGKLMQENFYQQSVLIGNDTSYYQSGKI
FT                   SSIHNRNSRGQYDGANERYSEEGKLLSKSVYKDGKQISVQTWYENGQKEEEKHFDEQGQ
FT                   LNGLVKQWYKNGNLAKSQNYKHDILDGNSEEWYENGIPESLSPYKNGKTDGIAKSWNKY
FT                   GKLTYSIEYKNGVENGAYRNWSKNTGKLTKETLYINGIRQGVEKEFNDRTGKLLTSTQY
FT                   VNNKRHGTEETYDQNGIKYITCYQNDQKLSSLDNPTQIKDNATTGDSSAQFALGKYEFI
FT                   CANIDEGIKWLTKSAEQKNTDAIYFLATAYKGNGIPTNNEKYLAYLQQAATLGSSNAQA
FT                   EIGYLYLIGKELPQNLPDAGVWFKKAAAQGNFAAHFYLGRMYQNGDGVERNMEKARFHL
FT                   SNAAEGGIEPALKALNELEHQTK"
FT   gene            complement(412823..414193)
FT                   /gene="yajR"
FT                   /locus_tag="SFV_0394"
FT   CDS_pept        complement(412823..414193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="SFV_0394"
FT                   /product="putative transport protein"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02666"
FT                   /db_xref="GOA:Q0T7G0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7G0"
FT                   /protein_id="ABF02666.1"
FT                   /translation="MNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHKLG
FT                   LHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFGIM
FT                   CLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQVF
FT                   VFCVGLIVVAEIVLWNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVAIGGSLGGWIDGMFDGQRVFLAGAMLAAVWLAVASTMKEPPYVSSLRI
FT                   EIPENVMADEKLEKCLLTTPGVKDVLLAKLEHCVYVKVDSKITNRFEIERVINEVSY"
FT   gene            414587..415861
FT                   /locus_tag="SFV_0395"
FT   CDS_pept        414587..415861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0395"
FT                   /product="putative periplasmic protein"
FT                   /note="Code: R; COG: COG0790"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02667"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7F9"
FT                   /protein_id="ABF02667.1"
FT                   /translation="MWSGKVILLSLGLSLASFCHASTDIDQLYERIVNKDQTALKELQK
FT                   LADTNNTQALVLLGFIYEHGVTVSVDIPKAIQWYEKACNQGGEYGCYNARYFFQYGKGV
FT                   TLDVTRAQKYASKSKTDDLNIPPDLMNKIINQAYELKSGAETDKTKRASLIEFVSRYVG
FT                   QAPENDLLFWGRIGFSKPEILRLATLWAQEGDPEMDYIVGNLYLDDFSPSDDRRSLDTI
FT                   KKALQWFRTAEEKGYPMAQYTMGDTYENGSAGLKIDAVEAKKWYELAANKNDEKALVAL
FT                   GNIYYSGLTGEVDYSKASMLFDKAEQQGAKKAALWLSWMYYNGLGETLDCDKVWDYYEK
FT                   GAGKYSMKFNKDEYLTRCNQDQKTRETQGDTLPYITLKHYGTYGFNANEKPKICDVSIE
FT                   INADKISSITNLQLTLELKGGGGSE"
FT   gene            416098..417033
FT                   /locus_tag="SFV_0396"
FT   CDS_pept        416098..417033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02668"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7F8"
FT                   /protein_id="ABF02668.1"
FT                   /translation="MLPNRILFSLMLIVSSGVVASKKAHELYDSIYGGKSAPDVINTLH
FT                   KMAESGDIDAQSLLGWEYYQPRYDTKPDVQEAIKWFELAAKQGDREAPLALGSIYYDGE
FT                   QVWVDYAKAYALFNQAAQQGMNLAWSRLGMMYANGQYVEVDCKKAKEYLDKGVYIYGGP
FT                   EDFLATCRKDMIDRKTVEDTLPVITVTRSGMRDNFLDKGFSCMDSLFATTNKLGEVANL
FT                   RVTFSIRRPSGKEINQTVGFAPFGLNRLNISFTDYLFGSFTSNSSLILYKPEFERKSCA
FT                   TVRTTIVAATATINGKDVELLKAGAIEQKW"
FT   gene            complement(417089..417487)
FT                   /locus_tag="SFV_0397"
FT   CDS_pept        complement(417089..417487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: KR; COG: COG0454"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02669"
FT                   /db_xref="GOA:Q0T7F7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7F7"
FT                   /protein_id="ABF02669.1"
FT                   /translation="MRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPS
FT                   EIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYAR
FT                   LGFVQLSATPNAFGAVPMFLAIQHILAA"
FT   gene            complement(417622..417981)
FT                   /locus_tag="SFV_0398"
FT   CDS_pept        complement(417622..417981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4453"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02670"
FT                   /db_xref="GOA:Q0T7F6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7F6"
FT                   /protein_id="ABF02670.1"
FT                   /translation="MRSTPYDFIQLIKEVIMLGKTAALYDVDKTLKNARVELKTSPDAK
FT                   NKLREAAQAVGVDLSAFILSAAMERAESVLDNQRRRELSNQSWELMNQLITEPAQPTLA
FT                   LKALMKRKNSDGRQA"
FT   gene            complement(418118..419008)
FT                   /pseudo
FT                   /gene="cyoE"
FT                   /locus_tag="SFV_0399"
FT                   /note="contains in-frame stop codon; original product:
FT                   protoheme IX farnesyltransferase"
FT   gene            complement(419020..419349)
FT                   /gene="cyoD"
FT                   /locus_tag="SFV_0400"
FT   CDS_pept        complement(419020..419349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="SFV_0400"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="Code: C; COG: COG3125"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02671"
FT                   /db_xref="GOA:Q0T7F5"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7F5"
FT                   /protein_id="ABF02671.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(419349..419963)
FT                   /gene="cyoC"
FT                   /locus_tag="SFV_0401"
FT   CDS_pept        complement(419349..419963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="SFV_0401"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /note="Code: C; COG: COG1845"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02672"
FT                   /db_xref="GOA:Q0T7F4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7F4"
FT                   /protein_id="ABF02672.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
FT   gene            complement(419887..421944)
FT                   /pseudo
FT                   /gene="cyoB"
FT                   /locus_tag="SFV_0402"
FT                   /note="contains in-frame stop codon; original product:
FT                   cytochrome o ubiquinol oxidase subunit I"
FT   gene            complement(421966..422433)
FT                   /pseudo
FT                   /gene="cyoA"
FT                   /locus_tag="SFV_0403"
FT                   /note="truncated; original product: cytochrome o ubiquinol
FT                   oxidase subunit II"
FT   mobile_element  422464..423311
FT                   /mobile_element_type="insertion sequence:ISSfl4"
FT                   /note="partial"
FT   gene            complement(422496..423302)
FT                   /locus_tag="SFV_0404"
FT   CDS_pept        complement(422496..423302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0404"
FT                   /product="ISSfl4 ORF3"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02673"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SYR1"
FT                   /protein_id="ABF02673.1"
FT                   /translation="MHADDTPVKVLAPGNGKTKTGRLWVYVRDDRNAGSSLPAAVWFAY
FT                   SADRKGEHPQLHLAKYQGVLQADAYAGYNVLYETGRVKEAGCLAHARRKIHDEDVRRPT
FT                   EMTQEALRRIAELYDIEAEIRGSPAEERLAVRKARSVQLMQSLYDWIQLQRKTLSKHAE
FT                   MAKAFDYILNHWNALNEFCRDGRVEIDNNIGENALRSVAVGRKNYLFFGSDKGGESAAI
FT                   IYSLLVTCKQNEVEPEDWLREVIEKLNDWPSNQVHELLPWNFSSVK"
FT   gene            complement(423278..423412)
FT                   /locus_tag="SFV_0405"
FT   CDS_pept        complement(423278..423412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0405"
FT                   /product="ISSfl4 ORF3"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SYR0"
FT                   /protein_id="ABF02674.1"
FT                   /translation="MNNELPDDIELLKAMLRKQQSRLRQYACQVAGYEQERCTQMTLR"
FT   mobile_element  423304..424532
FT                   /mobile_element_type="insertion sequence:ISSfl4"
FT                   /note="partial"
FT   gene            complement(423432..423779)
FT                   /locus_tag="SFV_0406"
FT   CDS_pept        complement(423432..423779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0406"
FT                   /product="ISSfl4 ORF2"
FT                   /note="Code: L; COG: COG3436"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02675"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SYQ9"
FT                   /protein_id="ABF02675.1"
FT                   /translation="MITLPTGTKIWIIAGITDMRCGFNGLASKVQNTLKDDPFSGHIFV
FT                   FRGRSGKMVKILWADRDGLCLFAKRLERGRFVWPVTREGKVHLTPAQLSMLLEGIAWQH
FT                   PKRTERPGIRI"
FT   gene            complement(423776..424450)
FT                   /locus_tag="SFV_0407"
FT   CDS_pept        complement(423776..424450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0407"
FT                   /product="ISSfl4 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02676"
FT                   /db_xref="GOA:Q0SXN9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXN9"
FT                   /protein_id="ABF02676.1"
FT                   /translation="MNSQTTKDIPCFRSYLPDALRLRFEDKLTIRAIAQRLGLSHSTIH
FT                   TLFQRFLASGIAWPLPDSVSFAQLDAILYANRKKELTEPQIREGSWRKERRTSYSREFK
FT                   VRLAKQALQPGAVVARIAREHDINNNLLFKWKSQYEDGLLSDDDIQECMPVPVALTDTP
FT                   EPTRPVTNPFWRNKHDERPEGAPGNVPRCELHLKSGVVKLFDPLTPELLRALIREMKGG
FT                   IR"
FT   gene            complement(424820..426295)
FT                   /gene="ampG"
FT                   /locus_tag="SFV_0408"
FT   CDS_pept        complement(424820..426295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="SFV_0408"
FT                   /product="regulates beta-lactamase synthesis"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02677"
FT                   /db_xref="GOA:Q0T7E9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7E9"
FT                   /protein_id="ABF02677.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADKWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILL
FT                   LVCRQTLEYTRVNDNFISRTEYPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSF
FT                   LPALLEVGVLVALSGVVLGGLLDYLALRKTHLT"
FT   gene            complement(426339..427019)
FT                   /gene="yajG"
FT                   /locus_tag="SFV_0409"
FT   CDS_pept        complement(426339..427019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="SFV_0409"
FT                   /product="putative polymerase/proteinase"
FT                   /note="Code: M; COG: COG3056"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02678"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7E8"
FT                   /protein_id="ABF02678.1"
FT                   /translation="MMNLHALPTSPRRWQCYDGGNFYQTRLRVSESPNMFKKILFPLVA
FT                   LFMLAGCAKPPTTIEVSPTITLPQQDPSLMGVTVSINGADQRTDQALAKVTRDNQIVTL
FT                   TASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQIIVSQLYADVSQGNVRYNIATKADI
FT                   AIIATAQNGNKMTKNYRASYNVEGAFQASNKNIADAVNSVLTDTIADMSQDTSIHEFIK
FT                   QNAR"
FT   gene            427883..429181
FT                   /gene="tig"
FT                   /locus_tag="SFV_0410"
FT   CDS_pept        427883..429181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SFV_0410"
FT                   /product="trigger factor"
FT                   /note="Code: O; COG: COG0544"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02679"
FT                   /db_xref="GOA:Q0T7E7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7E7"
FT                   /protein_id="ABF02679.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFT
FT                   YSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDR
FT                   VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSA
FT                   IRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVTEKETTFNELMNQQA"
FT   gene            429428..430051
FT                   /gene="clpP"
FT                   /locus_tag="SFV_0411"
FT   CDS_pept        429428..430051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SFV_0411"
FT                   /product="ATP-dependent proteolytic subunit of clpA-clpP
FT                   serine protease"
FT                   /note="Code: OU; COG: COG0740"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02680"
FT                   /db_xref="GOA:Q0T7E6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7E6"
FT                   /protein_id="ABF02680.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   gene            430177..431451
FT                   /gene="clpX"
FT                   /locus_tag="SFV_0412"
FT   CDS_pept        430177..431451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="SFV_0412"
FT                   /product="ATP-dependent protease ATP-binding subunit
FT                   protease"
FT                   /note="Code: O; COG: COG1219"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02681"
FT                   /db_xref="GOA:Q0T7E5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7E5"
FT                   /protein_id="ABF02681.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
FT   gene            431639..433993
FT                   /gene="lon"
FT                   /locus_tag="SFV_0413"
FT   CDS_pept        431639..433993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="SFV_0413"
FT                   /product="DNA-binding, ATP-dependent protease La"
FT                   /note="heat shock K-protein; Code: O; COG: COG0466"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02682"
FT                   /db_xref="GOA:Q0T7E4"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7E4"
FT                   /protein_id="ABF02682.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDVPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADNENRVGQVIGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            434202..434474
FT                   /gene="hupB"
FT                   /locus_tag="SFV_0414"
FT   CDS_pept        434202..434474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="SFV_0414"
FT                   /product="DNA-binding protein HU-beta, NS1 (HU-1)"
FT                   /note="Code: L; COG: COG0776"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02683"
FT                   /db_xref="GOA:Q0T7E3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7E3"
FT                   /protein_id="ABF02683.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            434666..436537
FT                   /gene="ybaU"
FT                   /locus_tag="SFV_0415"
FT   CDS_pept        434666..436537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaU"
FT                   /locus_tag="SFV_0415"
FT                   /product="putative protease maturation protein"
FT                   /note="Code: O; COG: COG0760"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02684"
FT                   /db_xref="GOA:Q0T7E2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7E2"
FT                   /protein_id="ABF02684.1"
FT                   /translation="MMDSLRTAANSLVLKIIFGIIIVSFILTGVSGYLIGGGNNYAAKV
FT                   NDQEISRGQFENAFNSERNRMQQQLGDQYSELAANEGYMKTLRQQVLNRLIDEALLDQY
FT                   ARELKLGISDEQVKQAIFATPAFQIDGKFDNSRYNGILNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVAQQRVVREATIDVNALAAKQPVTEQEIASYYEQNK
FT                   NNFMTPEQFRVSYIKLVAATMQQPVSDADIQSYYDQHQDQFTQPQRTRYSIIQTKTEDE
FT                   AKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSG
FT                   VIKSSVGFLIVRLDDIQPAKVKSLDEVRDDIAAKVKHEKALDAYYALQQKVSDAASNDT
FT                   ESLAGAEQAAGVKATQTGWFSKDNLPEELNFKPVADAIFNGGLVGENGASGINSDIITV
FT                   DGDRAFVLRVSEHKPEAVKPLADVQEQVKALVQHNKAEQQAKVDAEKLLVDLKAGKGAE
FT                   AMQAAGLKFGEPKILSRSGRDPISQAAFALPLPAKDKPSYGMATDMQGNVVLLALDEVK
FT                   QGSMPEDQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            436688..437059
FT                   /gene="ybaV"
FT                   /locus_tag="SFV_0416"
FT   CDS_pept        436688..437059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="SFV_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: L; COG: COG1555"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02685"
FT                   /db_xref="GOA:Q0T7E1"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7E1"
FT                   /protein_id="ABF02685.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
FT   gene            437153..437551
FT                   /gene="ybaW"
FT                   /locus_tag="SFV_0417"
FT   CDS_pept        437153..437551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="SFV_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0824"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02686"
FT                   /db_xref="GOA:Q0T7E0"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7E0"
FT                   /protein_id="ABF02686.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
FT   gene            complement(437603..438298)
FT                   /gene="ybaX"
FT                   /locus_tag="SFV_0418"
FT   CDS_pept        complement(437603..438298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="SFV_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0603"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02687"
FT                   /db_xref="GOA:Q0T7D9"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7D9"
FT                   /protein_id="ABF02687.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQQHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLR"
FT   gene            complement(438363..439787)
FT                   /gene="ybaE"
FT                   /locus_tag="SFV_0419"
FT   CDS_pept        complement(438363..439787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="SFV_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG4533"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02688"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D8"
FT                   /protein_id="ABF02688.1"
FT                   /translation="MLELAQLAPGELRTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPG
FT                   FLPGRAEQHLAGQIFSGLTRFDNNTQRPIGDLAHHWETSTDRLRWDFYLRSTLHWHNGD
FT                   AVKASHLHQRLLMLLQLPALDQLFISVKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSH
FT                   LAHPQFPLIGTGPFRLTQFTAELVRLESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSC
FT                   RHPVQITIGKPEELQRVSQVSSGISLGFCYLTLRKSPRLSLWQARKVISIIHQSGLLQT
FT                   LEVGENLITASHALLPGWTIPHWQVPDEVKLPKTLTLVYHLPIELHTMAERLQATLAAE
FT                   GCELTIIFHNAKNWDDTTLLAHADLMMGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAY
FT                   AHLQSTLDAVQVMPDEENRFNALKAVFSQLMADATLTPLFNYHYRISAPPGVNGVRLTP
FT                   RGWFEFTEAWLPAPSQ"
FT   gene            440155..440973
FT                   /gene="cof"
FT                   /locus_tag="SFV_0420"
FT   CDS_pept        440155..440973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="SFV_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0561"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02689"
FT                   /db_xref="GOA:Q0T7D7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7D7"
FT                   /protein_id="ABF02689.1"
FT                   /translation="MARLVAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFATGRH
FT                   ALEMQHILGALSLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRASMHI
FT                   FNDDGWFTGKESPALLQVFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQIQLY
FT                   EALGERAHLCFSATDCLEVLPVGCNKGAALTVRTQHLGLSLRDCMAFGDAMNDREMLGS
FT                   VGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE"
FT   gene            441019..441585
FT                   /gene="ybaO"
FT                   /locus_tag="SFV_0421"
FT   CDS_pept        441019..441585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="SFV_0421"
FT                   /product="putative LRP-like transcriptional regulator"
FT                   /note="Code: K; COG: COG1522"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02690"
FT                   /db_xref="GOA:Q0T7D6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D6"
FT                   /protein_id="ABF02690.1"
FT                   /translation="MNLSFCAVVFKPHRINCRDFTFKIELKEKKILRGRAMLDKIDRKL
FT                   LALLQQDCTLSLQALAEAVNLTTTPCWKRLKRLEDDGILIGKVALLDPEKIGLGLTAFV
FT                   LIKTQHHSSEWYCRFVTVVTEMPEVLGVWRMAGEYDYLMRVQVADMKRYDEFYKRLVNS
FT                   VPGLSDVTSSFAMEQIKYTTSLPIE"
FT   gene            441615..443387
FT                   /gene="mdlA"
FT                   /locus_tag="SFV_0422"
FT   CDS_pept        441615..443387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="SFV_0422"
FT                   /product="ATP-binding component of a transport system"
FT                   /note="Code: V; COG: COG1132"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02691"
FT                   /db_xref="GOA:Q0T7D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D5"
FT                   /protein_id="ABF02691.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDG
FT                   VTEQHFTTGLILMWIATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYLRHRTGDLMARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLF
FT                   ALLPMPVMAIMIKRNGDALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIH
FT                   QFTYPQTDHPALENVNFALKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIP
FT                   LTKLQLDSWRSRLAVVSQTPFLFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRL
FT                   PQGYDTEVGERGVMLSGGQKQRISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGQGRTVIISAHRLSALTEASEIIVMQHGHIAQRGNHDELAQQSGWYRDMYRYQQLEAA
FT                   LDDVPEIREEAVDA"
FT   gene            443380..445161
FT                   /gene="mdlB"
FT                   /locus_tag="SFV_0423"
FT   CDS_pept        443380..445161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="SFV_0423"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /note="Code: V; COG: COG1132"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02692"
FT                   /db_xref="GOA:Q0T7D4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D4"
FT                   /protein_id="ABF02692.1"
FT                   /translation="MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLL
FT                   ISYFIDNMVAKNNLPLKVVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGAVQQLRTDV
FT                   MDAALRQPLSEFDTQPVGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSL
FT                   DWRMALVAIMIFPVVLVVMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEV
FT                   GVLYAFISYLGRLNEPLIELTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDYPLQSGT
FT                   IEVDNVSFAYRDDNLVLKNINLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIH
FT                   LDGRPLSSLSHSALRQGVAMVQQDPVVLADTFLANVTLGRDISEERVWQALETVQLAEL
FT                   ARSMSDCIYTPLGEQGNNLSVGQKQLLALARVLVETPQILILDEATASIDSGTEQAIQH
FT                   ALAAVREHTTLVVIAHRLSTIIDADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQL
FT                   AGEELAASVREEESLSA"
FT   gene            445204..445680
FT                   /gene="glnK"
FT                   /locus_tag="SFV_0424"
FT   CDS_pept        445204..445680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="SFV_0424"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /note="Code: E; COG: COG0347"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02693"
FT                   /db_xref="GOA:Q0T7D3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D3"
FT                   /protein_id="ABF02693.1"
FT                   /translation="MHCHSAFSFSIFLTSCSLSRFSFLAHRLQYLLRVAEPLPNSDRRG
FT                   SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPK
FT                   VKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL"
FT   gene            445710..446996
FT                   /gene="amtB"
FT                   /locus_tag="SFV_0425"
FT   CDS_pept        445710..446996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="SFV_0425"
FT                   /product="probable ammonium transporter"
FT                   /note="Code: P; COG: COG0004"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02694"
FT                   /db_xref="GOA:Q0T7D2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D2"
FT                   /protein_id="ABF02694.1"
FT                   /translation="MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFM
FT                   TIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLM
FT                   LKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYI
FT                   PIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSVGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLL
FT                   GACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLA
FT                   DLTVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(447045..447905)
FT                   /gene="tesB"
FT                   /locus_tag="SFV_0426"
FT   CDS_pept        complement(447045..447905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="SFV_0426"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="Code: I; COG: COG1946"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02695"
FT                   /db_xref="GOA:Q0T7D1"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D1"
FT                   /protein_id="ABF02695.1"
FT                   /translation="MSQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPV
FT                   EFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHCIGFLEP
FT                   GIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGV
FT                   MRNHN"
FT   gene            448123..448695
FT                   /gene="ybaY"
FT                   /locus_tag="SFV_0427"
FT   CDS_pept        448123..448695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="SFV_0427"
FT                   /product="glycoprotein/polysaccharide metabolism"
FT                   /note="Code: S; COG: COG3126"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02696"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7D0"
FT                   /protein_id="ABF02696.1"
FT                   /translation="MKLVHMASGLAVAIALAACADKSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQGGTKADLTLVPVQQTAVPVQAS
FT                   GGATTTVPSTSPTQVNPSSAVPAPTQY"
FT   mobile_element  448721..450148
FT                   /mobile_element_type="insertion sequence:IS4"
FT   gene            448788..450134
FT                   /locus_tag="SFV_0428"
FT   CDS_pept        448788..450134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0428"
FT                   /product="IS4 ORF"
FT                   /note="Code: L; COG: COG3385"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02697"
FT                   /db_xref="GOA:Q0T7C9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C9"
FT                   /protein_id="ABF02697.1"
FT                   /translation="MFPDFFMHIGQALDLVSRYDSLRNPLTSLGDYLDPELISRCLAES
FT                   GTVTLRKRRLPLEMMVWCIVGMVLERKEPLHQIVNRLDIMLPGNRPFVAPSAVIQARQR
FT                   LGSEAVRRVFTKTAQLWHNATPHPHWCGLTLLAIDGVFWRTPDTPENDAAFPRQTHAGN
FT                   PALYPQVKMVCQMELTSHLLTAAAFGTMKNSENELAEQLIGQTGDNTLTLMDKGYYSLG
FT                   LLNGWSLAGEHRHWMIPLRKGTQYEELRKLSKGDHLVKLKTSPQTRKKWPGLGNEVTAR
FT                   LLTVTRKGKVCHLLTSMTDAMRFPGGEMADLYSNRWEIELGYREIKQTMQLSRLTLRSK
FT                   KPELVEQELWGVLLAYNLVRYQMIKMAEHLKGYWPNQLSFSESCGMVMRMLMTLQGASP
FT                   GRIPELMRDLASMGQLVKLPTRRGRAFPRVVKERPWKYPTAPKKSQSVA"
FT   gene            complement(450164..450553)
FT                   /gene="ybaZ"
FT                   /locus_tag="SFV_0429"
FT   CDS_pept        complement(450164..450553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="SFV_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: L; COG: COG3695"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02698"
FT                   /db_xref="GOA:Q0T7C8"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C8"
FT                   /protein_id="ABF02698.1"
FT                   /translation="MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIP
FT                   EGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQR
FT                   QALLAEGVMVSGSGQIDLQRYRWNY"
FT   gene            450854..451207
FT                   /gene="ybaA"
FT                   /locus_tag="SFV_0430"
FT   CDS_pept        450854..451207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="SFV_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5507"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02699"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C7"
FT                   /protein_id="ABF02699.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
FT   gene            complement(451249..452805)
FT                   /gene="ylaB"
FT                   /locus_tag="SFV_0431"
FT   CDS_pept        complement(451249..452805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="SFV_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: T; COG: COG4943"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02700"
FT                   /db_xref="GOA:Q0T7C6"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C6"
FT                   /protein_id="ABF02700.1"
FT                   /translation="MLVRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDT
FT                   YSSRVAIRANKVATQGKDALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVVYIDNNV
FT                   PQCSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASF
