(data stored in ACNUC7421 zone)

EMBL: CP000267

ID   CP000267; SV 1; circular; genomic DNA; STD; PRO; 4712337 BP.
XX
AC   CP000267; AAJK01000000-AAJK01000113;
XX
PR   Project:PRJNA13908;
XX
DT   13-MAR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Rhodoferax ferrireducens T118, complete genome.
XX
KW   .
XX
OS   Rhodoferax ferrireducens T118
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Rhodoferax.
XX
RN   [1]
RP   1-4712337
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Brettin T., Bruce D.,
RA   Han C., Tapia R., Gilna P., Kiss H., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Ivanova N., Richardson P.;
RT   "Complete sequence of Chromosome of Rhodoferax ferrireducens DSM 15236";
RL   Unpublished.
XX
RN   [2]
RP   1-4712337
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Brettin T., Bruce D.,
RA   Han C., Tapia R., Gilna P., Kiss H., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Ivanova N., Richardson P.;
RT   ;
RL   Submitted (27-FEB-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 66a11ffb28ab2b1463f657e78138f932.
DR   BioSample; SAMN02598320.
DR   CABRI; DSM 15236.
DR   EnsemblGenomes-Gn; EBG00001002839.
DR   EnsemblGenomes-Gn; EBG00001002840.
DR   EnsemblGenomes-Gn; EBG00001002842.
DR   EnsemblGenomes-Gn; EBG00001002843.
DR   EnsemblGenomes-Gn; EBG00001002844.
DR   EnsemblGenomes-Gn; EBG00001002845.
DR   EnsemblGenomes-Gn; EBG00001002846.
DR   EnsemblGenomes-Gn; EBG00001002847.
DR   EnsemblGenomes-Gn; EBG00001002848.
DR   EnsemblGenomes-Gn; EBG00001002849.
DR   EnsemblGenomes-Gn; EBG00001002850.
DR   EnsemblGenomes-Gn; EBG00001002851.
DR   EnsemblGenomes-Gn; EBG00001002852.
DR   EnsemblGenomes-Gn; EBG00001002854.
DR   EnsemblGenomes-Gn; EBG00001002855.
DR   EnsemblGenomes-Gn; EBG00001002856.
DR   EnsemblGenomes-Gn; EBG00001002857.
DR   EnsemblGenomes-Gn; EBG00001002858.
DR   EnsemblGenomes-Gn; EBG00001002859.
DR   EnsemblGenomes-Gn; EBG00001002861.
DR   EnsemblGenomes-Gn; EBG00001002862.
DR   EnsemblGenomes-Gn; EBG00001002863.
DR   EnsemblGenomes-Gn; EBG00001002864.
DR   EnsemblGenomes-Gn; EBG00001002865.
DR   EnsemblGenomes-Gn; EBG00001002866.
DR   EnsemblGenomes-Gn; EBG00001002867.
DR   EnsemblGenomes-Gn; EBG00001002868.
DR   EnsemblGenomes-Gn; EBG00001002869.
DR   EnsemblGenomes-Gn; EBG00001002870.
DR   EnsemblGenomes-Gn; EBG00001002871.
DR   EnsemblGenomes-Gn; EBG00001002872.
DR   EnsemblGenomes-Gn; EBG00001002873.
DR   EnsemblGenomes-Gn; EBG00001002874.
DR   EnsemblGenomes-Gn; EBG00001002875.
DR   EnsemblGenomes-Gn; EBG00001002876.
DR   EnsemblGenomes-Gn; EBG00001002877.
DR   EnsemblGenomes-Gn; EBG00001002879.
DR   EnsemblGenomes-Gn; EBG00001002880.
DR   EnsemblGenomes-Gn; EBG00001002881.
DR   EnsemblGenomes-Gn; EBG00001002882.
DR   EnsemblGenomes-Gn; EBG00001002883.
DR   EnsemblGenomes-Gn; EBG00001002884.
DR   EnsemblGenomes-Gn; EBG00001002885.
DR   EnsemblGenomes-Gn; EBG00001002886.
DR   EnsemblGenomes-Gn; EBG00001002887.
DR   EnsemblGenomes-Gn; EBG00001002888.
DR   EnsemblGenomes-Gn; EBG00001002889.
DR   EnsemblGenomes-Gn; EBG00001002891.
DR   EnsemblGenomes-Gn; EBG00001002893.
DR   EnsemblGenomes-Gn; EBG00001002895.
DR   EnsemblGenomes-Gn; EBG00001002896.
DR   EnsemblGenomes-Gn; EBG00001002898.
DR   EnsemblGenomes-Gn; EBG00001002899.
DR   EnsemblGenomes-Gn; EBG00001002900.
DR   EnsemblGenomes-Gn; EBG00001002901.
DR   EnsemblGenomes-Gn; EBG00001002902.
DR   EnsemblGenomes-Gn; EBG00001002903.
DR   EnsemblGenomes-Gn; EBG00001002904.
DR   EnsemblGenomes-Gn; EBG00001002905.
DR   EnsemblGenomes-Gn; EBG00001002906.
DR   EnsemblGenomes-Gn; EBG00001002908.
DR   EnsemblGenomes-Gn; EBG00001002909.
DR   EnsemblGenomes-Gn; EBG00001002910.
DR   EnsemblGenomes-Gn; EBG00001002911.
DR   EnsemblGenomes-Gn; EBG00001002912.
DR   EnsemblGenomes-Gn; EBG00001002913.
DR   EnsemblGenomes-Gn; EBG00001002914.
DR   EnsemblGenomes-Gn; EBG00001002915.
DR   EnsemblGenomes-Gn; EBG00001002916.
DR   EnsemblGenomes-Gn; EBG00001002917.
DR   EnsemblGenomes-Gn; EBG00001002918.
DR   EnsemblGenomes-Gn; EBG00001002919.
DR   EnsemblGenomes-Gn; EBG00001002920.
DR   EnsemblGenomes-Gn; EBG00001002921.
DR   EnsemblGenomes-Gn; EBG00001002922.
DR   EnsemblGenomes-Gn; EBG00001002923.
DR   EnsemblGenomes-Gn; EBG00001002925.
DR   EnsemblGenomes-Gn; EBG00001002927.
DR   EnsemblGenomes-Gn; EBG00001002929.
DR   EnsemblGenomes-Gn; EBG00001002930.
DR   EnsemblGenomes-Gn; EBG00001002931.
DR   EnsemblGenomes-Gn; EBG00001002933.
DR   EnsemblGenomes-Gn; EBG00001002934.
DR   EnsemblGenomes-Gn; EBG00001002935.
DR   EnsemblGenomes-Gn; EBG00001002936.
DR   EnsemblGenomes-Gn; EBG00001002937.
DR   EnsemblGenomes-Gn; EBG00001002938.
DR   EnsemblGenomes-Gn; EBG00001002939.
DR   EnsemblGenomes-Gn; EBG00001002941.
DR   EnsemblGenomes-Gn; EBG00001002943.
DR   EnsemblGenomes-Gn; EBG00001002944.
DR   EnsemblGenomes-Gn; EBG00001002945.
DR   EnsemblGenomes-Gn; EBG00001002946.
DR   EnsemblGenomes-Gn; EBG00001002947.
DR   EnsemblGenomes-Gn; EBG00001002948.
DR   EnsemblGenomes-Gn; EBG00001002949.
DR   EnsemblGenomes-Gn; EBG00001002950.
DR   EnsemblGenomes-Gn; EBG00001002951.
DR   EnsemblGenomes-Gn; EBG00001002952.
DR   EnsemblGenomes-Gn; EBG00001002953.
DR   EnsemblGenomes-Gn; EBG00001002954.
DR   EnsemblGenomes-Gn; EBG00001002955.
DR   EnsemblGenomes-Gn; EBG00001002956.
DR   EnsemblGenomes-Gn; EBG00001002957.
DR   EnsemblGenomes-Gn; EBG00001002958.
DR   EnsemblGenomes-Gn; EBG00001002959.
DR   EnsemblGenomes-Gn; EBG00001002960.
DR   EnsemblGenomes-Gn; EBG00001002961.
DR   EnsemblGenomes-Gn; EBG00001002962.
DR   EnsemblGenomes-Gn; EBG00001002963.
DR   EnsemblGenomes-Gn; EBG00001002964.
DR   EnsemblGenomes-Gn; EBG00001002965.
DR   EnsemblGenomes-Gn; EBG00001002966.
DR   EnsemblGenomes-Gn; EBG00001002967.
DR   EnsemblGenomes-Gn; EBG00001002968.
DR   EnsemblGenomes-Gn; EBG00001002969.
DR   EnsemblGenomes-Gn; EBG00001002970.
DR   EnsemblGenomes-Gn; EBG00001002971.
DR   EnsemblGenomes-Gn; EBG00001002972.
DR   EnsemblGenomes-Gn; EBG00001002973.
DR   EnsemblGenomes-Gn; EBG00001002974.
DR   EnsemblGenomes-Gn; EBG00001002977.
DR   EnsemblGenomes-Gn; EBG00001002979.
DR   EnsemblGenomes-Gn; EBG00001002981.
DR   EnsemblGenomes-Gn; EBG00001002983.
DR   EnsemblGenomes-Gn; EBG00001002984.
DR   EnsemblGenomes-Gn; EBG00001002985.
DR   EnsemblGenomes-Gn; EBG00001002986.
DR   EnsemblGenomes-Gn; EBG00001002987.
DR   EnsemblGenomes-Gn; EBG00001002989.
DR   EnsemblGenomes-Gn; EBG00001002990.
DR   EnsemblGenomes-Gn; EBG00001002991.
DR   EnsemblGenomes-Gn; EBG00001002992.
DR   EnsemblGenomes-Gn; EBG00001002993.
DR   EnsemblGenomes-Gn; Rfer_R0001.
DR   EnsemblGenomes-Gn; Rfer_R0002.
DR   EnsemblGenomes-Gn; Rfer_R0003.
DR   EnsemblGenomes-Gn; Rfer_R0004.
DR   EnsemblGenomes-Gn; Rfer_R0005.
DR   EnsemblGenomes-Gn; Rfer_R0006.
DR   EnsemblGenomes-Gn; Rfer_R0007.
DR   EnsemblGenomes-Gn; Rfer_R0008.
DR   EnsemblGenomes-Gn; Rfer_R0010.
DR   EnsemblGenomes-Gn; Rfer_R0011.
DR   EnsemblGenomes-Gn; Rfer_R0012.
DR   EnsemblGenomes-Gn; Rfer_R0013.
DR   EnsemblGenomes-Gn; Rfer_R0014.
DR   EnsemblGenomes-Gn; Rfer_R0015.
DR   EnsemblGenomes-Gn; Rfer_R0016.
DR   EnsemblGenomes-Gn; Rfer_R0017.
DR   EnsemblGenomes-Gn; Rfer_R0018.
DR   EnsemblGenomes-Gn; Rfer_R0020.
DR   EnsemblGenomes-Gn; Rfer_R0021.
DR   EnsemblGenomes-Gn; Rfer_R0022.
DR   EnsemblGenomes-Gn; Rfer_R0023.
DR   EnsemblGenomes-Gn; Rfer_R0024.
DR   EnsemblGenomes-Gn; Rfer_R0025.
DR   EnsemblGenomes-Gn; Rfer_R0026.
DR   EnsemblGenomes-Gn; Rfer_R0027.
DR   EnsemblGenomes-Gn; Rfer_R0030.
DR   EnsemblGenomes-Gn; Rfer_R0031.
DR   EnsemblGenomes-Gn; Rfer_R0032.
DR   EnsemblGenomes-Gn; Rfer_R0033.
DR   EnsemblGenomes-Gn; Rfer_R0034.
DR   EnsemblGenomes-Gn; Rfer_R0035.
DR   EnsemblGenomes-Gn; Rfer_R0036.
DR   EnsemblGenomes-Gn; Rfer_R0037.
DR   EnsemblGenomes-Gn; Rfer_R0040.
DR   EnsemblGenomes-Gn; Rfer_R0041.
DR   EnsemblGenomes-Gn; Rfer_R0044.
DR   EnsemblGenomes-Gn; Rfer_R0045.
DR   EnsemblGenomes-Gn; Rfer_R0046.
DR   EnsemblGenomes-Gn; Rfer_R0047.
DR   EnsemblGenomes-Gn; Rfer_R0048.
DR   EnsemblGenomes-Gn; Rfer_R0049.
DR   EnsemblGenomes-Gn; Rfer_R0050.
DR   EnsemblGenomes-Gn; Rfer_R0051.
DR   EnsemblGenomes-Gn; Rfer_R0052.
DR   EnsemblGenomes-Gn; Rfer_R0053.
DR   EnsemblGenomes-Gn; Rfer_R0054.
DR   EnsemblGenomes-Gn; Rfer_R0055.
DR   EnsemblGenomes-Gn; Rfer_R0056.
DR   EnsemblGenomes-Gn; Rfer_R0057.
DR   EnsemblGenomes-Gn; Rfer_R0058.
DR   EnsemblGenomes-Gn; Rfer_R0059.
DR   EnsemblGenomes-Tr; EBT00001526574.
DR   EnsemblGenomes-Tr; EBT00001526577.
DR   EnsemblGenomes-Tr; EBT00001526581.
DR   EnsemblGenomes-Tr; EBT00001526584.
DR   EnsemblGenomes-Tr; EBT00001526587.
DR   EnsemblGenomes-Tr; EBT00001526589.
DR   EnsemblGenomes-Tr; EBT00001526592.
DR   EnsemblGenomes-Tr; EBT00001526597.
DR   EnsemblGenomes-Tr; EBT00001526601.
DR   EnsemblGenomes-Tr; EBT00001526603.
DR   EnsemblGenomes-Tr; EBT00001526607.
DR   EnsemblGenomes-Tr; EBT00001526610.
DR   EnsemblGenomes-Tr; EBT00001526614.
DR   EnsemblGenomes-Tr; EBT00001526617.
DR   EnsemblGenomes-Tr; EBT00001526619.
DR   EnsemblGenomes-Tr; EBT00001526623.
DR   EnsemblGenomes-Tr; EBT00001526628.
DR   EnsemblGenomes-Tr; EBT00001526631.
DR   EnsemblGenomes-Tr; EBT00001526635.
DR   EnsemblGenomes-Tr; EBT00001526638.
DR   EnsemblGenomes-Tr; EBT00001526642.
DR   EnsemblGenomes-Tr; EBT00001526644.
DR   EnsemblGenomes-Tr; EBT00001526647.
DR   EnsemblGenomes-Tr; EBT00001526651.
DR   EnsemblGenomes-Tr; EBT00001526653.
DR   EnsemblGenomes-Tr; EBT00001526659.
DR   EnsemblGenomes-Tr; EBT00001526662.
DR   EnsemblGenomes-Tr; EBT00001526667.
DR   EnsemblGenomes-Tr; EBT00001526669.
DR   EnsemblGenomes-Tr; EBT00001526672.
DR   EnsemblGenomes-Tr; EBT00001526675.
DR   EnsemblGenomes-Tr; EBT00001526679.
DR   EnsemblGenomes-Tr; EBT00001526681.
DR   EnsemblGenomes-Tr; EBT00001526683.
DR   EnsemblGenomes-Tr; EBT00001526685.
DR   EnsemblGenomes-Tr; EBT00001526687.
DR   EnsemblGenomes-Tr; EBT00001526690.
DR   EnsemblGenomes-Tr; EBT00001526691.
DR   EnsemblGenomes-Tr; EBT00001526693.
DR   EnsemblGenomes-Tr; EBT00001526695.
DR   EnsemblGenomes-Tr; EBT00001526697.
DR   EnsemblGenomes-Tr; EBT00001526699.
DR   EnsemblGenomes-Tr; EBT00001526700.
DR   EnsemblGenomes-Tr; EBT00001526702.
DR   EnsemblGenomes-Tr; EBT00001526705.
DR   EnsemblGenomes-Tr; EBT00001526707.
DR   EnsemblGenomes-Tr; EBT00001526709.
DR   EnsemblGenomes-Tr; EBT00001526712.
DR   EnsemblGenomes-Tr; EBT00001526714.
DR   EnsemblGenomes-Tr; EBT00001526716.
DR   EnsemblGenomes-Tr; EBT00001526718.
DR   EnsemblGenomes-Tr; EBT00001526719.
DR   EnsemblGenomes-Tr; EBT00001526721.
DR   EnsemblGenomes-Tr; EBT00001526723.
DR   EnsemblGenomes-Tr; EBT00001526726.
DR   EnsemblGenomes-Tr; EBT00001526727.
DR   EnsemblGenomes-Tr; EBT00001526729.
DR   EnsemblGenomes-Tr; EBT00001526730.
DR   EnsemblGenomes-Tr; EBT00001526732.
DR   EnsemblGenomes-Tr; EBT00001526734.
DR   EnsemblGenomes-Tr; EBT00001526735.
DR   EnsemblGenomes-Tr; EBT00001526737.
DR   EnsemblGenomes-Tr; EBT00001526739.
DR   EnsemblGenomes-Tr; EBT00001526741.
DR   EnsemblGenomes-Tr; EBT00001526743.
DR   EnsemblGenomes-Tr; EBT00001526745.
DR   EnsemblGenomes-Tr; EBT00001526746.
DR   EnsemblGenomes-Tr; EBT00001526748.
DR   EnsemblGenomes-Tr; EBT00001526750.
DR   EnsemblGenomes-Tr; EBT00001526751.
DR   EnsemblGenomes-Tr; EBT00001526754.
DR   EnsemblGenomes-Tr; EBT00001526756.
DR   EnsemblGenomes-Tr; EBT00001526759.
DR   EnsemblGenomes-Tr; EBT00001526761.
DR   EnsemblGenomes-Tr; EBT00001526763.
DR   EnsemblGenomes-Tr; EBT00001526765.
DR   EnsemblGenomes-Tr; EBT00001526766.
DR   EnsemblGenomes-Tr; EBT00001526768.
DR   EnsemblGenomes-Tr; EBT00001526770.
DR   EnsemblGenomes-Tr; EBT00001526773.
DR   EnsemblGenomes-Tr; EBT00001526775.
DR   EnsemblGenomes-Tr; EBT00001526777.
DR   EnsemblGenomes-Tr; EBT00001526778.
DR   EnsemblGenomes-Tr; EBT00001526780.
DR   EnsemblGenomes-Tr; EBT00001526782.
DR   EnsemblGenomes-Tr; EBT00001526784.
DR   EnsemblGenomes-Tr; EBT00001526786.
DR   EnsemblGenomes-Tr; EBT00001526787.
DR   EnsemblGenomes-Tr; EBT00001526789.
DR   EnsemblGenomes-Tr; EBT00001526791.
DR   EnsemblGenomes-Tr; EBT00001526792.
DR   EnsemblGenomes-Tr; EBT00001526795.
DR   EnsemblGenomes-Tr; EBT00001526796.
DR   EnsemblGenomes-Tr; EBT00001526798.
DR   EnsemblGenomes-Tr; EBT00001526800.
DR   EnsemblGenomes-Tr; EBT00001526801.
DR   EnsemblGenomes-Tr; EBT00001526803.
DR   EnsemblGenomes-Tr; EBT00001526805.
DR   EnsemblGenomes-Tr; EBT00001526807.
DR   EnsemblGenomes-Tr; EBT00001526808.
DR   EnsemblGenomes-Tr; EBT00001526810.
DR   EnsemblGenomes-Tr; EBT00001526811.
DR   EnsemblGenomes-Tr; EBT00001526812.
DR   EnsemblGenomes-Tr; EBT00001526814.
DR   EnsemblGenomes-Tr; EBT00001526816.
DR   EnsemblGenomes-Tr; EBT00001526817.
DR   EnsemblGenomes-Tr; EBT00001526819.
DR   EnsemblGenomes-Tr; EBT00001526821.
DR   EnsemblGenomes-Tr; EBT00001526823.
DR   EnsemblGenomes-Tr; EBT00001526826.
DR   EnsemblGenomes-Tr; EBT00001526830.
DR   EnsemblGenomes-Tr; EBT00001526834.
DR   EnsemblGenomes-Tr; EBT00001526837.
DR   EnsemblGenomes-Tr; EBT00001526842.
DR   EnsemblGenomes-Tr; EBT00001526845.
DR   EnsemblGenomes-Tr; EBT00001526848.
DR   EnsemblGenomes-Tr; EBT00001526850.
DR   EnsemblGenomes-Tr; EBT00001526851.
DR   EnsemblGenomes-Tr; EBT00001526854.
DR   EnsemblGenomes-Tr; EBT00001526855.
DR   EnsemblGenomes-Tr; EBT00001526857.
DR   EnsemblGenomes-Tr; EBT00001526858.
DR   EnsemblGenomes-Tr; EBT00001526860.
DR   EnsemblGenomes-Tr; EBT00001526862.
DR   EnsemblGenomes-Tr; EBT00001526865.
DR   EnsemblGenomes-Tr; EBT00001526868.
DR   EnsemblGenomes-Tr; EBT00001526869.
DR   EnsemblGenomes-Tr; EBT00001526871.
DR   EnsemblGenomes-Tr; EBT00001526873.
DR   EnsemblGenomes-Tr; EBT00001526875.
DR   EnsemblGenomes-Tr; EBT00001526877.
DR   EnsemblGenomes-Tr; EBT00001526879.
DR   EnsemblGenomes-Tr; EBT00001526880.
DR   EnsemblGenomes-Tr; EBT00001526882.
DR   EnsemblGenomes-Tr; Rfer_R0001-1.
DR   EnsemblGenomes-Tr; Rfer_R0002-1.
DR   EnsemblGenomes-Tr; Rfer_R0003-1.
DR   EnsemblGenomes-Tr; Rfer_R0004-1.
DR   EnsemblGenomes-Tr; Rfer_R0005-1.
DR   EnsemblGenomes-Tr; Rfer_R0006-1.
DR   EnsemblGenomes-Tr; Rfer_R0007-1.
DR   EnsemblGenomes-Tr; Rfer_R0008-1.
DR   EnsemblGenomes-Tr; Rfer_R0010-1.
DR   EnsemblGenomes-Tr; Rfer_R0011-1.
DR   EnsemblGenomes-Tr; Rfer_R0012-1.