FT                   IDVIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPFP
FT                   EMNISIITWASTKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAI
FT                   ENRDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLI
FT                   IRSVFEDMGDCLRQHPQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTER
FT                   EFADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKN
FT                   VTPHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQH
FT                   L"
FT   gene            complement(452963..453472)
FT                   /gene="ylaC"
FT                   /locus_tag="SFV_0432"
FT   CDS_pept        complement(452963..453472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="SFV_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02701"
FT                   /db_xref="GOA:Q0T7C5"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C5"
FT                   /protein_id="ABF02701.1"
FT                   /translation="MFPGKLQIPRRQTMTEIQRLLTETIESLNTREKRDNKPRFSISFI
FT                   RKHPGLFIGMYVAFFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDID
FT                   VLDFRVCYNGEWYNTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLA
FT                   RAESTS"
FT   gene            complement(453549..454100)
FT                   /gene="ylaD"
FT                   /locus_tag="SFV_0433"
FT   CDS_pept        complement(453549..454100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaD"
FT                   /locus_tag="SFV_0433"
FT                   /product="putative transferase"
FT                   /note="Code: R; COG: COG0110"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02702"
FT                   /db_xref="GOA:Q0T7C4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C4"
FT                   /protein_id="ABF02702.1"
FT                   /translation="MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTL
FT                   RQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAP
FT                   GVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVT
FT                   KGVPDNVVVGGNPARIIKKL"
FT   gene            complement(454516..454890)
FT                   /gene="ybaJ"
FT                   /locus_tag="SFV_0434"
FT   CDS_pept        complement(454516..454890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="SFV_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02703"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C3"
FT                   /protein_id="ABF02703.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQALQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
FT   gene            complement(455436..458585)
FT                   /gene="acrB"
FT                   /locus_tag="SFV_0435"
FT   CDS_pept        complement(455436..458585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="SFV_0435"
FT                   /product="acridine efflux pump"
FT                   /note="Code: V; COG: COG0841"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02704"
FT                   /db_xref="GOA:Q0T7C2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C2"
FT                   /protein_id="ABF02704.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
FT                   NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFGWFN
FT                   RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMV
FT                   QLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGN
FT                   QAPSLYAISLIVVFLCLAALYESWSTPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
FT                   VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHSHTVDH
FT                   H"
FT   gene            complement(458608..459837)
FT                   /gene="acrA"
FT                   /locus_tag="SFV_0436"
FT   CDS_pept        complement(458608..459837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="SFV_0436"
FT                   /product="acridine efflux pump"
FT                   /note="Code: M; COG: COG0845"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02705"
FT                   /db_xref="GOA:Q0T7C1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C1"
FT                   /protein_id="ABF02705.1"
FT                   /translation="MTNLKSDTRGLHMNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQG
FT                   GQQMPAVGVVTVKTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVS
FT                   LYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQGYDQALADAQ
FT                   QANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLD
FT                   PIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQ
FT                   TTGSITLRAIFPNPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGA
FT                   DDKVETRPIVASQAIGDKWLVTEGLKAGDRVVISGQQKVRPGVQVKAQEVTADNNQQAA
FT                   SGAQPEQSKS"
FT   gene            459943..460590
FT                   /gene="acrR"
FT                   /locus_tag="SFV_0437"
FT   CDS_pept        459943..460590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="SFV_0437"
FT                   /product="acrAB operon repressor"
FT                   /note="Code: K; COG: COG1309"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02706"
FT                   /db_xref="GOA:Q0T7C0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7C0"
FT                   /protein_id="ABF02706.1"
FT                   /translation="MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTR
FT                   GAIYWHFKDKSDLFSEIWELSESNIGELELEYQAKFPGDPLSVLREILIHVLESTVTEE
FT                   RRRLLMEIIFHKCEFVGEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRA
FT                   AIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE"
FT   gene            460718..464080
FT                   /gene="aefA"
FT                   /locus_tag="SFV_0438"
FT   CDS_pept        460718..464080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aefA"
FT                   /locus_tag="SFV_0438"
FT                   /product="putative alpha helix protein"
FT                   /note="Code: M; COG: COG3264"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02707"
FT                   /db_xref="GOA:Q0T7B9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7B9"
FT                   /protein_id="ABF02707.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRIKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
FT   gene            complement(464292..464453)
FT                   /gene="ybaM"
FT                   /locus_tag="SFV_0439"
FT   CDS_pept        complement(464292..464453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="SFV_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02708"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7B8"
FT                   /protein_id="ABF02708.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKKL
FT                   THDDEAEK"
FT   gene            complement(464467..464994)
FT                   /gene="priC"
FT                   /locus_tag="SFV_0440"
FT   CDS_pept        complement(464467..464994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="SFV_0440"
FT                   /product="primosomal replication protein N'"
FT                   /note="Code: L; COG: COG3923"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02709"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7B7"
FT                   /protein_id="ABF02709.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFDRHLFQTRATT
FT                   LQSCLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREASAWSLREWDSAPPK
FT                   ISRWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
FT   gene            465064..465441
FT                   /gene="ybaN"
FT                   /locus_tag="SFV_0441"
FT   CDS_pept        465064..465441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="SFV_0441"
FT                   /product="putative gene 58"
FT                   /note="Code: S; COG: COG2832"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02710"
FT                   /db_xref="GOA:Q0T7B6"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7B6"
FT                   /protein_id="ABF02710.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
FT   gene            465594..466145
FT                   /gene="apt"
FT                   /locus_tag="SFV_0442"
FT   CDS_pept        465594..466145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="SFV_0442"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /note="Code: F; COG: COG0503"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02711"
FT                   /db_xref="GOA:Q0T7B5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7B5"
FT                   /protein_id="ABF02711.1"
FT                   /translation="MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   DLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISENYDLEY
FT                   GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGG
FT                   EQRLEKQGITSYSLVPFPGH"
FT   gene            466274..468199
FT                   /gene="dnaX"
FT                   /locus_tag="SFV_0443"
FT   CDS_pept        466274..468199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SFV_0443"
FT                   /product="DNA polymerase III, tau and gamma subunits"
FT                   /note="DNA elongation factor III; Code: L; COG: COG2812"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02712"
FT                   /db_xref="GOA:Q0T7B4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7B4"
FT                   /protein_id="ABF02712.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEGNGERVMALINEAAARGIEWEAL
FT                   LVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELP
FT                   YAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTLVPPQSAPQQAP
FT                   TVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQAR
FT                   PVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAVKLAAEAIE
FT                   RDPWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEALSM
FT                   LKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDE
FT                   ESIRPI"
FT   gene            468252..468581
FT                   /gene="ybaB"
FT                   /locus_tag="SFV_0444"
FT   CDS_pept        468252..468581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="SFV_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG0718"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02713"
FT                   /db_xref="GOA:Q0T7B3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7B3"
FT                   /protein_id="ABF02713.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            468581..469186
FT                   /gene="recR"
FT                   /locus_tag="SFV_0445"
FT   CDS_pept        468581..469186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="SFV_0445"
FT                   /product="recombination and repair"
FT                   /note="Code: L; COG: COG0353"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02714"
FT                   /db_xref="GOA:Q0T7B2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7B2"
FT                   /protein_id="ABF02714.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
FT   gene            469296..471169
FT                   /pseudo
FT                   /gene="htpG"
FT                   /locus_tag="SFV_0446"
FT                   /note="frameshift; original product: chaperone Hsp90, heat
FT                   shock protein"
FT   gene            471350..471994
FT                   /gene="adk"
FT                   /locus_tag="SFV_0447"
FT   CDS_pept        471350..471994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SFV_0447"
FT                   /product="adenylate kinase"
FT                   /note="Code: F; COG: COG0563"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02715"
FT                   /db_xref="GOA:Q0T7B1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7B1"
FT                   /protein_id="ABF02715.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
FT   gene            472126..473088
FT                   /gene="hemH"
FT                   /locus_tag="SFV_0448"
FT   CDS_pept        472126..473088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="SFV_0448"
FT                   /product="ferrochelatase"
FT                   /note="Code: H; COG: COG0276"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02716"
FT                   /db_xref="GOA:Q0T7B0"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7B0"
FT                   /protein_id="ABF02716.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTSRLLW
FT                   WPLLRGVILPLRSPRVAKLYASVWMEDGSPLMVYSRQQQQALAQRLPDTPVALGMSYGS
FT                   PSLESSVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARILARKRSIPGISFIRDYA
FT                   DNHDYINALANSVRASFAKHGEPDLLLLSYHGIPQRYADEGDDYPQRCRTTTRELASAL
FT                   GMVPEKVMMTFQSRFGREPWLMPYTDETLKMLGEKGVGHIQVMCPGFAADCLETLEEIA
FT                   EQNREVFLGAGGKKYEYIPALNATPEHIEMMANLVAAYR"
FT   gene            complement(473085..474044)
FT                   /gene="ybaC"
FT                   /locus_tag="SFV_0449"
FT   CDS_pept        complement(473085..474044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaC"
FT                   /locus_tag="SFV_0449"
FT                   /product="putative lipase"
FT                   /note="Code: I; COG: COG0657"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02717"
FT                   /db_xref="GOA:Q0T7A9"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T7A9"
FT                   /protein_id="ABF02717.1"
FT                   /translation="MKPENKLPVLDLISAEMKTVVNTLQPDLPSWPATGTIAEQRQYYT
FT                   LERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHD
FT                   RIMRLLASYSQCTVIGINYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAG
FT                   DSAGAMLALASALWLRDKQIDCGKIAGVLLWYGLYGLRDSVTRRLLGGAWDGLTQQDLQ
FT                   MYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQP
FT                   CEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL"
FT   gene            474196..475500
FT                   /gene="gsk"
FT                   /locus_tag="SFV_0450"
FT   CDS_pept        474196..475500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="SFV_0450"
FT                   /product="inosine-guanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02718"
FT                   /db_xref="GOA:Q0T7A8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A8"
FT                   /protein_id="ABF02718.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEVLYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVELV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSQEESYWDR"
FT   gene            complement(475633..477309)
FT                   /gene="ybaL"
FT                   /locus_tag="SFV_0451"
FT   CDS_pept        complement(475633..477309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="SFV_0451"
FT                   /product="putative transport protein"
FT                   /note="Code: P; COG: COG4651"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02719"
FT                   /db_xref="GOA:Q0T7A7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A7"
FT                   /protein_id="ABF02719.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSVAALFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVTYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
FT   gene            complement(477547..478767)
FT                   /gene="fsr"
FT                   /locus_tag="SFV_0452"
FT   CDS_pept        complement(477547..478767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="SFV_0452"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02720"
FT                   /db_xref="GOA:Q0T7A6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A6"
FT                   /protein_id="ABF02720.1"
FT                   /translation="MAMSEQTQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMVSISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYARLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
FT   gene            478985..480636
FT                   /pseudo
FT                   /gene="ushA"
FT                   /locus_tag="SFV_0453"
FT                   /note="frameshift; original product: UDP-sugar hydrolase"
FT   gene            complement(480673..481152)
FT                   /gene="ybaK"
FT                   /locus_tag="SFV_0454"
FT   CDS_pept        complement(480673..481152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="SFV_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2606"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02721"
FT                   /db_xref="GOA:Q0T7A5"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A5"
FT                   /protein_id="ABF02721.1"
FT                   /translation="MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"
FT   gene            complement(481356..482150)
FT                   /gene="ybaP"
FT                   /locus_tag="SFV_0455"
FT   CDS_pept        complement(481356..482150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="SFV_0455"
FT                   /product="putative ligase"
FT                   /note="Code: S; COG: COG3735"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02722"
FT                   /db_xref="GOA:Q0T7A4"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A4"
FT                   /protein_id="ABF02722.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNDITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
FT   gene            482234..482629
FT                   /gene="ybaQ"
FT                   /locus_tag="SFV_0456"
FT   CDS_pept        482234..482629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="SFV_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG3093"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02723"
FT                   /db_xref="GOA:Q0T7A3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A3"
FT                   /protein_id="ABF02723.1"
FT                   /translation="MIQYVLASLFTGKQQLKTMKQATRKPTTPGDILLYEYLEPLDLKI
FT                   NELAELLHVHRNRVSALINNNRKLTTEMAFRLAKVFDTTVDFRLNLQAAVDLWEVENNM
FT                   RTQEELGRIETVAEYLARREERAKKVA"
FT   gene            complement(482844..485348)
FT                   /gene="ybaR"
FT                   /locus_tag="SFV_0457"
FT   CDS_pept        complement(482844..485348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaR"
FT                   /locus_tag="SFV_0457"
FT                   /product="putative ATPase"
FT                   /note="Code: P; COG: COG2217"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02724"
FT                   /db_xref="GOA:Q0T7A2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A2"
FT                   /protein_id="ABF02724.1"
FT                   /translation="MSQTIDLNLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTG
FT                   TASAEQLIETIKQAGYDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLL
FT                   LSGMSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEA
FT                   IEDDAKRRERQQETAVATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVI
FT                   GLITLAVMVFAGGHFYRSAWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEA
FT                   RHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAE
FT                   VQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSV
FT                   LFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVVIALVSAAIWYFF
FT                   GPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTL
FT                   DTVVFDKTGTLTEGKPQVVAVKTFADVDEAQALRLAAALEQGSSHPLARAILDKAGDMQ
FT                   LPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNDQQVDTKAIEADISAQASQGATPVLL
FT                   AIDGKAVALLAVRDPLRSDSVAALQRLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIA
FT                   GVLPDGKAEAIKRLQSEGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLM
FT                   RHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAA
FT                   MALSSITVVSNANRLLRFKPKE"
FT   gene            485610..486542
FT                   /gene="ybaS"
FT                   /locus_tag="SFV_0458"
FT   CDS_pept        485610..486542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="SFV_0458"
FT                   /product="putative glutaminase"
FT                   /note="Code: E; COG: COG2066"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02725"
FT                   /db_xref="GOA:Q0T7A1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A1"
FT                   /protein_id="ABF02725.1"
FT                   /translation="MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAI
FT                   VTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIAL
FT                   ELHGGKPLSPLVNAGAIATTSLINAENAEQRWQRILHIQQQLAGEQVALSDEVNQSEQT
FT                   TNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTH
FT                   KRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSP
FT                   PLDEEGNSVRGQKMVASVAKQLGYNVFKG"
FT   gene            486545..487837
FT                   /gene="ybaT"
FT                   /locus_tag="SFV_0459"
FT   CDS_pept        486545..487837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="SFV_0459"
FT                   /product="putative amino acid/amine transport protein"
FT                   /note="Code: E; COG: COG0531"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02726"
FT                   /db_xref="GOA:Q0T7A0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T7A0"
FT                   /protein_id="ABF02726.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWGAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASGINANLFAVFNIMDNMGSERELPKLMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLDSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
FT   gene            487962..488372
FT                   /gene="ybbI"
FT                   /locus_tag="SFV_0460"
FT   CDS_pept        487962..488372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbI"
FT                   /locus_tag="SFV_0460"
FT                   /product="putative transcriptional regulator"
FT                   /note="Code: K; COG: COG0789"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02727"
FT                   /db_xref="GOA:Q0T799"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T799"
FT                   /protein_id="ABF02727.1"
FT                   /translation="MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLN
FT                   ELTLLRQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRDQ
FT                   LLALANACPGDDCADCPIIEISPPAVIIGQGD"
FT   gene            complement(488369..488815)
FT                   /gene="ybbJ"
FT                   /locus_tag="SFV_0461"
FT   CDS_pept        complement(488369..488815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="SFV_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: OU; COG: COG1585"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02728"
FT                   /db_xref="GOA:Q0T798"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T798"
FT                   /protein_id="ABF02728.1"
FT                   /translation="MVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLV
FT                   PLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLV
FT                   NGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLHIRAVSS"
FT   gene            complement(488824..489741)
FT                   /gene="ybbK"
FT                   /locus_tag="SFV_0462"
FT   CDS_pept        complement(488824..489741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="SFV_0462"
FT                   /product="putative protease"
FT                   /note="Code: O; COG: COG0330"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02729"
FT                   /db_xref="GOA:Q0T797"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T797"
FT                   /protein_id="ABF02729.1"
FT                   /translation="MLIFIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATKMVSEAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEA
FT                   SSLMGSIAGIAELVKDSANKRTQP"
FT   gene            489887..490564
FT                   /gene="ybbL"
FT                   /locus_tag="SFV_0463"
FT   CDS_pept        489887..490564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="SFV_0463"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /note="Code: R; COG: COG4619"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02730"
FT                   /db_xref="GOA:Q0T796"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T796"
FT                   /protein_id="ABF02730.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDTKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRDQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
FT   gene            490551..491330
FT                   /gene="ybbM"
FT                   /locus_tag="SFV_0464"
FT   CDS_pept        490551..491330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="SFV_0464"
FT                   /product="putative metal resistance protein"
FT                   /note="Code: R; COG: COG0390"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02731"
FT                   /db_xref="GOA:Q0T795"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T795"
FT                   /protein_id="ABF02731.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGAIEFIPMQVIPVAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
FT   gene            complement(491393..492283)
FT                   /gene="ybbN"
FT                   /locus_tag="SFV_0465"
FT   CDS_pept        complement(491393..492283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="SFV_0465"
FT                   /product="putative thioredoxin-like protein"
FT                   /note="Code: O; COG: COG3118"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02732"
FT                   /db_xref="GOA:Q0T794"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T794"
FT                   /protein_id="ABF02732.1"
FT                   /translation="MSKKISTTESDSMSVENIVNINESNLQQVLEQSMTTPVLFYFWSE
FT                   RSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDG
FT                   FQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYTDALPLLKDAWQLSNQNGEIG
FT                   LLLAETLIALNRSEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADKPEIQQLQQQVA
FT                   ENPEDAALATQLALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGD
FT                   ALASKYRRQLYALLY"
FT   gene            complement(492308..493078)
FT                   /gene="ybbO"
FT                   /locus_tag="SFV_0466"
FT   CDS_pept        complement(492308..493078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="SFV_0466"
FT                   /product="putative oxidoreductase"
FT                   /note="Code: IQR; COG: COG1028"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02733"
FT                   /db_xref="GOA:Q0T793"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T793"
FT                   /protein_id="ABF02733.1"
FT                   /translation="MQKSVLITGCSSGIGLESALELKRQGFHVLAGCRKPNDVERMNNM
FT                   GFTGVLIDLDSPESVNRAADEVIALTDNCLYGIFNNAGFGMYGPLSTISRAQMEQQFSA
FT                   NFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRME
FT                   LRHSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGPEAVVDKVRHAFIS
FT                   EKPKMRYPVTLVTWAVMVLERLLPGRVMDKILQG"
FT   gene            complement(493107..493729)
FT                   /pseudo
FT                   /gene="tesA"
FT                   /locus_tag="SFV_0468"
FT                   /note="frameshift; original product: acyl-CoA thioesterase
FT                   I; also functions as protease I"
FT   gene            493700..494302
FT                   /gene="ybbA"
FT                   /locus_tag="SFV_0467"
FT   CDS_pept        493700..494302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="SFV_0467"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /note="Code: Q; COG: COG4181"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02734"
FT                   /db_xref="GOA:Q0T792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T792"
FT                   /protein_id="ABF02734.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGQP
FT                   LHNMDEEARAKLRAKHVGFAFQSFMLIPTLNALENVELPALLRGESSAESRNGAKALLE
FT                   QLGLGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFS
FT                   LNREHGTTLIMVTHDLQLAARCDRCLRLVNGQLQEEA"
FT   gene            494299..496713
FT                   /gene="ybbP"
FT                   /locus_tag="SFV_0469"
FT   CDS_pept        494299..496713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="SFV_0469"
FT                   /product="putative oxidoreductase"
FT                   /note="Code: Q; COG: COG3127"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02735"
FT                   /db_xref="GOA:Q0T791"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T791"
FT                   /protein_id="ABF02735.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGDLQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNLFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGNENQLDGYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSMERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLTLSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNDVVANVWPLKFYLPIVSVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVAPLKAFLAEHHIVPE
FT                   SFYPVVRARLTAINDKPTEGNEDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVALGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQAKVFDFPWEPDWRLWIVLPCSGALLLSLFGGWLGARLVKGKALFRQFVG"
FT   gene            complement(497425..498519)
FT                   /gene="ybbB"
FT                   /locus_tag="SFV_0470"
FT   CDS_pept        complement(497425..498519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="SFV_0470"
FT                   /product="putative capsule anchoring protein"
FT                   /note="Code: R; COG: COG2603"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02736"
FT                   /db_xref="GOA:Q0T790"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T790"
FT                   /protein_id="ABF02736.1"
FT                   /translation="MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMDN
FT                   DERAAVGTCYKQQGSDAALALGHKLVAGEIRQQRMYAWRAACLQNPQGILCCARGGQRS
FT                   HIVQRWLHEAGIDYPLVEGGYKALRQTAIQATIELAQKPIVLIGGCTGSGKTLLVQQQP
FT                   NGVDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDARQDLRLWVLEDESRMIG
FT                   SNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEY
FT                   LHHGLSAIKRRLGLQRYNELAAQLDTALTTQLTTGSTDGHLAWLVPLLKEYYDPMYRYQ
FT                   LEKKAEKVVFRGEWAEVAVWVKAQ"
FT   gene            complement(498588..499514)
FT                   /gene="ybbS"
FT                   /locus_tag="SFV_0471"
FT   CDS_pept        complement(498588..499514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbS"
FT                   /locus_tag="SFV_0471"
FT                   /product="putative transcriptional regulator LYSR-type"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02737"
FT                   /db_xref="GOA:Q0T789"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T789"
FT                   /protein_id="ABF02737.1"
FT                   /translation="MFDPETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VALFFRTTRSVTLTAAGEHLLSQARDWLSWLESMPSELQQVNDGVERQVNIVINNLLYN
FT                   PQAVAQLLAWLNERYPFTQFHISRQIYMGVWDSLLYEGFSLAIGVTGTEALANTFSLDP
FT                   LGSVQWRFVMAADHPLANVEEPLTEAQLRRFPAVNIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFLPKSLCQSMIDNQQLVSRVIPTMRPPSPLSLAWRKFGSGKA
FT                   VEDIVTLFTQHRPEISGFLEIFGTPRS"
FT   gene            499744..500226
FT                   /gene="ybbT"
FT                   /locus_tag="SFV_0472"
FT   CDS_pept        499744..500226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbT"
FT                   /locus_tag="SFV_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: F; COG: COG3194"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02738"
FT                   /db_xref="GOA:Q0T788"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T788"
FT                   /protein_id="ABF02738.1"
FT                   /translation="MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVE
FT                   ILEQDRTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLST
FT                   LRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA"
FT   gene            500304..501119
FT                   /gene="ybbU"
FT                   /locus_tag="SFV_0473"
FT   CDS_pept        500304..501119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbU"
FT                   /locus_tag="SFV_0473"
FT                   /product="putative regulator"
FT                   /note="Code: K; COG: COG1414"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02739"
FT                   /db_xref="GOA:Q0T787"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T787"
FT                   /protein_id="ABF02739.1"
FT                   /translation="MTEVRRRGRPGQAEPVAQKGAQALERGIAILQYLEKSGGSSSVSD
FT                   ISLNLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGAAYIHNRDVLSVAGP
FT                   FMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LAEEELMSIILQTGLQQFTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAI
FT                   YDDVGRVVAAISISGPSSRLTEDRFVSQGELVRDTARDISTALGLKAHP"
FT   gene            501155..502984
FT                   /gene="gcl"
FT                   /locus_tag="SFV_0474"
FT   CDS_pept        501155..502984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="SFV_0474"
FT                   /product="glyoxylate carboligase"
FT                   /note="Code: R; COG: COG3960"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02740"
FT                   /db_xref="GOA:Q0T786"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T786"
FT                   /protein_id="ABF02740.1"
FT                   /translation="MTKFESWKIFPTNRGRNKMAKMRAVDAAMYVLEKEGITTAFGVPG
FT                   AAINPFYSAMRKHGGIRHILARHVEGVSHMAEGYTRATAGNIGVCLGTSGPAGTDIRRY
FT                   SASADSIPILCITGQAPRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAF
FT                   HLMRSGRPGPVLVDLPFDVQVAEIEFDPDMYEPLPVYKPAASRMQIEKAVEMLIQAERP
FT                   VIVAGGGVINADAAALLQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGN
FT                   ATLLASDMVFGIGNRFANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKA
FT                   ALTLLVEVAQEMQKAGRLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAF
FT                   GRDVCYVTTIGLSQIAAAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPKRNVVA
FT                   ISGDFDFQFLIEELAVGAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINS
FT                   SEVNGYGVDHVKVAEGLGCKAIRVFKPEDITPAFEQAKALMAQYRVPVVVEVILERVTN
FT                   ISMGSELDNVMEFEDIADNAADAPTETCFMHYE"
FT   mobile_element  complement(503274..504041)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(503289..503792)
FT                   /gene="insB"
FT                   /locus_tag="SFV_0475"
FT   CDS_pept        complement(503289..503792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0475"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02741"
FT                   /db_xref="GOA:Q0SXE9"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXE9"
FT                   /protein_id="ABF02741.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(504015..504686)
FT                   /gene="ylbA"
FT                   /locus_tag="SFV_0476"
FT   CDS_pept        complement(504015..504686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="SFV_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG3257"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02742"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T784"
FT                   /protein_id="ABF02742.1"
FT                   /translation="MGYLNNVTGYREDLLANRAIVKHGNFALLTPDGLIKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFALS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGHAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLGNAANLL
FT                   I"
FT   gene            complement(504697..505986)
FT                   /gene="ylbB"
FT                   /locus_tag="SFV_0477"
FT   CDS_pept        complement(504697..505986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbB"
FT                   /locus_tag="SFV_0477"
FT                   /product="putative hydantoin utilization protein"
FT                   /note="Code: E; COG: COG0624"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02743"
FT                   /db_xref="GOA:Q0T783"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T783"
FT                   /protein_id="ABF02743.1"
FT                   /translation="MVVHCRIIHRITHRIACGEITHSRQAIEETLPWLSSFGADPTGGM
FT                   TRLLYSPEWLETQQQFKKRMAASGLETRFDEVGNLYGRLSGTEYPQEVVLSGSHIDTVV
FT                   NGGNLDGQFGALAAWLAIDWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLA
FT                   NPDDVRNICDAKGNSFADAMKACGFTLPNAPLTPRQDIKAFVELHIEQGCVLESNGQSI
FT                   GVVNAIVGQRRYTVTLNGESNHAGTTPMGYRRDTVYAFSRICHQSIEKAKKMGDPLVLT
FT                   FGKVEPRPNTVNVVPGKTTFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIGIDIDLW
FT                   MDEEPVPMNKELVATLTELCEREKLNYRVMHSGAGHDAQIFAPRVPTCMIFIPSINGIS
FT                   HNPAERTNITDLAEGVKTLALMLYQLAWQK"
FT   gene            505992..506579
FT                   /gene="ylbF"
FT                   /locus_tag="SFV_0478"
FT   CDS_pept        505992..506579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="SFV_0478"
FT                   /product="putative carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02744"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T782"
FT                   /protein_id="ABF02744.1"
FT                   /translation="MAQGIRLGRFTVKQPQRYCLLRITPPSHPQPLAAAWMQRAEETGL
FT                   FGPLAMAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGPGLTPSHDDTLSGMLLAA
FT                   WYYGALDARAGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFASPLLHFVHALSCPKRTA
FT                   VAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
FT   gene            506576..507469
FT                   /gene="arcC"
FT                   /locus_tag="SFV_0479"
FT   CDS_pept        506576..507469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="SFV_0479"
FT                   /product="putative carbamate kinase"
FT                   /note="Code: E; COG: COG0549"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02745"
FT                   /db_xref="GOA:Q0T781"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T781"
FT                   /protein_id="ABF02745.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTEDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRSKPAWIGALS
FT                   RIEETLAGEAGTCISL"
FT   gene            complement(507606..508673)
FT                   /gene="purK"
FT                   /locus_tag="SFV_0480"
FT   CDS_pept        complement(507606..508673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SFV_0480"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /note="Code: F; COG: COG0026"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02746"
FT                   /db_xref="GOA:Q0T780"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T780"
FT                   /protein_id="ABF02746.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLADRS
FT                   EWPAVFDRLGELAIVKRRTGGYDGRGQWSLRANETEQLPAECYGECIVEQGINFSGEVS
FT                   LVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGV
FT                   MAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSV
FT                   MINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLP
FT                   PEYASGVIWAQSKFS"
FT   gene            complement(508670..509179)
FT                   /gene="purE"
FT                   /locus_tag="SFV_0481"
FT   CDS_pept        complement(508670..509179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SFV_0481"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /note="Code: F; COG: COG0041"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02747"
FT                   /db_xref="GOA:Q0T779"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T779"
FT                   /protein_id="ABF02747.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAVEIFEILNVPHHVEVVSAH
FT                   RTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNGWRKAQTDEVLENP
FT                   DPRGAA"
FT   gene            complement(509297..510019)
FT                   /gene="ybbF"
FT                   /locus_tag="SFV_0482"
FT   CDS_pept        complement(509297..510019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbF"
FT                   /locus_tag="SFV_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2908"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02748"
FT                   /db_xref="GOA:Q0T778"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T778"
FT                   /protein_id="ABF02748.1"
FT                   /translation="MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEA
FT                   WIGDDDPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLE
FT                   LYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQMLFLALPLFVRKRIAARMRANSKEA
FT                   NSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTE
FT                   GSMVKVTADDVELIHFPF"
FT   gene            complement(510022..510516)
FT                   /gene="ppiB"
FT                   /locus_tag="SFV_0483"
FT   CDS_pept        complement(510022..510516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="SFV_0483"
FT                   /product="peptidyl-prolyl cis-trans isomerase B (rotamase
FT                   B)"
FT                   /note="Code: O; COG: COG0652"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02749"
FT                   /db_xref="GOA:Q0T777"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T777"
FT                   /protein_id="ABF02749.1"
FT                   /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVI
FT                   NGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
FT                   NDFLNFSGESLQGWGYCVFAEVVDGMDVVDKIKGVATGRNGMHQDVPKEDVIIESVTVS
FT                   E"
FT   gene            510762..512075
FT                   /gene="cysS"
FT                   /locus_tag="SFV_0484"
FT   CDS_pept        510762..512075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SFV_0484"
FT                   /product="cysteine tRNA synthetase"
FT                   /note="Code: J; COG: COG0215"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02750"
FT                   /db_xref="GOA:Q0T776"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T776"
FT                   /protein_id="ABF02750.1"
FT                   /translation="MYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRNITD
FT                   IDDKIIKRANENGESFVALVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQL
FT                   IAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVVDDKRNPMDFVLWKMS
FT                   KEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFPHHENEIAQSTCAH
FT                   DGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYS
FT                   EENLKQARAALERLYTALRGTDKTVAPAGGEAFEARFIEAMDDDFNTPEAYSVLFDMAR
FT                   EVNRLKAEDMAAANAMASHLRKLSAVLGLLEQEPEAFLQSGAQADDSEVAEIEALIQQR
FT                   LDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTWRRK"
FT   gene            complement(512111..512620)
FT                   /gene="ybcI"
FT                   /locus_tag="SFV_0485"
FT   CDS_pept        complement(512111..512620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="SFV_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG1988"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02751"
FT                   /db_xref="GOA:Q0T775"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T775"
FT                   /protein_id="ABF02751.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKGLLFAGIILAMLPDADVLSFKFGV
FT                   AYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLDSVTT
FT                   GGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTAYGHQVIISELMWVWLPGMLLMGM
FT                   LWWRRR"
FT   gene            complement(512728..512970)
FT                   /gene="ybcJ"
FT                   /locus_tag="SFV_0486"
FT   CDS_pept        complement(512728..512970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="SFV_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2501"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02752"
FT                   /db_xref="GOA:Q0T774"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T774"
FT                   /protein_id="ABF02752.1"
FT                   /translation="MNIMIHRVSNMATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIA
FT                   EGQVKVDGAVETRKRCKIVAGQTVSFAGHSVQVVA"
FT   gene            complement(512942..513766)
FT                   /gene="folD"
FT                   /locus_tag="SFV_0487"
FT   CDS_pept        complement(512942..513766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SFV_0487"
FT                   /product="5,10-methylene-tetrahydrofolate dehydrogenase"
FT                   /note="Code: H; COG: COG0190"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02753"
FT                   /db_xref="GOA:Q0T773"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T773"
FT                   /protein_id="ABF02753.1"
FT                   /translation="MRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACE
FT                   EVGFVSRSYDLPETTSEAELLELIDALNADNTIDGILVQLPLPAGIDNVKVLERIHPDK
FT                   DVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSM
FT                   ELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLE
FT                   NGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHDPQGE"
FT   gene            514289..514813
FT                   /gene="sfmA"
FT                   /locus_tag="SFV_0488"
FT   CDS_pept        514289..514813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="SFV_0488"
FT                   /product="putative fimbrial-like protein"
FT                   /note="Code: NU; COG: COG3539"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02754"
FT                   /db_xref="GOA:Q0T772"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T772"
FT                   /protein_id="ABF02754.1"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNTDSADQV
FT                   VTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIASS
FT                   TNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQA
FT                   NADATFIMRYE"
FT   gene            515218..515643
FT                   /pseudo
FT                   /gene="sfmC"
FT                   /locus_tag="SFV_0489"
FT                   /note="truncated; original product: putative chaperone"
FT   gene            515674..518045
FT                   /pseudo
FT                   /gene="sfmD"
FT                   /locus_tag="SFV_0490"
FT                   /note="IS1 insertion; original product: putative outer
FT                   membrane protein, export function"
FT   mobile_element  complement(516171..516938)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(516186..516689)
FT                   /gene="insB"
FT                   /locus_tag="SFV_0491"
FT   CDS_pept        complement(516186..516689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0491"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02755"
FT                   /db_xref="GOA:Q0SZ75"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SZ75"
FT                   /protein_id="ABF02755.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSHIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLVRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            516764..516973
FT                   /locus_tag="SFV_0492"
FT   CDS_pept        516764..516973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0492"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02756"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T770"
FT                   /protein_id="ABF02756.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYPDNRELPQFTL"
FT   gene            518058..519065
FT                   /pseudo
FT                   /gene="sfmH"
FT                   /locus_tag="SFV_0493"
FT                   /note="contains in-frame stop codon; original product:
FT                   involved in fimbrial asembly"
FT   gene            519076..519591
FT                   /gene="sfmF"
FT                   /locus_tag="SFV_0494"
FT   CDS_pept        519076..519591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="SFV_0494"
FT                   /product="putative fimbrial-like protein"
FT                   /note="Code: NU; COG: COG3539"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02757"
FT                   /db_xref="GOA:Q0T769"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T769"
FT                   /protein_id="ABF02757.1"
FT                   /translation="MRRVFFSCFCGLLWSSSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGGAKAD
FT                   AIFMINYN"
FT   mobile_element  complement(519630..520960)
FT                   /mobile_element_type="insertion sequence:IS2"
FT   gene            complement(519641..520480)
FT                   /locus_tag="SFV_0495"
FT   CDS_pept        complement(519641..520480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0495"
FT                   /product="IS2 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02758"
FT                   /db_xref="GOA:Q0SXN7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXN7"
FT                   /protein_id="ABF02758.1"
FT                   /translation="MSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYG
FT                   YRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRVAVKESN
FT                   QRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAGTTGGFNSETVQDVMLGAVERRFG
FT                   NDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDY
FT                   ISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLEI"
FT   gene            complement(520504..520869)
FT                   /locus_tag="SFV_0496"
FT   CDS_pept        complement(520504..520869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0496"
FT                   /product="IS2 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02759"
FT                   /db_xref="GOA:Q0SXN8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXN8"
FT                   /protein_id="ABF02759.1"
FT                   /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQ
FT                   LFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYG
FT                   RAKKWIAHAPLLPGDGE"
FT   gene            complement(520945..521625)
FT                   /gene="fimZ"
FT                   /locus_tag="SFV_0497"
FT   CDS_pept        complement(520945..521625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimZ"
FT                   /locus_tag="SFV_0497"
FT                   /product="fimbrial Z protein"
FT                   /note="Code: TK; COG: COG2197"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02760"
FT                   /db_xref="GOA:Q0T766"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T766"
FT                   /protein_id="ABF02760.1"
FT                   /translation="MYQSTIYRPNGKLSAPMRLVTMKPTSVIIMDTHPIIRMSIEVLLQ
FT                   KNSELQIVLKTDDYRITIDYLRTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFL
FT                   LSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCST
FT                   NSSTVTVLSNREVTILRYLVSGLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELI
FT                   RLAP"
FT   gene            521805..521881
FT                   /locus_tag="SFV_0498"
FT   tRNA            521805..521881
FT                   /locus_tag="SFV_0498"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGA"
FT   gene            complement(521927..522688)
FT                   /gene="envY"
FT                   /locus_tag="SFV_0499"
FT   CDS_pept        complement(521927..522688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envY"
FT                   /locus_tag="SFV_0499"
FT                   /product="envelope protein"
FT                   /note="thermoregulation of porin biosynthesis; Code: K;
FT                   COG: COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02761"
FT                   /db_xref="GOA:Q0T765"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T765"
FT                   /protein_id="ABF02761.1"
FT                   /translation="MQLSSSEPCVVILTEKEVEVSVNNHATFTLPKNYLAAFACNNNVI
FT                   ELSTLNHVLITHINRNIINDYLLFLNKKLTCVKPWSRLATPVIACHSRTPEVFRLATNH
FT                   SKQQSSKPCEAELTRALLFTVLSNFLEQSRFIALLMYILRSSVRDSVCRIIQSDIQHYW
FT                   NLRIVASSLCLSPSLLKKKLKNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLCGY
FT                   SSTSYFISVFKAFYSLTPLNYLAKQRQKVMW"
FT   gene            complement(522871..523761)
FT                   /gene="ybcH"
FT                   /locus_tag="SFV_0500"
FT   CDS_pept        complement(522871..523761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="SFV_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02762"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T764"
FT                   /protein_id="ABF02762.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRFQGFDTLVLQWTRYGDAFTQPEQRTLLFKRAAAAQQTGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGITPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEQVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDMLY
FT                   FSLRYLPVAHGILEY"
FT   gene            complement(523762..526407)
FT                   /pseudo
FT                   /gene="nfrA"
FT                   /locus_tag="SFV_0501"
FT                   /note="contains in-frame stop codon; original product:
FT                   bacteriophage N4 receptor, outer membrane protein"
FT   gene            complement(526394..528556)
FT                   /gene="nfrB"
FT                   /locus_tag="SFV_0502"
FT   CDS_pept        complement(526394..528556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="SFV_0502"
FT                   /product="bacteriophage N4 receptor, outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02763"
FT                   /db_xref="GOA:Q0T763"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T763"
FT                   /protein_id="ABF02763.1"
FT                   /translation="MFISGLDDFFIDVVYWVRRIKRKLSVYRRYPRMSYRELYKPDEKP
FT                   LAIMVPAWNETGVIGNMAELAATTLDYENYHIFVGTYPNDPDTQRDVDEVCARFPNVHK
FT                   VVCARPGPTSKADCLNNVLDAITQFERSANFAFAGFILHDAEDVISPMELRLFNYLVER
FT                   KDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKDVPVREALAGQVPSAGVGTCFSRRAV
FT                   TALLADGNGIAFDVQSLTEDYDIGFRLKEKGMTEIFVRFPVVDEAKEREQRKFLQHART
FT                   SNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFKTHKWTSSLTLNYFLWRDRKGAISNF
FT                   VSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSGSAWLMTLLWLNFGLMVNRIVQRVIF
FT                   VTGYYGLTQGLLSVLRLFWGNLINFMANWRVLKQVLQHGDPRRVAWDKTTHDFPSVTGD
FT                   TRSLRPLGQILLENQVITEEQLDTALRNRVEGLRLGGSMLMQGLISAEQLAQALAEQNG
FT                   VAWESIDAWQIPSSLIAEMPASVALHYAVLPLRLENDELIVGSEDGIDPVSLAALTRKV
FT                   GRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAMLYNAVQHQWLTEQQTGEIWRQYVPHQ
FT                   FLFAEILTSLGHINRSAINVLLLRHERSSLPLGKFLVTEGVISQETLDRVLTIQRELQV
FT                   SMQSLLLKAGLNTEQVAQLESENEGE"
FT   gene            complement(528781..530223)
FT                   /gene="ybcZ"
FT                   /locus_tag="SFV_0503"
FT   CDS_pept        complement(528781..530223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcZ"
FT                   /locus_tag="SFV_0503"
FT                   /product="putative 2-component sensor protein"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02764"
FT                   /db_xref="GOA:Q0T762"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T762"
FT                   /protein_id="ABF02764.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDARGGEVYLLSGPTIMMPGHGHGHMEHSNWRMINLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   KVGKVFDFFEALAEDRGVELRFVGDKRQVAGDPLMLRRALSNLLSNALRYTPTRETIVV
FT                   RCQTVDHQVQVSVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSDARGTRFVITLPA"
FT   gene            complement(530213..530896)
FT                   /gene="ylcA"
FT                   /locus_tag="SFV_0504"
FT   CDS_pept        complement(530213..530896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylcA"
FT                   /locus_tag="SFV_0504"
FT                   /product="putative 2-component transcriptional regulator"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02765"
FT                   /db_xref="GOA:Q0T761"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T761"
FT                   /protein_id="ABF02765.1"
FT                   /translation="MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDY
FT                   DLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFA
FT                   FAELLARVRTLLQRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFL
FT                   RHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLE
FT                   VPDGQ"
FT   gene            531053..532435
FT                   /pseudo
FT                   /gene="ylcB"
FT                   /locus_tag="SFV_0505"
FT                   /note="contains in-frame stop codon; original product:
FT                   putative resistance protein"
FT   gene            532459..532791
FT                   /gene="ylcC"
FT                   /locus_tag="SFV_0506"
FT   CDS_pept        532459..532791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylcC"
FT                   /locus_tag="SFV_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5569"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02766"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T760"
FT                   /protein_id="ABF02766.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GVDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
FT   gene            532807..541545
FT                   /pseudo
FT                   /gene="ylcD"
FT                   /locus_tag="SFV_0507"
FT                   /note="IS629 and IS600+IS2 insertion; original product:
FT                   putative resistance protein"
FT   mobile_element  complement(534053..535358)
FT                   /mobile_element_type="insertion sequence:IS629"
FT   gene            complement(534095..534742)
FT                   /locus_tag="SFV_0508"
FT   CDS_pept        complement(534095..534742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0508"
FT                   /product="IS629 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02767"
FT                   /db_xref="GOA:Q0T759"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T759"