DR   EnsemblGenomes-Tr; Rfer_R0013-1.
DR   EnsemblGenomes-Tr; Rfer_R0014-1.
DR   EnsemblGenomes-Tr; Rfer_R0015-1.
DR   EnsemblGenomes-Tr; Rfer_R0016-1.
DR   EnsemblGenomes-Tr; Rfer_R0017-1.
DR   EnsemblGenomes-Tr; Rfer_R0018-1.
DR   EnsemblGenomes-Tr; Rfer_R0020-1.
DR   EnsemblGenomes-Tr; Rfer_R0021-1.
DR   EnsemblGenomes-Tr; Rfer_R0022-1.
DR   EnsemblGenomes-Tr; Rfer_R0023-1.
DR   EnsemblGenomes-Tr; Rfer_R0024-1.
DR   EnsemblGenomes-Tr; Rfer_R0025-1.
DR   EnsemblGenomes-Tr; Rfer_R0026-1.
DR   EnsemblGenomes-Tr; Rfer_R0027-1.
DR   EnsemblGenomes-Tr; Rfer_R0030-1.
DR   EnsemblGenomes-Tr; Rfer_R0031-1.
DR   EnsemblGenomes-Tr; Rfer_R0032-1.
DR   EnsemblGenomes-Tr; Rfer_R0033-1.
DR   EnsemblGenomes-Tr; Rfer_R0034-1.
DR   EnsemblGenomes-Tr; Rfer_R0035-1.
DR   EnsemblGenomes-Tr; Rfer_R0036-1.
DR   EnsemblGenomes-Tr; Rfer_R0037-1.
DR   EnsemblGenomes-Tr; Rfer_R0040-1.
DR   EnsemblGenomes-Tr; Rfer_R0041-1.
DR   EnsemblGenomes-Tr; Rfer_R0044-1.
DR   EnsemblGenomes-Tr; Rfer_R0045-1.
DR   EnsemblGenomes-Tr; Rfer_R0046-1.
DR   EnsemblGenomes-Tr; Rfer_R0047-1.
DR   EnsemblGenomes-Tr; Rfer_R0048-1.
DR   EnsemblGenomes-Tr; Rfer_R0049-1.
DR   EnsemblGenomes-Tr; Rfer_R0050-1.
DR   EnsemblGenomes-Tr; Rfer_R0051-1.
DR   EnsemblGenomes-Tr; Rfer_R0052-1.
DR   EnsemblGenomes-Tr; Rfer_R0053-1.
DR   EnsemblGenomes-Tr; Rfer_R0054-1.
DR   EnsemblGenomes-Tr; Rfer_R0055-1.
DR   EnsemblGenomes-Tr; Rfer_R0056-1.
DR   EnsemblGenomes-Tr; Rfer_R0057-1.
DR   EnsemblGenomes-Tr; Rfer_R0058-1.
DR   EnsemblGenomes-Tr; Rfer_R0059-1.
DR   EuropePMC; PMC2755013; 19772637.
DR   EuropePMC; PMC3753938; 23811518.
DR   EuropePMC; PMC4135758; 24928873.
DR   EuropePMC; PMC6015842; 29967598.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01322; CRISPR-DR9.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000267.
DR   SILVA-SSU; CP000267.
DR   StrainInfo; 303665; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA available from Derek Lovley (dlovley@microbio.umass.edu)
CC   Bacteria available from DSMZ: DSM 15236
CC   Contacts: Derek Lovley (dlovley@microbio.umass.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4712337
FT                   /organism="Rhodoferax ferrireducens T118"
FT                   /strain="DSM 15236"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:338969"
FT   gene            7..1419
FT                   /locus_tag="Rfer_0001"
FT   CDS_pept        7..1419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67763"
FT                   /db_xref="GOA:Q223G0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G0"
FT                   /protein_id="ABD67763.1"
FT                   /translation="MTEGQYANHPDFKGTGDGQSLWQTCVDQLAQELPEQQFNTWIKPL
FT                   SAQVTDDLAQITIFVANRFKLDWIRAQYSKRITSLLEMFSGQTIHLELALAPREIFVRS
FT                   QLTHRSMEPIPMDGVAELGEDRNPSSLKNRLNTALTFDTLIEGTANRMARAAAMHVAGM
FT                   PGHLYNPLFIYGGVGLGKTHLMHAVGNRLLADQPNAKVLYIHAEQFVSDVVKAYQRKTF
FT                   DEFKERYHSLDLLLIDDVQFFANKERTQEEFFNAFEALLAKKSHIVMTSDTYPKGLTDI
FT                   HERLVSRFDSGLTVAIEPPELEMRVAILINKARVEGIVMPEEVAFFVAKNVRSNVRELE
FT                   GALRKILAYSRFNQKDISILLAREALRDLLSIQNRQISVENIQKTVADYYKIKIADMYS
FT                   KKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIGGERQQMTELN
FT                   QQLHVLEQTLKG"
FT   gene            1515..2618
FT                   /locus_tag="Rfer_0002"
FT   CDS_pept        1515..2618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67764"
FT                   /db_xref="GOA:Q223F9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F9"
FT                   /protein_id="ABD67764.1"
FT                   /translation="MIVLKATQDKVLSVLQSVAGIVERRHTLPILANVLIRKTGTSLQL
FT                   TTSDLEIQIRTTAELDGDTGDFTTVGARKLIDILRTMPADQTVSLESSAAKLILKGGKS
FT                   RFTLQTMAAEDFPLVQEAASFGPVFSVPQKTLKDLLSQVSFAMAVHDIRYYLNGILFVA
FT                   EGSQLSLVATDGHRLAFASATLDVEVPKQEVILPRKTVIELQRLLSDTQGAIEMQFANN
FT                   QAKFSFDGMEFVTKLVEGKFPDYNRVIPKNHQNSITLGRSALLATLQRTAILTSEKFKG
FT                   VRLNIDPGTLRVASNNAEQEEAVDELDIDYGGDSIEIGFNVTYLIDALANMSQDMVRLE
FT                   LSDGNSSALFTIPDNATFKYVVMPMRI"
FT   gene            2723..5335
FT                   /locus_tag="Rfer_0003"
FT   CDS_pept        2723..5335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67765"
FT                   /db_xref="GOA:Q223F8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F8"
FT                   /protein_id="ABD67765.1"
FT                   /translation="MTEENKPVQPPENEVNGEDAVHTGEGASDSSNFQPTIDAHQIGAS
FT                   EAYGEGSIQILEGLEAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDESLAGHCDDILV
FT                   TIHSDNSVSVVDNGRGIPTGVKMDDKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLH
FT                   GVGVSCVNALSKMLRLTIRRDGKVHVMEFSRGFVQNRVTEVVNGVEVSPMKVIGTTEKR
FT                   GTEVHFLPDSEIFQQNSDFHYEILSKRLRELSFLNNGVRIRLKDERSGKEDDFSGAGGV
FT                   RGFVNFINKGKTVLNPNIFHALGDRQSDQDTNIGVEVAMQWNSGYNEQVLCFTNNIPQR
FT                   DGGTHLTGLRAAMTRVINKYIDDSELAKKAKVEVTGDDMREGLTCVLSVKVPEPKFSSQ
FT                   TKDKLVSSEVRGPVEDIVSKLLYDYLQERPADAKIIVGKIIEAARAREAARKARDMTRR
FT                   KGVLDGMGLPGKLADCQEKDPALCEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNV
FT                   EKARYEKLLTSNEILTLITALGTGIGNAGGSTGSDDFNVAKLRYHRIIIMTDADVDGAH
FT                   ICTLLLTFFYRQMPELVERGHIYIAQPPLYKVKAGKEELYLKDGDELDRFLLRIALVNA
FT                   SVFTGGENGTTLKGETLAELARKHQTTQAVIARLRNFLDAEALRSVADGVALNLDTVAD
FT                   AEISAAALQARLPDAEVAGEFDVASDKPILRISRRHHGNIKSSVLTQDFVHGADYAVLA
FT                   DAASTFKDLLSPGAIVMRGEGERQKEEKVSDFRQAMTWLLAQAEHATSRQRYKGLGEMN
FT                   PAQLWETTMDPTVRRLLRVQIDDAIETDRVFTMLMGDEVEPRREFIEANALRAGNIDV"
FT   gene            complement(5397..5825)
FT                   /locus_tag="Rfer_0004"
FT   CDS_pept        complement(5397..5825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0004"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67766"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I6"
FT                   /protein_id="ABD67766.1"
FT                   /translation="MKPVLELLKNRNSTVFQVSPSVTVFEALKLLANYGVGALTVMENG
FT                   KLAGIVSERDYTRKVALMGKNSKETTVADIMTRDVITVTPNTGTHACMALMSQKKIRHL
FT                   PVLDGAEVVGLISIRDLMDDIIADQEQTISQLTSYINS"
FT   gene            6309..7871
FT                   /locus_tag="Rfer_0005"
FT   CDS_pept        6309..7871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0005"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67767"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I5"
FT                   /protein_id="ABD67767.1"
FT                   /translation="MIAKKPFEIARETLRQLTARKLAPTPINYQAIYNEVAGVATDPPF
FT                   PTDRLRDIAQALPTKTPGQQKQRALLDSAIGQLNWDGVKSALMAYGGFSPPAADPATAT
FT                   PSTGLPMPGASAPGDVSAPALTFDFLQQMARLIEFTLPALGSDDARFNEQTQTLLKAMR
FT                   QPGADVVALKLMLGSFSDRLSFAAEDQAEIKVTLLKLLHLIIENIGELSLDDRWLKGQI
FT                   EALMTASTPPLTLRRLDDVERRLKDVIFKQTEAKGRALEAQEEMRQMLATFIERLSQMT
FT                   ESTSAYRGKLDDNARLIEQARTLAEIAPVLKEVVGATRTMAHDSLTARDELRGMREKAQ
FT                   STEAELVKLHQELDRVSSQARHDPLTGALNRKGLEEAVNREVSNVRRKETPLCVALLDI
FT                   DNFKKLNDALGHASGDVALAHLATVTREVMRPHDTLARYGGEEFVILMPDTALDNGIEA
FT                   MTRLQRELTTRFFLAGTEKVLITFSAGVAQLATDETGQSAIKRADQAMYLAKRAGKNRV
FT                   LGA"
FT   gene            7888..8466
FT                   /locus_tag="Rfer_0006"
FT   CDS_pept        7888..8466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0006"
FT                   /product="NnrU"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67768"
FT                   /db_xref="GOA:Q223I4"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I4"
FT                   /protein_id="ABD67768.1"
FT                   /translation="MTYLILGLIVFLGVHSVRIVADDWRTQTRARIGPLAWKGLYSVLS
FT                   LLGFALIVWGFGLARQQPVQLWSPPVALRHLASLLTLLSFVLLAAAYVPGNIIKERIHH
FT                   PMVLGVKLWALAHLLANGNLGHVVLFGSFLAWAIVDFTASRRRDRTLGTRYPGGTAGAT
FT                   GITVALGVGAWIAFALWLHGLLIGVRPLG"
FT   sig_peptide     7888..7953
FT                   /locus_tag="Rfer_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.617) with cleavage site probability 0.597 at
FT                   residue 22"
FT   gene            8487..11159
FT                   /locus_tag="Rfer_0007"
FT   CDS_pept        8487..11159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0007"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67769"
FT                   /db_xref="GOA:Q223I3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I3"
FT                   /protein_id="ABD67769.1"
FT                   /translation="MSIRNLDSLFAPASIAVFGASLRVGSVGATVWHNLSSGHYQGALY
FT                   AVNPKHHKLGNHPVVAKASDLPEVPALAVICTPPASVPGLIETLGRLGTRAAVVMTAGM
FT                   NDQQKQAMLDAAGAHLLRILGPNCIGLLAPHQGLNASFSHIDAQPGEVAFVSQSGALVT
FT                   AMLDWAQGRGIGFSYFVSLGEHADVDFGDMLDYLASDAKTRAILLYAESIESPRKFMSA
FT                   ARAAARNKPVIVVKAGRSALGQLAAASHTGALAGSDMVFEAAIARAGMLRVNTLQELFL
FT                   AAETLSRFRTNTSETITILTNGGGAGVMAADAAAFAEVELTQLSGSTRQKLDAVLPANW
FT                   SHGNPVDIIGDAPVSRYEQALQVLKDDPGSGAVLFIHAPTAIVPSADIARALVPLAQHQ
FT                   PGMPPRLMSCWLGDKAVQQARQLFQDADIASFDTPEQAISAFSMLQRYRRNQAELMEAP
FT                   PALLAELRPDTATIRALVLDALASGREMLTEPEAKAVLDACHIPVVPTRRIRATAAAAV
FT                   KAALTIGFPVVLKILSDDISHKSDVGGVALNLQDENDVRAAARTMLARVKRQQPNARIQ
FT                   GFTVQAMVRRPHAQELIVGSTIDPVFGPVILFGQGGTAVEVTADRAIALPPLNEPLARA
FT                   LVSRTRVARLLAGWRDTPAVDEAALHRVLVAVSQLLAEIPEIAELDINPLIVNFEGAMA
FT                   LDARIRLSAAAPAGASNFAIRPYPAQLEETVQWQGRDLFLRPIRPEDEALHMAFLQQLD
FT                   PEDVRMRVFYTRRNIERSELARLVQIDYAREMAFVAQATGPDGQLQTLGVARAMADPDN
FT                   VDAEFGVIVRSDLKGTGLGRLLMEKLVAYLRAQGTQRLVATVLDYNERMLKLARDMGFQ
FT                   EDPTSKNGEGTKGIFLPLT"
FT   sig_peptide     8487..8573
FT                   /locus_tag="Rfer_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.820) with cleavage site probability 0.429 at
FT                   residue 29"
FT   gene            complement(11152..11364)
FT                   /locus_tag="Rfer_0008"
FT   CDS_pept        complement(11152..11364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67770"
FT                   /db_xref="GOA:Q223I2"
FT                   /db_xref="InterPro:IPR021249"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I2"
FT                   /protein_id="ABD67770.1"
FT                   /translation="MFGYSEEQIAAFGLSFGVGGFMLYMLFIIGHLAWESKAGKFGTFV
FT                   IFLGLAFGMTGFVAKYLIQWAIGIK"
FT   gene            complement(11364..12215)
FT                   /locus_tag="Rfer_0009"
FT   CDS_pept        complement(11364..12215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0009"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67771"
FT                   /db_xref="GOA:Q223I1"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I1"
FT                   /protein_id="ABD67771.1"
FT                   /translation="MHLSTLPAASPVSAMPAVRCIPLTRPLHWLRLAWRDLVRCGWTSL
FT                   AHGLALALAGAVIVAITYNRFWLLAGAISGFLVVAPVLATSLYALSRALERGETADARV
FT                   VLKTWLNWQNNHFNKWGNDYWCLVQFGALLALAGTGWVLTSAALITLLAPLPINNPVDF
FT                   VQHVMLADRGFLFELWLVLGGVLAGPIFASTVITIPLLLDRRLGLLQAVLTSWRAVLAN
FT                   PLPMAFWGALIMALTLLGMATALMGLVLVMPLLGHASWHAYRDLVDASGLPPRDAPDQE
FT                   AS"
FT   gene            12308..12673
FT                   /locus_tag="Rfer_0010"
FT   CDS_pept        12308..12673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0010"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67772"
FT                   /db_xref="GOA:Q223J5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J5"
FT                   /protein_id="ABD67772.1"
FT                   /translation="MPRPILAESNIHPAIREKIATHEQGIVREVQAAVAKHAVVVVGMG
FT                   LNPFPKKARKALDAAGVAHHYLEYGNYFSNWRQRNALKLWTGWPTLPMVFVKGVLVGGA
FT                   DDLIKLIDNGELTKLLA"
FT   gene            complement(12743..13288)
FT                   /locus_tag="Rfer_0011"
FT   CDS_pept        complement(12743..13288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67773"
FT                   /db_xref="GOA:Q223J4"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J4"
FT                   /protein_id="ABD67773.1"
FT                   /translation="MKSFFKPVLIASLLATAGFAAFSQVPAAGQDCMMGQGAMYGGMHH
FT                   ERMGKFDPAKMQARMDQRSAALKAQLKLTPAQETAWTTFTAAMKPPAAMMANRPDYAEL
FT                   IKLPTPERIDKMKALHTQRMADMTAAMEQRGEATKAFYAVLTPEQQKVFDAGTARHFGS
FT                   VGRKGGHMGHMGVPAPKQ"
FT   sig_peptide     complement(13217..13288)
FT                   /locus_tag="Rfer_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.880 at
FT                   residue 24"
FT   gene            13460..14371
FT                   /locus_tag="Rfer_0012"
FT   CDS_pept        13460..14371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0012"
FT                   /product="putative exonuclease, RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67774"
FT                   /db_xref="GOA:Q223J3"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J3"
FT                   /protein_id="ABD67774.1"
FT                   /translation="MERVQVFKNIIVYRIGAGWSATVAQMEEGLEADRFVECGASQEKS
FT                   VGWVEPRGEAHGLLVEAVGGQLILKLMVESRALPGSVVTRKVKERVAQIEASTGRKPGK
FT                   KEIRDLKDDIRLELLPMAFTKQAAVLIWIDPQARWLVIDASSQARADEVVTLLVKSLTG
FT                   LAVTLLNTQVSPTAAMSEWLISQEPPAGFTVDRECELKAADESKAVVRYARHPLDNEEV
FT                   KQHVVGGKLPTRLALTWDSRVSFVLTEGLQLKKLTFLEVVFEGAAAGKDDGFDADTAIA
FT                   TGELRKLLPDLLQALGGEVALA"
FT   gene            complement(14571..15326)
FT                   /locus_tag="Rfer_0013"
FT   CDS_pept        complement(14571..15326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0013"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67775"
FT                   /db_xref="GOA:Q223J2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J2"
FT                   /protein_id="ABD67775.1"
FT                   /translation="MREPLYAQIARELAQGIASGKFPEGSLLSSEFDLCNQYQASRQTV
FT                   RAALRELMDLGLVSRRKGVGTRVEARTKAQGYDHSLGSLDDLVQLAMTNPRVVKRTNEV
FT                   VADRELAKAIGCAPGSRWLHIASIRQDSDKSAPPVCWTDTYVNTAYSDLSQLVRQDPTP
FT                   LISELIEKHYGRRSAEVHQTISAVTISPLLAEELQVEPGSPALRIVRRYIDRVGETIET
FT                   TISVHPAERYTFSMVLKRSSIGQDANLTT"
FT   gene            15516..16868
FT                   /locus_tag="Rfer_0014"
FT   CDS_pept        15516..16868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0014"
FT                   /product="fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67776"
FT                   /db_xref="GOA:Q223J1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J1"
FT                   /protein_id="ABD67776.1"
FT                   /translation="MASTVFDSILFRDAFGTPAMRAVFDDNELIRKYVQVEIALAKAEA
FT                   RCGVIPVAAAEEIAACCNGDTLDFDLLRHETEIVGYPILPLVHQISKQAGESGGYVHWG
FT                   ATTQDIMDTAVVLQLRDAFDLVEADIKTLRHTLAGLAKRYRDTPMAGRTHLQQALPITF
FT                   GYKVAIWLDMFDRHAERVAQARPRIMVGEFAGAAGTLASLGDKGLAVQKAMMEELGLGV
FT                   PVSTWHVARDGFAEAVNLLGLITGSLGKIAYDVMIMASNEFGELYEPFVKGRGASSTMP
FT                   QKRNPISSELMLACAKGVRQNAGLMLDAMVQDLERATGPWHAEWIAIPEAFILAAGALN
FT                   QAKFMLGGLIVDEKAMLKNLGMTNGLIVAEAVMMGLAPHIGRQDAHDVVYDACRVVNEQ
FT                   GGRLADALNAIPSVASRLQPELIERLTDPANYLGSASQMVDQVLASSARLG"
FT   gene            16906..18333
FT                   /locus_tag="Rfer_0015"
FT   CDS_pept        16906..18333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0015"
FT                   /product="anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67777"
FT                   /db_xref="GOA:Q223J0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J0"
FT                   /protein_id="ABD67777.1"
FT                   /translation="MSSNGTTSNRKQVIAAAVPIILGLAIWFTPAPQGLSLQAWHMFAI
FT                   FAATIAGILTQPLPSGAVMLIAICVTIFTKTLTEAKALSGFASGTVWLIFCAYILSLGF
FT                   VTSGLGKRIAYKMLSKFGGSSLGIAYSLGVSDLIMAPAMPSVTARSGGIIFPIVRSINE
FT                   VLGSGPGPSGKKIGDFLTMVCFQFTPITGAMFLTGMAANPLVGNLAKSALGVEVTWVGW
FT                   FTAAVVPGLVCFFLMPLLVYKILNPDLKRTPEAKEMGRRSLSELGPMTRTEKKVAFGFA
FT                   LALIGWGTSLMTGLGATTVGLGLAAYLFATNAVSWKDLLKDHAAWDTVIWFGAIISLAG
FT                   GLSDLGFIKWMTGALGSSLTGMGAMETFVILGLLYIYVHYLFATASGHVAALYAPFAAT
FT                   AIAAGAPPMMVAICFGIFSNLMWGNTEYGGGPGPIYFAQGYFERPRFYTINFFVVTFNV
FT                   ILTFMVGGVWWKVLGYY"
FT   gene            18731..19351
FT                   /locus_tag="Rfer_0016"
FT   CDS_pept        18731..19351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0016"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67778"
FT                   /db_xref="GOA:Q223I9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I9"
FT                   /protein_id="ABD67778.1"
FT                   /translation="MLIDQSGAKHHILDCGERLVASKGFVGVGLAEILSVAGVPKGSFY
FT                   HYFGSKERFGEELLVRYLGQYLSRLDTLLQADGTPARARLMRYWSYWNITQCGTAADGC
FT                   SEPQAGAKCLIVKLSAEVADISETMRLTLRDGTDRVVQRIAQCLEEARFDGSVPPTLVA
FT                   DATALTLYELWLGASLLAKLRRDGSPFEHALRSTELLLGSPRI"
FT   gene            19454..20614
FT                   /locus_tag="Rfer_0017"
FT   CDS_pept        19454..20614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0017"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67779"
FT                   /db_xref="GOA:Q223I8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I8"
FT                   /protein_id="ABD67779.1"
FT                   /translation="MLNFDFYNPTQIVFGKDRIADLAKLVPAEARVLILVGGASAEKTG
FT                   TLAEVRQALGTRQHETFSGIEPNPGFDTSMQAVQKVREGGFDFLLAVGGGSVIDAAKFI
FT                   AAAVPFEGDAWDILLQGGRNIKAALPFGAVLTLPATGSEMNNGSVITRRDIGAKLPFRS
FT                   RLLFPQFSVLDPTKTYTLPPQQLANGVVDAFVHTVEQYLTYPVNAPLQDRFAESLLQTL
FT                   VDIGPRLLAAPEPDYDDRASLMWAATLALNGLIGAGVPQDWATHMMGHELTALHNIDHA
FT                   RTLAIVLPAMLNERRVQKRAKLLQYGERVWGIRSGNDEERITAAIDQTRDFFERMGIPT
FT                   RLGAYGLGTEAIDAVIRQLEAHGMTQLGEHRDVTPAVSRRVLEAAL"
FT   gene            20653..21687
FT                   /locus_tag="Rfer_0018"
FT   CDS_pept        20653..21687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0018"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67780"
FT                   /db_xref="GOA:Q223I7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I7"
FT                   /protein_id="ABD67780.1"
FT                   /translation="MTQTTTLNRQVQLAARPVGTPTAADFHLATTAVPVAGPGQLLLRT
FT                   VYLSLDPYMRGRMSDAASYAASVAIGATMVGATVCRVQSSQHAGFAVGDWVLAYTGWQD
FT                   YALSDGTGLTKLDPGLARPSYALGVLGMPGFTAYMGLLDIGAPKAGETVVVAAATGAVG
FT                   SVVGQIAKLKGCRVVGIAGGADKCRSAVQELGFDACIDHHNPDLAALLAAACPKGIDVY
FT                   FENVGGKVFDAVLPLLNTAARVPVCGLIAQYNATALPEGPDRSPLLMRTLLTKRIRMQG
FT                   FIIFDDYGHRYPEFAKDMSQWLANGQIKFREDIVNGLENAPQAFIGLLEGKNFGKLIVR
FT                   VAND"
FT   gene            21742..22434
FT                   /locus_tag="Rfer_0019"
FT   CDS_pept        21742..22434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0019"
FT                   /product="ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67781"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q223I0"
FT                   /protein_id="ABD67781.1"
FT                   /translation="MKKILMVLTSHSQLGHTGAKTGFWLEEFAAPYYVFKDAGAAITLA
FT                   SPLGGQPPLDPKSDEAASQTDATRRFKADPAAQALLASTHPLRELSAADFDAVFYPGGH
FT                   GPLWDLAENYYSIALIEATLAAGKPVAAVCHASAALRHPKAADGLPVVHGKSVTGFTNT
FT                   EEAAVGLTQVVPFLVEDMLKANGGRYSKGADWQAFVVTDGLLITGQNPASSEPAAKALL
FT                   EKLSQVSS"
FT   gene            22508..23584
FT                   /locus_tag="Rfer_0020"
FT   CDS_pept        22508..23584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0020"
FT                   /product="protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67782"
FT                   /db_xref="GOA:Q223H9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H9"
FT                   /protein_id="ABD67782.1"
FT                   /translation="MNPSDNPVSASFKNQALLPLMVAVSIALGWILLPFYGTIMWGAII
FT                   ALLFTPVYRRLLARLKWRRTPAALLTLLLVLLLLVLPFALLTAALAREAAQVYQQLQSG
FT                   ELNPSLYFQGLFDALPDWLTALLDSFGLVNFAALQRRLIAALAQGSQFLATQAMGIGQI
FT                   TFEFVTSLFITLYLAFFLIRDGDSVARALRHAVPLAPEHKKELIGKFTTVIRATVKGNL
FT                   LVAVIQGALGGIAFWFLGVGGALLWAVLMAFLSLLPAVGAGLVWLPVAIYFFLTGATWQ
FT                   GIALCAWGVLVIGLIDNLLRPILVGKDTRMPDYVVMITTLGGMVVFGINGFVIGPAIAA
FT                   MFMAVWEIYVTTRIDPAP"
FT   gene            complement(23634..23831)
FT                   /locus_tag="Rfer_0021"
FT   CDS_pept        complement(23634..23831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67783"
FT                   /db_xref="GOA:Q223H8"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H8"
FT                   /protein_id="ABD67783.1"
FT                   /translation="MKTNEGGIDRILRIVAGLVLMGLTLTGTIGAWGWIGVVPLATGLI
FT                   GWCPLYTLLGINSCPMKSNS"
FT   gene            complement(23927..24616)
FT                   /locus_tag="Rfer_0022"
FT   CDS_pept        complement(23927..24616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0022"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67784"
FT                   /db_xref="GOA:Q223H7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H7"
FT                   /protein_id="ABD67784.1"
FT                   /translation="MLCQPQARAAANVMMATALRPTELYPALAQVQPSLAELGPGAAPM
FT                   SVPAGTVLFSENTPCQGFPLVLGGEIKVSRSSGDGRALELYRVVAGELCLVSSSCLFRS
FT                   QPLSAHGITTQASTLMLIAPDIFRRWLETPAFRNEVLGLFAERMADLTSLIDAVAFHKL
FT                   DRRLAAALLGHGQQRKVTHQMLADELGTVREIVTRLLRRFEREGWVTLGREQIQIVDGA
FT                   ALRALGN"
FT   gene            complement(24678..25397)
FT                   /locus_tag="Rfer_0023"
FT   CDS_pept        complement(24678..25397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0023"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67785"
FT                   /db_xref="GOA:Q223H6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H6"
FT                   /protein_id="ABD67785.1"
FT                   /translation="MDHLTFPRWQGSGYALDHLKEFFHEANIYSYRHDLRPLRKSRHPR
FT                   RETGRPASRGQHRPRSQQGRRAVRTAARVAGPSHCRRRLHRRRMKMTLPAPMEAATLEG
FT                   TLWPVAIGVAARLSNVSAKMVRHYESLGLLAPVTRTDSGYRQYNAADVRTLQFIKRGRD
FT                   LGFSMAEIAELVSLWRNRQRASASVKRIAQKHVNELAHRIEAMQAMQRTLTALLDHCQG
FT                   DERPDCPILDDLAGTCC"
FT   gene            25444..27717
FT                   /locus_tag="Rfer_0024"
FT   CDS_pept        25444..27717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0024"
FT                   /product="Heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67786"
FT                   /db_xref="GOA:Q223H5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H5"
FT                   /protein_id="ABD67786.1"
FT                   /translation="MNTAAAPAISPGSLDIGIGGMTCASCVGRVERALKKVPGVQSVAV
FT                   NLATESARIAYAPTEQMEARLRRAVRDAGYEPLAADATIDAPDASPWAGFMPVAIGLAL
FT                   SAPLVLPMLGNLAGWHWMLPAWLQFALATPVQFILGARFYKAGWHALKNLAGNMDLLVA
FT                   LGTTAGWLLSMWLWLNAAPGVMAHLYFEGSAVVITMVLLGKWLEARAKRQTTSAIRALH
FT                   GLRPATAHLISIDGEVDVPVAEVLVGDRLVVKPGERLPVDGLLQEGQTQVDESMLTGEP
FT                   LPIVKDPGAALTGGSINGDGRIVMQVKAVGSETVLAHIIRLVEDAQAAKAPIQRLVDQV
FT                   SAVFVPVVLGIALITLLGWWLSGHPFEVAVINAVTVLVIACPCALGLATPAAIMAGTGV
FT                   AAKYGILIKDAQALELAHKVDVVVFDKTGTLTVGQPRLTAFQAVAGGDEVTLLAAAASL
FT                   QSGSEHPLARAVVAVASERGLAIHPPITVRAVPGRGTEGELRATDGNEAAQPSYLIGSL
FT                   RWMDELGVDWRALAAPAATLQGSGATVSLLARRWVATAAQAERIEILALLAFADEPKPG
FT                   AQAAVAALRARSIKTVMISGDNQGAARAMARRLGFRPESDEVRAEVLPGDKAAQVLALK
FT                   NGGHTVAMVGDGVNDAPALTAADVGMAMANAGGGGSDVAMHAAGITLMRGDPGLVAAAL
FT                   DISDRTVAKIRQNLFWAFAYNVAGIPLAALGFLNPVVAGAAMAMSSVSVMSNALLLKRW
FT                   KPRK"
FT   gene            complement(27784..28506)
FT                   /locus_tag="Rfer_0025"
FT   CDS_pept        complement(27784..28506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67787"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H4"
FT                   /protein_id="ABD67787.1"
FT                   /translation="MTRPLNPNDPNVVMLELVARRLGADLCSRFAFVGGSIAGLLITDP
FT                   ANPPIRSTEDVDIVAEVLALSGYHGIEKALRERGFTQDMSADAPICRWQVEGVTVDVMP
FT                   TLEEILGFANRWYPLCVSTAESLELPSGVAIRVVQAPVFIGTKLEAFHGRGGGDYLFSH
FT                   DLGDIISVVDGRDSLLGECEQMPEELRGYLAEQFSALLADRRFLDALPGHLPGDVMNQS
FT                   RLPDLEAKIQQLATLSKI"
FT   gene            complement(28503..29048)
FT                   /locus_tag="Rfer_0026"
FT   CDS_pept        complement(28503..29048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67788"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H3"
FT                   /protein_id="ABD67788.1"
FT                   /translation="MYRSKSNPQIVLRPQDVVVLLRLSLQRGPAPTYAALAEELKLTAS
FT                   EIHAGVERAMAAQLLRKDAAGKPAVLLEPLRLFVLHGVRYCFPATRGEMTRGVPTSYAA
FT                   PPMLALIVQPNEAPPVWPHKAGTVRGAAFYPLYPTVPDAALANPALYELLVLVDAIRGG
FT                   SLRERALAIAELDKRWSA"
FT   gene            complement(29130..29516)
FT                   /locus_tag="Rfer_0027"
FT   CDS_pept        complement(29130..29516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0027"
FT                   /product="protein of unknown function DUF296"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67789"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H2"
FT                   /protein_id="ABD67789.1"
FT                   /translation="MKSLPPSPNPWPRLAPSALEAVIHSQNCHAAFVLSGIGSLSTAGL
FT                   RFAGADQPERLTGDIQILSLSGTVAFDGVKSSSHLHMALSTSTGQVPGGYIPAGCIVRT
FT                   TAEVLVLLLEWAFSREPDALTGFE"
FT   gene            complement(29673..32813)
FT                   /locus_tag="Rfer_0028"
FT   CDS_pept        complement(29673..32813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0028"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67790"
FT                   /db_xref="GOA:Q223H1"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H1"
FT                   /protein_id="ABD67790.1"
FT                   /translation="MVESDLEQLALTWFQDTGWDYRAGPDIAPDSDSPQRSDYRQMLLQ
FT                   GELREALSRLNPQVPAAVLDDVAHQLSKPDHPSLIQSNRAFHEALVGGVPVEVEVNGER
FT                   RGDRVVLVDFDTPERNRFLVVNQFTVQGSKQPRRPDLVCFINGLPIAVIELKNLAAEQV
FT                   GVQDAFHQLQTYKDELADLFVTNEALVASDGLHARIGSLTASFERFLPWRTVKNENDRP
FT                   LLEFELEKVVRGFFAPALLLDYLRYFVLFEMADGQVVKKIAAYHQFHAVRAAVKAAVIA
FT                   ATPPATNAAQEQWASYAERVKPGSRMGGIVWHTQGSGKSISMVCFAAKLMQQPEMHNPT
FT                   LVVVTDRNDLDGQLFQTFVGARSLLREQPQQAGSRDELRALLAGRPSGGIIFTTVQKFT
FT                   PDAGEEVFPLLSERNNIVVMADEAHRSQYGFRAVLDKKTGKYKYGFAKHLRDALKNATF
FT                   VGFTGTPIEAGDHDTRAVFGEYVSIYDIQDAVDDGATVPIFYESRLAKLNLNQVEMEKL
FT                   NADVEDVFEDEEDAALIEAEKTRWAALEKLVGAKERVDLVAADIVQHFEARNTAVAGKG
FT                   MVVAMSREICARLYAAIIKLRPDWHSDDPAQGAIKVVMTGSAADATLLQPHIYNSAAKK
FT                   LLERRFKDATDPLKLVIVRDMWLTGFDVPCLHTMYIDKPMRDHNLMQAIARVNRVFRDK
FT                   EGGLVVDYIGIAAELRKALRTYTESKGKGQPTLDATEALAKLQELMEVARHLLHGFDFS
FT                   AYRTQATTLLLPAANFVLGLDDGKKRWADVVLAITKAFSLCGTLDDAALLREEIAFFQA
FT                   IKAVIAKATTSDAKLSEEGRNAVLKQILDNAVVAEGVEDIFKLAGLERPDIGILSDAFL
FT                   EEVRQLPQRNFAVELLQKLLNDQVKSRMRTNVVMERKFSERLQAALNRYLSRAVESAQV
FT                   IEELIAMAKEFREAALRGNKLGLNTSELAFYDALTDNESAVREMDDEVLKKIAVEITEK
FT                   LRNSTSVDWQKRESVRARLRNLVRITLRRYKYPPDMQEEAIRLVLEQAERLSDAWTK"
FT   gene            complement(32826..33959)
FT                   /locus_tag="Rfer_0029"
FT   CDS_pept        complement(32826..33959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67791"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q223H0"
FT                   /protein_id="ABD67791.1"
FT                   /translation="MSEIDQNDRRMLETAIAILTDQYQENGEFNEHIDAEEPVVIGESE
FT                   YLRSSVLFWVDPEAYEVEKENWQRSESDAKHEKALELIRSNGVVGLVEDMLLAVERGRV
FT                   VPFVGAGLSKPLGMPLWGDALTQLLGRLPGADAPKIQALIASGQYLEAAQELAAYDKVQ
FT                   TSHFVKTTYRASQLKLKAGPLQHLPRFARGCIVTTNFDDAIEKTYEGATHQGKQLVFDA
FT                   YMHGTQENKFFSRLVRGDRCLLKLHGDAESEATHILTAEQYELAYGQPFDFQKSLPKAL
FT                   RQIYISQSLLFLGCGLEQDWTMELFKAARDSDGYQVPNHYAIVEAPVDVKVKQQKETRL
FT                   LDLNIQPIWYPNGEHQMVENVIDLVADVAEKRFVFKG"
FT   gene            complement(33956..35299)
FT                   /locus_tag="Rfer_0030"
FT   CDS_pept        complement(33956..35299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0030"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67792"
FT                   /db_xref="GOA:Q223G9"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G9"
FT                   /protein_id="ABD67792.1"
FT                   /translation="MSEWIETTVGEIAASSRNALVGGPFGSNLVSKDYVDQGVPVIRGQ
FT                   NMGGRWVAGDFACVSTEKAAALSANTARPGDIVFTQRGTLGQVALVPDSPYETYVVSQS
FT                   QMKLTVDPEKADSLFLYYLFSSPIQQEYIRQNSIQVGVPHTNLGILRDTPVVLPKSVDV
FT                   QKDIARQLGTLDDKIELNRRMNETLEAMARAIFQSWFVDFDPVRAKASGESADSICQRL
FT                   GLTPKLLALFPDSFEDSELGEIPSGWMIGSIGTLANVTGGSTPNTKEPKYWDDGVHCWA
FT                   TPKDLSRLSSPVLLETERKVSDDGLAQIGSGLLKPGAVLLSSRAPIGYRVINEVPVAVN
FT                   QGFIAMTPNSGVSKYFLLYWAEWAHDEIVSRANGSTFLEISKANFRPIPVVRPTDALFE
FT                   KFDQYVGPLYKRIVSNEQEKQLLVAQRDSLLPKLLSGEVMVAAEEEAS"
FT   gene            complement(35292..36422)
FT                   /locus_tag="Rfer_0031"
FT   CDS_pept        complement(35292..36422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0031"
FT                   /product="protein of unknown function DUF1016"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67793"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G8"
FT                   /protein_id="ABD67793.1"
FT                   /translation="MNTDTAFNFSSLVESIRQADTALAEQASRAVNISLTLRNWFIGYY
FT                   IAEFELQGADRANYGDKLLTELAKALRGQAISNSGRRQLYGYLAFYRAYPQIVRTASAL
FT                   SAQVVPHPLLEQKVRTLSAPSSSIAGTDPETLIARLSYSHMEKLVELGDPLQRAFYEGE
FT                   ALRGNWSVRELKRQIATQYYQRTGLSTDKAAIAALAHGTAEQAKSSQIIRDPYVFEFLG
FT                   LKPQEVMSEGHLEDALLDKLQTFLLELGHGFCFEARQKRLLIGGEHFFVDLVFYHRVLK
FT                   CHVLIELKNDAFKHENLGQLNSYVSYYKQHHMTEGDQPPIGILLCTRKNAELVQYALAD
FT                   MSNQLFVSRYQVQLPGKAEMAAFLHKAVEELGGGDE"
FT   gene            complement(36476..38110)
FT                   /locus_tag="Rfer_0032"
FT   CDS_pept        complement(36476..38110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0032"
FT                   /product="N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67794"
FT                   /db_xref="GOA:Q223G7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G7"
FT                   /protein_id="ABD67794.1"
FT                   /translation="MNDEEQQYLNNLDKQLWAAADRLRAAVNPSEYMHVVLGLVFLKYI
FT                   SDAFKERRLELQAAFQDPANDYYLGTDADELIAQELEARDYYTETNVFWVPALARWDFL
FT                   KDNAKVAIDTVLTVKNGKTFEYKFKGIGRLLDDALEAVEKDNPKLKGVLDKSYARWRVD
FT                   EALPGLIDEFSKIPFNHGALKAKDILGHIYEYFLGEFSIAAGKRGGEFYTPKSIVSVIV
FT                   EMLEPFEGRVYDPCCGSGGFFVQSERFVLEHGGKIGQLSIYGQEFNPTTWRLASMNMAI
FT                   RGLDFDFGKEPASTYTRPQHPDLRADFIMANPPFNMKAWKEGVKDDDPRWKYGVPPDGN
FT                   ANFAWMQHMIHHLAPHGSMALLLANGSMSSNTNNEGEIRKALIEADLVECMVALPGQLF
FT                   TNTQIPACIWFLTRSKAERKAKRSRHGEVLFIDARQLGYMKDRVLRDFKPEDLAKVADT
FT                   FHAWQRGVGYADEAGFCKAATLADIGKADYVLTPGRYVGAAAQEADAEPFEDKMARLTA
FT                   ALGDQFKESARLEAAIRKNLAGLGYEV"
FT   gene            complement(38073..38348)
FT                   /locus_tag="Rfer_0033"
FT   CDS_pept        complement(38073..38348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67795"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G6"
FT                   /protein_id="ABD67795.1"
FT                   /translation="MSPEQKARVSIDALLQQAGWHVCHMADANIHAARGVALREFPLNT
FT                   GYGFADYLLYIDDKAAGSSQIASRPRSKRQSHQKYERRRTTISQQP"
FT   gene            complement(38578..38838)
FT                   /locus_tag="Rfer_0034"
FT   CDS_pept        complement(38578..38838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0034"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67796"
FT                   /db_xref="GOA:Q223G5"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223G5"
FT                   /protein_id="ABD67796.1"
FT                   /translation="MSFFSFFVGEKKKSASVAKERLQIILAHERSGRNAAEPDYLPALQ
FT                   RELMAVISKYVKINLEDIKVNVERQDDLEVLEVKIELPDSR"
FT   gene            complement(38843..39658)
FT                   /locus_tag="Rfer_0035"
FT   CDS_pept        complement(38843..39658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0035"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67797"
FT                   /db_xref="GOA:Q223L0"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L0"
FT                   /protein_id="ABD67797.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTTSASFATGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIHGEANLNQALIKDKQCDHLYVLAASQTRDKDALTQDGVEK
FT                   VLSDLTAMDFEFIVCDSPAGIETGALMAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TRRGMEGLEPVKEHLLITRYNPARVDQGQMLSLEDIQDILRIKLIGVIPESEAVLQASN
FT                   QGVPAVHMKGSDVSEAYKDVIDRFLGEERPMRFTDAPKQGFLKRLFGGK"
FT   gene            complement(39734..40519)
FT                   /locus_tag="Rfer_0036"
FT   CDS_pept        complement(39734..40519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0036"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67798"
FT                   /db_xref="GOA:Q223K9"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K9"
FT                   /protein_id="ABD67798.1"
FT                   /translation="MSVSSAANPPSSVPASFEIKSAQLPLVALLLKTPDWDLLASDLLK
FT                   QFGPQGESPDFFDNDPLVLDFSSLPPDSPVQDLKPLLQTLRACRLLAVAARGAGAVWMQ
FT                   AALALGLVEAPLDLPRVRPARAEPVRQAAAVEPVREAARKVPGPATLVIDKPLRSGQKV
FT                   YARGGDLVVLAMVNQGAEVVADGNIHVYAPLRGKAMAGASGNTQARIFSLCLEPELISI
FT                   AGVYRTSENPLAPDIHGKPAQVRLSNDGQDKLLFEALNT"
FT   gene            complement(41353..42753)
FT                   /locus_tag="Rfer_0037"
FT   CDS_pept        complement(41353..42753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0037"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67799"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K8"
FT                   /protein_id="ABD67799.1"
FT                   /translation="MTVFIAIAVLLTLLVMAWIVRPLLRPAPAAGVSSERLNASIYRDQ
FT                   LDTLERDLARGVISPADCEATRDELQLRLLDDTEEPAPIQHTSGTSIWTGRLTAALIVV
FT                   LMPLGSAGMYWLLGTPAAIDPAASQKANEDQAMKMVNSLAARLQANPDNPQGWAMLARS
FT                   YKVMGRFDEAEQAFKKAGDLVNTNPDLMVDYADLLAVRANNNIEGKSLELVNKALSIDP
FT                   QHPMGLMMAGVAAYRRSDFKGAVNRWETLLTLLEPGSPDAQQVETDIADARAKAGLPAA
FT                   QKVTAPPVTPAAGPGAEAGKLPPVDPAAAAAMTPEMINQMVDRLAARQKANPDDLPGWV
FT                   RLAHAYKVQGRLADAEQAYAKASKLVDSDPDLLTQYADVLATRADNKIEGRPLALVNKA
FT                   LALNPKHPTALMMAGTAAYRRADYAQAVAHWEKVLSVLPPGSSDATQVQAEIADARAKG
FT                   GLGLLAKP"
FT   sig_peptide     complement(42700..42753)
FT                   /locus_tag="Rfer_0037"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.836) with cleavage site probability 0.798 at
FT                   residue 18"
FT   gene            complement(42750..43217)
FT                   /locus_tag="Rfer_0038"
FT   CDS_pept        complement(42750..43217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0038"
FT                   /product="cytochrome C biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67800"
FT                   /db_xref="GOA:Q223K7"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K7"
FT                   /protein_id="ABD67800.1"
FT                   /translation="MKYWLALVLALQCALSSYAGEATPLAEDPVVEQRMIAISEELRCL
FT                   VCQNESLAGSRADLAQDLRRELRELIKANKTDAEIMEYMVSRYGDFVRYRPAVKPITWL
FT                   LWFGPFLLLIGAIVMLVRMVRRNQRSAESPVLDAAQRKKAQSLLKDSETPS"
FT   sig_peptide     complement(43158..43217)
FT                   /locus_tag="Rfer_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            complement(43214..43738)
FT                   /locus_tag="Rfer_0039"
FT   CDS_pept        complement(43214..43738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0039"
FT                   /product="periplasmic protein thiol"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67801"
FT                   /db_xref="GOA:Q223K6"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K6"