FT                   /protein_id="ABF02767.1"
FT                   /translation="MARCTVARLMAVMGLAGVLRGKKVRTTISRKAVAAGDRVNRQFVA
FT                   ERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGWRVSSSMETTFVLDALEQALWAR
FT                   RPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGDSYDNAMAESINGLYKAEVIHR
FT                   KSWKNRAEVELATLTWVDWYNNRRLLERLGHIPPAEAEKAYYASIGNDDLAA"
FT   gene            complement(534978..535304)
FT                   /locus_tag="SFV_0509"
FT   CDS_pept        complement(534978..535304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0509"
FT                   /product="IS629 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02768"
FT                   /db_xref="GOA:Q0T742"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T742"
FT                   /protein_id="ABF02768.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKEPERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            535381..536601
FT                   /locus_tag="SFV_0510"
FT   CDS_pept        535381..536601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0510"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02769"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T757"
FT                   /protein_id="ABF02769.1"
FT                   /translation="MIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQN
FT                   AIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVL
FT                   RLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYL
FT                   MQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAW
FT                   SSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSF
FT                   SNSWIAADADGTEQFTGIYFRTPASTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIF
FT                   VFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPIRYLRSGGVSVTDCYLAGITEVQKP
FT                   EGRYNTY"
FT   mobile_element  complement(536599..537862)
FT                   /mobile_element_type="insertion sequence:IS600"
FT   gene            complement(536642..537355)
FT                   /locus_tag="SFV_0511"
FT   CDS_pept        complement(536642..537355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0511"
FT                   /product="IS600 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02770"
FT                   /db_xref="GOA:Q0T1L4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T1L4"
FT                   /protein_id="ABF02770.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLACLRKELRLRCKQK
FT                   RKFRATTNPNHNLPVAPNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   gene            complement(537496..537798)
FT                   /locus_tag="SFV_0512"
FT   CDS_pept        complement(537496..537798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0512"
FT                   /product="IS600 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02771"
FT                   /db_xref="GOA:Q0SX79"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SX79"
FT                   /protein_id="ABF02771.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   mobile_element  complement(539500..540830)
FT                   /mobile_element_type="insertion sequence:IS2"
FT   gene            complement(539511..540350)
FT                   /locus_tag="SFV_0513"
FT   CDS_pept        complement(539511..540350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0513"
FT                   /product="IS2 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02772"
FT                   /db_xref="GOA:Q0SXN7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXN7"
FT                   /protein_id="ABF02772.1"
FT                   /translation="MSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYG
FT                   YRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRVAVKESN
FT                   QRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAGTTGGFNSETVQDVMLGAVERRFG
FT                   NDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDY
FT                   ISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLEI"
FT   gene            complement(540374..540739)
FT                   /locus_tag="SFV_0514"
FT   CDS_pept        complement(540374..540739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0514"
FT                   /product="IS2 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02773"
FT                   /db_xref="GOA:Q0SXN8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXN8"
FT                   /protein_id="ABF02773.1"
FT                   /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQ
FT                   LFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYG
FT                   RAKKWIAHAPLLPGDGE"
FT   gene            541557..544736
FT                   /gene="ybdE"
FT                   /locus_tag="SFV_0515"
FT   CDS_pept        541557..544736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdE"
FT                   /locus_tag="SFV_0515"
FT                   /product="putative inner membrane component for iron
FT                   transport"
FT                   /note="Code: P; COG: COG3696"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02774"
FT                   /db_xref="GOA:Q0T752"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T752"
FT                   /protein_id="ABF02774.1"
FT                   /translation="MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPY
FT                   WARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIYEYALVDRSGKHDLADLRSLQDWF
FT                   LKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSI
FT                   ELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKVQIGPEMRRGIAELNGE
FT                   GEVAGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSG
FT                   KLLEEFIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMPFQGLNANIMSLGGIAIA
FT                   VGAMVDAAIVMIENAHKRLEEWQHQHPDATLDNKTRWQVITDASVEVGPALFISLLIIT
FT                   LSFIPIFTLEGQEGQEGQEGQEGQEGRLFGPLAFTKTYAMAGAALLAIVVIPILMGYWI
FT                   RGKIPPESSNPLNRFLIRVYHPLLLKVLHWPKTTLLVAALSVLTVLWPLNKVGGEFLPQ
FT                   INEGDLLYMPSTLPGISAAEAASMLQKTDKLIMSVPEVARVFGKTGKAETATDSAPLEM
FT                   VETTIQLKPQDQWRPGMTMDKIIEELDNTVRLPGLANLWVPPIRNRIDMLSTGIKSPIG
FT                   IKVSGTVLADIDAMAEQIEEVARTVPGVASALAERLEGGRYINVEINREKAARYGMTVA
FT                   DVQLFVTSAVGGAMVGETVEGIARYPINLRYPQSWRDSPQALRQLPILTPMKQQITLAD
FT                   VADVKVSTGPSMLKTENARPTSWIYIDARDRDMVSVVHDLQKAIAEKVQLKPGTSVAFS
FT                   GQFELLERANHKLKLMVPMTLMIIFVLLYLAFRRVGEALLIISSVPFALVGGIWLLWWM
FT                   GFHLSVATGTGFIALAGVAAEFGVVMLMYLRHAIEAEPSLNNPQTFSEQKLDEALYHGA
FT                   VLRVRPKAMTVAVIIAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYK
FT                   LMWLHRHRVRN"
FT   gene            544837..546213
FT                   /gene="pheP"
FT                   /locus_tag="SFV_0516"
FT   CDS_pept        544837..546213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheP"
FT                   /locus_tag="SFV_0516"
FT                   /product="phenylalanine-specific transport system"
FT                   /note="Code: E; COG: COG1113"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02775"
FT                   /db_xref="GOA:Q0T751"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T751"
FT                   /protein_id="ABF02775.1"
FT                   /translation="MKNASTVSEDTASNQEPTLHRGLHNRHIQLIALGGAIGTGLFLGI
FT                   GPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSG
FT                   WNYWVMFVLVGMAELTAAGIYMQYWFPDVPTWIWAAAFFIIINAVNLVNVRLYGETEFW
FT                   FALIKVLAIIGMIGFGLWLLFSGHGGEKASIDNLWRYGGFFATGWNGLILSLAVIMFSF
FT                   GGLELIGITAAEARDPEKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNSSPFV
FT                   MIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVSRRGV
FT                   PINSLMLSGAITSLVVLINYLLPQKAFGLLMALVVATLLLNWIMICLAHLRFRAAMRRQ
FT                   GRETQFKALLYPFGNYLCIAFLGMILLLMCTMDDMRLSAILLPVWIVFLFVAFKTLRRK
FT                   "
FT   gene            complement(546281..547528)
FT                   /gene="ybdG"
FT                   /locus_tag="SFV_0517"
FT   CDS_pept        complement(546281..547528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="SFV_0517"
FT                   /product="putative transport"
FT                   /note="Code: M; COG: COG0668"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02776"
FT                   /db_xref="GOA:Q0T750"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T750"
FT                   /protein_id="ABF02776.1"
FT                   /translation="MQDLISQVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVL
FT                   RTFEKRAIASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQ
FT                   LWIMMYALLSVFSLLDVILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDE
FT                   MQRLNKAHLLKPYLTSRHQEINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPR
FT                   IRKDMTLMVRQLAPGDNGLPLEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQ
FT                   SPTGNDIRSLAGAFKQ"
FT   gene            complement(547636..548289)
FT                   /gene="nfnB"
FT                   /locus_tag="SFV_0518"
FT   CDS_pept        complement(547636..548289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="SFV_0518"
FT                   /product="oxygen-insensitive NAD(P)H nitroreductase"
FT                   /note="Code: C; COG: COG0778"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02777"
FT                   /db_xref="GOA:Q0T749"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T749"
FT                   /protein_id="ABF02777.1"
FT                   /translation="MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYVFNKRKILDASHVVVFCAKTAMDDAWLKLVVDQEDA
FT                   DGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVP
FT                   IEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNTTLTEV"
FT   gene            complement(548383..548751)
FT                   /gene="ybdF"
FT                   /locus_tag="SFV_0519"
FT   CDS_pept        complement(548383..548751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="SFV_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2315"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02778"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T748"
FT                   /protein_id="ABF02778.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYSGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
FT   gene            complement(548816..549064)
FT                   /gene="ybdJ"
FT                   /locus_tag="SFV_0520"
FT   CDS_pept        complement(548816..549064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="SFV_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02779"
FT                   /db_xref="GOA:Q0T747"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T747"
FT                   /protein_id="ABF02779.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTMFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
FT   gene            complement(549130..550248)
FT                   /gene="ybdK"
FT                   /locus_tag="SFV_0521"
FT   CDS_pept        complement(549130..550248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="SFV_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2170"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02780"
FT                   /db_xref="GOA:Q0T746"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T746"
FT                   /protein_id="ABF02780.1"
FT                   /translation="MPLPDFHVSEPFTLGIELEMQVVNPPGYDLNQDSSMLIDAVKNKI
FT                   TAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAAADHHLEICGGGTPPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIA
FT                   LSAASPYMQGTDTRFAPSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKD
FT                   LHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLLYK
FT                   FNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVS
FT                   GLNEAQLMRDFVADGGSLIGLVKKHCEIWAGD"
FT   mobile_element  550633..551115
FT                   /mobile_element_type="insertion sequence:IS150"
FT                   /note="partial"
FT   gene            550680..551162
FT                   /locus_tag="SFV_0522"
FT   CDS_pept        550680..551162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0522"
FT                   /product="IS150 ORF1(ORF A)"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02781"
FT                   /db_xref="GOA:Q0T745"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T745"
FT                   /protein_id="ABF02781.1"
FT                   /translation="MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVAL
FT                   YEKHGEKGLIPKPKGVSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVY
FT                   EERGEAGLRALKIGTKRNIAISVDPEKAASALELSKDRRIEVRCTGNSGHYHLFFF"
FT   mobile_element  complement(551116..552099)
FT                   /mobile_element_type="insertion sequence:IS600"
FT                   /note="partial"
FT   gene            complement(551159..551872)
FT                   /locus_tag="SFV_0523"
FT   CDS_pept        complement(551159..551872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0523"
FT                   /product="IS600 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02782"
FT                   /db_xref="GOA:Q0T1G6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T1G6"
FT                   /protein_id="ABF02782.1"
FT                   /translation="MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQK
FT                   RKFRATTNPNHNLPVAPNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCE
FT                   IVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQSGLKTS
FT                   MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGN
FT                   ISPAAFREKYHQMAA"
FT   mobile_element  complement(552100..553405)
FT                   /mobile_element_type="insertion sequence:IS629"
FT   gene            complement(552142..552789)
FT                   /locus_tag="SFV_0524"
FT   CDS_pept        complement(552142..552789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0524"
FT                   /product="IS629 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02783"
FT                   /db_xref="GOA:Q0SYJ2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SYJ2"
FT                   /protein_id="ABF02783.1"
FT                   /translation="MARCTVARLMAVMGLAGVLRGKKVRTTISRKAVAAGDRVNRQFVA
FT                   ERPDQLWVADFTYVSTWRGFVYVAFIIDVFAGYIVGWRVSSSMETTFVLDALEQALWAR
FT                   RPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGDSYDNAMAESINGLYKAEVIHR
FT                   KSWKNRAEVELATLTWVDWYNNRRLLERLGHIPPAEAEKAYYASIGNDDLAA"
FT   gene            complement(553025..553351)
FT                   /locus_tag="SFV_0525"
FT   CDS_pept        complement(553025..553351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0525"
FT                   /product="IS629 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02784"
FT                   /db_xref="GOA:Q0T742"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T742"
FT                   /protein_id="ABF02784.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKEPERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            complement(553403..553624)
FT                   /locus_tag="SFV_0526"
FT   CDS_pept        complement(553403..553624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0526"
FT                   /product="IS600 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02785"
FT                   /db_xref="GOA:Q0T741"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T741"
FT                   /protein_id="ABF02785.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKA"
FT   mobile_element  complement(553405..553688)
FT                   /mobile_element_type="insertion sequence:IS600"
FT                   /note="partial"
FT   mobile_element  553689..554651
FT                   /mobile_element_type="insertion sequence:IS150"
FT                   /note="partial"
FT   gene            553774..554625
FT                   /locus_tag="SFV_0527"
FT   CDS_pept        553774..554625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0527"
FT                   /product="IS150 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02786"
FT                   /db_xref="GOA:Q0SZE9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SZE9"
FT                   /protein_id="ABF02786.1"
FT                   /translation="MKVLNELRQFYPLDELLRAAEIPRSTFYYHLKALSKPDKYADVKK
FT                   RIGEIYHENRGRYGYRRVTLSLHREGKQINHKAVQRLMGTLSLKAAIKVKRYRSYRGEV
FT                   GQTAPNVLQRDFKATRPNEKWVTDVTEFAVNGRKLYLSPVIDLFNNEVISYSLSERPVM
FT                   NMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILKEHGIKQSMSRKGNCLDNAV
FT                   VECFFGTLKSECFYLDEFSNISELKDAVTEYIEYYNSRRISLKLKGLTPIEYRNQTYMP
FT                   RV"
FT   gene            complement(555499..556269)
FT                   /gene="entD"
FT                   /locus_tag="SFV_0528"
FT   CDS_pept        complement(555499..556269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="SFV_0528"
FT                   /product="enterochelin synthetase, component D"
FT                   /note="Code: Q; COG: COG2977"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02787"
FT                   /db_xref="GOA:Q0T739"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T739"
FT                   /protein_id="ABF02787.1"
FT                   /translation="MRVVHAGCGVNALSGLQRSCQFNILQDHVGLISVAHQAVLRLSSV
FT                   SNMVDMKTTHTSLPFAGHTLHFVEFDPANFCEQDLLWLPHYAQLQHAGRKRKTEHLAGR
FT                   IAAVYALREYGYKCVPAIGELRQPVWPAEVYGSISHCGATALAVVSRQPIGVDIEEIFS
FT                   AQTATELTDNIITPAEHERLADCGLAFSLALTLAFSAKESAFKASEIQTDAGFLDYQII
FT                   SWNKQQVIIHRENEMFAVHWQIKEKIVITLCQHD"
FT   gene            complement(556294..558534)
FT                   /gene="fepA"
FT                   /locus_tag="SFV_0529"
FT   CDS_pept        complement(556294..558534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="SFV_0529"
FT                   /product="outer membrane receptor for ferric enterobactin
FT                   (enterochelin) and colicins B and D"
FT                   /note="Code: P; COG: COG4771"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02788"
FT                   /db_xref="GOA:Q0T738"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T738"
FT                   /protein_id="ABF02788.1"
FT                   /translation="MNKKIHSLALLVNLGIYGVAQAQEPTDTPVSHDDTIVVTAAEQNL
FT                   QAPGVSTITADEIRKNPVARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENT
FT                   LILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAAGGV
FT                   VNIITKKGSGEWHGSWDAYFNAPEHKEEGATKRTNFSLTGPLGDELSFRLYGNLDKTQA
FT                   DAWDINQGHQSARAGTYATTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQGNL
FT                   YAGDTQNTNSDAYTRSKYGDETNRLYRQNYALTWNGGWDNGVTTSNWVQYEHTRNSRIP
FT                   EGLAGGTEGKFNEKATQDFVDIDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRMKDL
FT                   SSNTQALTGTNTGGAIDGVSATDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFDHHS
FT                   IVGNNWSPALNISQGLGDDFTLKIGIARAYKAPSLYQTNPNYILYSKGQGCYASAGGCY
FT                   LQGNDDLKVETSINKEIGLEFKRDGWLAGVTWFRNDYRNKIEAGYVAVGQNAVGTDLYQ
FT                   WDNVPKAVVEGLEGSLNVPVSETVMWTNNITYMLKSENKTTGDRLSIIPEYTLNSTLSW
FT                   QAREDLSMQTTFTWYGKQQPKKYNYKGQPAVGPETKEISPYSIVGLSATWDVTKNVSLT
FT                   GGVDNLFDKRLWRAGNAQTTGDLAGANYIAGAGAYTYNEPGRTWYMSINTHF"
FT   gene            558777..559979
FT                   /gene="fes"
FT                   /locus_tag="SFV_0530"
FT   CDS_pept        558777..559979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fes"
FT                   /locus_tag="SFV_0530"
FT                   /product="enterochelin esterase"
FT                   /note="Code: P; COG: COG2382"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02789"
FT                   /db_xref="GOA:Q0T737"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T737"
FT                   /protein_id="ABF02789.1"
FT                   /translation="MTALKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYST
FT                   IKRVWVYITGVTDHHQNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSA
FT                   PSPDRLELREGWRKLLPQAIADPLNPQSWKGGRGHAVSALEMPQAPLQPGWDCPQAPEI
FT                   PAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQ
FT                   QLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQS
FT                   FGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLE
FT                   AGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFHDR
FT                   S"
FT   gene            559982..560200
FT                   /gene="ybdZ"
FT                   /locus_tag="SFV_0531"
FT   CDS_pept        559982..560200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="SFV_0531"
FT                   /product="putative cytoplasmic protein"
FT                   /note="Code: S; COG: COG3251"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02790"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T736"
FT                   /protein_id="ABF02790.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCALPAGWDIVCQPQS
FT                   QESCQQWLEAHWRTLTPANFTQLQEAQ"
FT   gene            560197..564090
FT                   /gene="entF"
FT                   /locus_tag="SFV_0532"
FT   CDS_pept        560197..564090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="SFV_0532"
FT                   /product="Enterobactin synthetase component F"
FT                   /note="Code: Q; COG: COG1020"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02791"
FT                   /db_xref="GOA:Q0T735"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T735"
FT                   /protein_id="ABF02791.1"
FT                   /translation="MSQHLPLVAAQPGIWMAEKLSDLPSAWSVAHYVELTGEVDAPLLA
FT                   RAVVAGLAQADTLRMRFTEDNGEVWQWVDDALIFELPEIIDLRTNIDPHGTAQALMLAD
FT                   LQQDLRVDSGKPLVFHQLIQVADNRWYWYQRYHHLLVDGFSFPAITRQIANIYCALLRG
FT                   EPTPASPFTPFADVVEEYQQYRESEAWQRDAAFWVEQRRQLPPPASLSPAPLAGRSASA
FT                   DILRLKMEFTDGEFRQLATQLSGVQRTDLALALTALWLGRLCNRMDYAAGFIFMRRLGS
FT                   AALTATGPVLNVLSLGIHIAAQETLPELATRLATRLAAQLKKMRRHQRYDAEQIVRDSG
FT                   RAAGDEPLFGPVLNIKVFDYQLDIPGVQAQTHTLATGPVNGLELALFPDEHGDLSIEIL
FT                   ANKQRYDEPTLIQHAERLKMLIAQFAADPALLCGDVDIMLPGEYAQLAQINATQVEIPE
FT                   TTLSALVAEQAAKTPDAPALADARYLFSYREMHEQVVALANLLRERGVKPGDSVAVALP
FT                   RSVFLTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTDDQLPRFSDVPNL
FT                   TNLCYNAPLTPQGSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHY
FT                   PLTGEDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLAMQQFFAEYGVTTT
FT                   HFVPSMLAAFVASLTPQTARQSCVTLKQVFCSGEALPADLCREWQQLTGAPLHNLYGPT
FT                   EAAVDVSWYPAFGEELAQVRGSSVPIGYPVWNTGLRILDAMMHPVPPGVAGDLYLTGIQ
FT                   LAQGYLGRPDLTASRFIADPFAPGERMYRTGDVARWLDNGAVEYLGRSDDQLKIRGQRI
FT                   ELGEIDRVMQALPDVKQAVTHACVINQAAATGGDARQLVGYLVSQSGLPLDTSALQAQL
FT                   RETLPPHMVPVVLLQLPQLPLSANGKLDRKALPLPELKAQAPGRAPKAGSETIIAAAFA
FT                   SLLGCDVQDADADFFALGGHSLLAMKLAAQLSRQFARQVTPGQVMVASTVAKLATIIDG
FT                   EEDSSRRMGFETILPLREGNGPTLFCFHPASGFAWQFSVLSRYLDPQWSIIGIQSPRPH
FT                   GPMQTATNLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRARGEQVAFLG
FT                   LLDTWPPETQNWQEKEANGLDPEVLAEINREREAFLAAQQGSTSTELFTTIEGNYADAV
FT                   RLLTTAHSVPFDGKATLFVAERTLQEGMSPERAWSPWIAELDIYRQDCAHVDIISPGAF
FT                   VKIGPIIRATLNR"
FT   gene            complement(564102..564293)
FT                   /locus_tag="SFV_0533"
FT   CDS_pept        complement(564102..564293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0533"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02792"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T734"
FT                   /protein_id="ABF02792.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYLIMGL"
FT   mobile_element  564119..564886
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            564368..564871
FT                   /gene="insB"
FT                   /locus_tag="SFV_0534"
FT   CDS_pept        564368..564871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0534"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02793"
FT                   /db_xref="GOA:Q0T733"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T733"
FT                   /protein_id="ABF02793.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYGRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            565523..566215
FT                   /pseudo
FT                   /gene="fepE"
FT                   /locus_tag="SFV_0535"
FT                   /note="frameshift; original product: ferric enterobactin
FT                   (enterochelin) transport"
FT   gene            complement(566212..567027)
FT                   /gene="fepC"
FT                   /locus_tag="SFV_0536"
FT   CDS_pept        complement(566212..567027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="SFV_0536"
FT                   /product="ATP-binding component of ferric enterobactin
FT                   transport"
FT                   /note="Code: PH; COG: COG1120"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02794"
FT                   /db_xref="GOA:Q0T732"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T732"
FT                   /protein_id="ABF02794.1"
FT                   /translation="MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDEEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETA
FT                   IMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKI
FT                   VAQGAPKEIVTAELIERIYGLRCMIIDDPVAGTPLVVPLGRTAPSTANS"
FT   gene            complement(567024..568016)
FT                   /gene="fepG"
FT                   /locus_tag="SFV_0537"
FT   CDS_pept        complement(567024..568016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="SFV_0537"
FT                   /product="ferric enterobactin transport protein"
FT                   /note="Code: P; COG: COG4779"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02795"
FT                   /db_xref="GOA:Q0T731"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T731"
FT                   /protein_id="ABF02795.1"
FT                   /translation="MIYVSRRLLITCLLLISACVVAGIWGLRSGAVTLEISQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALAAMVGGIITSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAATLLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLAADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
FT   gene            complement(568013..569017)
FT                   /gene="fepD"
FT                   /locus_tag="SFV_0538"
FT   CDS_pept        complement(568013..569017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="SFV_0538"
FT                   /product="ferric enterobactin (enterochelin) transport"
FT                   /note="Code: P; COG: COG0609"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02796"
FT                   /db_xref="GOA:Q0T730"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T730"
FT                   /protein_id="ABF02796.1"
FT                   /translation="MSGSVAVTRAIAVPGLLLLLIIATALSLLIGAKSLPASVVLEAFS
FT                   GTCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGLLGVNAGASFA
FT                   IVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQLSPVRLTLAGVALAAVLE
FT                   GLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLIAGATALLLSRALNSLSL
FT                   GSDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGADHRWS
FT                   LPVTLLATPALLLFADIIGRVIVPGELRVSVVSAFIGAPVLIFLVRRKTRGGA"
FT   gene            569128..570360
FT                   /gene="ybdA"
FT                   /locus_tag="SFV_0539"
FT   CDS_pept        569128..570360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdA"
FT                   /locus_tag="SFV_0539"
FT                   /product="putative transport"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02797"
FT                   /db_xref="GOA:Q0T729"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T729"
FT                   /protein_id="ABF02797.1"
FT                   /translation="MNKQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQIQ
FT                   MMTHSTWQVGLSVTLTGGAMFVGLMVGGVLADRYERKKVILLARGTCGIGFIGLCLNAL
FT                   LPEPSLLAIYLLGLWDGFFASLGVTTLLAATSALVGRENLMQAGAITMLTVRLGSVISP
FT                   MIGGLLLATGGVAWNYGLAAAGTFITLLPLLSLPALPPPPQPLEHPLKSLLAGFRFLLA
FT                   SPLLGGLLTMASAVLVLYPALADNWQMSAAQIGFLYAAIPLGAAIGALTSGKLAHSARP
FT                   GLLMLLSTLGSFLAIGLFGLMPMWILGVVCLALFGWLSAVSSLLQYTMLQTQTPEAMLG
FT                   RINGLWTAQNVTGDAIGAALLGGLGAMMTPVASASASGFGLLIIGVLLLLVLVELRRFR
FT                   QTPPQVTASDS"
FT   gene            complement(570364..571320)
FT                   /gene="fepB"
FT                   /locus_tag="SFV_0540"
FT   CDS_pept        complement(570364..571320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="SFV_0540"
FT                   /product="Ferrienterobactin-binding periplasmic protein
FT                   precursor"
FT                   /note="Code: P; COG: COG4592"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02798"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T728"