FT                   /protein_id="ABD67801.1"
FT                   /translation="MKKKLIPLGIFAVLVVFLAIGLTRDPHEIPSPLIGKAAPMFNAPL
FT                   LQTPEQQFSAKDMLGQVWLLNTWASWCVACRQEHPILMEFAKTKTLPIVGLDYKDQNPE
FT                   GLKWLARFGNPYDHAITDKDGRIGIDFGVYGVPESFLIDKAGVIRYKQIGPVTEEALRD
FT                   KIVPLIRELQK"
FT   sig_peptide     complement(43673..43738)
FT                   /locus_tag="Rfer_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.628 at
FT                   residue 22"
FT   gene            complement(43735..45708)
FT                   /locus_tag="Rfer_0040"
FT   CDS_pept        complement(43735..45708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0040"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67802"
FT                   /db_xref="GOA:Q223K5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K5"
FT                   /protein_id="ABD67802.1"
FT                   /translation="MIPEIGHFSLILALFVALALGTLSVVGGQQGRADWMAMARPGAQA
FT                   LWLLTALSFGCLTYAFFTNDFSVSYVAQHSNTKLPDIYRIAGVWGGHEGSLLLWLMMLC
FT                   TWMMAVSLFSRQLPEVMVSRVLGVLALVAVGFLLFMLITSNPFLRLSDIPADGRDLNPL
FT                   LQDPGLVFHPPMLYMGYVGMSVPFAFAIAALLNGRLDAAWARWSRPWATAAWICLTIGI
FT                   AMGSWWAYYELGWGGWWFWDPVENASFLPWLVGTALIHSLAVTEKRGLFRNWTIILAIT
FT                   AFSLSLLGTFLVRSGVLTSVHAFATDPKRGVFILLFLSVVVGGSLTLFAMRASKVRAGG
FT                   AFALVSRETFLLVNNVLLTTAAAAVLLGTLYPLIVDALNLGKLSVGPPYFNSVFAPIML
FT                   PVLFFMVLGSFARWKNDSVAELTKKLRPVAILSVLLGCSAPFLAGEWSPLVALSLTLVF
FT                   WIVLASIQQIYRQLKDTVNWRSTPISFWGMHVAHIGIAVFVVGVTMVKAYENEKDVRMV
FT                   VGDTVEVADYTFRLTGIREVPGPNYTADQGDVEVLRGGKLLKTLHPEKRTYFSSTMPMT
FT                   ETAIDSNLLRDVYVSLGERLEGGDKPAWAMRVYHKPFIVWIWLGSLMMALGGGMAALDR
FT                   RYRRKVTASAGAVNPKIKGVAA"
FT   sig_peptide     complement(45625..45708)
FT                   /locus_tag="Rfer_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.905 at
FT                   residue 28"
FT   gene            complement(45719..46162)
FT                   /locus_tag="Rfer_0041"
FT   CDS_pept        complement(45719..46162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0041"
FT                   /product="CcmE/CycJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67803"
FT                   /db_xref="GOA:Q223K4"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223K4"
FT                   /protein_id="ABD67803.1"
FT                   /translation="MKPRHKRAAIIAGGLAALGIAAYLVLNAFQSNLVFFFSPTQVFAG
FT                   EAPKNRAFRIGGLVKEGTVKRDNLTVAFVVTDTAKEVPVSYTGILPDLFKEGKGVVAQG
FT                   KLDENGHFTATEVLAKHDENYMPPEAKAALDQAQIQKTIKSLK"
FT   sig_peptide     complement(46028..46162)
FT                   /locus_tag="Rfer_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.507 at
FT                   residue 45"
FT   gene            complement(46159..46338)
FT                   /locus_tag="Rfer_0042"
FT   CDS_pept        complement(46159..46338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0042"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67804"
FT                   /db_xref="GOA:Q223K3"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K3"
FT                   /protein_id="ABD67804.1"
FT                   /translation="MQWNSVSEFFAMGGYAFYVWGSFGVTAAVMGIETLVIRRQRQELL
FT                   RNLRNELLSEGASS"
FT   gene            complement(46325..47065)
FT                   /locus_tag="Rfer_0043"
FT   CDS_pept        complement(46325..47065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0043"
FT                   /product="heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67805"
FT                   /db_xref="GOA:Q223K2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K2"
FT                   /protein_id="ABD67805.1"
FT                   /translation="MNTRVIHWFKFASPQNFYVLAGRMQPWFTALAIVLMAVGLWISFF
FT                   VAPTDAQQGEGYRIIFVHVPASQMSMFIYLVMAAWAGFGLAFNTRLSGMMASALAPTGA
FT                   LFAFLSLITGSLWGKPMWGAWWVWDARLTSELILLFLYLGFLALQSSIDDPRRADKACA
FT                   VLALVGVVNVPIIYFSVKWWNTLHQGASVSLTRSPTMASTMLAGMLIMVVAFWMYTIAT
FT                   TLARVRNIILDRERHTEWVKNAVE"
FT   sig_peptide     complement(46910..47065)
FT                   /locus_tag="Rfer_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.806) with cleavage site probability 0.785 at
FT                   residue 52"
FT   gene            complement(47062..47745)
FT                   /locus_tag="Rfer_0044"
FT   CDS_pept        complement(47062..47745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0044"
FT                   /product="heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67806"
FT                   /db_xref="GOA:Q21QM0"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q21QM0"
FT                   /protein_id="ABD67806.1"
FT                   /translation="MKKLGLGSVLLAVLRREVSLALRQKGEVLTPLVFFVVIASLFPLG
FT                   VGPESALLLRMAPGVLWVSALLAAMLSLQRLFATDYADGSLEQMALSSTPLGLLVLAKA
FT                   LSHFLLSGLPLVLMAPVLGLQFGLDGRALGILMLTLLLGTPTLSLIGSIGAALTLGVRG
FT                   AGVLLSLLILPLYIPVLIFGAGAVEADAAGLGMGGHLSLLAALLVLSIFFAPLATTTAL
FT                   RISLE"
FT   gene            complement(47742..48374)
FT                   /locus_tag="Rfer_0045"
FT   CDS_pept        complement(47742..48374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0045"
FT                   /product="heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67807"
FT                   /db_xref="GOA:Q21QL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21QL9"
FT                   /protein_id="ABD67807.1"
FT                   /translation="MKTVPTLSFSKLGCSRGGRQLFQNIDCVLESGHWLYVAGANGVGK
FT                   TSLLRMVCGLAPIESGEIFWNGTPIHAQADAYRQDLCYLGHLNALQESMTVHENLAFTA
FT                   ALGGMAPDMAQTQSVLAHFGVAGRDRQLVRHLSQGQKRRVALSRLALSQARLWVLDEPF
FT                   VAMDEAGVRMLADLIAAHLTQGGLAVLTSHQQVDIGAIPAQLLELRA"
FT   gene            48665..49135
FT                   /locus_tag="Rfer_0046"
FT   CDS_pept        48665..49135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0046"
FT                   /product="cytochrome c family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67808"
FT                   /db_xref="UniProtKB/TrEMBL:Q21QL8"
FT                   /protein_id="ABD67808.1"
FT                   /translation="MKFKVLGILACATMALPALAADVTYRADVQPILKAQCDDCHGAEA
FT                   PTLKEFDLAKEKYTKEKSGPRLSTYETLLQLIAYPDSGAFMRRLDDGSGSADKKPGNMY
FT                   KHLGETDGQRAANLKVIKAWVGEGGWNPNRWTARGDVPAITKEQLDKLQLKY"
FT   sig_peptide     48665..48727
FT                   /locus_tag="Rfer_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(49239..49847)
FT                   /locus_tag="Rfer_0047"
FT   CDS_pept        complement(49239..49847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0047"
FT                   /product="glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67809"
FT                   /db_xref="GOA:Q21QL7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q21QL7"
FT                   /protein_id="ABD67809.1"
FT                   /translation="MKLYYSPGACSLSPHIALQEAGLAFEAIRAPTKTHQLADGTDYYT
FT                   INPLGYVPLLALDDGTQLREGPAIVQYIADQVPAKQLAPANGTFARYKLQEWLNFIGTE
FT                   LHKGFSPLFTPGMPEEAKTIAKTRLNSRLQWVDGELAKTPYLMGDTFTVADGYLFVVAG
FT                   WTKHVGIDISALANLGAFMSRVGERPAVQAALRAEGLLK"
FT   gene            complement(50035..51486)
FT                   /locus_tag="Rfer_0048"
FT   CDS_pept        complement(50035..51486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0048"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67810"
FT                   /db_xref="GOA:Q21QL6"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q21QL6"
FT                   /protein_id="ABD67810.1"
FT                   /translation="MNTNPLYRAAPPTDLNPLDNGLEATLKLQRAAYFAHPYPSFSERK
FT                   ADLLQLKALIRDNRDAIVAAISADYGNRSRHETLFAEIFSVMDGVDHTLKHLKQWMKPQ
FT                   RRGVDWKNFFGASNRVIPQPLGIVGAIVPWNFPINLSFSGLIATFAAGNRSMVKMSENS
FT                   RHLAKLLIEKCPAYFPREKLAFFDETGGVGIEFSKLKFDHLLFTGSGLTGRAVMAAAAP
FT                   NLCPVTLEMGGKSPAIICDDYPLRKAAERLLFVKCFNAGQICTTVDHAYIPTAKVNEFA
FT                   AMAKEIVSMRYPTLDTPDYTSMIDERSFNRVVAALEEAQERGATLVQLIPGKQWDSASR
FT                   KIAPHIVLNAPPDCALRTREIFGPVLPIIAYTSMEEPIQAINAGPRPLALYPFSNDKPL
FT                   VEHLLRHVISGGVSVNDGLFHVGQHDLPFGGVGDSGMGHYHGHDGFVTFSKMRPVFYQA
FT                   PFSAIKFLWPPYGKFATRYLDFLTR"
FT   gene            51689..53728
FT                   /locus_tag="Rfer_0049"
FT   CDS_pept        51689..53728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0049"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67811"
FT                   /db_xref="GOA:Q21QL5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21QL5"
FT                   /protein_id="ABD67811.1"
FT                   /translation="MLYPQHFDVIVVGGGHAGTEAALAAARMGCKTLLLSHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRLLY
FT                   KAAIRRRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQAGIKFRAKTVVLTAGTFLDGKI
FT                   HVGLNNYAAGRAGDPPAVRLSARLKELKLPQGRLKTGTPPRLDGRSIDFSKCGEQPGDG
FT                   MPGGMSPVMPVFSFMGRVEQHPPQMSCWTTHTNERTHEIIRSGFDRSPMFTGKIEGVGP
FT                   RYCPSVEDKINRFADKDSHQIFLEPEGLTTNEYYPNGISTSLPFDIQYALVRSMAGLEN
FT                   AHILRPGYAIEYDYFDPQQLKSSFETRAIGGLFFAGQINGTTGYEEAAAQGLFAGVNAA
FT                   LQAGAQTSWQQETWVPGRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADM
FT                   RLTETGRRLGLVDDARWEAFSRKREAVSRETERLRSLWVSPKNLTATESERVLGKSIEH
FT                   EYSLADLLRRPDVNYANLMSLEGGKYASAELNIPVSRETPAVPLPEAVFAAVVIEQVEI
FT                   VAKYAGYIDRQIEEVGRAAHYENLKLPLELDYLQVSALSFEARQKLSKHRPETLGQASR
FT                   LSGITPAAISLLLVHLKKSNFKGFAAAGKVTAPSESGDVQQGVI"
FT   gene            53728..54402
FT                   /locus_tag="Rfer_0050"
FT   CDS_pept        53728..54402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0050"
FT                   /product="methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67812"
FT                   /db_xref="GOA:Q21QL4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21QL4"
FT                   /protein_id="ABD67812.1"
FT                   /translation="MRELEQALRGGLADLALVLEDRQIALLLDYLALIQKWTQVYNLTA
FT                   VREPAEMLTHHLLDSLAVIQPLRRQLAGLRDQTPDTDTANVRLLDVGSGAGLPGVVIAI
FT                   CCPEITVDCVDTVAKKVAFIRQVAATLKLANLHGLHARVESLTGPYRVICSRAFASLAD
FT                   FTRLSSAALAPQGLWLAMKAKDPAEEVAALPATVKVFHVEHLVVPGLGADRCIVWMRQS
FT                   AV"
FT   gene            54656..55441
FT                   /locus_tag="Rfer_0051"
FT   CDS_pept        54656..55441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0051"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67813"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21QL3"
FT                   /protein_id="ABD67813.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTTVNLAAGLAKVGQRVLMVDLDPQGNA
FT                   TMGSGVDKRQLELTIYDVLLEAASVAEARVKSDRLIEAGCGYDILGANRELTGAEVEMV
FT                   AMERRERRLKEALTEVEKDYDFILIDCPPSLSMLTLNGLCCAHGVIVPMQCEYFALEGL
FT                   TDLVNTIKQVHANLNKDLAIIGLLRVMFDPRITLQQQVSEQLKAHFADKVFNTVIPRNV
FT                   RLAEAPSYGVPGVVFDPLAKGAQAYVAFAQEMVARIETL"
FT   gene            55517..56152
FT                   /locus_tag="Rfer_0052"
FT   CDS_pept        55517..56152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0052"
FT                   /product="protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67814"
FT                   /db_xref="GOA:Q223L6"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L6"
FT                   /protein_id="ABD67814.1"
FT                   /translation="MMTHDLPTPQVLLLPGWQNAGPAHWLSRWQAAHGYRRVEQHDWLR
FT                   PLRGDWLMQLEEAVLRSKSAPGPGLTLVAHGLGCLLVAAWATHSRHTHLVKAALLVAPT
FT                   DVEREALRALLASWSPIPWQPLPFSSMLLGSRDDPDCSFERAQAFAHAWGAEFIDGGPH
FT                   GQINAESGLGDWPQGHALLQLVEGRTQGLSQVKTGESSAGLTVCAAHY"
FT   gene            56171..57112
FT                   /locus_tag="Rfer_0053"
FT   CDS_pept        56171..57112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0053"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67815"
FT                   /db_xref="GOA:Q223L5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L5"
FT                   /protein_id="ABD67815.1"
FT                   /translation="MVTKKPKGLGRGLDALLGPKVAESAALDGSVPGAGNAGLPTTLLL
FT                   IDLVPGQYQPRTRMDEGALYELAESIKAQGIMQPILVRQLLDGVSQGKYEIIAGERRFR
FT                   AAKLAGLDSVPVLVRDVANEDAAAMALIENIQREDLNPLEEAQGLQRLVKEFGHTHEQA
FT                   AQAVGRSRSAASNLLRLLNLADPVQTMLMAGDLDMGHARALLVLDRATQITAATQISAR
FT                   SLSVREAERLAKKLSADFSLTSVRPKPEKSRDMKRVEEELSDLLTAAVEVRVKKRVKRA
FT                   GRLEEMGELSIQFGSLDELNGLIDKLRRAATR"
FT   gene            57198..57941
FT                   /locus_tag="Rfer_0054"
FT   CDS_pept        57198..57941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0054"
FT                   /product="Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67816"
FT                   /db_xref="GOA:Q223L4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L4"
FT                   /protein_id="ABD67816.1"
FT                   /translation="MLVHLRWPLPALLTWGAAWASFWGLQRLGLSAWVALAVAAALGVV
FT                   LSGWAASWWRRAIIGLGFPVSLALSGSASLPAWAWLLPLALLLLIYPLNAWRDAPLFPT
FT                   PEHALRDLAGQAPLPAGALVLDAGCGLGAGLRALREAYPAAQLHGLEWSWPLRALCALR
FT                   CPWARVRQGDIWRADWAPYTLVYLFQRPESMARAVAKARAQLKPGAWLVSLEFEASALV
FT                   PQAVLSAPDGRPVWLYRMPLQARQP"
FT   gene            58043..58789
FT                   /locus_tag="Rfer_0055"
FT   CDS_pept        58043..58789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0055"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67817"
FT                   /db_xref="GOA:Q223L3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L3"
FT                   /protein_id="ABD67817.1"
FT                   /translation="MTRPDPSPPPAADPMYAAMAVAAFAIVTLAGTRSSDTGQHILRVQ
FT                   QYVQALVQRLKEHPRFAAALTESYCRVLFQSALLHDMGTIGIPDRILLKPAALTPAEYE
FT                   IIKSHTTLARDAIEQAELTLGYQAPLLQTVKELAYSHHEKWDGSGYPQGLSEENIPLSA
FT                   RLMAIADVYDALISERVYRAGLPHDQAVGIIFQGRASHFDPDMVDVFIEIQDEFRAIAL
FT                   RFADTGQDMQRKMAYMANAIAEEVQL"
FT   gene            58963..60168
FT                   /locus_tag="Rfer_0056"
FT   CDS_pept        58963..60168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0056"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67818"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L2"
FT                   /protein_id="ABD67818.1"
FT                   /translation="MKLSRNSKLALGGVLVAGLAACGGGGGSASTDNGSLRLALTDAPA
FT                   CGYDAVNVTIQKVRVHQSGSASDTDSGWSEIVMNPALRVDLLKLQNGDLAELGEVTLPA
FT                   GSYNQMRLVLAENSTNPTAVLANSVVLTSDPTKTELALKTPSGQQSGVKAKQFNITIAP
FT                   NQLANFVIDFDACKSVVVAGNSGQYLLKPQLSVLARFISGVTGFVDTATLANGNTSVSL
FT                   QQGGVVIKATAPDNFGKFMLQPVAPGNYSLVLTAPGRTTAVVTNVAVAADTVTSVNTSG
FT                   TALNPAVSTSATVTGTAPVDTLVRVLQPLPSTLAGGAVTTVEIAGRFVDGATGLYTYPL
FT                   VVNAPLVAPYVAAPGALVFTADLAAAGKYTLNASLTGFADKTTVLPTLASGATVTTNFT
FT                   FP"
FT   sig_peptide     58963..59052
FT                   /locus_tag="Rfer_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.480 at
FT                   residue 30"
FT   gene            60184..60690
FT                   /locus_tag="Rfer_0057"
FT   CDS_pept        60184..60690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67819"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L1"
FT                   /protein_id="ABD67819.1"
FT                   /translation="MVKITQVTTGRAPAFLLAGLLVTAGAMAAKPDWVAGGKPGKSGQH
FT                   QQTQVQERQDSPSQGRPDRAAGHFGDDQRAVIRNYYSEQYRVGRCPPGLAKKNNGCMPP
FT                   GQARKWALGQPLPRDVVVYSLPPAIVVQLGVAPAGHRYVRVASDILLIAIGTGLVVDAI
FT                   QDLGR"
FT   sig_peptide     60184..60270
FT                   /locus_tag="Rfer_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(60804..61241)
FT                   /locus_tag="Rfer_0058"
FT   CDS_pept        complement(60804..61241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0058"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67820"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M4"
FT                   /protein_id="ABD67820.1"
FT                   /translation="MYSTIRQRTLLGCAALITGFVIWSAQGAAPNTLIALGDQQWAAGQ
FT                   LELAQKTFEHAVKAEPRSVDAHMKLAGLQLSRQEFKACIETYQRAIGLDANNARAWLGL
FT                   GFAYLHTGQNDLSLAALDEAIRIDPGNQEKLAPVLAKLGTP"
FT   sig_peptide     complement(61158..61241)
FT                   /locus_tag="Rfer_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.732 at
FT                   residue 28"
FT   gene            complement(61322..62839)
FT                   /locus_tag="Rfer_0059"
FT   CDS_pept        complement(61322..62839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67821"
FT                   /db_xref="GOA:Q223N2"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q223N2"
FT                   /protein_id="ABD67821.1"
FT                   /translation="MRRIGRFAAPMGWAIACLLSLSLAVPAFAVNQTAAKKVGADQMIK
FT                   KSPADAAIGKKCISCHGAEDDPGIYGEWKKSSHAAKNVDCYDCHKAKQGEKAAFAHHGA
FT                   SIQVIVTPNTCANCHAAEVAQQQRSHHAKAGNILASLDNLLGEVIGGPAAVNAGCLQCH
FT                   GSTVVLDDKGRPTPQTWPNTGIGRINPDGSLGSCSACHARHSFSSAQARTPDTCGKCHL
FT                   GPDHPQLEIYNESKHGILYRAKIKEMNLDSKKWVVGADYTAAPTCATCHMSATREQKVT
FT                   HDVGERISWTLRPAISTKLNMIRLSTGDEFDQPEGQPLPKVGDEVKGAKVTEILTWTQR
FT                   RDKMKDVCVACHSANTVAGQYKQFDDLVELYNDKYAKPIAAVMKELEDKGYLTHQPMDA
FT                   KIKWTWFEIWHHEGRRARHGAAMNGPDYTWWHGIYEVSQHTYFKWIPELKEVVRQKDGN
FT                   EDFANALLDKHFKPIAGHDWFFNGMGKDAIEKVRKGYDERYGKGALK"
FT   sig_peptide     complement(62750..62839)
FT                   /locus_tag="Rfer_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 30"
FT   gene            complement(62970..63674)
FT                   /locus_tag="Rfer_0060"
FT   CDS_pept        complement(62970..63674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0060"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67822"
FT                   /db_xref="GOA:Q223N1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q223N1"
FT                   /protein_id="ABD67822.1"
FT                   /translation="MNPEPFDIQRLLSALPLFSDLSQLERERIARGCRLVRLARGEMFF
FT                   RVGEACEAFHVVVSGQIKLYVSSPAGQEKVIEIIGPGRSFAEALVFLGQPHIVNAQSLT
FT                   DTLLVSVAKAAVLAEVERDPRFSLHMLAGISRRLHSLIHDVEGYALQSGMQRLIGYLLR
FT                   DVEAAVGHGSGNVSVSVHLPASKATIASRLSLTPEYFSRVLHELETQGLIQIDKREIRI
FT                   LDVHRLANFESH"
FT   gene            complement(63721..64143)
FT                   /locus_tag="Rfer_0061"
FT   CDS_pept        complement(63721..64143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0061"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67823"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q223N0"
FT                   /protein_id="ABD67823.1"
FT                   /translation="MLIWKRPISVAELTAISVNTAVDHLGMEFLEVGEDFIRARVPVDH
FT                   RTQQPYGLLHGGVSVVLAETLGSCGAAYASPAGQLAVGLDINANHLKGVTSGWVTGTAR
FT                   PVHIGRTTQVWQIDLQNDAGELTCVSRITMAVLPPR"
FT   gene            complement(64247..65950)
FT                   /locus_tag="Rfer_0062"
FT   CDS_pept        complement(64247..65950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0062"
FT                   /product="acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67824"
FT                   /db_xref="GOA:Q223M9"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M9"
FT                   /protein_id="ABD67824.1"
FT                   /translation="MLLLNPRHLVRNYPDQRSREIMEKTVAFFEKTGLTKLKADFHGAV
FT                   WYEDFLNFCKEEGIFASMMTPAEHGKEGEHAVWDTWRVCGFAEILGFYGLPYWYAYQVS
FT                   VLGIGPIWMSKNKKAQAKAKRLLDEGGIFAFGLSEKEHGADIYSSDMIVTQLEDGSYRA
FT                   CGGKYYIGNANQARMVSTFGKMADTGEYIYFVADSQHPKYELVKNVVYSQNYVAEFRLH
FT                   DYPLTEEDILHHGDDAWNAALNTVNVGKYNLGWASIGICTHAFYEAFDHAANRHLYKLT
FT                   VTDFPHVRQLFTDAYARLVAMKLFALRAADYMKAASNEDRRYLLFNPIQKMKVTTQGEE
FT                   VINLLWDVIAAKGFEKDMYFAMAAVEIRGLPKLEGTVHVNMALIIKFMANYFFAPAEYP
FT                   EVPRRDEGSNDSFLFDQGPTKGLGKIKFHDYHIAYDSVDSPNLSVFKAQIETFKQMAML
FT                   APPTPAQAKDIDFLLTVGEMFTLVVYGQLVLENARIYKIEPELLDQVFDFMVRDFSKFA
FT                   LQMYSKPSSTEGQMAQCLKMIRKPVTDDVRYARVWSEHVSKMQGQYKMPD"
FT   gene            66180..66437
FT                   /locus_tag="Rfer_0063"
FT   CDS_pept        66180..66437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0063"
FT                   /product="FeoA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67825"
FT                   /db_xref="GOA:Q223M8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M8"
FT                   /protein_id="ABD67825.1"
FT                   /translation="MLLSQLSNGAHAVVQRVLPSSADVGAATLRRLGELGFIAGEPVQV
FT                   LRRGPGGREPLAVQVGETLFALRLLEAQCIEVQAMDVCVN"
FT   gene            66445..68331
FT                   /locus_tag="Rfer_0064"
FT   CDS_pept        66445..68331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0064"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67826"
FT                   /db_xref="GOA:Q223M7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M7"
FT                   /protein_id="ABD67826.1"
FT                   /translation="MSQSLGVEPTLPIRCIALVGNPNCGKTALFNLLTGARQKVANYAG
FT                   VTVERKVGLVHLHNGQTVSVVDLPGAYSLTAATPDEQVTLEVIEGRRAGEDTPDAIVAV
FT                   VDATNLRMNLRLVLELKRLGRPLLVAVNMADVARAQGLKIDLARLAIELGLPVVETVAI
FT                   KHNGHAQLLAQLEQHLAQPWPSAPASTASASSADLQREVRRILALVAPLAPTLGRFQYR
FT                   LDAVVMHPVWGLVVLAAVLFLIFQAVFSWANWPMDAIKGAMAAVGDWILAHMASGPLRS
FT                   LLVDGVVAGVGGVLVFMPQILILFFFILLLEDSGYLPRAAFLLDNLMGKVGLSGRAFIP
FT                   LLSSFACAIPGIMATRTIANWKDRLATIMVAPLMTCSARLPVYALLIGAFVPERRLGGL
FT                   SLRGLTLFGLYVAGVVSAMGVAWVFKRVWMKDGYQPLMLELPPYRRPSLRNLAQGLWER
FT                   AHIFLRRVGGIIFALMVVLWFLSTYPAPPAGWDAAQGPAIQYSFAGMMGHALQWIFAPI
FT                   GFNWQISIALVPGMAAREVVVGALGTVYALSGVDASVADALSPVIAQGWSLATAYALLA
FT                   WFVFAPQCLSTLAVVRRETNSWRYPLFMAAYLFVLAYAAAFATYRITLWLGG"
FT   gene            68336..68626
FT                   /locus_tag="Rfer_0065"
FT   CDS_pept        68336..68626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67827"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M6"
FT                   /protein_id="ABD67827.1"
FT                   /translation="MWLQSLLVLLLVAGSSIYAAWALLPQAARRSLAQGLLRWPLPRSL
FT                   AGYLQQAARAPAGCHCSGCDRAPANVKQGNKRGPTDGLLAKPLVFHPRKRD"
FT   sig_peptide     68336..68395
FT                   /locus_tag="Rfer_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.873 at
FT                   residue 20"
FT   gene            complement(68690..69757)
FT                   /locus_tag="Rfer_0066"
FT   CDS_pept        complement(68690..69757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0066"
FT                   /product="putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67828"
FT                   /db_xref="GOA:Q223M5"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M5"
FT                   /protein_id="ABD67828.1"
FT                   /translation="MFASPFRAMTALWWSVLLLISAVLGWALTALHLPAGVLLGCMLAG
FT                   IVLSSQEIRLGIPTTLFALAQGVVGCLMAKSLQPSTLAKVASDWPIFLGATFSIVAASA
FT                   ALGWLLMHRQVFPGTTAVWGLAPGAASAMVLMAEAYGADVRLVAFMQYLRVAVVTAVAA
FT                   LVAHFWTTRAAPMTPEVHWFAVINPGDLGWTLLLAFAVSSIAGWLHIPGGPMVVPLVLG
FT                   AALQAMGWLVIELPPALLAVSYAVIGWSIGLRFTRAILRHALRALPAVLGSIFALMGVG
FT                   LVIAVGLTQWAGHDPLTAYLASSPGGADSVAIIAATSAVDAGFVMAMQLARFLMVLVLG
FT                   PRVSKFVATQSRTDR"
FT   sig_peptide     complement(69680..69757)
FT                   /locus_tag="Rfer_0066"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.636 at
FT                   residue 26"
FT   gene            69848..70219
FT                   /locus_tag="Rfer_0067"
FT   CDS_pept        69848..70219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67829"
FT                   /db_xref="GOA:Q223M3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M3"
FT                   /protein_id="ABD67829.1"
FT                   /translation="MTPAALPSPAAVLVVCLCAEWCGVCRDYRQRFAQVQTQFPGVRFL
FT                   WIDVEDEAELLDPLDVEDFPTLLLAVGDRPHFFGPLTPQTDTLARLVRSLIEDSSSPAL
FT                   ADPSLTALVARLRAAHPFL"
FT   gene            70250..70840
FT                   /locus_tag="Rfer_0068"
FT   CDS_pept        70250..70840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0068"
FT                   /product="putative lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67830"
FT                   /db_xref="GOA:Q223M2"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M2"
FT                   /protein_id="ABD67830.1"
FT                   /translation="MSTRNSLKQLLAIGLLALVSVLPSWAAEVGGVKIDEAVTVEGQPL
FT                   KLNGAGVRTKFVFKVYAMGLYLTDHKTTPSDIQALAGPKRVTIVMLREVASDELAKTFV
FT                   AGLNNNSNAAEKAKVSDQTQKFEKMFTTVPVVKKGDVITLDWLPATGTVSQLNGKPLGE
FT                   ALPDAAFYNAVLRIWLGEKPVDDALKSALLGAK"
FT   sig_peptide     70250..70330
FT                   /locus_tag="Rfer_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(70953..72239)
FT                   /locus_tag="Rfer_0069"
FT   CDS_pept        complement(70953..72239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0069"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67831"
FT                   /db_xref="GOA:Q223M1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M1"
FT                   /protein_id="ABD67831.1"
FT                   /translation="MPLFNWTVKSASVLQQGGVIAPDERLPWPQTAVMGMQHVIAMFGA
FT                   TVLAPILMGFDPNLAILMSGIGTLIFFVVTGGKVPSYLGSSFAFIGVVIAATGYAGKGL
FT                   NPNIGVALGGIIACGAAYTAIGLLVQVVGTNWIEKLMPPVVTGAVVAVIGLNLASVPIK
FT                   NMAASNFDSWMQAVTFVCVALVAVFTRGMVQRLLILVGLIVATAVYAVLTNGLGLGKAL
FT                   DVSTLLNAAWIGAPGFAAPVFEPKAMLMIVPVAIILVAENLGHLKAVSAMTGKNMDPYM
FT                   GRAFIGDGIATMVSASAGGTGVTTYAENIGVMAATKIYSTALFLVAALLAVVLGFSPKF
FT                   GAIIAAIPLPVMGGVSIVVFGLIAVAGARIWVQNKVDFADNKNLLVAAITLILGTGDFT
FT                   LKFGGFALGGIGTATFGAIFLYALLNRKR"
FT   gene            complement(72547..72801)
FT                   /locus_tag="Rfer_0070"
FT   CDS_pept        complement(72547..72801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0070"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67832"
FT                   /db_xref="GOA:Q223M0"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q223M0"
FT                   /protein_id="ABD67832.1"
FT                   /translation="MLIPFKPVFQHEGNTMKIIQKYSVGVLAAALVVLSGCAGMTHQEK
FT                   GTAAGAVIGGVVGSASGGGVLGTAAGAAVGGVIGHEVTK"
FT   gene            complement(72818..73465)
FT                   /locus_tag="Rfer_0071"
FT   CDS_pept        complement(72818..73465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67833"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L9"
FT                   /protein_id="ABD67833.1"
FT                   /translation="MKTPAAHAIVLAIGLALSVGAMAQGMTKVQYETARTGVSAELKLA
FT                   RAACDSFSAHAKDLCLAEASGKEKVATAELNARLAPSEQASYKVRLTRADAQYTLAREK
FT                   CDDLAGHAKDVCVREAKAKAVTAKANAKAHMRTAVAHDAAYDKTRKAQGVADEKAAQAQ
FT                   AKADDISTAARTDAVKEKSTAAYTVAKEKCDALAGDAKGNCVKDATARSSKP"
FT   sig_peptide     complement(73394..73465)
FT                   /locus_tag="Rfer_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            complement(73485..73958)
FT                   /locus_tag="Rfer_0072"
FT   CDS_pept        complement(73485..73958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0072"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67834"
FT                   /db_xref="GOA:Q223L8"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L8"
FT                   /protein_id="ABD67834.1"
FT                   /translation="MKTMNKAGSVLALAALLALGGCQNMTPPNTYDSGTAYPQSSSGAG
FT                   AYTGYGVVQSIDLVRQGGSTGIGGAIVGGVVGGILGHQVGSGQGNTAATVLGAAGGAYA
FT                   GHEIEKRNQPQADAYKFTIRMRDGSYQTVTQTSIDDIRVGDRVRIDNGVARRY"
FT   sig_peptide     complement(73884..73958)
FT                   /locus_tag="Rfer_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.774 at
FT                   residue 25"
FT   gene            complement(73992..74582)
FT                   /locus_tag="Rfer_0073"
FT   CDS_pept        complement(73992..74582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0073"
FT                   /product="transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67835"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q223L7"
FT                   /protein_id="ABD67835.1"
FT                   /translation="MRTRFELLALSTALAALTALSVGCSKAPEATGASASGASTPSTTV
FT                   GTVIDDSIVTASVKAALLADPDLKGFDFKVVTRKGEVQLSGFVDKQTQIDIAVTVAGAV
FT                   TGVKSVQNNVSLRSVAPTVGGKVDDTLITAKVKTALLADESIKSLDIAVITRQGDVQLS
FT                   GFVNNQSQIDRAIAVVSGIAGVSHVSNEMSIKK"
FT   sig_peptide     complement(74502..74582)
FT                   /locus_tag="Rfer_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.483 at
FT                   residue 27"
FT   gene            74835..75050
FT                   /locus_tag="Rfer_0074"
FT   CDS_pept        74835..75050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67836"
FT                   /db_xref="GOA:Q223K1"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K1"
FT                   /protein_id="ABD67836.1"
FT                   /translation="MNPTKMIGIILIAAGCLGLAFGGFSYTKETTGMKLGPLELKVQEK
FT                   QTVNVPLIVSAGGIILGVFLLVVGRK"
FT   sig_peptide     74835..74918
FT                   /locus_tag="Rfer_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.959 at
FT                   residue 28"
FT   gene            75237..76511
FT                   /locus_tag="Rfer_0075"
FT   CDS_pept        75237..76511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67837"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:Q223K0"
FT                   /protein_id="ABD67837.1"
FT                   /translation="MTEPTIICPNCRTEIKLTESLAAPLLAATRQQFEAQLARKDHDIA
FT                   QRESAMREKEKALTDAKRDLDEQVADQVASQLKTERSRVAAEEAKKARAAAANELEAKA
FT                   RELAELRGVLTVQDAKLAEAQQAQAEVIKQQRELDDAKRELDLTVEKRVQTSLSEVRTL
FT                   AKREAEDGMKLRVAEKDQTIASMQQKIEELKQKAEQGSQQLQGEVQELELENLLRAKFP
FT                   FDLIEPVPKGEFGGDALHRVNSQSGVLCGSILWESKRTRNWSDGWLPKLREDQRCAKAE
FT                   VCVLVSQVLPKGVETFDLVDGVWITSPRVAIPVAIMLRQALLQISQTRALSDGMQTKTE
FT                   MVYQYLTGPRFRQRVEAIVEAFSSMQDDLDKERKVIMKQWAKRQEQIERVMGATVGMYG
FT                   DLQGIAGKSLQEIEGLELSALEMKR"
FT   gene            complement(76523..77026)
FT                   /locus_tag="Rfer_0076"
FT   CDS_pept        complement(76523..77026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0076"
FT                   /product="CinA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67838"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J9"
FT                   /protein_id="ABD67838.1"
FT                   /translation="MTQKLSKSELSTQYLCGLVADLMLRNRLKLVTAESCTGGMIAAAC
FT                   TDLAGSSDWFERGFVTYSNEAKTELLDVQAQLLLSEGAVSEAVARAMVRGALAHAHAQV
FT                   AVAVTGVAGPTGGSPAKPVGTVWFGFAVPGQVITEKRHFDGDRAQVRAATVRHTFTRLV
FT                   ELLG"
FT   gene            complement(77023..77604)
FT                   /locus_tag="Rfer_0077"
FT   CDS_pept        complement(77023..77604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0077"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67839"
FT                   /db_xref="GOA:Q223J8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J8"
FT                   /protein_id="ABD67839.1"
FT                   /translation="MPVDEPFFDPPIAARPITPEPVLPSARFLYTHPAHLMALGFGSGL
FT                   SPLAPGTAGTLWAWLTFVLLQPGMNDARWALLIALSLPLGWWACSVTAKHMRVLDPSSI
FT                   VWDEIAAFWLVLWLVTPAGFWGQLVAFGLFRFFDAAKPGPVRWADQLFHGVNVTSDPAA
FT                   WRKAGFGIMLDDLVAAACALLVIAGWRYFQ"
FT   gene            complement(77643..79031)
FT                   /locus_tag="Rfer_0078"
FT   CDS_pept        complement(77643..79031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0078"
FT                   /product="cardiolipin synthetase 2"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67840"
FT                   /db_xref="GOA:Q223J7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J7"
FT                   /protein_id="ABD67840.1"
FT                   /translation="MTLHTLLRSAATAVGALAFAACATLPDTDELIQRHAGQAARFETA
FT                   RGALPAQKSAAILAQLKSQSGDIDILDKQIALEQAVNDSPLVLGNKVTLLQDGAATYPA
FT                   MFAAIRSARDHINLESYIIENDEVGRQFSDLLLAQQARGVQVNVIYDSVGALNTPKAFF
FT                   ERLKQGGIEVLEFNPINPLTAKGPWMINHRDHRKLLLVDGRIAFIGGINISSVYGSGSI
FT                   PSRSHKAAANTDEWRDTDLQIEGPVVSEFQKLFLQTWEKQRGRPLATKNYFPALKVQGK
FT                   DIVRTIGSTPDDPFSLMYLTLISAIGNAEKQVHLTQAYFVPDPQLLQALVAAAGRGVDV
FT                   KLILPSHSDSGLVFHAGRAHYTELLQGGVKLYERVGGLLHAKTAVIDGVWSTVGSSNLD
FT                   WRSFLDNNEIDAVVLGQEFAQKMEAMFASDLQASQAIDLQGWQHRPLQFRIKEWLARVW
FT                   ERLL"
FT   sig_peptide     complement(78960..79031)
FT                   /locus_tag="Rfer_0078"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.939 at
FT                   residue 24"
FT   gene            complement(79028..81037)
FT                   /locus_tag="Rfer_0079"
FT   CDS_pept        complement(79028..81037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0079"
FT                   /product="AsmA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67841"
FT                   /db_xref="GOA:Q223J6"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q223J6"
FT                   /protein_id="ABD67841.1"
FT                   /translation="MPLSPSYHAMTLPRSLKWIAGAVIAPVVLALLFIAIFGWNWLRAP
FT                   IERMALEKTGRVLAINGDLRVTLGWPRPRLRANAVTFANPLWTQEKQMLAADAVEITLD
FT                   LSQLLGRKLVFPELRLERPVVFLEQGTEGRKSWLLDQQQQDPGARIQIDRLTLDQGTLG
FT                   YDDAVQKTSIRAELASLTPPAGSTADTGLTFSAHGRYKGQALTAQGNGGPVLALRDEST
FT                   PYPLTIDASVGHTRVRAEGSVTSLLKFTAVDLALALSGDNLAQLYPLLGITFPATRSYV
FT                   TAGHLLHSGNSWRYEKFSGRIGTSDIAGSLQVKTGGQRPALTAELTSSVLDLADLGPLI
FT                   GSRPGSVQAAKQAARQLPTEPPQTAAVTPAQARVLPDQSFNTERWRSVDAEVSLRAKAL
FT                   KREKELPLEDLVAHLSLQDGLLTLDPLNFGLAGGQLNSVVTLDGRTDPITAHAKVRARK
FT                   ILLAKLFPTAELNQASIGQINGEFDLAGQGNSVGRMLAGSNGKVGLVVSGGEISKLMME
FT                   KAGLHLWEILQLSLSGDRLIKLRCAVADFEVKNGKMQTDALVLDTQVTTLLGSGNVDLA
FT                   QERLDLTFNQKTKATSPLALRSPIYVRGSFAKPELGVDKTRVAVRALGALALGVVNPFL
FT                   TLLPLIDAGPGQDSDCGQLVRDARALPHPKSQKK"
FT   gene            complement(81242..81565)
FT                   /locus_tag="Rfer_0080"
FT   CDS_pept        complement(81242..81565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0080"
FT                   /product="Collagen triple helix protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67842"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G4"
FT                   /protein_id="ABD67842.1"
FT                   /translation="MKYSNLLLATAASLALAGCFSLPAGPAGPQGATGATGDTGYTGAT
FT                   GRTGGTGATGATGYTGATGGAGATGDTGATGYTGATGSTGATGRTGATGSVPAGTVVIV
FT                   PAQ"
FT   sig_peptide     complement(81461..81565)
FT                   /locus_tag="Rfer_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.444 at
FT                   residue 35"
FT   gene            81897..82316
FT                   /locus_tag="Rfer_0081"
FT   CDS_pept        81897..82316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67843"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G3"
FT                   /protein_id="ABD67843.1"
FT                   /translation="MKPSNKVRHLVLSVLVAASAVAVPAFAQVSVNINLAPPAPLYEVR
FT                   PVIAPGYAWAPGYWVLMGDRHVWVRGRTIVQREGYRWAPDHWEQRNNIYVRQPGYWQRD
FT                   DNYKSIKMEKQKKPKHWDKGQGQGGKHGNKGKRND"
FT   sig_peptide     81897..81980
FT                   /locus_tag="Rfer_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(82418..83161)
FT                   /locus_tag="Rfer_0082"
FT   CDS_pept        complement(82418..83161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67844"
FT                   /db_xref="GOA:Q223G2"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G2"
FT                   /protein_id="ABD67844.1"
FT                   /translation="MSYILDALKRADTERERGNVPGLHTRQLATPTGPTVPGARSSLWL
FT                   AVAAAVALGGIGVGLWLWLTPADTPRPVVLKPVVVQPPVNAPAPVAAVAPKSTPAPTAT
FT                   PAATATLPPTVAAPPTQVAALPVMPTTVKPRPEPTRAAPAVATPAPPKAEVKPGPIPPA
FT                   AAPATAALTAVPLLSDLPEDLRRQVPALTITGAVYSENPAQRLLLVNNLVLAQGALAAP