FT                   /protein_id="ABF02798.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAVVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLERLKALF"
FT   gene            571612..572787
FT                   /pseudo
FT                   /gene="entC"
FT                   /locus_tag="SFV_0541"
FT                   /note="contains in-frame stop codon; original product:
FT                   isochorismate hydroxymutase 2, enterochelin biosynthesis"
FT   gene            572797..574407
FT                   /gene="entE"
FT                   /locus_tag="SFV_0542"
FT   CDS_pept        572797..574407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="SFV_0542"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /note="Code: Q; COG: COG1021"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02799"
FT                   /db_xref="GOA:Q0T727"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T727"
FT                   /protein_id="ABF02799.1"
FT                   /translation="MSIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDG
FT                   ERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLAL
FT                   FSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVAEHSSIRVVQLHNDSGEHNL
FT                   QDAINHPAEGFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSAEICQFTQ
FT                   QTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIAKHQVNVTALVPP
FT                   AVSLWLQALAEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVN
FT                   YTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQ
FT                   HNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEDIENLLLSHPAVI
FT                   YAALVSMENELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTA
FT                   VGKVDKKQLRQWLASRASA"
FT   gene            574421..575278
FT                   /gene="entB"
FT                   /locus_tag="SFV_0543"
FT   CDS_pept        574421..575278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="SFV_0543"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate synthetase,
FT                   isochroismatase"
FT                   /note="Code: Q; COG: COG1535"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02800"
FT                   /db_xref="GOA:Q0T726"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T726"
FT                   /protein_id="ABF02800.1"
FT                   /translation="MAIPKLQAYAPPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSF
FT                   WGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPE
FT                   QQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATD
FT                   AFMRDIKPFMVADALADFSRDEHLMSLKYVGGRSGRVVMTEELLPAPIPASKAALREVI
FT                   LPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLS
FT                   REVK"
FT   gene            575278..576024
FT                   /gene="entA"
FT                   /locus_tag="SFV_0544"
FT   CDS_pept        575278..576024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="SFV_0544"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
FT                   /note="Code: IQR; COG: COG1028"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02801"
FT                   /db_xref="GOA:Q0T725"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T725"
FT                   /protein_id="ABF02801.1"
FT                   /translation="MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQEQYP
FT                   FATEVMDVADAGQVAQVCQRLLAETERLDVLINAAGILRMGATDQLSKEDWQQTFAVNV
FT                   GGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTARIGMSAYGASKAALKSLALSVGLELA
FT                   GSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTI
FT                   LFLASDLASHITLQDIVVDGGSTLGA"
FT   gene            576027..576440
FT                   /gene="ybdB"
FT                   /locus_tag="SFV_0545"
FT   CDS_pept        576027..576440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="SFV_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: Q; COG: COG2050"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02802"
FT                   /db_xref="GOA:Q0T724"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T724"
FT                   /protein_id="ABF02802.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
FT   gene            576621..578726
FT                   /gene="cstA"
FT                   /locus_tag="SFV_0546"
FT   CDS_pept        576621..578726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="SFV_0546"
FT                   /product="carbon starvation protein"
FT                   /note="Code: T; COG: COG1966"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02803"
FT                   /db_xref="GOA:Q0T723"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T723"
FT                   /protein_id="ABF02803.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFSITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQSVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTADWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKDPKPTAKETPYEPMPENVEEIV
FT                   AQAKGAH"
FT   gene            578908..579105
FT                   /gene="ybdD"
FT                   /locus_tag="SFV_0547"
FT   CDS_pept        578908..579105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="SFV_0547"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="Code: S; COG: COG2879"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02804"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T722"
FT                   /protein_id="ABF02804.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
FT   gene            complement(579115..580203)
FT                   /gene="ybdH"
FT                   /locus_tag="SFV_0548"
FT   CDS_pept        complement(579115..580203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /locus_tag="SFV_0548"
FT                   /product="putative oxidoreductase"
FT                   /note="Code: C; COG: COG0371"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02805"
FT                   /db_xref="GOA:Q0T721"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T721"
FT                   /protein_id="ABF02805.1"
FT                   /translation="MPHNPIRVVVGPANYFSHPGSFNHLHNFFTDEQLSRAVWIYGKRA
FT                   IAAAQTKLPPAFGLPGAKHILFRGHCSESDVQQLAAESGDDRSVVIGVVGGALLDTAKA
FT                   LARRLGLPFVAAPTIAATCAAWTPLSVWYNDAGQALHYEIFDDANFMVLVEPEIILNAP
FT                   QQYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINNAQAIRDVLLNSSEQALADQQN
FT                   QQLTQSFCDVVDAIIAGGGMVGGLGDRFTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYG
FT                   ILVQSALLGQDDVLAQLTGAYQRFHLPTTLAELEVDINNQAEIDKVIAHTLRPVESIHY
FT                   LPVTLTPDTLRAAFEKVESFKA"
FT   gene            580312..581472
FT                   /gene="ybdL"
FT                   /locus_tag="SFV_0549"
FT   CDS_pept        580312..581472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /locus_tag="SFV_0549"
FT                   /product="putative aminotransferase"
FT                   /note="Code: E; COG: COG0436"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02806"
FT                   /db_xref="GOA:Q0T720"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T720"
FT                   /protein_id="ABF02806.1"
FT                   /translation="MTNNPLIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGP
FT                   RYLQERLAYHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEAL
FT                   YAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSER
FT                   TRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHP
FT                   QLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADML
FT                   RAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVSTLDDVEFCQW
FT                   LTQEHGVAAIPLSVFCADPFPHKLIRLCFAKKESTLLAAAERLRQL"
FT   gene            complement(581473..581964)
FT                   /gene="ybdM"
FT                   /locus_tag="SFV_0550"
FT   CDS_pept        complement(581473..581964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="SFV_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: K; COG: COG1475"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02807"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T719"
FT                   /protein_id="ABF02807.1"
FT                   /translation="MDCVLWVKNSQLMPNDYNPNNVAPPEKKLLQKSIEIDGFTQPIVV
FT                   THTDKNAMEIVDGFHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGR
FT                   HQITAMSEIVRELSQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK
FT                   "
FT   mobile_element  complement(581984..583232)
FT                   /mobile_element_type="insertion sequence:IS911"
FT   gene            complement(581992..582831)
FT                   /locus_tag="SFV_0551"
FT   CDS_pept        complement(581992..582831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0551"
FT                   /product="IS911 ORF2"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02808"
FT                   /db_xref="GOA:Q0T2Q5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T2Q5"
FT                   /protein_id="ABF02808.1"
FT                   /translation="MVTLCHVFGVHRSSYRYWKNRPEKPDGRRAVLRSQVLELHGISHG
FT                   SAGARSIATMATRRGYQMGRWLAGRLMKELGLVSCQQPTHRYKRGGHEHVAIPNYLERQ
FT                   FAVTEPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTMKALEMAW
FT                   ETRGKPGGVMFHSDQGSHYTSRQFRQLLWRYQIRQSMSRRGNCWDNSPMERFFRSLKNE
FT                   WMPVVGYVSFSEAAHAITDYIVGYYSALRPHEYNGGLPPNESENRYWKNSNSVASFC"
FT   gene            complement(582858..583160)
FT                   /locus_tag="SFV_0552"
FT   CDS_pept        complement(582858..583160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0552"
FT                   /product="IS911 ORF1"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02809"
FT                   /db_xref="GOA:Q0T2D7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T2D7"
FT                   /protein_id="ABF02809.1"
FT                   /translation="MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQ
FT                   LRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEILKKATALLMSDSLNSSR"
FT   gene            complement(583327..583821)
FT                   /locus_tag="SFV_0553"
FT   CDS_pept        complement(583327..583821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02810"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T716"
FT                   /protein_id="ABF02810.1"
FT                   /translation="MRICEPFGPEQRQGLWLCHVIEPDRWAAMCARVSGVKSGGIYAGH
FT                   DNHFYGHRKIFKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGIEVPQTQ
FT                   QGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKAKNYQRYNERIKGKRQEWGILCNN
FT                   D"
FT   gene            complement(583894..584304)
FT                   /locus_tag="SFV_0554"
FT   CDS_pept        complement(583894..584304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02811"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T715"
FT                   /protein_id="ABF02811.1"
FT                   /translation="MYTDVIEEFYWVALPLTTQNSLSQYQPEWQCWEPDVEWVRQPPQD
FT                   AITAPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMMIGIRADESYNRFVAIASLNKQR
FT                   FADDKPWTTAAPGGHSWYIYPIYDWKVADIWT"
FT   gene            584410..584688
FT                   /locus_tag="SFV_0555"
FT   CDS_pept        584410..584688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0555"
FT                   /product="ISEhe3 orfA"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02812"
FT                   /db_xref="GOA:Q0T714"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T714"
FT                   /protein_id="ABF02812.1"
FT                   /translation="MSGKRYPEEFKTEAVKQVVDRGYSVASVATRLDITTHSLYAWIKK
FT                   YGPDSSTNKEQSDAQAEIRRLQKELKRVTDERDILKKATAYFAKLSD"
FT   gene            584745..585557
FT                   /locus_tag="SFV_0556"
FT   CDS_pept        584745..585557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0556"
FT                   /product="ISEhe3 orfB"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02813"
FT                   /db_xref="GOA:Q0T713"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T713"
FT                   /protein_id="ABF02813.1"
FT                   /translation="MLDVHPSVFYAWLQQPHSQRHQADLRLTGQIKQFWLESGCVYGYR
FT                   KIHLDLRDSGQQCGVNRVWRLMKRVGIKAQVGYRSPRARKGEASIVSPNRLQRQFNPDA
FT                   PDERWVTDITYIRTHEGWLYLAVVVDLFSRKIIGWSMQSRMTKDIVLNALLMAVWRRNP
FT                   EKQVLVHSDQGSQYTSHEWQSFLKSHGLEGSMSRRGNCHDNAVAESFFQLLKRERIKKK
FT                   IYGTREEARSDIFDYIEMFYNSKRRHGSSEQMSPTEYENQYYQRLGSV"
FT   gene            complement(585926..586828)
FT                   /gene="ybdO"
FT                   /locus_tag="SFV_0557"
FT   CDS_pept        complement(585926..586828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="SFV_0557"
FT                   /product="putative transcriptional regulator LYSR-type"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02814"
FT                   /db_xref="GOA:Q0T712"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T712"
FT                   /protein_id="ABF02814.1"
FT                   /translation="MANLYDLKKFDLNLLVIFECIYQHLSISKAAESLYITPSAVSQSL
FT                   QRLRAQFNDPLFIRSGKGIAPTTTGLNLHHHLEKNLKGLEQTINIVNKSELKKNFIIYG
FT                   PQLISCSNNSMLIRCLRQDASVEIECHDILMSAENAEELLVHRKADLVITQMPVISRSV
FT                   ICMPLHTIRNTLICSNKHPRITDNSTYEQIMAEEFTQLISKSAGVDDIQMEIDEKFMNR
FT                   KISFRGSSLLTIINSIAVTDLLGIVPYELYNYHRDFLNLKEIKLEHPLPSIKLYISYNK
FT                   SSLNNLVFSRFIDRLNESF"
FT   gene            complement(587038..587844)
FT                   /gene="dsbG"
FT                   /locus_tag="SFV_0558"
FT   CDS_pept        complement(587038..587844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="SFV_0558"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="Code: O; COG: COG1651"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02815"
FT                   /db_xref="GOA:Q0T711"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T711"
FT                   /protein_id="ABF02815.1"
FT                   /translation="MTVIGYAFYSTFALTEKNKLMLKKILLLALLPAIAFAEELPSPVK
FT                   AIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTL
FT                   IEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFSDPFCPYCKQFWQQARPWVDSG
FT                   KVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGCKLKLNVPANVSTEQMKVL
FT                   SDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGNK"
FT   gene            588156..588719
FT                   /gene="ahpC"
FT                   /locus_tag="SFV_0559"
FT   CDS_pept        588156..588719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="SFV_0559"
FT                   /product="alkyl hydroperoxide reductase, C22 subunit,
FT                   thioredoxin-like"
FT                   /note="detoxification of hydroperoxides; Code: O; COG:
FT                   COG0450"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02816"
FT                   /db_xref="GOA:Q0T710"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T710"
FT                   /protein_id="ABF02816.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
FT   gene            588964..590529
FT                   /gene="ahpF"
FT                   /locus_tag="SFV_0560"
FT   CDS_pept        588964..590529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="SFV_0560"
FT                   /product="Alkyl hydroperoxide reductase subunit F"
FT                   /note="Code: O; COG: COG3634"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02817"
FT                   /db_xref="GOA:Q0T709"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T709"
FT                   /protein_id="ABF02817.1"
FT                   /translation="MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAE
FT                   LSDKVTFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKE
FT                   AQSLLEQIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEI
FT                   TDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGP
FT                   AGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYD
FT                   VDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTK
FT                   GVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDK
FT                   LAQPEKRRHYSECANHGSERRRQQSRWSGISRSCQRQYHNIELAGIFVQIGLLPNTNWL
FT                   EGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIR
FT                   TKTA"
FT   gene            complement(590650..591078)
FT                   /gene="ybdQ"
FT                   /locus_tag="SFV_0561"
FT   CDS_pept        complement(590650..591078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdQ"
FT                   /locus_tag="SFV_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: T; COG: COG0589"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02818"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T708"
FT                   /protein_id="ABF02818.1"
FT                   /translation="MYKAIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSAS
FT                   LSLHRFAADVRRFEEHLQHEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEEL
FT                   GADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR"
FT   gene            591299..592537
FT                   /gene="ybdR"
FT                   /locus_tag="SFV_0562"
FT   CDS_pept        591299..592537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdR"
FT                   /locus_tag="SFV_0562"
FT                   /product="putative oxidoreductase"
FT                   /note="Code: ER; COG: COG1063"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02819"
FT                   /db_xref="GOA:Q0T707"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T707"
FT                   /protein_id="ABF02819.1"
FT                   /translation="MKALTYHGPHHVQVENVPDPGIEQADDIILRITVTAICGSDLHLY
FT                   RGKIPQVKHGDIFGHEFMGEVVETGKDVKNLQKGDRVVIPFVIACGDCFFCRLQQYAAC
FT                   ENTNAGKGAALNKKQIPAPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDD
FT                   KALFLSDILPTAWQAAKNVQIQQGSSVAVYGAGPVGLLTIACARLLGAEQIFVVDHHPY
FT                   RLRFAADRYGAIPINFDEDSDPAQSIIEQTAGHRGVDAVIDAVGFEAKGSTTETVLTNL
FT                   KLEGSSGKALRQCIAAVRRGGIVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWL
FT                   GELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFEKREEECRKVILVPGAQSAEAAQKA
FT                   VSGLVNAMPGGTI"
FT   gene            complement(592768..593178)
FT                   /gene="rnk"
FT                   /locus_tag="SFV_0563"
FT   CDS_pept        complement(592768..593178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="SFV_0563"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /note="Code: K; COG: COG0782"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02820"
FT                   /db_xref="GOA:Q0T706"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T706"
FT                   /protein_id="ABF02820.1"
FT                   /translation="MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCS
FT                   PEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVG
FT                   DSIHWELPGGVATHLEVLELEYQPEAAGDYLL"
FT   gene            complement(593407..594231)
FT                   /gene="rna"
FT                   /locus_tag="SFV_0564"
FT   CDS_pept        complement(593407..594231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rna"
FT                   /locus_tag="SFV_0564"
FT                   /product="RNase I"
FT                   /note="cleaves phosphodiester bond between any two
FT                   nucleotides; Code: J; COG: COG3719"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02821"
FT                   /db_xref="GOA:Q0T705"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="InterPro:IPR039378"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T705"
FT                   /protein_id="ABF02821.1"
FT                   /translation="MSSTPIMKAFCRNAALLAVSLLPLSSANAVALQAKQYGDFDRYVL
FT                   ALSWQTGFCQSQHDRNRNERDECRLQTETTNNADFLTVHGLWPGLPKSVAARGVDERRW
FT                   MRFGCATRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHG
FT                   ACFGFDPDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAV
FT                   KLTCQGNPAYLTEIQISIKADAINAPLSANSFLPQPHPGNCGKTFVIDKAGY"
FT   gene            complement(594327..595790)
FT                   /gene="ybdS"
FT                   /locus_tag="SFV_0565"
FT   CDS_pept        complement(594327..595790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdS"
FT                   /locus_tag="SFV_0565"
FT                   /product="putative a membrane protein"
FT                   /note="Code: P; COG: COG0471"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02822"
FT                   /db_xref="GOA:Q0T704"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T704"
FT                   /protein_id="ABF02822.1"
FT                   /translation="MSLAKDNIWKLLAPLVVMGVMFLIPVPDGMPPQAWHYFAVFVAMI
FT                   VGMILEPIPATAISFIAVTICVIGSNYLLFDAKELADPAFNAQKQALKWGLAGFSSTTV
FT                   WLVFGAFIFALGYEVSGLGRRIALFLVKFMDKRTLTLGYAIVIIDILLAPFTPSNTART
FT                   GGTVFPVIKNLPPLFKSFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEF
FT                   VSKIAGIQISWLQWFLCFLPVGVILLIIAPWLSYVLYKPEITHSEEVATWAGDELKTMG
FT                   ALTRREWTLIGLVLLSLGLWVFGSEVINATAVGLLAVSLMLALHVVPWKDITRYNSAWN
FT                   TLVNLATLVVMANGLTRSGFIDWFAGTMSTHLEGFSPNATVIVLVLVFYFAHYLFASLS
FT                   AHTATMLPVILAVGKGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSK
FT                   DYWRLGAIFGVIYISMLLLVGWPILAMWN"
FT   gene            complement(595841..596719)
FT                   /gene="citG"
FT                   /locus_tag="SFV_0566"
FT   CDS_pept        complement(595841..596719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="SFV_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: H; COG: COG1767"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02823"
FT                   /db_xref="GOA:Q0T703"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T703"
FT                   /protein_id="ABF02823.1"
FT                   /translation="MSMPATSTKTTKLATSLIDEYALLGWRAMLTEVNLSPKPGLVDRI
FT                   NCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHGLRPIGMACEGDMFR
FT                   ATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPVTPTTVCSTAASFCRGLTDRELRTNNSR
FT                   LTAGQRLYQQLGLTGARGEAEAGYPLVINHALPHYLTLLDQGLDPELALLDTLLLLMAT
FT                   NGDTNVASRGGEGGLRWLQREAQTLLQKGGIRTPTDLDYLRQFDRECIERNLSPGGSAD
FT                   LLILTWFLAQI"
FT   gene            complement(596694..597245)
FT                   /gene="ybdU"
FT                   /locus_tag="SFV_0567"
FT   CDS_pept        complement(596694..597245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdU"
FT                   /locus_tag="SFV_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: HI; COG: COG3697"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02824"
FT                   /db_xref="GOA:Q0T702"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T702"
FT                   /protein_id="ABF02824.1"
FT                   /translation="MHLLPELASHHAVSIPELLVSRDERQARQHAWLKHHPVPLVSFTV
FT                   VAPGPIKDSEVTRRIFNHRVTALRALATKQGWQIQEQAALVSASGPEGMLSIAAPARDL
FT                   KLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKTHQL
FT                   TDLLNRMEALLNDVDACNVN"
FT   gene            complement(597249..598823)
FT                   /gene="citF"
FT                   /locus_tag="SFV_0568"
FT   CDS_pept        complement(597249..598823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="SFV_0568"
FT                   /product="citrate lyase alpha chain"
FT                   /note="Code: C; COG: COG3051"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02825"
FT                   /db_xref="GOA:Q0T701"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T701"
FT                   /protein_id="ABF02825.1"
FT                   /translation="MQNFPASAKNKAIKMTQKIEQSQRQERVAAWNRRTECDLAAFQNS
FT                   PKQTYQAEKARDRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGF
FT                   KNLTLASSSLSDCHAPLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGR
FT                   VHLVQSGELNIDVAFLGVPSCDEFGNANGYTGKACCGSLGYAMVDADNAKQVVMLTEEL
FT                   LPYPHNPASIEQDQVDLIVKVDRVGDAAKIGAGTTRMTTNPRELLIARSAADVIVNSGY
FT                   FKEGFSMQTGTGGASLAVTRFLEDKMRSRDIRADFVLGGITATMVDLHEKGLIRKLLDV
FT                   QSFDSHAAQSLARNPNHIEISANQYANWGSKGASVDRLDVVVLSALEIDRQFNVNVLTG
FT                   SDGVLRGASGGHCDTAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGI
FT                   AVNPARPELAERLQEAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVID
FT                   VVHQVKE"
FT   gene            complement(598792..599700)
FT                   /gene="citE"
FT                   /locus_tag="SFV_0569"
FT   CDS_pept        complement(598792..599700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="SFV_0569"
FT                   /product="citrate lyase beta chain (acyl lyase subunit)"
FT                   /note="Code: G; COG: COG2301"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02826"
FT                   /db_xref="GOA:Q0T700"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T700"
FT                   /protein_id="ABF02826.1"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDTARRMVYHALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVLDIEKEILRIEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIDLLHNLYAPTQKEVDHAHRVVEAAEAAAREGLGVVSLNGKMVDG
FT                   PVIDRARLVLSRAELSGIREE"
FT   gene            complement(599697..599993)
FT                   /gene="citD"
FT                   /locus_tag="SFV_0570"
FT   CDS_pept        complement(599697..599993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="SFV_0570"
FT                   /product="citrate lyase acyl carrier protein (gamma chain)"
FT                   /note="Code: C; COG: COG3052"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02827"
FT                   /db_xref="GOA:Q0T6Z9"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6Z9"
FT                   /protein_id="ABF02827.1"
FT                   /translation="MKINQPAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGDAI
FT                   RTTILDVLARYNVRGVQLNVDDKGALDCILRARLEALLARASGIPALPWEDCQ"
FT   gene            complement(600008..601055)
FT                   /pseudo
FT                   /gene="citC"
FT                   /locus_tag="SFV_0571"
FT                   /note="frameshift; original product: citrate lyase
FT                   synthetase (citrate (pro-3S)-lyase ligase"
FT   mobile_element  complement(601249..602016)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(601264..601767)
FT                   /gene="insB"
FT                   /locus_tag="SFV_0572"
FT   CDS_pept        complement(601264..601767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0572"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02828"
FT                   /db_xref="GOA:Q0T6Z8"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z8"
FT                   /protein_id="ABF02828.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQHIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            601881..602594
FT                   /locus_tag="SFV_0573"
FT   CDS_pept        601881..602594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0573"
FT                   /product="putative integrase"
FT                   /note="Code: L; COG: COG0582"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02829"
FT                   /db_xref="GOA:Q0T6Z7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z7"
FT                   /protein_id="ABF02829.1"
FT                   /translation="MSGSAFAVTHHAFSSGAGRTSDGNGSHASTLKSPSYTKSVSWQHY
FT                   RLAEEDPASATRPFRTEVKRSRLLIDEYLLIRKIADVQNEWFGLCMDLALVTGQRKGDL
FT                   AAMRWEDIRDSRLYVEQQKTGAKIRISLPTTISRLNLTLADVLDNLKKINGKNEKLLGG
FT                   KTARTIAAQFRIARDTSGLKWEGDPPPFHEIRSLSGRLHSAEKGSDFTQALLGHRSSSM
FT                   TDKYRDGRGREWKDI"
FT   gene            602728..603648
FT                   /gene="ybhA"
FT                   /locus_tag="SFV_0574"
FT   CDS_pept        602728..603648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhA"
FT                   /locus_tag="SFV_0574"
FT                   /product="putative phosphatase"
FT                   /note="Code: R; COG: COG0561"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02830"
FT                   /db_xref="GOA:Q0T6Z6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z6"
FT                   /protein_id="ABF02830.1"
FT                   /translation="MAVNAELKRRILSDSGIGVPFAQTKILNLNLEYAMTTRVIALDLD
FT                   GTLLTPKKTLLPSSIEALARAREAGYQLIIVTGRHHVAIHPFYQALALDTPAICCNGTY
FT                   LYDYHAKTVLEADPMPVNKALQLIEMLNEHHIHGLMYVDDAMVYEHPTGHVIRTSNWAQ
FT                   TLPPEQRPTFTQVASLAETTQQVNAVWKFALTHDDLPQLQHFGKHVEHELGLECEWSWH
FT                   DQVDIAHGGNSKGKRLTKWVEAQGWSMENVVAFGDNFNDISMLEAAGTGVAMGNADDAV
FT                   KARANIVIGDNTTDSIAQFIYSHLI"
FT   gene            complement(603649..604707)
FT                   /gene="modC"
FT                   /locus_tag="SFV_0575"
FT   CDS_pept        complement(603649..604707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="SFV_0575"