FT                   EVKLEEIQARSSVFSFRGTRFRVAH"
FT   gene            complement(83166..84864)
FT                   /pseudo
FT                   /locus_tag="Rfer_0083"
FT   gene            84980..85756
FT                   /locus_tag="Rfer_0084"
FT   CDS_pept        84980..85756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0084"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67845"
FT                   /db_xref="GOA:Q223G1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q223G1"
FT                   /protein_id="ABD67845.1"
FT                   /translation="MSAFLEETVLSVHHWTDRLFSFTTTRDPTLRFSNGHFTMIGLRLE
FT                   TGKPLLRAYSIVSANYEDHLEFLSIKVQDGPLTSRLQHIKVGDKIVVGRKPTGTLLIDY
FT                   LLSGKNLYLIGTGTGLAPFLSIVRDPETYERFEKVILVHGVREVAELAYHDYLTYELPE
FT                   HEFLGDMVTQQLLYYPTVTREAFVHQGRVTTLLESGQLQTDLGLSKFDPAHDRVMLCGS
FT                   PDMLRDLKHLLEKRDFMEGNTTKQGDFVIERAFVEQ"
FT   gene            85846..86664
FT                   /locus_tag="Rfer_0085"
FT   CDS_pept        85846..86664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0085"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67846"
FT                   /db_xref="GOA:Q223F7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F7"
FT                   /protein_id="ABD67846.1"
FT                   /translation="MLLAAGRGERMRPLTDTTPKPLLPVRGKPLMQWQLEALARAGVGR
FT                   VVVNTAWLGPQIAAQFNDVFRLQPASNKHEQLSIQDSLQIRYSHEGQDFGAALETAGGI
FT                   ARALPLLCPPTGAGARAEVFWVLAGDVYVPDFVFSPAAVARFLAGDKLAHLWLVPNPAH
FT                   NLRGDFGLGTVDTGGPTPVGLALNLPAADPRPRYTYSTIGLYRRALFESPWCDIAAGNP
FT                   LGIKAPLAPLLRAAMDNGFVSAELYGGRWTDVGTPERLRALNLNPPSAQP"
FT   gene            86684..88093
FT                   /locus_tag="Rfer_0086"
FT   CDS_pept        86684..88093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0086"
FT                   /product="aminopeptidase P. Metallo peptidase. MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67847"
FT                   /db_xref="GOA:Q223F6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F6"
FT                   /protein_id="ABD67847.1"
FT                   /translation="MTATPLAKTADTGYAQRRAQVAKLIGPHGIAIIPTAPEQQRNRDN
FT                   DFLFRPDSYFYYLTGFTEPKAWLVITGDGKTSLFCQAKDQEREIWDGYRLGPQAAPAAL
FT                   GVDAAFAVADLDAQLPGLLDGRDAVWYPFATHKGLETRIDGWLGSVRARVRYGTLCPEQ
FT                   QRDLCGLLDEMRLVKDAHEQATMRRAAQISAGAHIRAMQLSARMLRGGQEVREYHLDAE
FT                   LLHEFRRHGSQSPAYGSIVAAGANACVLHYRADAGQVRAGELVLIDAACELDGYASDIT
FT                   RTFPANGKFSGPQRALYELVLAAQEAAVAATRAGARFTDPHEASVKVLAQGMLDLGLLE
FT                   RNKVGSLEDVIDKRAYFQFYMHRTGHWIGMDVHDCGAYTEPSEIGQVSTRKDALTGDLI
FT                   KDRPARILQPGMVLTIEPGIYVRPAAGVPAQFHNIGIRIEDDAIVTASGCELISRGVPV
FT                   QADDIEALMRG"
FT   gene            88135..88647
FT                   /locus_tag="Rfer_0087"
FT   CDS_pept        88135..88647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0087"
FT                   /product="thiol-disulfide isomerase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67848"
FT                   /db_xref="GOA:Q223F5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F5"
FT                   /protein_id="ABD67848.1"
FT                   /translation="MKTVFSLILLCLVATTNLAAAKTPGEVEVGSVLREATMLGLSGPS
FT                   RQLSQYRGKPLIINVWASWCGPCQQEMGSLERLARSKTGQQVTLIGISTDDYPEAARAF
FT                   LKRYPTSFSHYIDQQLLLENMLGAAQLPLTLLVDAQGRVLAKHVGAQQWDSPQALQFIG
FT                   KTLRLKP"
FT   sig_peptide     88135..88200
FT                   /locus_tag="Rfer_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.683 at
FT                   residue 22"
FT   gene            complement(88705..91500)
FT                   /locus_tag="Rfer_0088"
FT   CDS_pept        complement(88705..91500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0088"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67849"
FT                   /db_xref="GOA:Q223F4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F4"
FT                   /protein_id="ABD67849.1"
FT                   /translation="MTSSKKYVYAFEEGDGKNKMLLGGKGANLCEMTQIGLNVPPGFTA
FT                   STDACNAYLEKNQLPPGLMDEIRTHMAALEKKTGKGFGDAKNPLLISVRSGAAMSMPGM
FT                   MDTILNLGLNEVSLKGLITQTGNERFAYDAYRRFIQLFGKIALNISDEHFDERMVAIKR
FT                   KYGAPQDVDLNTEHLKELAGEFLAIVQRQTGQAFPQDPFVQLEIAVGAVFRSWMGKRAV
FT                   DYRKQFRITKAQANGTAVSICTMVFGNMGNDSGTGVGFTRNPGTGENVIYGEYLVNAQG
FT                   EDVVAGIRTPKAIAEMEQEMPEIHRQLIQLRSRLESHYHEVQDFEFTIEKGILYCLQTR
FT                   NGKMNARAMVRTSVEMFHQGLITKERALLRTEPAVLEQLLVPQLAPNFHAKSLAQGLSA
FT                   SPGAASGKIVFDADTAETRGRAGEKIILVREETKPEDIHGFFQAQGILTSRGGKTSHAA
FT                   VVARGMGKPCVSGCEQIVINDQLRSAKVGDTVLREGDVITIDGGTGHVYAGEIPTVEAE
FT                   FSEEMNTLLGWADEVAALKVMANADSPVDALRAREFGAMGIGLCRTERMFNATDRLPIV
FT                   QEMILAETLEERQAALDRLLPIQRADFKGIFKAMKGLPVTVRLLDPPMHEFLPTAAQLE
FT                   LEIAHLHQLRDTIKALEDLPETLKMLNPKLYQQYADGLTPLMGALGTFKKSHMEDEVIA
FT                   KKEKILKKVRALAEVNPMLGHRGVRLGITYPEIYSMQIRAILEAAALCGKQGIEIYPEI
FT                   MVPQVATVEELKRIHSYVQRIRQEVRATHGIDVQFKFGSMLEVVRACMRSGRMAEIAEF
FT                   FSFGTNDLSQATFSFSREDAENKFLPFYNETGILEDNPFEVLDIKGVGQLMKMAVQNGR
FT                   VTNPDLKVGICGEHGGHPGSIRFCHHIKLNYVSCSGPRVPIARLAAAQAKLLEDQYREP
FT                   V"
FT   gene            complement(91596..92597)
FT                   /locus_tag="Rfer_0089"
FT   CDS_pept        complement(91596..92597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0089"
FT                   /product="prolyl aminopeptidase. Serine peptidase. MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67850"
FT                   /db_xref="GOA:Q223F3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F3"
FT                   /protein_id="ABD67850.1"
FT                   /translation="MPNSKPKKEPPPMSADALNPLYPAIAPYRTGQLPVDDIHTLYWEE
FT                   CGNPDGVPALFLHGGPGAGLSPQHRQFFDPAYYRIVLFDQRGAGQSTPLGEALENTTDL
FT                   LIHDIERLREQLGIAQWLVFGGSWGSTLALAYGEAHPERCTGFVLRGIFLCTRSEIDWF
FT                   LNGIRLFFPQEHARFVADIPETERGNLLQAYARRLFSGNPAENMRAARTWSRYEGSCLH
FT                   LLPHPEVAETFGSAAVGLGLGRLEAHYFLHDAFLSEDQLVRNVDRIRHLPAVIIQGRYD
FT                   VVCPPVSAWRLHEAWPEASFQMIEDAGHAAFEPGIASALIAATNQFKRDGTL"
FT   gene            92806..93288
FT                   /locus_tag="Rfer_0090"
FT   CDS_pept        92806..93288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0090"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67851"
FT                   /db_xref="GOA:Q223F2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F2"
FT                   /protein_id="ABD67851.1"
FT                   /translation="MTAKQRPEIKTMANLESAFAGESMAHIKYRYFAKLAREMGDEDTA
FT                   RVFEATADQEVMHAFGHLDLLYPKATMTAAKALQIAIDGETYEYTEMYPGFRATAEAEG
FT                   HAAAVAEMDEQIGESKEHAAQFRATLEKAQKRFAALAKVEERHANHYKAQLAKAQA"
FT   gene            93415..93579
FT                   /locus_tag="Rfer_0091"
FT   CDS_pept        93415..93579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0091"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67852"
FT                   /db_xref="GOA:Q223F1"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F1"
FT                   /protein_id="ABD67852.1"
FT                   /translation="MKTYLCIVCGFIYDEAAGRPEDGIAPGTRWADVPDTWACPDCGVA
FT                   KADFEPVEI"
FT   gene            93595..94899
FT                   /locus_tag="Rfer_0092"
FT   CDS_pept        93595..94899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0092"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67853"
FT                   /db_xref="GOA:Q223F0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q223F0"
FT                   /protein_id="ABD67853.1"
FT                   /translation="MAPPIIIIGAGLAGWTTVRELRKLDQRTPVLLITADSGDFYAKPA
FT                   LSNALQQQRTPAQLVTTPAAQMAATHKVRLLAHTRVLVIDALTRTLRSTRGEFSYRHLV
FT                   LATGAQPIRLPLAGDAADQVQSINSLDDFSRFHQRLTRAAGCGDKGVGGGSPLNLQSAS
FT                   EHSRRHALIMGAGLIGCEFANDLAAAGYRVTVVDPSTGPMTALLPASASAQLQQALAGL
FT                   GVRWHFGATVKSVNWAKTGGSIAVAESARVHQVESVLQVELSNGSLAPVDIVLSAIGLK
FT                   SDTALAQAAGLVCERGIVVDATLQTSSPHIYALGDAAQYATGRWGVAADAAATSVAGAR
FT                   TMPYVMPIMSAARALAATLAGTPTAVAFALMPVAIKTPALPIVVAAPAPGTAGEWRSEA
FT                   SGQWQFMDGQHQVRGFALTGTQTARRAEQAKLVLA"
FT   gene            94994..97303
FT                   /locus_tag="Rfer_0093"
FT   CDS_pept        94994..97303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0093"
FT                   /product="malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+)"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67854"
FT                   /db_xref="GOA:Q223E9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR032683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q223E9"
FT                   /protein_id="ABD67854.1"
FT                   /translation="MPHTTATAADKRAELRRATLEYHEFPTPGKISIAPTKQLINQHDL
FT                   GLAYTPGVAIPCEEIVKDPNNAYKYTSRGNLVAVVTNGTAVLGLGDIGPLAGKPVMEGK
FT                   AVLFKKFAGIDVFDIEINEKHDLDKLVDIIASLEPTFGGINLEDIKAPDCFYVERKLRE
FT                   RMKIPVFHDDQHGTAITVGAAILNGLKVAGKDPKDVKLVTSGAGAAALACVGLLVKLGI
FT                   PRENVWVTDLAGVVYEGRTELMDPDKIIYSQKTSARTLGEVIEGADVFLGLSAGGVLKG
FT                   EMVKRMAPRPIIFALANPTPEITPEEVKAVRSDAIIGTGRSDYPNQINNILCFPYIFRG
FT                   ALDAGASTITVEMEMAAVHAIADLAQAEQSEVVAAAYVGEPLAFGPEYLIPKPFDPRLM
FT                   IKVAPAVAQAAFDSGVALRPIADMDAYREKLQSFVYASGTVMKPIFAAAKSALKKRIAY
FT                   AEGEDERVLRAAQIVVDEGLALPTLIGRPLVIAERINKFGLRLEEGQDYSVVNVEQDHR
FT                   YRDFWQTYHRMTERKGMTAQVAKIEMRRRLTLIGSMLLQKGDVDGLICGTWGTTAMHLQ
FT                   YLDQVIGKRTGVNTYACMNCLMLPERQLFIVDTHVNYDPTAEQLAEITILAAEEMVRFG
FT                   IRPKAALLSHSNFGSSNQPSAVKMREALDLLRVKAPWLEVDGEMHGDVALDGAARAALM
FT                   PNSTLAGDANLLVLPNIDAANIAYNLLKTAAGGNIAVGPVLLGAAKPVHILTASATVRR
FT                   IVNMTALTVADANASR"
FT   gene            97461..97853
FT                   /locus_tag="Rfer_0094"
FT   CDS_pept        97461..97853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0094"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67855"
FT                   /db_xref="GOA:Q223E8"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:Q223E8"
FT                   /protein_id="ABD67855.1"
FT                   /translation="MLRLKSSKLVLTSFFLAAIFACAGVLAKGPAPADAATAIAVTALP
FT                   KQGVQTYDLIHQGGPFAHEKDGVVFGNRERLLPLQKRGYYREYTVATPNLHARGARRIV
FT                   CGGAARAPDACYYTADHYASFRRIVP"
FT   sig_peptide     97461..97544
FT                   /locus_tag="Rfer_0094"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.912 at
FT                   residue 28"
FT   gene            97888..98337
FT                   /locus_tag="Rfer_0095"
FT   CDS_pept        97888..98337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67856"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:Q223E7"
FT                   /protein_id="ABD67856.1"
FT                   /translation="MNMSLSQETAALQRAATDVPLRGVRPNIVQSIRAFRVPELQGAAQ
FT                   SLGQHFLYANLANAQTKQDVLDLIAQQFMLSVHVGKNFDALYDSMTDPLHKSGPQPGFI
FT                   VVLEHIPAHAKFDKEAREQLLDIFRDAADYWADRKIPFRCFYSFL"
FT   gene            complement(98638..99423)
FT                   /locus_tag="Rfer_0096"
FT   CDS_pept        complement(98638..99423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0096"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67857"
FT                   /db_xref="GOA:Q223E6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223E6"
FT                   /protein_id="ABD67857.1"
FT                   /translation="MKHIARKRFGQHFLTDGAMIEAIVDAIGPRPGQAMVEIGPGLAAL
FT                   TQPLVERLGQLTVIELDRDLAARLRAHPQLVVIESDVLKVDFAQVAQALTTTKLRVVGN
FT                   LPYNISTPILFHLLNFIDVIEDQHFMLQKEVIDRMVAGPCTAAYGRLSVMLQWRYAMEN
FT                   VLLVPPESFEPPPRVNSAVVRMVPHVNPAAVDGHLLSELVQVAFSQRRKLLRHTLGQWL
FT                   QQKGYADEFDVQRRAEEVPVAEYLALALKLATHSQAASH"
FT   gene            complement(99450..100829)
FT                   /locus_tag="Rfer_0097"
FT   CDS_pept        complement(99450..100829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0097"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67858"
FT                   /db_xref="GOA:Q223E5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223E5"
FT                   /protein_id="ABD67858.1"
FT                   /translation="MNHRLVALSVASLALLAPLTVPAQGLRPSSATVGAGVLAPARVPA
FT                   ATGLAADYIVAVVNSEPITNNEVRAALQRVLQQLAQQGNPQVDSKTLVRQVLERLINEK
FT                   AQLQLARESGIAADEAAIDQAEQNIARQNQLTVAELRRRLTQEGGVPGQFRNQLRDQIL
FT                   LTRLREREVEPRARVSELEIDQFLREQQSSTPAVQQINLAQVLVSVPDTATPVQVTALQ
FT                   ARAQRALARARAGEDFVTLVREFSDASDKASLANGGELGLRTADRYPPLFLEATHNLAV
FT                   GEISALVRSGAGFHILKVLEKKSAALPAMTVTQSRARHILLRVSPQLTESAARDKLNEF
FT                   KKRVAAGQADFAALARDHSQDGSAAQGGDLGWANPGMFVPEFEAVMNSLTPGQISEPLV
FT                   SRFGVHLIQLMERRQATLSPQEQREAVRAMLHEKKLDEAYISWAQDVRGRAYVELREPP
FT                   Q"
FT   sig_peptide     complement(100752..100829)
FT                   /locus_tag="Rfer_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.847 at
FT                   residue 26"
FT   gene            complement(100836..103235)
FT                   /locus_tag="Rfer_0098"
FT   CDS_pept        complement(100836..103235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0098"
FT                   /product="Organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67859"
FT                   /db_xref="GOA:Q223E4"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223E4"
FT                   /protein_id="ABD67859.1"
FT                   /translation="MMHELDLRPHLARFAQRPLALLAWALLQGTSVNAQVAQVAPDEPP
FT                   LPLKTSPLLQEQVAPALRSSLPTFISAEHIFGRPDLETVLEGRAELRRGDLVIKADRLE
FT                   YDQPSDLATASGNVLINRAGNVYEGPLLELKLDTFEGFFNQPRYYFLKNDAHGQADRVD
FT                   FIDDQRAVIHNATFTTCRRLPGPSWLPDWILRAASISLDNEEDVGTAKGALLSFKGVPL
FT                   LPIPYLSFPLSDKRKSGVLPPILGLDNVNGAEVSVPYYWNIAPNRDATFTPTLMSKRGV
FT                   NLSSELRYLEADYAGQVQLDLMPSDQLRDSTRWGLTYTHQATLQNSWTRPFTAGGVALN
FT                   LNLNRVSDDNYWRDFTRASTGSLTQRLLTNDASLSWTEGNFSNTVRTLKWQTLQDVSAP
FT                   ITPPYDRLPQLATRYARSNVGGFDYSVDADYTRFQSERSLTLQPNAQRVFSVLQLSRPW
FT                   VTAAGFITPKLQLNVSNYQFDTPLSNGARAASRVVPTLSVDSGLVFERDARYFGMNFRQ
FT                   TLEPRAFYVNTPFRDQRLLPNYDSGAVDFNFATIYTDNAFVGNDRISDSDLLTLGVSTR
FT                   LLDPATGAQVARFGVAQRLRFRDQNVTLLPTDAPVTDRISDLLLGAAVNWDPKWAFDST
FT                   VQFNPTTKQSVRSTIGARYSAGHYRTVSAAYRYQRESSEQLDIGWQWPINDLWGERGQE
FT                   LGAGRGQGEGRWYSVGRLNYSMQERKLVDAVLGFEYDAGCWLGRIVLEQLQTSTASANQ
FT                   RIMFQLEFVGLTRLGVNPLKSLKDNIPGYQYLREQTSPPSRFSNYD"
FT   sig_peptide     complement(103131..103235)
FT                   /locus_tag="Rfer_0098"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.912 at
FT                   residue 35"
FT   gene            103322..104410
FT                   /locus_tag="Rfer_0099"
FT   CDS_pept        103322..104410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0099"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67860"
FT                   /db_xref="GOA:Q223E3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q223E3"
FT                   /protein_id="ABD67860.1"
FT                   /translation="MSTAFPPETTPATAPIWPDAQRAADFSVWLAGLAPAHGLVIDSLR
FT                   TASADASFRRYLRVDGTQGSYIIMDAPPDKEDCQPFVKVAQLLHQAQVHAPEVLAWDAA
FT                   HGFMLLTDLGAQTMMQVIKRDDPQANQGLYLQAVDALIAWQSASKPGVLPPYDEALLRR
FT                   ELELFPDWYLARHRGVAVEGEVRRTLDQAFAQIMAHNLAWPSVYVHRDFMPRNLMVAPA
FT                   GAGQRMGVLDFQDAVYGPITYDIASLMRDAFLSWEEDFCLDITIRYWEKARKAGLAVGD
FT                   DFGEFYRGVEWMGLQRHLKVAGIFARLTLRDGKPQYLADTPRFISYIRATCARYRELKP
FT                   LLRLIERIEGLVVADGYAFGRI"
FT   gene            complement(104452..104991)
FT                   /locus_tag="Rfer_0100"
FT   CDS_pept        complement(104452..104991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67861"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:Q223E2"
FT                   /protein_id="ABD67861.1"
FT                   /translation="MDDIVKQALLKWPNVPDCYGWLGLDARGNWFMRDERAQAQGPFAG
FT                   GSAAGKGSELKHDKLIEFIQRNYQPTTEGQWFFQNGPQRVYVELEATPLIWRVNHDLSI
FT                   QDHCGRAASVQHCLLDELGHVYLDTSTGFGLVHSMDMDYVADAVLQGLWQPQDVLHADL
FT                   PSRFNYVPSPYSLQKA"
FT   gene            complement(105077..105526)
FT                   /locus_tag="Rfer_0101"
FT   CDS_pept        complement(105077..105526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67862"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q223E1"
FT                   /protein_id="ABD67862.1"
FT                   /translation="MSKAKKQAASVGGSADEIEASFYEALQTADIDKLMACWADEDEIV
FT                   CVHPGGPRLVGLGAIRAAFDAIFNNGSIRVQPQAVRKIESLASVVHNVRERIEVLTEDG
FT                   LVQAFVIATNVYHRTAQGWRMVAHHASPGSQQEAQDGSEIPPVFH"
FT   gene            105632..106264
FT                   /locus_tag="Rfer_0102"
FT   CDS_pept        105632..106264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0102"
FT                   /product="LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67863"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q223E0"
FT                   /protein_id="ABD67863.1"
FT                   /translation="MRVYAKVAFFTLEIYMTRWLLILLTALSLTGCGYNDFQRLDEQTK
FT                   SAWSEVLNQYQRRADLVPNIVATVKGEAAFEQETLTKVIEARAKATSIQVTPETLNNPE
FT                   AFNKFQAAQGELGSALSRLMAVSEQYPSLKANQGFSDLRVQLEGTENRVTVARNRYIQA
FT                   VQAYNVLVRSFPSNLTAMVFSYQPKPSFTVQNEAAITTPPVVDFNKK"
FT   gene            106284..107204
FT                   /locus_tag="Rfer_0103"
FT   CDS_pept        106284..107204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0103"
FT                   /product="protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67864"
FT                   /db_xref="GOA:Q223D9"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q223D9"
FT                   /protein_id="ABD67864.1"
FT                   /translation="MRPLFLLQRWPAQLRRLGRWLAVASVGLLLLLSQAQAQLAVPTLV
FT                   AHVMDATGTLNAVQVQQLEAKLTAFEQSRGTQMVLLLVPTTQPEDIASYSNRVANSWKI
FT                   GRKEIGDGLLLVVAKDDRRVRIEVAKTLEGAIPDLAAKRVIDQAITPRFKQGDFAGGLD