FT                   /product="ATP-binding component of molybdate transport"
FT                   /note="Code: P; COG: COG4148"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02831"
FT                   /db_xref="GOA:Q0T6Z5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z5"
FT                   /protein_id="ABF02831.1"
FT                   /translation="MLELNFSQTLGNHCLTINETLPANGITAIFGVSGAGKTSLINAIS
FT                   GLTRPQKGRIVLNGRVLNDAEKGICLTPEKRRVGYVFQDARLFPHYKVRGNLRYGMSKS
FT                   MVDQFDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPR
FT                   KRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVM
FT                   NPWLPKEQQSSILKVTVLEHHPHYAMTALALGDQHLWVNKLGEPLQAALRIRIQASDVS
FT                   LVLQPPQQTSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELAIKPGLW
FT                   LYAQIKSVSITA"
FT   gene            complement(604710..605399)
FT                   /gene="modB"
FT                   /locus_tag="SFV_0576"
FT   CDS_pept        complement(604710..605399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="SFV_0576"
FT                   /product="molybdate transport permease protein"
FT                   /note="Code: P; COG: COG4149"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02832"
FT                   /db_xref="GOA:Q0T6Z4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z4"
FT                   /protein_id="ABF02832.1"
FT                   /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKA
FT                   LLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSF
FT                   PLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGE
FT                   FGATITFVSNIPSETRTIPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARI
FT                   SRERAGR"
FT   gene            complement(605399..606172)
FT                   /gene="modA"
FT                   /locus_tag="SFV_0577"
FT   CDS_pept        complement(605399..606172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="SFV_0577"
FT                   /product="Molybdate-binding periplasmic protein precursor"
FT                   /note="Code: P; COG: COG0725"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02833"
FT                   /db_xref="GOA:Q0T6Z3"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z3"
FT                   /protein_id="ABF02833.1"
FT                   /translation="MARKWLNLFAGAALSFAVAGNALADEGKITVFAAASLTNAMQDIA
FT                   TQYKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTL
FT                   LGNSLVVVAPKASEQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAW
FT                   DTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPV
FT                   AVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTTK"
FT   gene            complement(606339..606488)
FT                   /locus_tag="SFV_0578"
FT   CDS_pept        complement(606339..606488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02834"
FT                   /db_xref="GOA:Q0T6Z2"
FT                   /db_xref="InterPro:IPR019702"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z2"
FT                   /protein_id="ABF02834.1"
FT                   /translation="MLELLKSLVFAVIMVPVVIAIILGLIYGLGEVFNIFSGVGKKDQP
FT                   GQNH"
FT   gene            606617..607405
FT                   /gene="modE"
FT                   /locus_tag="SFV_0579"
FT   CDS_pept        606617..607405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modE"
FT                   /locus_tag="SFV_0579"
FT                   /product="molybdate uptake regulatory protein"
FT                   /note="Code: R; COG: COG2005"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02835"
FT                   /db_xref="GOA:Q0T6Z1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z1"
FT                   /protein_id="ABF02835.1"
FT                   /translation="MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISY
FT                   KSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLS
FT                   DDDALPLNSLLAAISRFSLQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAIT
FT                   AQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMA
FT                   LPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATLC"
FT   gene            607473..608945
FT                   /gene="modF"
FT                   /locus_tag="SFV_0580"
FT   CDS_pept        607473..608945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modF"
FT                   /locus_tag="SFV_0580"
FT                   /product="ATP-binding component of molybdate transport
FT                   system"
FT                   /note="Code: P; COG: COG1119"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02836"
FT                   /db_xref="GOA:Q0T6Z0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Z0"
FT                   /protein_id="ABF02836.1"
FT                   /translation="MSSLQILQGTFRLSDTKTLQLPQLTLNAGDSWAFVGSNGSGKSAL
FT                   ARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEWQRNNTDMLGPSEDYTGRTTAE
FT                   IIQDEVKDAPRCMQLAQQFGITALLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPF
FT                   DGLDVASRQQLAERLASLHQSGITLVLVLNRFDKIPEFVQFAGVLADCTLAETGAKEEL
FT                   LQQALVAQLAHSEQLEGVQLPEPDEPSARHALPANESRIVLNNGVVSYNDRPILNNLSW
FT                   QVNLGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSSETIWDIKKHIGY
FT                   VSSSLHLDYRVSTTVRNVILSGYFDSIGIYQVVSDRQQKLVQQWLDILGIDKHTADAPF
FT                   HSLSWGQQRLALIVRALVKHPTLLILDEPLQGLDPLNRQLIRRFVDVLISEGETQLLFV
FT                   SHHAEDAPACITHRLEFVPDGGLYRYVLTKIY"
FT   gene            609206..610222
FT                   /gene="galE"
FT                   /locus_tag="SFV_0581"
FT   CDS_pept        609206..610222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="SFV_0581"
FT                   /product="UDP-galactose-4-epimerase"
FT                   /note="Code: M; COG: COG1087"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02837"
FT                   /db_xref="GOA:Q0T6Y9"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Y9"
FT                   /protein_id="ABF02837.1"
FT                   /translation="MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIE
FT                   RLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVAESVQKTLEYYDNNVNGT
FT                   LRLISAMRAANVKNFIFSSSATVYGDQPQIPYVESFPTGTPQSPYGKSKLMVEQILTDL
FT                   QKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDY
FT                   PTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGSSVLDVVNAFSKACG
FT                   KPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD"
FT   gene            610232..611278
FT                   /gene="galT"
FT                   /locus_tag="SFV_0582"
FT   CDS_pept        610232..611278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="SFV_0582"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /note="Code: C; COG: COG1085"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02838"
FT                   /db_xref="GOA:Q0T6Y8"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Y8"
FT                   /protein_id="ABF02838.1"
FT                   /translation="MTQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVL
FT                   PAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFAALMSDTPDAPESNDPLMRCQSARG
FT                   TSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNP
FT                   HPHGQIWANSFLPNEAEREDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAV
FT                   VPYWAAWPFETLLLPKAHVLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWH
FT                   GAPFNGEENQHWQLHAHFYPPLLRSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVSD
FT                   IHFRESGV"
FT   gene            611282..612430
FT                   /gene="galK"
FT                   /locus_tag="SFV_0583"
FT   CDS_pept        611282..612430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="SFV_0583"
FT                   /product="galactokinase"
FT                   /note="Code: G; COG: COG0153"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02839"
FT                   /db_xref="GOA:Q0T6Y7"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6Y7"
FT                   /protein_id="ABF02839.1"
FT                   /translation="MSLKEKTQSLFANAFGYPATHTIQAPGRVNLIGEHTDYNDGFVLP
FT                   CAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLNAPIVAHENYQWANYVRGVVKHLQ
FT                   LRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVLQQLYHLPLDGAQIALNGQEAEN
FT                   QFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVSMPKGVAVVIINSNFKRTLVGSE
FT                   YNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPIVAKRVRHILTENARTVEAASA
FT                   LEQGDLKRMDELMAESHASMRDDFEITVPQIDTLVEIVKAVIGDKGGVRMTGGGFGGCI
FT                   VALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAGQC"
FT   gene            612424..613464
FT                   /gene="galM"
FT                   /locus_tag="SFV_0584"
FT   CDS_pept        612424..613464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="SFV_0584"
FT                   /product="galactose-1-epimerase"
FT                   /note="Code: G; COG: COG2017"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02840"
FT                   /db_xref="GOA:Q0T6Y6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013458"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Y6"
FT                   /protein_id="ABF02840.1"
FT                   /translation="MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLS
FT                   DGSVREALLGCASPECYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLH
FT                   GGPEGFDKRRWQIVNQNDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRAT
FT                   VDKPCPVNMTNHVYFNLDGEQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDF
FT                   RSAKIIASEFLADDDQRKVKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPAL
FT                   QFYSGNFLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTE
FT                   YQFIAE"
FT   gene            613667..614419
FT                   /gene="gpmA"
FT                   /locus_tag="SFV_0585"
FT   CDS_pept        613667..614419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="SFV_0585"
FT                   /product="phosphoglyceromutase 1"
FT                   /note="Code: G; COG: COG0588"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02841"
FT                   /db_xref="GOA:Q0T6Y5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6Y5"
FT                   /protein_id="ABF02841.1"
FT                   /translation="MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLL
FT                   KEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETA
FT                   EKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIP
FT                   YWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENF
FT                   KPLKRYYLGNADEIAAKAAAVANQGKAK"
FT   gene            complement(614586..615638)
FT                   /gene="aroG"
FT                   /locus_tag="SFV_0586"
FT   CDS_pept        complement(614586..615638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="SFV_0586"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /note="Code: E; COG: COG0722"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02842"
FT                   /db_xref="GOA:Q0T6Y4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Y4"
FT                   /protein_id="ABF02842.1"
FT                   /translation="MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHK
FT                   ILKGNDDRLLVVIGPCSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGW
FT                   KGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIG
FT                   ARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVN
FT                   TSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDV
FT                   CADVCQQIAGGEKAIIGVMVESHLVEGNQSLDSGEPLAYGKSITDACIGWEDTDALLRQ
FT                   LVNAVKARRG"
FT   gene            615954..616334
FT                   /locus_tag="SFV_0587"
FT   CDS_pept        615954..616334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0587"
FT                   /product="putative homeobox protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02843"
FT                   /db_xref="GOA:Q0T6Y3"
FT                   /db_xref="InterPro:IPR020363"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Y3"
FT                   /protein_id="ABF02843.1"
FT                   /translation="MKMTKLATLFLTATLSLASGAALAADSGAQTNNGQANAAADAGQV
FT                   APDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDIN
FT                   KKVQTGDGINNDVDTKTDGTTQ"
FT   gene            616448..617389
FT                   /gene="ybgR"
FT                   /locus_tag="SFV_0588"
FT   CDS_pept        616448..617389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgR"
FT                   /locus_tag="SFV_0588"
FT                   /product="putative transport system permease protein"
FT                   /note="Code: P; COG: COG1230"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02844"
FT                   /db_xref="GOA:Q0T6Y2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023500"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Y2"
FT                   /protein_id="ABF02844.1"
FT                   /translation="MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSL
FT                   ALLADAGHMLTDTAALLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITIL
FT                   IVWEAIERFRTPRPVEGGMMMTIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGD
FT                   LLGSVGAIIAALIIIWTGWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDI
FT                   AELKRRMCREIPEVRNVHHVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQ
FT                   IEHATIQMEYQPCHRPDCHLNEGVSGHSHHHH"
FT   gene            complement(617386..618105)
FT                   /gene="pnuC"
FT                   /locus_tag="SFV_0589"
FT   CDS_pept        complement(617386..618105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnuC"
FT                   /locus_tag="SFV_0589"
FT                   /product="required for NMN transport"
FT                   /note="Code: H; COG: COG3201"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02845"
FT                   /db_xref="GOA:Q0T6Y1"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6Y1"
FT                   /protein_id="ABF02845.1"
FT                   /translation="MDFFSVQNILVHIPIGAGGYDLSWIEAVGTIAGLLCIGLASLEKI
FT                   SNYFFGLINVTLFGIIFFQIQLYASLLLQVFFFAANIYGWYAWSRQTSQNEAELKIRWL
FT                   PLPKALSWLAVCVVSIGLMTVFINPVFAFLTRVAVMIMQALGLQVVMPELQPDAFPFWD
FT                   SCMMVLSIVAMILMTRKYVENWLLWVIINVISVVIFALQGVYAMSLEYIILTFIALNGS
FT                   RMWINSARERGSRALSH"
FT   gene            complement(618143..619186)
FT                   /gene="nadA"
FT                   /locus_tag="SFV_0590"
FT   CDS_pept        complement(618143..619186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="SFV_0590"
FT                   /product="quinolinate synthetase, A protein"
FT                   /note="Code: H; COG: COG0379"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02846"
FT                   /db_xref="GOA:Q0T6Y0"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023513"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6Y0"
FT                   /protein_id="ABF02846.1"
FT                   /translation="MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMV
FT                   AHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTI
FT                   LMPTLQVECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
FT                   DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAA
FT                   ILVHPESPQAIVDMADAVGSTSQLIAAAKALPHQRLIVATDRGIFYKMQQAVPDKELLE
FT                   APTAGEGATCRSCAHCPWMAMNGLQAIAEALEQEGSNHEVHVDERLRERALVPLNRMLD
FT                   FAATLRG"
FT   gene            complement(619435..619510)
FT                   /locus_tag="SFV_0591"
FT   tRNA            complement(619435..619510)
FT                   /locus_tag="SFV_0591"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            complement(619514..619589)
FT                   /locus_tag="SFV_0592"
FT   tRNA            complement(619514..619589)
FT                   /locus_tag="SFV_0592"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            complement(619725..619800)
FT                   /locus_tag="SFV_0593"
FT   tRNA            complement(619725..619800)
FT                   /locus_tag="SFV_0593"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            complement(619965..620756)
FT                   /gene="ybgF"
FT                   /locus_tag="SFV_0594"
FT   CDS_pept        complement(619965..620756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="SFV_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1729"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02847"
FT                   /db_xref="GOA:Q0T6X9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X9"
FT                   /protein_id="ABF02847.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAHWAAFAQAPISSVSSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSSDQSGATASTTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
FT   gene            complement(620766..621287)
FT                   /gene="pal"
FT                   /locus_tag="SFV_0595"
FT   CDS_pept        complement(620766..621287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="SFV_0595"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="Code: M; COG: COG2885"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02848"
FT                   /db_xref="GOA:Q0T6X8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X8"
FT                   /protein_id="ABF02848.1"
FT                   /translation="MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDA
FT                   NGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVT
FT                   VEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAY
FT                   SKNRRAVLVY"
FT   gene            complement(621322..622614)
FT                   /gene="tolB"
FT                   /locus_tag="SFV_0596"
FT   CDS_pept        complement(621322..622614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="SFV_0596"
FT                   /product="translocation protein TolB precursor"
FT                   /note="Code: U; COG: COG0823"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02849"
FT                   /db_xref="GOA:Q0T6X7"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6X7"
FT                   /protein_id="ABF02849.1"
FT                   /translation="MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWA
FT                   GPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQV
FT                   TPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAF
FT                   RTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESG
FT                   RSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIR
FT                   QVTDGRSNNTEPTWFPDSQNLAFTSDLAGRPQVYKVNINGGAPQRITWEGSQNQDADVS
FT                   SDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGS
FT                   VLNLVSTDGRFKARLPATDGQVKFPAWSPYL"
FT   gene            complement(622747..623988)
FT                   /gene="tolA"
FT                   /locus_tag="SFV_0597"
FT   CDS_pept        complement(622747..623988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="SFV_0597"
FT                   /product="cell envelope integrity inner membrane protein
FT                   TolA"
FT                   /note="Code: M; COG: COG3064"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02850"
FT                   /db_xref="GOA:Q0T6X6"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X6"
FT                   /protein_id="ABF02850.1"
FT                   /translation="MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGG
FT                   GGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLK
FT                   QLEKERLAAQEQKKQAEEAAKQAELKQKQAEVAAAKAAADAKAAEEAAKKAAADAKKKA
FT                   EAEAAKAAAEAQKKAEVAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAEAEKKAAAE
FT                   KAAADKKAAAEKAAADKKAAEKAAADKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAK
FT                   AAAEADDIFGELSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAI
FT                   ESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQA
FT                   VYEVFKNAPLDFKP"
FT   gene            complement(624053..624481)
FT                   /gene="tolR"
FT                   /locus_tag="SFV_0598"
FT   CDS_pept        complement(624053..624481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="SFV_0598"
FT                   /product="TolR protein"
FT                   /note="Code: U; COG: COG0848"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02851"
FT                   /db_xref="GOA:Q0T6X5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X5"
FT                   /protein_id="ABF02851.1"
FT                   /translation="MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
FT   gene            complement(624485..625168)
FT                   /gene="tolQ"
FT                   /locus_tag="SFV_0599"
FT   CDS_pept        complement(624485..625168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="SFV_0599"
FT                   /product="TolQ protein"
FT                   /note="Code: U; COG: COG0811"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02852"
FT                   /db_xref="GOA:Q0T6X4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X4"
FT                   /protein_id="ABF02852.1"
FT                   /translation="MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAARE
FT                   AEAFEDKFWSGIELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEG
FT                   ASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQM
FT                   VAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAFTVS
FT                   ESNKG"
FT   gene            complement(625174..625578)
FT                   /gene="ybgC"
FT                   /locus_tag="SFV_0600"
FT   CDS_pept        complement(625174..625578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgC"
FT                   /locus_tag="SFV_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0824"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02853"
FT                   /db_xref="GOA:Q0T6X3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X3"
FT                   /protein_id="ABF02853.1"
FT                   /translation="MNTTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHF
FT                   SQQALMAERVAFVVRKMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVNAENTLL
FT                   NEAEVLVVCVAPLKMKPRALPKSIVAEFKQ"
FT   gene            complement(625728..626021)
FT                   /gene="ybgE"
FT                   /locus_tag="SFV_0601"
FT   CDS_pept        complement(625728..626021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="SFV_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3790"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02854"
FT                   /db_xref="GOA:Q0T6X2"
FT                   /db_xref="InterPro:IPR011846"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X2"
FT                   /protein_id="ABF02854.1"
FT                   /translation="MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSE
FT                   LEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF"
FT   gene            complement(626149..627288)
FT                   /gene="cydB"
FT                   /locus_tag="SFV_0602"
FT   CDS_pept        complement(626149..627288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SFV_0602"
FT                   /product="cytochrome d terminal oxidase polypeptide subunit
FT                   II"
FT                   /note="Code: C; COG: COG1294"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02855"
FT                   /db_xref="GOA:Q0T6X1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X1"
FT                   /protein_id="ABF02855.1"
FT                   /translation="MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGF
FT                   DYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQ
FT                   LLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWV
FT                   MYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLLLLTIL
FT                   TARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVM
FT                   TWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY"
FT   gene            complement(627304..628872)
FT                   /gene="cydA"
FT                   /locus_tag="SFV_0603"
FT   CDS_pept        complement(627304..628872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="SFV_0603"
FT                   /product="cytochrome d terminal oxidase, polypeptide
FT                   subunit I"
FT                   /note="Code: C; COG: COG1271"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02856"
FT                   /db_xref="GOA:Q0T6X0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6X0"
FT                   /protein_id="ABF02856.1"
FT                   /translation="MLDIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGK
FT                   QIYKDMTKFWGKLFGINFALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFVGLFFFGWDRLGKVQHMCVTWLVALGSNLSALWILVANGWMQNPIASDFNFET
FT                   MRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAWYMLKGRDFAFAKRSFAI
FT                   AASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQEEET
FT                   NKFAIQIPYALGIIATRSVDTPVIGLKELMVQHEERIRNGMKAYYLLEQLRSGSTDQAV
FT                   RDQFNSMKKDLGYGLLLKRYTPNVADATEAQIQQATKDSIPRVAPLYFAFRTMVACGFL
FT                   LLAIIALSFWSVIRNRIGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLP
FT                   TAVANSSLTAGDLIFSMVLICGLYTLFLVAELFLMFKFARLGPSSLKTGRYHFEQSSTT
FT                   TQPAR"
FT   gene            complement(629722..632355)
FT                   /gene="ybgG"
FT                   /locus_tag="SFV_0604"
FT   CDS_pept        complement(629722..632355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgG"
FT                   /locus_tag="SFV_0604"
FT                   /product="putative sugar hydrolase"
FT                   /note="Code: G; COG: COG0383"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02857"
FT                   /db_xref="GOA:Q0T6W9"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W9"
FT                   /protein_id="ABF02857.1"
FT                   /translation="MKAVSRVHITPHMHWDREWYFTTEESRILLVNNMEEILCRLEQDN
FT                   EYKYYVLDGQTAILEDYFAVKPENKDRVKKLVEAGKLIIGPWYTQTDTTIVSAESIVRN
FT                   LMYGMRDCLAFGEPMKIGYLPDSFGMSGQLPHIYNGFGITCTMFWRGCSERHGTDKTEF
FT                   LWQSSDGSEVTAQVMPLGYAIGKYLPADENGLRKRLDSYFDVLEKASVTKEILLPNGHD
FT                   QMPLQQNIFEVMEKLREIYPQRKFVMSRFEEVFEKIEAQRDNLATLKGEFIDGKYMRVH
FT                   RTIGSTRMDIKVAHARIENKIVNLLEPLATLAWTLGFGYHHGLLEKMWKEILKNHAHDS
FT                   IGCCCRDKVHREIVARFELAEDMADNLLRFYMRKIADNMPQSDADKLVLFNLMPWPREE
FT                   VINTTVRLRASQFNLRDDRGQPVPYFIRHAREIDPGLIDRQIVHYGNYDPFMEFDIQIN
FT                   QIVPSMGYRTLYIEANQPGNVIAAKSDAEGILENAFWQIALNEDGTLQLVDKDSGVRYD
FT                   RVLQIEESSDDGDEYDYSPAKEEWVITSANAKPQCEIIHEAWQSRAVIRYEMAVPRNLQ
FT                   QRSARQSTGRVDVELVVTLSHNNRRIDVDINLDNQADDHRLRVLIPTSFNTDSVLADTQ
FT                   FGSLTRPVNDSAMNNWQQEGWKEAPVPVWNMLNYAALQEGRNGMAVFSEGLREFEVIGE
FT                   EKKTFAITLLRGVGLLGKEDLLLRPRRPSGIKMPVPDSQLRGLLSCRLSLLSYTGTPTA
FT                   AGVAQQARAWLTPVQCYNKIPWDAMKLNKAGFNVPESYSLLKMPPVGCLISALKKAEDR
FT                   QEVILRLFNPAESATCDATVAFSREVISCSETMMDEHITTEENQGSNLSGPFLPGQSRT
FT                   FSYRLA"
FT   gene            complement(632373..634289)
FT                   /pseudo
FT                   /gene="hrsA"
FT                   /locus_tag="SFV_0605"
FT                   /note="contains in-frame stop codon; original product:
FT                   protein modification enzyme, induction of ompC"
FT   gene            634459..635181
FT                   /gene="farR"
FT                   /locus_tag="SFV_0606"
FT   CDS_pept        634459..635181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="farR"
FT                   /locus_tag="SFV_0606"
FT                   /product="transcriptional regulator of succinylCoA
FT                   synthetase operon"
FT                   /note="Code: K; COG: COG2188"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02858"
FT                   /db_xref="GOA:Q0T6W8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W8"
FT                   /protein_id="ABF02858.1"
FT                   /translation="MGHKPLYRQIADRIREQIARGELKPGDALPTESALQTEFGVSRVT
FT                   VRQALRQLVEQQILESIQGSGTYVKEERVNYDIFQLTSFDEKLSDRHVDTHSEVLIFEV
FT                   IPADDFLQQQLQITVQDRVWHVKRVRYRKQKPMALEETWMPLALFPDLTWQVMENSKYH
FT                   FIEEVKKMVIDRSEQEIIPLMPTEEMSRLLNISQTKPILEKVSRGYLVDGRVFEYSRNA
FT                   FNTDDYKFTLIAQRKSSR"
FT   gene            complement(635284..636153)
FT                   /gene="sucD"
FT                   /locus_tag="SFV_0607"
FT   CDS_pept        complement(635284..636153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="SFV_0607"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="Code: C; COG: COG0074"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02859"