FT                   AAVDQLMALIKGEALPVPVAAVRGVKNGFQWTDLAIFMFFAVPVVGAVARSIFGTKLGS
FT                   LATGGLVGGIALLVTASLAIAALAALVGFVFALFSGLMPGGGRGVGRHGGWGAGGGGFG
FT                   GGFGGGGFGSGGGGDFGGGGASGRW"
FT   sig_peptide     106284..106397
FT                   /locus_tag="Rfer_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.857 at
FT                   residue 38"
FT   gene            107204..107725
FT                   /locus_tag="Rfer_0104"
FT   CDS_pept        107204..107725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0104"
FT                   /product="protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67865"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q223D8"
FT                   /protein_id="ABD67865.1"
FT                   /translation="MLNRIKRIFRHRWVDESATQHASAPDMLQRLQQRVAASEQRHSGE
FT                   VRIYIEAGLPLSYLWTNAPTRQIARQRALDLFSQLGVWDTAANNGVLIYLLLAEHAIEV
FT                   VADRGVNGRVHPSVWPALVTRMSAAFKQAQFEDGLTNALAEVSALLVQHFPLGANEVNP
FT                   NELPDAPILN"
FT   gene            complement(107821..108237)
FT                   /locus_tag="Rfer_0105"
FT   CDS_pept        complement(107821..108237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0105"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67866"
FT                   /db_xref="GOA:Q223D7"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223D7"
FT                   /protein_id="ABD67866.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGEVGELGIYPRHTPLISRI
FT                   KAGSVRIEKADGSEEFVFVAGGLLEVQPNCVTVLSDTAIRGKDLDEEKANAAKLAAEEA
FT                   MKNAKTDIDLARATSELAVMAAQIAALRKYRQKK"
FT   gene            complement(108239..109663)
FT                   /locus_tag="Rfer_0106"
FT   CDS_pept        complement(108239..109663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0106"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67867"
FT                   /db_xref="GOA:Q223D6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223D6"
FT                   /protein_id="ABD67867.1"
FT                   /translation="MAQDTQTNTAVQGKIVQCIGAVVDVEFPRDQMPKIYDALKLEGSA
FT                   LTLEVQQQLGDGIVRTIALGSSDGLRRGLMVSNTANPIMVPVGTATLGRIMDVLGTPID
FT                   ERGPVSTEKYASIHRKAPTYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVGK
FT                   TVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYHEMADSGVVNLENLGESKVAMVYG
FT                   QMNEPPGNRLRVALTGLTIAESFRDEGKDVLFFVDNIYRFTLAGTEVSALLGRMPSAVG
FT                   YQPTLAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDI
FT                   ASLGIYPAVDPLDSTSRQLDPNVVGQDHYETARAVQGTLQRYKELRDIIAILGMDELAP
FT                   EDKLTVARARKIQRFLSQPFHVAEVFTGSPGKYVSLAETIRGFKMIVAGECDHLPEQAF
FT                   YMVGTIDEAFEKAKKI"
FT   gene            complement(109715..110611)
FT                   /locus_tag="Rfer_0107"
FT   CDS_pept        complement(109715..110611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0107"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67868"
FT                   /db_xref="GOA:Q223D5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223D5"
FT                   /protein_id="ABD67868.1"
FT                   /translation="MATGKEIRGKIKNFESTKKITKAMEMISVSKMRKAQERMRAARPY
FT                   ADKVRNIAANLGQANPEYIHAFMKTNEAPVVGMIVVTTDKGLCGGLNTNVLRSVTNKLR
FT                   DLQSAGMSAQTVAIGNKGFGFLNRIGAKVVSHVTQLGDKPHLERLIGPVKVLLDAYARG
FT                   EISAVYLSYTKFINTMKQEVVLEQLLPLSAARMQAETEASETASGAKHGWDYIYEPDAQ
FT                   SVIDDLLVRYVEALVYQSVAENMASEHAARMVAMKAATDNAGNVIGELKLVYNKTRQAA
FT                   ITKELSEIVSGAAAIGA"
FT   gene            complement(110641..112194)
FT                   /locus_tag="Rfer_0108"
FT   CDS_pept        complement(110641..112194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0108"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67869"
FT                   /db_xref="GOA:Q223D4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223D4"
FT                   /protein_id="ABD67869.1"
FT                   /translation="MQLNPAEISELIKSRIEGLTAGANIRNQGTVVSVTDGIVRIHGLS
FT                   DVMQGEMLEFPADAEGQPSYGLALNLERDSVGAVILGAYEHISEGNTVKCTGRILEVPV
FT                   GPELKGRVVNALGQPIDGKGPIDAKMTDVIEKVAPGVIARQSVSQPMQTGLKSIDSMVP
FT                   VGRGQRELIIGDRQTGKTAVAIDAIINQKGQNMTCVYVAIGQKASSVKNVVRSLEQAGA
FT                   MEYTIVVAATASESAAMQYVAAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAYPGDVFYLHSRLLERAARVNEKYVEDFTKGAVKGKTGSLTALPIIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGAAQTKLIKNLSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLERGARVTELLKQAQYSPLPISLMGATLFAVNK
FT                   GYLDDIAVNKLLSFEHGLHGYLKDKHAALLAKLEADKAMDKDAEAELNAATAAFKKSFA
FT                   "
FT   gene            complement(112245..112775)
FT                   /locus_tag="Rfer_0109"
FT   CDS_pept        complement(112245..112775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0109"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67870"
FT                   /db_xref="GOA:Q223D3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223D3"
FT                   /protein_id="ABD67870.1"
FT                   /translation="MAELATIARPYAEALFKASLSDLNGAAVWVEELETIAKNPQLLQF
FT                   ADNPNVTAAQVYELIAGIAQGALPAMAQNFLRTVIENGRLSALPEIAAQFRVMKNAQSG
FT                   SSDAVVYSAFAIDSTALAELAATLEQRFARKLNVSVQLQPELIGGIRVVVGDEVLDSSV
FT                   KARLEQMKMALTA"
FT   gene            complement(112786..113256)
FT                   /locus_tag="Rfer_0110"
FT   CDS_pept        complement(112786..113256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0110"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67871"
FT                   /db_xref="GOA:Q223D2"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223D2"
FT                   /protein_id="ABD67871.1"
FT                   /translation="MNINSTLFLQAIVFAILVWFTMKFVWPPITKALDERAQKIADGLA
FT                   AADKAKSELSSANKRVEAELALSRTETTARLADADRRGQSIVEEAKSKATEEANKIIAA
FT                   AKVEAEQQSNKAREVLREQVAALAVKGAEQILRKEVNASVHADLLGRLKLEL"
FT   gene            complement(113294..113539)
FT                   /locus_tag="Rfer_0111"
FT   CDS_pept        complement(113294..113539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0111"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67872"
FT                   /db_xref="GOA:Q223D1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q223D1"
FT                   /protein_id="ABD67872.1"
FT                   /translation="MENILGLVALACGIIVGLGALGASIGIALMGGKFLESSARQPELM
FT                   NELQTKMFILAGLIDAAFLIGVAIALLFAFAKPFAI"
FT   sig_peptide     complement(113471..113539)
FT                   /locus_tag="Rfer_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.906 at
FT                   residue 23"
FT   gene            complement(113596..114486)
FT                   /locus_tag="Rfer_0112"
FT   CDS_pept        complement(113596..114486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0112"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67873"
FT                   /db_xref="GOA:Q223D0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q223D0"
FT                   /protein_id="ABD67873.1"
FT                   /translation="MAAEHAEVHAQTAGEYIQHHLHHLQKNFSFENVEQHSIVDFSVFN
FT                   FDSLIYSILLGAMACYFLWRAASKATSGVPGRFQAAVEILSEMVDTQAKGVIHNATSRK
FT                   LVAPLALTVFVWIFLMNAMDMLPVDAIPALWHTAGPAMGYMNYMRVVPTADLSTTLGMS
FT                   VSVLLVCLVYNVKIKGLGGWIHELLSAPFGDKFFLYPVNLLMQLIEFAAKTVSHGMRLF
FT                   GNMFAGELIFMLIALMGGTWAWQFNPLSGWFWLGFGHVIAGTAWSIFHILVITLQAFIF
FT                   MMLTLIYVGQAHSSH"
FT   gene            complement(114501..114980)
FT                   /locus_tag="Rfer_0113"
FT   CDS_pept        complement(114501..114980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0113"
FT                   /product="putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67874"
FT                   /db_xref="GOA:Q223C9"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C9"
FT                   /protein_id="ABD67874.1"
FT                   /translation="MPLFEFDTDASDEPGFKQLNAEEAQALRERHPSLSPWRVVVWQAA
FT                   VGLLVALGTWGLTQNLVAGASAAYGAMAVILPAALFARGLSRQRRAANAGSALTGFFVW
FT                   EMVKIALTVAMLIVAPRLILGLNWLALLAGFVVTMKVYWVAVWLRPVSRQSLNKN"
FT   gene            115452..116717
FT                   /locus_tag="Rfer_0114"
FT   CDS_pept        115452..116717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0114"
FT                   /product="protein of unknown function DUF482"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67875"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C8"
FT                   /protein_id="ABD67875.1"
FT                   /translation="MPDQDFVIRVLDSPLKVDAVAWNTLLAAQDLADEPSPFMRHEYLA
FT                   AMLESGSATPATGWTARFVTLWQHGQLVGACALYLKDQSYGEYVFDHAWANAYQQLGLA
FT                   YYPKAVVASPFTPVPGARLLARDADTRTLLVKALLAWCGEQGLSSLHLLFASDADVRAC
FT                   EAAGLMLRHNVQFHWTNRAPTVAPAPAMSVAGTGGYLDFDDFLRSLSREKRKKIGQERR
FT                   KVRDAGVSFRWSQGTAIASVDWDFFYRCYEHTYDEHGNAPYLSRDFFQRMADTMAEHWL
FT                   LFVAERNGRPIASSLIALSGVIKGVNGDFGKKTRAKIAYGRYWGALEQVDCLHFEACYY
FT                   QPLAWCIEHGYQRFEGGAQGEHKMARALMPVKTNSAHWLAHPAFAAAVGRFLAREDEGI
FT                   HGYLEELARRNPFRRDGSAENL"
FT   gene            complement(116778..117476)
FT                   /locus_tag="Rfer_0115"
FT   CDS_pept        complement(116778..117476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0115"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67876"
FT                   /db_xref="GOA:Q223C7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C7"
FT                   /protein_id="ABD67876.1"
FT                   /translation="MRLSTTTHQARIMSRPLKIDFVSDISCPWCAIGLSALEQALDRLQ
FT                   NEVAAELHFQPFELNPQMPAGGQDIGEHLAQKYGSTPEQQTQIRDTIRQRGAEVGFSFN
FT                   PAGRGRIYNTFDAHRLLHWAGLETPSRQPALKKALLVACHSQGQNMESHEVLLAAVAQA
FT                   GLDVARARAILASDEFAPEVREREAFYTSQGIHSVPTVIINDRHLISGGQPVAVFEQAL
FT                   RQIAANQPGD"
FT   gene            117774..118970
FT                   /locus_tag="Rfer_0116"
FT   CDS_pept        117774..118970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0116"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67877"
FT                   /db_xref="GOA:Q223C6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C6"
FT                   /protein_id="ABD67877.1"
FT                   /translation="MKSSRNPNKSLWLVLLALMLAFVFETAAWWWASQTPRASSLQGPI
FT                   WLGLGAALCGLAAAVLLWRQLRTATRATRRARQLLASSLDTLDVGLEIWDEHDRLVLYN
FT                   KKINLIYKGFHTPADIGQTFEALMRAKLKRQAIPAAIGCEQEWLAQRLASRGTHKAHTL
FT                   KELTRNQWVNFYETRTSEGYLVAAWVDVTELVLKGKVLEANNQRLAQQTAMDGLTGLAN
FT                   RRRFDEALTVEWQRAARGRTPLSLLMVDIDHFKNYNDNYGHLAGDQCLRRVSSVLSRCV
FT                   RRAGELVARYGGEEFVLLLPGADMAHACEIAQMCLDLMQQECVAHAASPTSVYVTLSIG
FT                   VACALPDAMLDDPASLVNAADAAMYRAKSSGRAHYEVADQADWEIDDNTPRTQPSSLS"
FT   sig_peptide     117774..117857
FT                   /locus_tag="Rfer_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.570 at
FT                   residue 28"
FT   gene            119521..121602
FT                   /locus_tag="Rfer_0117"
FT   CDS_pept        119521..121602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0117"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67878"
FT                   /db_xref="GOA:Q223C5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C5"
FT                   /protein_id="ABD67878.1"
FT                   /translation="MSDLSKPSDAAADSTGSWPVIKKTAGRLLDWFVIQPVIVKLTVLV
FT                   LAVLIPATAIYSFTLIQKQAAMAEQVKTMTVAGQAGEGVWELNDKLPVVFGSGSLPSFL
FT                   ESKPVERITVVYEPLLWNASERIILIESQGRQYAYYPSDMETRIFTDKAVTAPWGAKLA
FT                   FIPRSELKPGGVALFERLDQRFAGARPQAGKDSWKAGVSGVLSATLMLGVLAFLYLQLK
FT                   GQFKSLKFIEPAQVHGSIDDLVGMDDIKAEVAQIKDQYERGAAYAEYGISKPFNVMFSG
FT                   PAGTGKTKLASYLAKELRLPILFHSAANLETGFVAGGSNTLSRIMAMAKRRKHCIVFLD
FT                   EAQDLFMKRGGRRKFDDDTANTLLSVLDGVRSKNDAEIIWIVASNFNSETMEMDEAMLR
FT                   RFQMKVDFRMPNREERLAIIGHYLSQRAGKVLPDLDLRHLVDVTEGRSPADLETIVNQA
FT                   GIAAVQAGEMIDAATLMQAAERVLVGNVNTNTTQERARDRRIIAVHEWGHFLVDLEHER
FT                   QLPNSNWEQILADMKTIKISLKANPRTNALGFVFHKQGSNLLKTKSDIEHDVRVLLGGM
FT                   ANEELFFGEEGTTNGAHNDITRVTQLLHHAVGEMGMYRKTRLNFGSLAKDSRRSGEVDE
FT                   ETRSIMEAQSERLYGETKAVLARLKPLTEHLVGKLLEAGEMSLSEALYQIRSFEAKVV"
FT   gene            complement(121603..121983)
FT                   /locus_tag="Rfer_0118"
FT   CDS_pept        complement(121603..121983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67879"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C4"
FT                   /protein_id="ABD67879.1"
FT                   /translation="MLVSISNHIHHNLSLLLRLLGSYAYLTFNEESNMNLSSSCTTLPL
FT                   APAEDPWLARLLRRTARTSGRYLATFWNLRLGRPAVEGRRLPVREMSTDMLRDLNLQHC
FT                   FHAQRELDRYEQTRAGLPLSHF"
FT   gene            122006..122905
FT                   /locus_tag="Rfer_0119"
FT   CDS_pept        122006..122905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0119"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67880"
FT                   /db_xref="GOA:Q223C3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C3"
FT                   /protein_id="ABD67880.1"
FT                   /translation="MPTFRAVARLSNLRAAAEQLHLTHSAISQQMRVLEQQLGFALFDR
FT                   RGRRVVLNAAGAALLGAVEPALEQIDAGVRAAALAASGTEQSLRLTTLPSFAQHWLLPR
FT                   MARWREQHPGIAIDLHTSLQVIDLQREGYHAALRQGKGPWQGLTATCLIDSPLIVVASP
FT                   EVARRLAGGDPAALVHEPLLGEAQRWNRWFALAGQRCRIKPVAVFNDMGMLLLAAEQGL
FT                   GVALGRQLLAADALRDGRLVQLSPIALADQGADTFWLLHPPELQDWPPLVALRDWLQQE
FT                   LLSSASQLEQPPVGSASL"
FT   gene            complement(123047..124606)
FT                   /locus_tag="Rfer_0120"
FT   CDS_pept        complement(123047..124606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0120"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67881"
FT                   /db_xref="GOA:Q223C2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C2"
FT                   /protein_id="ABD67881.1"
FT                   /translation="MRMNLPVTQREFDYPAEHMLVSTTDSKGFITHCNRAFVAVSGYTY
FT                   DELIGQNHNLIRHPDMPAAAFKDLWSSVGRGRPWTGMVKNRRADGDHYWVQANVTPIME
FT                   NGKPRGYMSVRIKPSRQEIKAAEGLYAQMNAAQESGKLPFHLQGGQVHYKGVRGMAGRI
FT                   RRMTLTSRLGLALGFMIALGMLPQWLDLQGMSGLGLKLGSLLAGAALVLLWFHKNFDTA
FT                   MGEAGRFADDLAGCNLTTSVATHFPPPLDSLIRSLRQIQANLQAVVGDVRGEIASFTRS
FT                   AAEIAAGSLNLSARTESQASSLQQTAASMEEISSTVRQTADTAAQVSAQSAISTRVATR
FT                   GGEAMHQVGLAMQAIESSSTEVREIVDVIEGIAFQTNILALNAAVEAARAGEQGRGFAV
FT                   VAAEVRALATRSAVAAKEIRTLIAQSVDQISQVTQQMTGAGDTIDEVVQSVRQVGELIQ
FT                   QISNTTQEQSLGISQVNEAVIQLDAVTQQNAALVEESAASANGLSDSAVTLARSVQVFR
FT                   LG"
FT   gene            124739..125845
FT                   /locus_tag="Rfer_0121"
FT   CDS_pept        124739..125845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0121"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67882"
FT                   /db_xref="GOA:Q223C1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C1"
FT                   /protein_id="ABD67882.1"
FT                   /translation="MKTRAAVAWKAGAPLSIETVDLQGPKFGEVLVEIKATGICHTDYY
FT                   TLSGADPEGIFPAILGHEGAGIVVDVGPGVTSLQKGDHVIPLYTPECRRCKYCLSRKTN
FT                   LCQLIRGTQGQGLMPDASSRFSLDGKPIFHYMGTSTFSNYTVVPEIALAKIRKDAPFDK
FT                   VCYIGCGVTTGIGAVLFTAKVEVGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDINPA
FT                   RQEMARKFGMTHFINPKEVDNVVETIVQLTDGGADYSFECIGNTKVMRQALECTHKGWG
FT                   RSIIIGVAEAGAEISTRPFQLVTGRKWEGSAFGGARGRTDVPKIVDWYMEGKINIDDLI
FT                   THTMPLEDINKGFDLMKSGESIRGVVLF"
FT   gene            125845..126711
FT                   /locus_tag="Rfer_0122"
FT   CDS_pept        125845..126711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0122"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67883"
FT                   /db_xref="GOA:Q223C0"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q223C0"
FT                   /protein_id="ABD67883.1"
FT                   /translation="MAALELLSEHACFGGVQRFYRHVSTVIGLPMRFSVYLPPQARSQT
FT                   VPAVMYLAGLTCTEETFMAKAGAQRVAAELGLALIAPDTSPRGAGVPGEAESWDFGVGA
FT                   GFYLDATQAPWSRHYRMETCLISELLPLLAPALPVDAQRLGISGHSMGGHGALTLALRH
FT                   PGLFKSVSAFAPICAPTQCPWGHKAFAAYLGADTTQWAAHDASALMSECSTAPYPAGIL
FT                   IDQGLADKFLPTQLNPHLFEAACAKAGQPLTLRRHAGYDHGYYFISTFMADHLAHHAQT
FT                   LLAPRSS"
FT   gene            complement(126815..127846)
FT                   /locus_tag="Rfer_0123"
FT   CDS_pept        complement(126815..127846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0123"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67884"
FT                   /db_xref="GOA:Q223B9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B9"
FT                   /protein_id="ABD67884.1"
FT                   /translation="MSSIVPENNPSSAHKSSARDWIMKIFLHWGVMPFLLVIAVVTFSL
FT                   MSSRFLTTDNLINLFRQSVYLVLVSLGQMLALISGGFDLSVGTIVAVSSVVSALTMGAL
FT                   ALSFPDAIWLVITLGCLAGLGAAMLIGMVNGAGVAVFGVSPFIMTLGMQSIGFGIALFL
FT                   TAGVPVSNLPDTLGDVFGFGVLLGVPVPILMMLLILALMFVLLNYSAWGRHLYAVGSNP
FT                   KAALLSGIRVKPVLISAYVLCALIAGVSGLLLTARTASGDANLGGSMALESIAACVIGG
FT                   VSLRGGIGRLENVVLGAIFIGLVQNGMNLAQIGSYLQIVVLGVLLIIAVVFDRIRQKRL
FT                   YRL"
FT   gene            complement(127875..129368)
FT                   /locus_tag="Rfer_0124"
FT   CDS_pept        complement(127875..129368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0124"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67885"
FT                   /db_xref="GOA:Q223B8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B8"
FT                   /protein_id="ABD67885.1"
FT                   /translation="MSDVLLSIEGLSKKFPGVRALDGVDFELLAGEVHAIFGENGAGKS
FT                   TLISIIAGAQPQGSGIIRMHGEELRFSSVADARRHGISAVFQEFSLAPHLTVEENLCLG
FT                   EERLHQRFGLLQLSAMSRHASALLQRLNFDIDPQRVVATLSRAEQQMVEIAKALRAKLS
FT                   VLILDEPTASLTERESEQLFATVRSLKQQGVGIIYITHRIQEIKRLADRVTVLRDGKHI
FT                   GVVDAATTTEAKLIEMMAGRTVEKIYPSIAANPGRTILELSQMRGGVGIDVDHFVAREG