FT                   /db_xref="GOA:Q0T6W7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W7"
FT                   /protein_id="ABF02859.1"
FT                   /translation="MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   TTHLGLPVFNTVREAVAATGASASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLD
FT                   MLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVK
FT                   QTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYI
FT                   KEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
FT                   EALKTVLK"
FT   gene            complement(636153..637319)
FT                   /gene="sucC"
FT                   /locus_tag="SFV_0608"
FT   CDS_pept        complement(636153..637319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="SFV_0608"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /note="Code: C; COG: COG0045"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02860"
FT                   /db_xref="GOA:Q0T6W6"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6W6"
FT                   /protein_id="ABF02860.1"
FT                   /translation="MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDI
FT                   AKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGREL
FT                   AFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNA
FT                   LFRQPDLREMRDQSQEDPRAAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAAKGLTDAAQQVVAAVEGK"
FT   gene            complement(637413..638630)
FT                   /gene="sucB"
FT                   /locus_tag="SFV_0609"
FT   CDS_pept        complement(637413..638630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="SFV_0609"
FT                   /product="2-oxoglutarate dehydrogenase"
FT                   /note="Code: C; COG: COG0508"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02861"
FT                   /db_xref="GOA:Q0T6W5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W5"
FT                   /protein_id="ABF02861.1"
FT                   /translation="MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKV
FT                   VLEVPASADGILDAVLEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQA
FT                   SLEEQNNDALSPAIRRLLAEHNIDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA
FT                   APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGE
FT                   AFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVT
FT                   PVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP
FT                   PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEEPT
FT                   RLLLDV"
FT   gene            complement(638645..641446)
FT                   /gene="sucA"
FT                   /locus_tag="SFV_0610"
FT   CDS_pept        complement(638645..641446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="SFV_0610"
FT                   /product="2-oxoglutarate dehydrogenase"
FT                   /note="Code: C; COG: COG0567"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02862"
FT                   /db_xref="GOA:Q0T6W4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W4"
FT                   /protein_id="ABF02862.1"
FT                   /translation="MHNRALKAWLSSSYLSGANQSWIEQLYEDFLTDPDSVDANWRSTF
FT                   QQLPGTGVKPDQFHSQTREYFRRLAKDASRYSSTISDPDTNVKQVKVLQLINAYRFRGH
FT                   QHANLDPLGLWQQDKVADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELISALKQT
FT                   YCGPIGAEYMHITSTEEKRWIQQRIESGRATFNSEEKKRFLSELTAAEGLERYLGAKFP
FT                   GAKRFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDE
FT                   FAGKHKEHLGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPVVIGSVRARLDR
FT                   LDEPNSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNP
FT                   LDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH
FT                   GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGD
FT                   CVVAEWRPMNMHSFTWSPYLNHEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAK
FT                   IYGDRQAMAAGEKLFDWGGAENLAYATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQSN
FT                   GSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQ
FT                   VVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPST
FT                   PAQVYHMLRRQALRGMRRPLVVMSPKSLLRHPLAVSSLEELANGTFLPAIGEIDELDPK
FT                   GVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVW
FT                   CQEEPLNQGAWYCSQHHFREVIPFGASLRYAGRPASASPAVGYMSVHQKQQQDLVNDAL
FT                   NVE"
FT   gene            complement(641747..642463)
FT                   /gene="sdhB"
FT                   /locus_tag="SFV_0611"
FT   CDS_pept        complement(641747..642463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SFV_0611"
FT                   /product="succinate dehydrogenase, iron sulfur protein"
FT                   /note="Code: C; COG: COG0479"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02863"
FT                   /db_xref="GOA:Q0T6W3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W3"
FT                   /protein_id="ABF02863.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
FT   gene            complement(642479..644245)
FT                   /gene="sdhA"
FT                   /locus_tag="SFV_0612"
FT   CDS_pept        complement(642479..644245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SFV_0612"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="Code: C; COG: COG1053"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02864"
FT                   /db_xref="GOA:Q0T6W2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W2"
FT                   /protein_id="ABF02864.1"
FT                   /translation="MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGL
FT                   PFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDG
FT                   VGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHV
FT                   DPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGLHLQESIAEQGALHDASESDVEASLDRLNRWNNNRNGEDPVA
FT                   IRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELD
FT                   NLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPK
FT                   LRPAFPPKIRTY"
FT   gene            complement(644245..644592)
FT                   /gene="sdhD"
FT                   /locus_tag="SFV_0613"
FT   CDS_pept        complement(644245..644592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="SFV_0613"
FT                   /product="succinate dehydrogenase, hydrophobic subunit"
FT                   /note="Code: C; COG: COG2142"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02865"
FT                   /db_xref="GOA:Q0T6W1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W1"
FT                   /protein_id="ABF02865.1"
FT                   /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTY
FT                   EVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVY
FT                   VIYGFVVVWGV"
FT   gene            complement(644586..644975)
FT                   /gene="sdhC"
FT                   /locus_tag="SFV_0614"
FT   CDS_pept        complement(644586..644975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="SFV_0614"
FT                   /product="succinate dehydrogenase, cytochrome b556"
FT                   /note="Code: C; COG: COG2009"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02866"
FT                   /db_xref="GOA:Q0T6W0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6W0"
FT                   /protein_id="ABF02866.1"
FT                   /translation="MIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILQ
FT                   WLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFE
FT                   AGKRSAKISFVITVVLSLLAGVLVW"
FT   gene            645684..646967
FT                   /gene="gltA"
FT                   /locus_tag="SFV_0615"
FT   CDS_pept        645684..646967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="SFV_0615"
FT                   /product="citrate synthase"
FT                   /note="Code: C; COG: COG0372"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02867"
FT                   /db_xref="GOA:Q0T6V9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V9"
FT                   /protein_id="ABF02867.1"
FT                   /translation="MADTKAKLNLNGDTAVELDVLKGTLGQDVIDIRTLGSKGVFTFDP
FT                   GFTSTASCESKITFIDGDEGILLHRGFPIDQLATDSNYLEVCYILLNGEKPTQEQYDEF
FT                   KTTVTRHTMIHEQITRLFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNSRHREIAAF
FT                   RLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVNPILERAMDR
FT                   ILILHADHEQNASTSTVRTAGSSGANPFACIAAGIASLWGPAHGGANEAALKMLEEISS
FT                   VKHIPEFVRRAKDKNDSFRLMGFGHRVYKNYDPRATVMRETCHEVLKELGTKDDLLEVA
FT                   MELENIALNDPYFIEKKLYPNVDFYSGIILKAMGIPSSMFTVIFAMARTVGWIAHWSEM
FT                   HSYGMKIARPRQLYTGYEKRDFKSDIKR"
FT   gene            647357..647923
FT                   /gene="ybgD"
FT                   /locus_tag="SFV_0616"
FT   CDS_pept        647357..647923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="SFV_0616"
FT                   /product="putative fimbrial-like protein"
FT                   /note="Code: NU; COG: COG3539"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02868"
FT                   /db_xref="GOA:Q0T6V8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V8"
FT                   /protein_id="ABF02868.1"
FT                   /translation="MFKGQKTLAALAVSLLFTAPVYAADEGSGEIHFKGEVIEAPCEIH
FT                   QDDIDKEVELGQVTTSHINQSHHSDAVAVDLLLVNCDLENSSNGSGGKISKVAVTFDSS
FT                   AKTTGADPILNNTSTGEATGVGVRLMNKDQSNIVLGTATPDIDLAPTSSEQTLNFFAWM
FT                   EQIDQATPVTPGAVTANATYVLDYK"
FT   gene            647932..650433
FT                   /gene="ybgQ"
FT                   /locus_tag="SFV_0617"
FT   CDS_pept        647932..650433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgQ"
FT                   /locus_tag="SFV_0617"
FT                   /product="putative outer membrane protein"
FT                   /note="Code: NU; COG: COG3188"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02869"
FT                   /db_xref="GOA:Q0T6V7"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V7"
FT                   /protein_id="ABF02869.1"
FT                   /translation="MAALSPPFIKYLSGMDTVNIYRLSFVSCLVVAMPCALAVEFNLNV
FT                   LDKSMRDRIDISLLKEKGVIAPGEYFVSVAVNNNQISNEQKINWHKNDDKTIPCINDLL
FT                   VDKFGLKPEVRQSLPLINQCVDFSSRPEMLFNFAQANQQLNISIPQAWLAWHSENWTPP
FT                   STWKEGVAGVLMDYNLFASSYRPQDGSSSTNLNAYGTAGINTGAWRLRSDYQLNHTDSD
FT                   DNHEQSGEISRTYLFRPLPQLGSKLTLGETDFSPNIFDGFSYTGAALASDDRMLPWELR
FT                   GYAPQISGIAQTNATVTISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRV
FT                   NNFQVSAASTPFLTRQGQVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYSG
FT                   LLLSGDDYHSAAMGIGQNMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATN
FT                   STISLAAYRFSDRHFHSYANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLH
FT                   QTWWNADASTTANITAGFNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNG
FT                   GRVGYDMQNSSHSTTHRMSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGE
FT                   WDISGTYAANDYSSVSSSWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNL
FT                   DYTNHFGIAVVPLISSYQPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSG
FT                   KDVNVIIRNASGQFPPLGADIRQDDSGISVGMVGEEGHAWLSGVAENQKFTVVWGDSQH
FT                   CSLHLPEHMEDTANRLILPCH"
FT   gene            650448..651179
FT                   /gene="ybgP"
FT                   /locus_tag="SFV_0618"
FT   CDS_pept        650448..651179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgP"
FT                   /locus_tag="SFV_0618"
FT                   /product="putative chaperone"
FT                   /note="Code: NU; COG: COG3121"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02870"
FT                   /db_xref="GOA:Q0T6V6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V6"
FT                   /protein_id="ABF02870.1"
FT                   /translation="MTFMKGLPLLLLVASLCSHAALQPDRTRIVFNANDKATSLRVDNR
FT                   SDKLPYLAYSWLENEKGEKSDDLLVALPPIQRLEPKATTQVRIVKQASTTKLPGDRETL
FT                   FFYNMREIPPAPEKNSDHAVLQVAIQSRIKVFWRPAALRKKAGEKVELQLQVSQQGNQL
FT                   TLKNPTAYYLTIAYLGRNEKGVLPGFKTVMVAPFSTVNTNTGNYSGSQFYLGYMDDYGA
FT                   LRMTTLNCSGQCHLQAVEAKK"
FT   gene            651512..652252
FT                   /gene="ybgO"
FT                   /locus_tag="SFV_0619"
FT   CDS_pept        651512..652252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgO"
FT                   /locus_tag="SFV_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02871"
FT                   /db_xref="GOA:Q0T6V5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V5"
FT                   /protein_id="ABF02871.1"
FT                   /translation="MALIMTPTREKAASTLTSVSTVRTLTFIPLMGWQNKICSGDPANI
FT                   HMSRTFLARMRLYVKIREMPPHDYQSTLSDYIVVQFDGAGSVNEDPTAQNLKYHITGLE
FT                   NIRVLDCSVNFSISPETQVIDFGKFNLLDIRRHTMSKTFSIKTTKSQNDQCTDGFKVSS
FT                   SFYTEETLVEEDKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLVYEKTYTAEL
FT                   SSIAGTPIEAGPFDTVVLFKINYN"
FT   gene            652404..653450
FT                   /pseudo
FT                   /gene="abrB"
FT                   /locus_tag="SFV_0620"
FT                   /note="contains in-frame stop codon; original product:
FT                   putative transport protein"
FT   gene            complement(653447..654238)
FT                   /gene="nei"
FT                   /locus_tag="SFV_0621"
FT   CDS_pept        complement(653447..654238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nei"
FT                   /locus_tag="SFV_0621"
FT                   /product="endonuclease VIII and DNA N-glycosylase with an
FT                   AP lyase activity"
FT                   /note="Code: L; COG: COG0266"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02872"
FT                   /db_xref="GOA:Q0T6V4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR023713"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6V4"
FT                   /protein_id="ABF02872.1"
FT                   /translation="MPEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHV
FT                   THVETRGKALLTHFPNGLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLY
FT                   SASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAF
FT                   LAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHH
FT                   GALFRFKVFHRDGELCERCGGIIEKTTLSSRPFYWCPGCQH"
FT   gene            complement(654274..655008)
FT                   /gene="ybgL"
FT                   /locus_tag="SFV_0622"
FT   CDS_pept        complement(654274..655008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="SFV_0622"
FT                   /product="putative lactam utilization protein"
FT                   /note="Code: R; COG: COG1540"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02873"
FT                   /db_xref="GOA:Q0T6V3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6V3"
FT                   /protein_id="ABF02873.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQTMQACVR
FT                   EEIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALVLVGLAGSELIRAGKQYGLTTREEVFADR
FT                   GYQADGSLVPRSQPGALIENEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGE
FT                   HALAFARRLRATFAKKGIVVAA"
FT   gene            complement(654998..655930)
FT                   /pseudo
FT                   /gene="ybgK"
FT                   /locus_tag="SFV_0623"
FT                   /note="contains in-frame stop codon; original product:
FT                   putative carboxylase"
FT   gene            complement(655924..656580)
FT                   /gene="ybgJ"
FT                   /locus_tag="SFV_0624"
FT   CDS_pept        complement(655924..656580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /locus_tag="SFV_0624"
FT                   /product="putative carboxylase"
FT                   /note="Code: E; COG: COG2049"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02874"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V2"
FT                   /protein_id="ABF02874.1"
FT                   /translation="MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVE
FT                   AIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAGGPDLAV
FT                   VAAYCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLLVPAGSV
FT                   GIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFVPQKEGIC"
FT   gene            complement(656603..657346)
FT                   /gene="ybgI"
FT                   /locus_tag="SFV_0625"
FT   CDS_pept        complement(656603..657346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="SFV_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG0327"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02875"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V1"
FT                   /protein_id="ABF02875.1"
FT                   /translation="MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTAS
FT                   QALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHP
FT                   ELGNNAQLAALLGITVMGEIEPLVPWGELTMPVPGMELASWIEARLGRKPLWCGDTGPE
FT                   VVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGG
FT                   IRALSEWLNENTDLDVTFIDIPNPA"
FT   gene            657617..659098
FT                   /gene="ybgH"
FT                   /locus_tag="SFV_0626"
FT   CDS_pept        657617..659098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgH"
FT                   /locus_tag="SFV_0626"
FT                   /product="putative transport protein"
FT                   /note="Code: E; COG: COG3104"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02876"
FT                   /db_xref="GOA:Q0T6V0"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023777"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6V0"
FT                   /protein_id="ABF02876.1"
FT                   /translation="MNKHASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYNDT
FT                   HAYELFSAYCSLVYVTPILGGFLADKVLGNRMAVMLGALLMAIGHVVLGASEIHPSFLY
FT                   LSLAIIVCGYGLFKSNVSCLLGELYEPTDPRRDGGFSLMYAAGNVGSIIAPIACGYAQE
FT                   EYSWAMGFGLAAVGMIAGLVIFLCGNRHFTHTRGVNKKVLRATNFLLPNWGCLLFLLVP
FT                   TLALITVLFWKECSVYALIVATIIGLGVLAKIYRKAENQKQRKELGLIVTLTFFSMLFW
FT                   AFAQQGGSSISLYIDRFVNRDMFGYTVPTAMFQSINAFAVMLCGVFLAWVVKESVAGNR
FT                   TVRIWGKFALGLGLMSAGFCILTLSARWSAMYGHSSLPLMVLGLAVMGFAELFIDPVAM
FT                   SQITRIEIPGVTGVLTGIYMLLSGAIANYLAGVIADQTSQASFDASGAINYSINAYIEV
FT                   FDQITWGALACVGLVLMIWLYQALKFRNRALALES"
FT   gene            complement(659248..660666)
FT                   /gene="phrB"
FT                   /locus_tag="SFV_0627"
FT   CDS_pept        complement(659248..660666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="SFV_0627"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /note="Code: L; COG: COG0415"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02877"
FT                   /db_xref="GOA:Q0T6U9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U9"
FT                   /protein_id="ABF02877.1"
FT                   /translation="MTTHLAWFRQDLRLHDNLALAAACRNSSARVLALYIATPRQWETH
FT                   NMSPRQAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNY
FT                   QYEVNERARDVDVERALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLR
FT                   EGMPECVAAPKVRSSGSIKPAPSITLNYPRQSFDTAHFPVEEKAAIAQLRQFCENGAGE
FT                   YEQQRDFPAVEGTSRLSASLATGGLSPRQCLHRLLAEQPQALDGGAGSVWLSELIWREF
FT                   YRHLMTYYPSLCKHRPFIAWTDRVQWQSNPAHLQAWQKGKTGYPIIDAAMRQLNSTGWM
FT                   HNRLRMITASFLVKDLLIDWREGERYFMSQLIDGDLAANNGGWQWAASTGTDAAPYFRI
FT                   FNPITQGEKFDREGEFIRRWLPELRDVPGKAVHEPWKWAQKAGVKLDYPQPIVEHKEAR
FT                   VQTLAAYEAARKGK"
FT   gene            complement(660663..661172)
FT                   /gene="ybgA"
FT                   /locus_tag="SFV_0628"
FT   CDS_pept        complement(660663..661172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="SFV_0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3272"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02878"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U8"
FT                   /protein_id="ABF02878.1"
FT                   /translation="MNLQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDFYNQYRQRVIVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHSGVL"
FT   gene            661301..661588
FT                   /locus_tag="SFV_0629"
FT   CDS_pept        661301..661588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02879"
FT                   /db_xref="GOA:Q0T6U7"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U7"
FT                   /protein_id="ABF02879.1"
FT                   /translation="MAEHDITPEVTISKTQRRYKVGYVRARHQDRKTGIARYYSQHPSL
FT                   HLKGDWLKEAGFDTGRGVTVKISEGGLTIIADSDEVQELRDGMFSVLNES"
FT   gene            complement(662026..666690)
FT                   /locus_tag="SFV_0630"
FT   CDS_pept        complement(662026..666690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0630"
FT                   /product="putative Rhs-family protein"
FT                   /note="Code: M; COG: COG3209"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02880"
FT                   /db_xref="GOA:Q0T6U6"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U6"
FT                   /protein_id="ABF02880.1"
FT                   /translation="MEEAFWAARQGDALLHTSFMADVLGAVLEVAANVVIDALIVGTTS
FT                   LLATSVGITMGCTAVVLTGFVAGVAMVYTGVTEKVSEACSALANMLFPPQIEGYILTGS
FT                   GDTWINSKPAARAAATAASRQDIEAQEAQAKAEQEEAQRQEDARTFRDVAGEYLEMAGA
FT                   IALAVNPVTGPVLMSRALHDQLSTEEGRSEMVDGVTHFVSELWQPTVASAAPGSTPPPD
FT                   DKIDCHKHPSSLTQFLAQKKAAFLDDPLGTALNLLNPGGMLETAFQGVNAVIGSISNLF
FT                   KGDDEPPAAEYIAEGARDVRINSQPATRSGARCTCEARVVNEPGNGAFVSPDVRIGGPL
FT                   LVVRDIRSGRSQITLVATVALMFLRPGKMLSKIACFAASVGMSMLTQKATSALPHPVNA
FT                   ATGAKYLADDDDFDFSLPGHFPLDWQRVYSSRDERTEGMFGQGWSVMYEVSLVCTPGSA
FT                   DENCMTFVSGMGRRLDMEAVLPGGGFYSPGEGLAVRRGEQGHWLISSDDGQCFLFEADP
FT                   HHPQRQRLKMLGDRNSNCLNLYYDDRGRIVEISGEQQRPCIRLYYELAAHPRRVTQIYQ
FT                   HFPETAPLLLRRYSYDEAGHLNGVYDSTGHLLREFAYDENHCMTLHRQPGGEGYYYQWG
FT                   WYEGPDDAAWRVTGHHTDSGEQYRLAWDLAQRRLCVTDGLGRTRYHQWDAQNQVTAYQD
FT                   EAGQVTTFRWSDEERLLLGMTDPQGGKWRYVYDLQGHITETHDPLGRVEQAQWHPVWHQ
FT                   PETEVDAAGNTWRCVYDERGNLLAVTDPLQQNTRYQYDHHGQVVQITDARGGNKYLQWN
FT                   EDGQLMRHTDCSGSQTAWFYDERTRLIRMTDAQSHSTRYGYDDSGHLTEVILADGRTVN
FT                   YQSDAAGRLVKYTSPMGRITRWQRDGQGRVRSRTDAMGRRTAFGYDAYGRLVTLTNENG
FT                   ERYRFRHDVLDRLAEQINPDGCRQSYRYNALNAVTEVVFTGDRGGEIRHRLARDAAGRL
FT                   TAKETADGRTEYVHDAADQLLEIRRQRHETDAPEVIRFSYDRLGRMLSEETAQGILTHQ
FT                   YDKLGNRTATTFPDGRTQRHLYYGSGHLQQINLDREVISEFTRDHLHREVLRSQGRLST
FT                   RQLYDPGGRLKRRETYSGMRGVVPETFTDRQYSYSGEDELLKTRHSRRGETDYFYDPTG
FT                   RITACRSEDEGYLASWQYDAAGNLLGRRAGERATAENSVVPFNRLMSYRGVHYRYDEFG
FT                   RAVEKEGRSGTQSYRYDAEHRMVEVTTARGTYRYVYDALGRRTEKQHISPDGKPYNRTK
FT                   FLWDGMRLAQESRPEGTGSLYIYRDQGSYEPLARVDKAGKEDPNRILYFHTDVNGAPEE
FT                   MTDSDGKIVWETGYQVWGNTIQEKDHGGVEQNLRYQGQYLDRETGLHYNLHRYYDPDVG
FT                   RFMVTDPIGLRGGLNLYSYAPNPLKYADPLGLTPCAVSNQKANRLLDSSETKVTVRSRS
FT                   DAEQLFMDRYLGHNYKNMTGESGPSTKNLMEYLTGNKTKAGSYHWDDIKDPSVTKPSYR
FT                   VSGHGPGNPDGDLPHLQVHQHGGSVRHIFFPWET"
FT   gene            complement(666709..666909)
FT                   /locus_tag="SFV_0631"
FT   CDS_pept        complement(666709..666909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02881"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U5"
FT                   /protein_id="ABF02881.1"
FT                   /translation="MEIQSQFLRGNEQVYQCQVAFVLPGERVMMAFTYSRTTPLTPADM
FT                   TRWAEIKKNLRFRMRQEVRTN"
FT   mobile_element  complement(667291..668058)
FT                   /mobile_element_type="insertion sequence:IS1"
FT   gene            complement(667306..667809)
FT                   /gene="insB"
FT                   /locus_tag="SFV_0632"
FT   CDS_pept        complement(667306..667809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SFV_0632"
FT                   /product="IS1 ORF2"
FT                   /note="Code: L; COG: COG1662"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02882"
FT                   /db_xref="GOA:Q0SXE9"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SXE9"
FT                   /protein_id="ABF02882.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   HWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            667884..668099
FT                   /locus_tag="SFV_0633"
FT   CDS_pept        667884..668099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0633"
FT                   /product="putative IS1 encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02883"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U3"
FT                   /protein_id="ABF02883.1"
FT                   /translation="MPCFTAMRAEIALMSGSAFAVTHHAFSSGAGRTSDGNGSHASTLK
FT                   SPSYTKSVSWQHYHNITSYWIRYVNN"
FT   gene            complement(668497..668703)
FT                   /gene="ybfA"
FT                   /locus_tag="SFV_0634"
FT   CDS_pept        complement(668497..668703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="SFV_0634"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02884"
FT                   /db_xref="GOA:Q0T6U2"
FT                   /db_xref="InterPro:IPR019663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U2"
FT                   /protein_id="ABF02884.1"
FT                   /translation="MELYREYPAWLIFLRRTYAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
FT   gene            669105..670754
FT                   /gene="kdpA"
FT                   /locus_tag="SFV_0635"
FT   CDS_pept        669105..670754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="SFV_0635"
FT                   /product="ATPase of high-affinity potassium transport
FT                   system, A chain"
FT                   /note="Code: P; COG: COG2060"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02885"
FT                   /db_xref="GOA:Q0T6U1"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6U1"
FT                   /protein_id="ABF02885.1"
FT                   /translation="MAAQGFLLIATFLLVLMVLARLINDIPLPGTAGVERILFRLPGVS
FT                   DHEMNWKQYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALNTTVSFVTN
FT                   TNWQSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFAFIRAFTRQSMSTLGNAWVDLL
FT                   RITLWVLVPVALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQEAIKMLGT
FT                   NGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVTGDRRQGRMLLWAMSV
FT                   IFVICVGVVMWAEVQGNPHLLALGADSSINMEGKESRFGVLVSSLFAVVTTAASCGAVI
FT                   AMHDSFTALGGMVPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIGRTPEYLGK
FT                   KIDVREMKLTALAILVTPTLVLMGAALAMMTDAGRSAMLNPSPHGFSEVLYAVSSAANN
FT                   NGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQPASSGTLPTHGP
FT                   LFVGLLIGTVLLVGALTFIPALALGPVAEYLS"
FT   gene            670777..672824
FT                   /pseudo
FT                   /gene="kdpB"
FT                   /locus_tag="SFV_0636"
FT                   /note="frameshift; original product: ATPase of
FT                   high-affinity potassium transport system, B chain"
FT   gene            672833..673405
FT                   /gene="kdpC"
FT                   /locus_tag="SFV_0637"
FT   CDS_pept        672833..673405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="SFV_0637"
FT                   /product="high-affinity potassium transport system"
FT                   /note="Code: P; COG: COG2156"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02886"
FT                   /db_xref="GOA:Q0T6U0"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6U0"
FT                   /protein_id="ABF02886.1"
FT                   /translation="MSGLRPALSTFLFLLLITGGVYPLLTTALGQWWYPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAA
FT                   LRAANPDASTNVPVELVTASASGLDNNITPQAAAWQIPRIAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
FT   gene            673365..676081
FT                   /pseudo
FT                   /gene="kdpD"
FT                   /locus_tag="SFV_0638"
FT                   /note="frameshift; original product: sensor for
FT                   high-affinity potassium transport system"
FT   gene            676153..676755
FT                   /gene="kdpE"
FT                   /locus_tag="SFV_0639"
FT   CDS_pept        676153..676755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="SFV_0639"
FT                   /product="regulator of kdp operon (transcriptional
FT                   effector)"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02887"
FT                   /db_xref="GOA:Q0T6T9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T9"
FT                   /protein_id="ABF02887.1"
FT                   /translation="MRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQW
FT                   SPVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSATAAPDPLV
FT                   KFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEH
FT                   SHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML"
FT   gene            complement(676777..676911)
FT                   /locus_tag="SFV_0640"
FT   CDS_pept        complement(676777..676911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SFV_0640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02888"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T8"
FT                   /protein_id="ABF02888.1"
FT                   /translation="MNIAILDAVLLLKCCNFVFYICVKKLNLPNNNIRRRFNNKLITI"
FT   gene            677445..679642
FT                   /pseudo
FT                   /gene="speF"
FT                   /locus_tag="SFV_0641"
FT                   /note="frameshift; original product: ornithine
FT                   decarboxylase isozyme, inducible"
FT   gene            679639..680958
FT                   /gene="potE"
FT                   /locus_tag="SFV_0642"
FT   CDS_pept        679639..680958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="SFV_0642"
FT                   /product="putrescine transport protein"
FT                   /note="Code: E; COG: COG0531"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02889"
FT                   /db_xref="GOA:Q0T6T7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T7"
FT                   /protein_id="ABF02889.1"
FT                   /translation="MSQAKSNKMGVVQLTILTMVNMMGSGIIMLPTKLAEVGTISIISW
FT                   LVTAVGSMALAWAFAKCGMFSRKSGGMGGYAEYAFGKSGNFIANYTYGVSLLIANVAIA
FT                   ISAVGYGTELLGASLSPVQIGLATIGVLWICTVANFGGARITGQISSITVWGGIIPVVG
FT                   LYIIGWFWFSPTLYVDSWNPHHAPFFSAVGSSIAMTLWAFLGLESACANTDVVENPERN
FT                   VPIAVLGGTLGAAVIYIVSTNVIAGIVPNMELANSTAPFGLAFAQMFTPEVGKVIMALM
FT                   VMSCCGSLLGWQFTIAQVFKSSSDEGYFPKIFSRVTKVDAPVQGMLTIVIIQSGLALMT
FT                   ISPSLNSQFNVLVNLAVVTNIIPYILSMAALVIIQKVANVPPSKAKVANFVAFVGAMYS
FT                   FYALYSSGEEAMLYGSIVTFLGWTLYGLVSPRFELKNKHG"
FT   gene            complement(681014..682654)
FT                   /gene="pgm"
FT                   /locus_tag="SFV_0643"
FT   CDS_pept        complement(681014..682654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="SFV_0643"
FT                   /product="phosphoglucomutase"
FT                   /note="Code: G; COG: COG0033"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02890"
FT                   /db_xref="GOA:Q0T6T6"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T6"
FT                   /protein_id="ABF02890.1"
FT                   /translation="MAIHNRAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGTS
FT                   GHRGSAARHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAA
FT                   NGVDVIVQENNGFTPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGG
FT                   PADTNVTKVVEDKANALMADGLKGVKRISLDEAMASGYVKEQDLVQPFVEGLADIVDMA
FT                   AIQKAGLTLGVDPLGGSGIEYWKRIGEYYNLNLTIVNDQVDQTFRFMHLDKDGAIRMDC
FT                   SSECAMAGLLALRDKFDLAFANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWG
FT                   KDVAVGKTLVSSAMIDRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLR
FT                   FDGTPWSTDKDGIIMCLLAAEITAVTGKNPQEHYNELAKRFGAPSYNRLQAAATSAQKA
FT                   ALSKLSPEMVSASTLAGDPITARLTAAPGNGASIGGLKVMTDNGWFAARPSGTEDAYKV
FT                   YCESFLGEEHRKQIEKEAVEIVSEVLKNA"
FT   gene            complement(682680..683258)
FT                   /gene="seqA"
FT                   /locus_tag="SFV_0644"
FT   CDS_pept        complement(682680..683258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="seqA"
FT                   /locus_tag="SFV_0644"
FT                   /product="negative modulator of initiation of replication"
FT                   /note="Code: L; COG: COG3057"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02891"
FT                   /db_xref="GOA:Q0T6T5"
FT                   /db_xref="InterPro:IPR005621"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026577"
FT                   /db_xref="InterPro:IPR033761"
FT                   /db_xref="InterPro:IPR036835"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T5"
FT                   /protein_id="ABF02891.1"
FT                   /translation="MYSAKTLHWIKMKTIEVDDELYSYIASHTKHIGESASDILRRMLK
FT                   FSAASQPAAPVTKEVRVASPAIVEAKPVKTIKDKVRAMRELLLSDEYAEQKRAVNRFML
FT                   LLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTN
FT                   TGRKCSMIEHIMQSMQFPAELIGKVCGTI"
FT   gene            683411..684175
FT                   /gene="ybfF"
FT                   /locus_tag="SFV_0645"
FT   CDS_pept        683411..684175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="SFV_0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0596"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02892"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T4"
FT                   /protein_id="ABF02892.1"
FT                   /translation="MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNI
FT                   IQVDMRNHGLSPREPVMNYPAMAQDLVDTLDALQIDKATFIGHSMGGKAVMALTALAPD
FT                   RIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLL
FT                   KSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFP
FT                   QARAHVIAGAGHWVHAEKPDAVLRAIRRYLND"
FT   gene            684246..684608
FT                   /gene="ybfE"
FT                   /locus_tag="SFV_0646"
FT   CDS_pept        684246..684608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="SFV_0646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02893"
FT                   /db_xref="GOA:Q0T6T3"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T3"
FT                   /protein_id="ABF02893.1"
FT                   /translation="MYYGALSIRAEAWLIVSPEVTKIMAKEQTDRTTLDLFAHERRPGR
FT                   PKTNPLSRDEQLRINKRNQLKRDKVRGLKRVELKLNAEAVEALNELAESRNMSRSELIE
FT                   EMLMQQLAALRSQGIV"
FT   gene            684631..685278
FT                   /gene="fldA"
FT                   /locus_tag="SFV_0647"
FT   CDS_pept        684631..685278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="SFV_0647"
FT                   /product="flavodoxin 1"
FT                   /note="Code: C; COG: COG0716"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02894"
FT                   /db_xref="GOA:Q0T6T2"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T2"
FT                   /protein_id="ABF02894.1"
FT                   /translation="MCSPARLLIPQDCLFCYDCLYPWAIFHPHFNKFQEVISLMAITGI
FT                   FFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYGEAQCD
FT                   WDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDALGTIRDIIEPRGATIVGHWPTAG
FT                   YHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA"
FT   gene            685568..686014
FT                   /gene="fur"
FT                   /locus_tag="SFV_0648"
FT   CDS_pept        685568..686014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="SFV_0648"
FT                   /product="negative regulator"
FT                   /note="Code: P; COG: COG0735"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02895"
FT                   /db_xref="GOA:Q0T6T1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T1"
FT                   /protein_id="ABF02895.1"
FT                   /translation="MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLID
FT                   MGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSD
FT                   DSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK"
FT   gene            complement(686098..686442)
FT                   /gene="ybfN"
FT                   /locus_tag="SFV_0649"
FT   CDS_pept        complement(686098..686442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /locus_tag="SFV_0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02896"
FT                   /db_xref="InterPro:IPR025727"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6T0"
FT                   /protein_id="ABF02896.1"
FT                   /translation="MCLPHSMKKLILIAMMASGLVACAQSTAPQEDSRLKEAYSACINT
FT                   AQGSPEKIEACQSVLNVLKKEIQHQQFADQESVRVLDYQQCLRATQTGNDQAVKADCDK
FT                   VWQEIRSNNK"
FT   gene            complement(686461..687867)
FT                   /gene="ybfM"
FT                   /locus_tag="SFV_0650"
FT   CDS_pept        complement(686461..687867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfM"
FT                   /locus_tag="SFV_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02897"
FT                   /db_xref="GOA:Q0T6S9"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6S9"
FT                   /protein_id="ABF02897.1"
FT                   /translation="MRTFSGKRSTLALAIAGVTAMSGFMAMPEARAEGFIDDSTLTGGI
FT                   YYWQRERDRKDVTDGDKYKTNLSHSTWNANLDFQSGYAADMFGLDIAAFTAIEMAENGD
FT                   SSHPNEIAFSKSNKAYDEDWSGDKSGISLYKAAAKFKYGPVWARAGYIQPTGQTLLAPH
FT                   WSFMPGTYQGAEAGANFDYGDAGALSFSYMWTNEYKAPWHLEMDEFYQNDKTTKVDYLH
FT                   SIGAKYDFKNNFVLEAAFGQAEGYIDQYFAKASYKFDIAGSPLTTSYQFYGTRDKIDDR
FT                   SVNDLYDGTAWLQALTFGYRAADVVDLRLEGTWIKADSQQGYFLQRMTPTYASSNGRLD
FT                   IWWDTRSDFNANGEKAVFFGAMYDLKNWNLPGFAIGASYVYAWDAKPATWQSNPDAYYD
FT                   KNRTIEESAYSLDAVYTIQDGRAKGTMFKLHFTEYDNHSDIPSWGGGYGNIFQDERDVK
FT                   FMVIAPFTIF"
FT   gene            complement(688446..690110)
FT                   /gene="glnS"
FT                   /locus_tag="SFV_0651"
FT   CDS_pept        complement(688446..690110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="SFV_0651"
FT                   /product="glutamine tRNA synthetase"
FT                   /note="Code: J; COG: COG0008"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02898"
FT                   /db_xref="GOA:Q0T6S8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6S8"
FT                   /protein_id="ABF02898.1"
FT                   /translation="MSEAEARPTNFIRQIIDEDLASGKHITVHTRFPPEPNGYLHIGHA
FT                   KSICLNFGIAQDYKGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHWSGNVRYSSDYF
FT                   DQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRA
FT                   GGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDAL
FT                   EGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDK
FT                   HVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENA
FT                   PRAMAVIDPVKLVIENYQGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANK
FT                   QYKRLVLGKEVRLRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIH
FT                   WVSAAHALPVEIRLYDRLFSVPNPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAF
FT                   QFEREGYFCLDSRHSTAEKPVFNRTVGLRDTWAKVGE"
FT   gene            complement(690313..692259)
FT                   /gene="nagE"
FT                   /locus_tag="SFV_0652"
FT   CDS_pept        complement(690313..692259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="SFV_0652"
FT                   /product="PTS system, N-acetylglucosamine-specific enzyme
FT                   IIABC"
FT                   /note="Code: G; COG: COG1263"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02899"
FT                   /db_xref="GOA:Q0T6S7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6S7"
FT                   /protein_id="ABF02899.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVIFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLTQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLLIKAQGH
FT                   VVAGQTPLYEIKK"
FT   gene            692592..693392
FT                   /gene="nagB"
FT                   /locus_tag="SFV_0653"
FT   CDS_pept        692592..693392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="SFV_0653"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /note="Code: G; COG: COG0363"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02900"
FT                   /db_xref="GOA:Q0T6S6"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6S6"
FT                   /protein_id="ABF02900.1"
FT                   /translation="MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTP
FT                   MTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENI
FT                   NLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLT
FT                   HDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMIMVLGSQKALALQAAVEGCVNH
FT                   MWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL"
FT   gene            693452..694600
FT                   /gene="nagA"
FT                   /locus_tag="SFV_0654"
FT   CDS_pept        693452..694600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="SFV_0654"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="Code: G; COG: COG1820"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02901"
FT                   /db_xref="GOA:Q0T6S5"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6S5"
FT                   /protein_id="ABF02901.1"
FT                   /translation="MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRS
FT                   LNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSD
FT                   ELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENA
FT                   DVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMP
FT                   YITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGAN
FT                   IEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPA
FT                   RAIDVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ"
FT   gene            694609..695829
FT                   /gene="nagC"
FT                   /locus_tag="SFV_0655"
FT   CDS_pept        694609..695829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="SFV_0655"
FT                   /product="transcriptional repressor of nag
FT                   (N-acetylglucosamine) operon"
FT                   /note="Code: KG; COG: COG1940"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02902"
FT                   /db_xref="GOA:Q0T6S4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6S4"
FT                   /protein_id="ABF02902.1"
FT                   /translation="MTPGGQAQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLA
FT                   PASVTKITRQLIERGLIKEVDQQASTGGRRAISIVTETRNFHAIGVRLGRHDATITLFD
FT                   LSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQRKLRELIAISVILPGLVDPDSG
FT                   KIHYMPHIQVENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQDCEDSILVRVHR
FT                   GTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLNL
FT                   LKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVI
FT                   AGEITEADKVLLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGIL
FT                   LQHLLEN"
FT   gene            695877..696629
FT                   /gene="nagD"
FT                   /locus_tag="SFV_0656"
FT   CDS_pept        695877..696629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagD"
FT                   /locus_tag="SFV_0656"
FT                   /product="N-acetylglucosamine metabolism"
FT                   /note="Code: G; COG: COG0647"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02903"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6S3"
FT                   /protein_id="ABF02903.1"
FT                   /translation="MTIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYP
FT                   SQTGQDLANRFATAGVDVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKAGF
FT                   TITDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDTHGRGFYPACGALCAGI
FT                   EKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLS
FT                   GVSSLDDIDSMPFRPSWIYPSVAEIDVI"
FT   gene            697026..698690
FT                   /gene="asnB"
FT                   /locus_tag="SFV_0657"
FT   CDS_pept        697026..698690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="SFV_0657"
FT                   /product="asparagine synthetase B"
FT                   /note="Code: E; COG: COG0367"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02904"
FT                   /db_xref="GOA:Q0T6S2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6S2"
FT                   /protein_id="ABF02904.1"
FT                   /translation="MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAI
FT                   LAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVIL
FT                   ALYQEKGPEFLDDLQGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMK
FT                   SLVPVCRTIKEFPAGSYLWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKS
FT                   HLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDL
FT                   KAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAM
FT                   GIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVE
FT                   ARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVG
FT                   YSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPG
FT                   GPSVACSSAKAIEWDEAFKKMDDPSGRAVGVHQSAYK"
FT   gene            699071..699147
FT                   /locus_tag="SFV_0658"
FT   tRNA            699071..699147
FT                   /locus_tag="SFV_0658"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            699157..699241
FT                   /locus_tag="SFV_0659"
FT   tRNA            699157..699241
FT                   /locus_tag="SFV_0659"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            699265..699339
FT                   /locus_tag="SFV_0660"
FT   tRNA            699265..699339
FT                   /locus_tag="SFV_0660"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            699374..699448
FT                   /locus_tag="SFV_0661"
FT   tRNA            699374..699448
FT                   /locus_tag="SFV_0661"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            699464..699540
FT                   /locus_tag="SFV_0662"
FT   tRNA            699464..699540
FT                   /locus_tag="SFV_0662"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            699589..699663
FT                   /locus_tag="SFV_0663"
FT   tRNA            699589..699663
FT                   /locus_tag="SFV_0663"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAG"
FT   gene            699701..699775
FT                   /locus_tag="SFV_0664"
FT   tRNA            699701..699775
FT                   /locus_tag="SFV_0664"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAG"
FT   gene            complement(699929..701104)
FT                   /gene="yleB"
FT                   /locus_tag="SFV_0665"
FT   CDS_pept        complement(699929..701104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yleB"
FT                   /locus_tag="SFV_0665"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: HC; COG: COG0654"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02905"
FT                   /db_xref="GOA:Q0T6S1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6S1"
FT                   /protein_id="ABF02905.1"
FT                   /translation="MTNQPTEIAIVGGGMVGGALALGLAQHGFSVTVIEHAEPAPFVAD
FT                   SQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPL
FT                   LGYMVENTVLQQALWQALEAHPKVTLRVPTSLIALHRDNDLQELELKGGETIRAKLVIG
FT                   ADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNW
FT                   ASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQP
FT                   GLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMA
FT                   DNFIMQSGMDLFYAGFSNNLPPLRFVRNLGLMAAERAGVLKRQALKYALGL"
FT   gene            701250..702674
FT                   /gene="yleA"
FT                   /locus_tag="SFV_0666"
FT   CDS_pept        701250..702674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yleA"
FT                   /locus_tag="SFV_0666"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: J; COG: COG0621"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02906"
FT                   /db_xref="GOA:Q0T6S0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6S0"
FT                   /protein_id="ABF02906.1"
FT                   /translation="MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLL
FT                   LNTCSIREKAQEKVFHQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFG
FT                   PQTLHRLPEMINSVRGDRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTY
FT                   CVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLL
FT                   RLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTH
FT                   TALEYKAIIRKLRAARPDIQISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSA
FT                   RPGTPAADMVDDVPEEEKKQRLYILQERINQQAMAWSRRMLGTTQRILVEGTSRKSIME
FT                   LSGRTENNRVVNFEGTPDMIGKFVDVEITDVYPNSLRGKVVRTEDEMGLRMAETPESVI
FT                   ARTRKENDLGVGYYQP"
FT   gene            702827..703867
FT                   /gene="ybeZ"
FT                   /locus_tag="SFV_0667"
FT   CDS_pept        702827..703867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="SFV_0667"
FT                   /product="putative ATP-binding protein in pho regulon"
FT                   /note="Code: T; COG: COG1702"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02907"
FT                   /db_xref="GOA:Q0T6R9"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6R9"
FT                   /protein_id="ABF02907.1"
FT                   /translation="MNIDTREITLEPADNARLLSLCGPFDDNIKQLERRLGIEINRRDN
FT                   HFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKEARVLEQSAESVPE
FT                   YGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQ
FT                   EIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIERNVIE
FT                   VAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTK
FT                   SGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAEQKRKAALAAERKR
FT                   EEQEQK"
FT   gene            703864..704331
FT                   /gene="ybeY"
FT                   /locus_tag="SFV_0668"
FT   CDS_pept        703864..704331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="SFV_0668"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0319"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02908"
FT                   /db_xref="GOA:Q0T6R8"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6R8"
FT                   /protein_id="ABF02908.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE"
FT   gene            704421..705299
FT                   /gene="ybeX"
FT                   /locus_tag="SFV_0669"
FT   CDS_pept        704421..705299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeX"
FT                   /locus_tag="SFV_0669"
FT                   /product="putative transport protein"
FT                   /note="Code: P; COG: COG4535"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02909"
FT                   /db_xref="GOA:Q0T6R7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6R7"
FT                   /protein_id="ABF02909.1"
FT                   /translation="MSDDNSHSSDTISNKKGFFSLLLSQLFHGEPKNRDELLALIRDSG
FT                   QNDLIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFP
FT                   VISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRY
FT                   HMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIED
FT                   FNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKI
FT                   PDDSPQPKLDE"
FT   gene            705324..706862
FT                   /gene="lnt"
FT                   /locus_tag="SFV_0670"
FT   CDS_pept        705324..706862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="SFV_0670"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="Code: M; COG: COG0815"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02910"
FT                   /db_xref="GOA:Q0T6R6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6R6"
FT                   /protein_id="ABF02910.1"
FT                   /translation="MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQ
FT                   ALTFNRRPLQSAAIGFCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLY
FT                   TGLFAGVLSRLWPKTTWLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGL
FT                   APLMGVEAINFLLMMGSGLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTI
FT                   QVSMVQGDIPQSLKWDEGQLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFL
FT                   KALDGELRDKGSSLVTGIVDARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVP
FT                   FGEFVPLESILRPLAPFFDLPMSSFSRGPYIQPPLSANGIELTAAICYEIILAEQVRDN
FT                   FRPDTDYLLTISNDAWFGKSIGPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEI
FT                   QAMIPQFTREVLTTNVTPTTGLTPYARTGNWPLWVLTALFGFAAVLMSLRQRRK"
FT   gene            707259..708167
FT                   /gene="ybeJ"
FT                   /locus_tag="SFV_0671"
FT   CDS_pept        707259..708167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeJ"
FT                   /locus_tag="SFV_0671"
FT                   /product="putative periplasmic binding transport protein"
FT                   /note="Code: ET; COG: COG0834"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02911"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6R5"
FT                   /protein_id="ABF02911.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   DIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
FT   gene            708337..709077
FT                   /gene="gltJ"
FT                   /locus_tag="SFV_0672"
FT   CDS_pept        708337..709077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="SFV_0672"
FT                   /product="glutamate/aspartate transport system permease"
FT                   /note="Code: E; COG: COG0765"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02912"
FT                   /db_xref="GOA:Q0T6R4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6R4"
FT                   /protein_id="ABF02912.1"
FT                   /translation="MSIDWNWGIFLQQAPFGNTTYLGWVWSGFQVTIALSICAWIIAFL
FT                   VGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAEL
FT                   DPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQTYRYVLLPN
FT                   AYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLI
FT                   NAFIMLVMTLVERKVRLPGNMGGK"
FT   gene            709077..709751
FT                   /gene="gltK"
FT                   /locus_tag="SFV_0673"
FT   CDS_pept        709077..709751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="SFV_0673"
FT                   /product="glutamate/aspartate transport system permease"
FT                   /note="Code: E; COG: COG0765"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02913"
FT                   /db_xref="GOA:Q0T6R3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6R3"
FT                   /protein_id="ABF02913.1"
FT                   /translation="MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMR
FT                   LSSFAPVSWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAF
FT                   SMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGI
FT                   VLFQDTSLVYVLSLADFLPYRSTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR
FT                   TA"
FT   gene            709751..710476
FT                   /gene="gltL"
FT                   /locus_tag="SFV_0674"
FT   CDS_pept        709751..710476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="SFV_0674"
FT                   /product="ATP-binding protein of glutamate/aspartate
FT                   transport system"
FT                   /note="Code: E; COG: COG1126"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02914"
FT                   /db_xref="GOA:Q0T6R2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0T6R2"
FT                   /protein_id="ABF02914.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMAPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
FT   gene            710594..711529
FT                   /gene="ybeK"
FT                   /locus_tag="SFV_0675"
FT   CDS_pept        710594..711529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeK"
FT                   /locus_tag="SFV_0675"
FT                   /product="putative tRNA synthetase"
FT                   /note="Code: F; COG: COG1957"
FT                   /db_xref="EnsemblGenomes-Gn:SFV_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABF02915"
FT                   /db_xref="GOA:Q0T6R1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022975"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0T6R1"
FT                   /protein_id="ABF02915.1"
FT                   /translation="MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKT
FT                   LRNVLRMLTLLNRTDIPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTA
FT                   VELMAKTLRESAEPVTIVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAA
FT                   EFNIYVDPEAAEIVFQSGIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDF
FT                   FLEYHKDEKWGFVGAPLHDPCTIAWLLKPELFTTVERWVGVETQGKYTQGMTVVDYYYL
FT                   TGNKPNATVIVDVDRQGFVDLLADRLKFYA"
FT   gene            711613..713283
FT                   /gene="ybeW"
FT                   /locus_tag="SFV_0676"
FT   CDS_pept        711613..713283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeW"
FT                   /locus_tag="SFV_0676"
FT                   /product="putative dnaK protein"
FT                   /note="Code: O; COG: COG0443"
FT