FT                   EVVGVAGLVGCGKSELLRMAFGIEPMKSGVVKLDGQTIKKPTPRRMLDAGVFYLPPDRR
FT                   EEGLMLSASTADNISLNALTQQPIHFRSGFLSLSAERTVTRDIGRRVDIHPSNMPRATA
FT                   LLSGGNQQKVLFGRGLTRSIKLYIFDEPTVGVDVGTRSAIYYLIKELCEKGAAVILISS
FT                   DLPEILHLSHRAYVMRSGRIAAEIDRSCLTEAAVLQHFF"
FT   gene            complement(129460..130530)
FT                   /locus_tag="Rfer_0125"
FT   CDS_pept        complement(129460..130530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0125"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67886"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B7"
FT                   /protein_id="ABD67886.1"
FT                   /translation="MKKISAPTLFAGVLLTASFAAPAANWYPYAAEQTEPAFSDTGVKK
FT                   PIDYSPLPKASKKWKLCVSFPHMKDAYWLGVDYGVVEEAKRLGVSAQVLEAGGYTNLNK
FT                   QISQIEDCVAGGGQAVVIGGISADGLVNLVKSLKAKNIPTVDVINGINSPDLTAKSLVS
FT                   FYTMGQEAGAYLAKKHPAGSAKAVVAWFPGPAGAGWVEAANKGFAEAVKGSSLEVMAPI
FT                   YGDTGKEVQAKLVEDALQSNPAIRYIAGTAVTAEVSQGIVRARNLKDKVQVISFYLTPD
FT                   VYAGIEKGTIMASPADAMVIQGRIAIDQAVRALEGKDLIKHVGPKIVTIDKANLKQIRR
FT                   DDVLPPASFKPLFEVK"
FT   sig_peptide     complement(130468..130530)
FT                   /locus_tag="Rfer_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.845 at
FT                   residue 21"
FT   gene            complement(130638..131615)
FT                   /locus_tag="Rfer_0126"
FT   CDS_pept        complement(130638..131615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0126"
FT                   /product="Allophanate hydrolase"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67887"
FT                   /db_xref="GOA:Q223B6"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B6"
FT                   /protein_id="ABD67887.1"
FT                   /translation="MAIKVLQPGLATTVQDAGRIGYYHLGIPLSGALDQYSFRAANLLV
FT                   GNSEDAATLEITMLGPKLEFMHDAAIALTGANLPAKLDGVPIPNNQVVAVKAGSVLSFD
FT                   FLKDGVRAYLAVAGGIDVPEVLGSRSTYTLGAIGGFCGRKLQAGDVLPVGAFQGPSHVG
FT                   KKLPDHLKQALPKQVQVRVLPGLYFHWLTQASGKSFFEDTWQVGPEADRIGYRFKHGRP
FT                   LEFEPRERPFGAGSDPSNIVDAGYPIGSIQVPGGLEPIVLHRDAVSGGGYAMIGTVISA
FT                   DMDVVAQLQPNFQTQFVAVDMAQALSARAKRNQRLADLRQALLN"
FT   gene            complement(131605..132489)
FT                   /locus_tag="Rfer_0127"
FT   CDS_pept        complement(131605..132489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0127"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67888"
FT                   /db_xref="GOA:Q223B5"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B5"
FT                   /protein_id="ABD67888.1"
FT                   /translation="MSLPPARYSFGGDEHIFVELNHEMSLEAFFKGMSITNAIAQRKIA
FT                   GVTEICPANASYQVRFDPDLMAPDKLMEILKSIEIELGDGALELNTRIIEIPVFYNDPW
FT                   TNETQQRFRERHQDPTSTDLEYGARVNGYANVDAFIAAHAASPWFVSMVGFVAGLPFMF
FT                   QMVERTKQIQVPKYLRPRTDTPKLTIGHGGCFGCIYSVRGAGGYQMFGITPAPIFDPQQ
FT                   SLPYVKDFMVFFRPGDIVKFKPINRSEYDAALTKVQDGSFDLRIREVKFSLQDFVKDPS
FT                   AYNQQLTETLYGN"
FT   gene            complement(132522..133917)
FT                   /pseudo
FT                   /locus_tag="Rfer_0128"
FT   gene            complement(133964..134197)
FT                   /locus_tag="Rfer_0129"
FT   CDS_pept        complement(133964..134197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0129"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67889"
FT                   /db_xref="GOA:Q223B4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B4"
FT                   /protein_id="ABD67889.1"
FT                   /translation="MAEIISPLPGTFYRRPAPDAPNYKQVGDSVAIDEVIGLVEVMKMF
FT                   NEVRAEVSGKVVRYTIDNEDPVEAGQVLMIIE"
FT   gene            complement(134275..135102)
FT                   /locus_tag="Rfer_0130"
FT   CDS_pept        complement(134275..135102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0130"
FT                   /product="LamB/YcsF"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67890"
FT                   /db_xref="GOA:Q223B3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B3"
FT                   /protein_id="ABD67890.1"
FT                   /translation="MNKRQFKPSTRTKMGETMKRVMDLNSDMGEGFGPWSIGEGADEAI
FT                   MSQISSANIATGFHAGDPNIMQRMVSYAKQYGVGIGAHPGFRDLVGFGRRDIKASSSEL
FT                   LNDVIYQTGALREFAHWQGVRLQHVKLHGALYMRAAVDEEFSIALIKALQEIEPSLYLY
FT                   CMEASVTYQVAKRMGHPVVREFYGDRNYDKTGSIVFTRQVGQLDPATVAARALRACTHG
FT                   VVRTVEGEDIAIDFDSICIHSDTPGALALIKATKNALTSNGIKIASLSEVVPR"
FT   gene            135237..136160
FT                   /locus_tag="Rfer_0131"
FT   CDS_pept        135237..136160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0131"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67891"
FT                   /db_xref="GOA:Q223B2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B2"
FT                   /protein_id="ABD67891.1"
FT                   /translation="MRFSLRQIKYFAATAELGQISRAAVELSVSQSAVTISIRDLEEGL
FT                   GYKLFIRQSHGMELTDNGRHFLTRAYAILAAVDDARNMPQEIAPVSGELTLAATYTVMG
FT                   YFLPDHLQRLSLLYPALRIRMLELDRDTIESGLLAQNYDMAMLLTSNVRNPAIQTETLF
FT                   SSQRRLWVSPQHRFAAKRQVSFADIAQEPFIMLTVDEAADSALRYWHLHGFEPNVALNT
FT                   KSIEAVRSLVANDLGVAILSDMVYRPWSLEGKRIETIKPVESIPSMNVGLAWRADASMS
FT                   PAMNTVRQYFKQRYLDPQNPHGSSHR"
FT   gene            complement(136207..137691)
FT                   /locus_tag="Rfer_0132"
FT   CDS_pept        complement(136207..137691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0132"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67892"
FT                   /db_xref="GOA:Q223B1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q223B1"
FT                   /protein_id="ABD67892.1"
FT                   /translation="MAYRDLRDFITQLEHLGELKRVQAEVSPYLEMTALCDRTLRAGGP
FT                   ALLFENPTGHNTPVLGNLFGTTRRVALGMGVNDVSELRQFGHVLASLKEPEAPKGFKEL
FT                   MGLGSLVKTLWAMAPKELRSAPCQEIIWEGADVDLARLPIQHCWPGDVAPLITWGLVIT
FT                   QGPHKARQNLGIYRQQVLARNKVIMRWLAQRGGALDFKEHAALNPGQPYPVCVALGADP
FT                   ATILGAVTPVPDSLSEYQFAGLLRGSRTELVKALGSELRVPAFAEIVLEGHIYPDATHA
FT                   SGFEHALEGPFGDHTGYYNEQDWFPVFTIDRITQRRDPIYHSTYTGKPPDEPAMLALAL
FT                   NELFVPLLQRQYPEITDFYLPPEGCSYRLAVVQIKKSYPGHARRVMFGIWSFLRQFMYT
FT                   KFIVVVDDDVNIRDWKDVIWAITTRVDPTRDTLLADSTPIDYLDFASPVSGLGSKMGLD
FT                   ATNKWPGETSREWGRPLTMSADVTARVEQVWQTLGL"
FT   gene            complement(137732..138301)
FT                   /locus_tag="Rfer_0133"
FT   CDS_pept        complement(137732..138301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0133"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67893"
FT                   /db_xref="GOA:Q223B0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q223B0"
FT                   /protein_id="ABD67893.1"
FT                   /translation="MKRVIVAISGASGAVYGVRLLQMLRGMQGVQTHLTVSEAGWLNVQ
FT                   QELDMARAEVEALADVVYPVQNVGAAIASGSFQCDGMVVAPCAMRTLAAVALGLSDNLI
FT                   TRAADVMLKERRRLILMVRETPLNLAHLRNMTSVTEMGGIIFPPVPGFYHRPQSINEMV
FT                   DHSVSRVIDLLGLPQPDATRWTGLAS"
FT   gene            complement(138298..138780)
FT                   /locus_tag="Rfer_0134"
FT   CDS_pept        complement(138298..138780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67894"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A9"
FT                   /protein_id="ABD67894.1"
FT                   /translation="MSAKPLLIPTPLGAMLGRLPAYPGSLFFVTGLNLALSKQLAPDVT
FT                   QMLLGKKLRLRVTDAHWAFDFEWRNKHFAACQNVGEADLTISASAHDFVLLARRQEDPD
FT                   TLFFSRRLAMEGDTELGLLVKNTIDAIELPMVNLEPFKPAQVLARLRARWTLRQSH"
FT   gene            complement(138799..139707)
FT                   /locus_tag="Rfer_0135"
FT   CDS_pept        complement(138799..139707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0135"
FT                   /product="peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67895"
FT                   /db_xref="GOA:Q223A8"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A8"
FT                   /protein_id="ABD67895.1"
FT                   /translation="MKLALGPILYYWPRDEVLAFYDAVAQSPVDIVYLGEAVCSRRHEV
FT                   RLNDWLDIAAALRDAGKEVVLSTQVLIESGADVTVLHKIAANGQFMVEANDMGAVHCLE
FT                   GKVPFVAGPHLNIYNVPTLQWMAALGIKRWVMPLEMGRDDLALLLAGCPPGVQTEVFAY
FT                   GRMPLAFSARCFTARHCNLPKDDCQFKCIEHPDGLVMRTRESEEFLVLNGIQTQSARVH
FT                   NLLAELPAMRDMGVDVVRISPQSRHTVRIVELFQAVIQGRMGVTAASTELAALMPEKAC
FT                   NGYWYGQPGLEQVAASPEQVS"
FT   gene            complement(139829..140926)
FT                   /locus_tag="Rfer_0136"
FT   CDS_pept        complement(139829..140926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0136"
FT                   /product="peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67896"
FT                   /db_xref="GOA:Q223A7"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A7"
FT                   /protein_id="ABD67896.1"
FT                   /translation="MHRSKVVHNPTTMMNTILDNSLVPPLAVPVAASMELVCPAGSLPA
FT                   LKAAVDNGADCVYLGFRDATNARNFAGLNFDEAAIETGIRYAHDRGRKVFVALNTYPQA
FT                   AKAELWQRAVDRAAHSGVDAVILADPGMMAYAVKHQPQLRLHLSVQGSATNYEALDFYY
FT                   QHFGIARAVLPRVLSLTQVEQVLEKTSVEIEVFGFGSLCVMVEGRCALSSYVTGEAPNT
FT                   NGVCSPPKAVRWVETPQGRESRLNGVLIDRYATGENAGYPTLCKGRFDVGDEKNYYAIE
FT                   EPTSLNTLSLLPELMRIGVRAIKIEGRQRSPAYVAQVTKVWREAIDSCRTNPQLYAAKP
FT                   AWMSSLDKVAEGQQHTLGAYHRPWK"
FT   gene            complement(141058..141354)
FT                   /locus_tag="Rfer_0137"
FT   CDS_pept        complement(141058..141354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67897"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A6"
FT                   /protein_id="ABD67897.1"
FT                   /translation="MSACFATTIDLRRVAPPARHSLIFSSFSDLLPGQSLELINDHDPQ
FT                   PLNEQFQMRSPGVFSWSYLEKGPQVWRVQIGKNAASAASGASDSCCSGGACCG"
FT   gene            complement(141488..142135)
FT                   /locus_tag="Rfer_0138"
FT   CDS_pept        complement(141488..142135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0138"
FT                   /product="transferase hexapeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67898"
FT                   /db_xref="GOA:Q223A5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A5"
FT                   /protein_id="ABD67898.1"
FT                   /translation="MHYTHIAAHNLPPPASLGLAPTLSASAIVRDCRFGRYTQVGEQTR
FT                   MGDCLLDDYAYVQHNCDLMSTDIGKFANIANMVRINPGFHPMERPTLHHFTYRPTMYGM
FT                   DTQDDADFFAWRLRQRVVIGHDTWIGHGAVIMPGVHIGNGAVVGSNSVVTRDVASYAIV
FT                   AGAPATVIRQRFPRAIAQALEATAWWDWDHDTLTERMPDFKDMRCFLAKYAP"
FT   gene            complement(142208..143350)
FT                   /locus_tag="Rfer_0139"
FT   CDS_pept        complement(142208..143350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0139"
FT                   /product="Phosphonate metabolism PhnM"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67899"
FT                   /db_xref="GOA:Q223A4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A4"
FT                   /protein_id="ABD67899.1"
FT                   /translation="MKQRIFRNARIVTPDNEFTGCLVVEDGIIRSMDSGNTSVPGAQDW
FT                   AGDWLLPGLVEVHTDNLEKHLSPRPGVLWNAHSAMTVHDAQCAAAGITTVLDSVVIGDL
FT                   DDDGTRSQTQHTSIAALHQCHEEGLMRVEHLLHLRCELSAPDMLEVFHEYADDSLLALV
FT                   SMMDHTPGQRQWRDLKSYRRYTERNGSYNDAEFAAMIAQRKADQQAFSLPHRVEIVREC
FT                   QARGLPLASHDDTLLSDIAQAVAEGVAMSEFPTTVAAAQAARAAGMAIIMGGPNMVKGG
FT                   SHSGNVSAAELAQLDLLDIFSSDYVPSSLLLGTFMLGQLEGWTLPKAVRTVTVNPARAI
FT                   RLQDRGDVAPGQRADLLRVRMNRVGMPVVLEAWLAGKRAF"
FT   gene            complement(143370..144068)
FT                   /locus_tag="Rfer_0140"
FT   CDS_pept        complement(143370..144068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0140"
FT                   /product="Phosphonate C-P lyase system, PhnL"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67900"
FT                   /db_xref="GOA:Q223A3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A3"
FT                   /protein_id="ABD67900.1"
FT                   /translation="MTALIETLCLSKTFTLHGRGGLQLPVFAGIDLSVHPGECLALTGH
FT                   SGSGKSSLLRCLYGNYGASSGEVRIRHSGDWVSLSSAAPREVFEVRRRTLGYVSQFLRV
FT                   IPRVSTLDIVADPLRRLGVGAEEARAQAAQWLKRLNLHEHLWHLPPATFSGGEQQRVNI
FT                   AHGMITAPPVLLLDEPTASLDADNRHVVVELIHAARAQGSAIVGIFHDDEVRAAVATRC
FT                   FDVEQHRNPV"
FT   gene            complement(144065..144949)
FT                   /locus_tag="Rfer_0141"
FT   CDS_pept        complement(144065..144949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0141"
FT                   /product="Phosphonate C-P lyase system, PhnK"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67901"
FT                   /db_xref="GOA:Q223A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A2"
FT                   /protein_id="ABD67901.1"
FT                   /translation="MSAAPGRPQASSHRSAQHEGTPVIPPVLLSARQVGKAFVHQGQPR
FT                   WACRGVSFDLYPGEVLAVVGESGSGKSTLLRLLAARLACDEGSVHYDVRAESPNESGSE
FT                   STGLVDLAELSEARLRWLARTDWGFVEQHARDGLRMNVSGGANVGERLMALGARHYGHL
FT                   RSEASSWMQRVELDAGRMDDLPATYSGGMQQRLQIARNLVTHPRLVFMDEPTTGLDVSV
FT                   QARLLDLLRELVDELQLAAVVVTHDLAVARLLAQRMLVMKDGCVVEQGLTDRVLDDPQH
FT                   PYTQLLVSSVLTP"
FT   gene            complement(144946..145869)
FT                   /locus_tag="Rfer_0142"
FT   CDS_pept        complement(144946..145869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0142"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67902"
FT                   /db_xref="GOA:Q223A1"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A1"
FT                   /protein_id="ABD67902.1"
FT                   /translation="MMDQHYNFAFLDERTKKHIRRALLKAVAVPGYQVPFGSREMPFAY
FT                   GWGTGGVQITASIIGSSDVLKVIDQGSDDTTNAVNIRRFFARTTGVTTTEKTREATLIQ
FT                   TRHRIPEAPLTESQTLVYQVPMPEPLSKLEPRRRETIKMHALSEYGLMHVRLYEDIAQL
FT                   GAISHAYDYPVMVNERYLMSPSPIPKFDNPKMHMNPALQLFGAGREKRLYAIPPYTPVR
FT                   SLDFEDHPFEVQRWDHACALCGASESYLDEMIVDDAGSRLFVCSDSDYCEERRDAGQVG
FT                   TQQAVTLHDALATPSEAVTPSEQEAA"
FT   gene            complement(145866..147050)
FT                   /locus_tag="Rfer_0143"
FT   CDS_pept        complement(145866..147050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0143"
FT                   /product="phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67903"
FT                   /db_xref="GOA:Q223A0"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:Q223A0"
FT                   /protein_id="ABD67903.1"
FT                   /translation="MYVAVKGGAAAIESSWRLLEAQRRGDTAIAELSVAQIRAQLSLAV
FT                   DRVMSEGSLYDPELAALAIKQASGDLMEAIFLLRAYRTTLPRLGYSEPLDTARIALVRR
FT                   ISATFKEVPGGQLLGPTYDYTQRLLDFALLAEGENTGHSPAASDTAPDCLAKAFTDPLE
FT                   KYLAIETPSATVPRINELLAREGLLETPQPFDAAPPGDLTRDPLMFPADRALRLQALAR
FT                   GDEGWLLAMGYSTQRGYANSHPFAGEIRRGFVSVELVPDELGFALDIGELEITECQMIN
FT                   QFSGSREVPPQFTQGYGLAFGGAERKAMAMALVDRALRADELGEPRVAPAQDEEFVLSH
FT                   ADNVEASGFVQHLKLPHYVDFQAELELVRKLRAAHAAPARDSASAFNPTQQEAA"
FT   gene            complement(147140..147739)
FT                   /locus_tag="Rfer_0144"
FT   CDS_pept        complement(147140..147739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0144"
FT                   /product="phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67904"
FT                   /db_xref="GOA:Q222Z9"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z9"
FT                   /protein_id="ABD67904.1"
FT                   /translation="MNGAQTLAPGLLDGVHDSQQAFRAVLDALARPGQVRRIGPALPDV
FT                   ALGGAMARLLLSLSDDETPVWWQRADAGLQHWLRFHTGAGLAERPEAASFAVFTGIHQG
FT                   FALSDFASGTAAAPEFSSTLLIELPGLADGPALEWRGPGIRDVQCVGLQGLPDDFWAQW
FT                   QANHAAFPRGVDIVFTCGEDALGLPRTTRVRRLEGV"
FT   gene            complement(147736..148200)
FT                   /locus_tag="Rfer_0145"
FT   CDS_pept        complement(147736..148200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0145"
FT                   /product="phosphonate metabolism PhnG"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67905"
FT                   /db_xref="GOA:Q222Z8"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z8"
FT                   /protein_id="ABD67905.1"
FT                   /translation="MTSNILTSDYPTRLAWLAVLARATLTQLEDMLPAAGELPELKPVR
FT                   APEIGMVMLRGRVGGTGNPFNLGEASVVRCAVRLGNGPLGVSYALGRDKRRAELAALFD
FT                   ALLQDPQHHDDLQRDLIAPLALGQAQARAQKQRDGAGSKVEFFTFVRGEA"
FT   gene            148533..149291
FT                   /locus_tag="Rfer_0146"
FT   CDS_pept        148533..149291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0146"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67906"
FT                   /db_xref="GOA:Q222Z7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z7"
FT                   /protein_id="ABD67906.1"
FT                   /translation="MTFEQLTTSSPGRRSGVAVWRQIADTLTTEIRDRAYAGTGRLPGE
FT                   VELSARFAVNRHTLRQAVAALQSEGLLRIEPGRGMFVQHELMDYALSRRTRFSENLLRQ
FT                   GLLPSKQLLTAREMPAPERAARELKLDKGAKVLMVEMLDEANDAPIGLATAYYPALRFA
FT                   GLLEMLAEGTRTTDILKHFGVQDYVREQSRITTQMPNDETARLLRQPGTRPLLCVECLD
FT                   VDMDGTPIKYGETVFCGDRVQLVVNAGGTA"
FT   gene            149288..149983
FT                   /locus_tag="Rfer_0147"
FT   CDS_pept        149288..149983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0147"
FT                   /product="protein of unknown function DUF1045"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67907"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z6"
FT                   /protein_id="ABD67907.1"
FT                   /translation="MKPRYAVYFAPEQGSPWWEFGSRWLGRDECEDVNKVQHALAEIGP
FT                   VELREITAQPRRYGFHATLKAPFSLSGSHNAADLTARLRALAATRKPVLLGPMQAVMLG
FT                   DFVALVPALGSDELMALAAACVTTLDDLRRPLSEADLARRRVEQLDAREQELLQQYGYP
FT                   YVLECFRFHLTLSGPLARPTAQRVLQAVAAPVAQLNATAPLVLDRLCLFVEPAPGQPFQ
FT                   RMADVALSA"
FT   gene            149980..150537
FT                   /locus_tag="Rfer_0148"
FT   CDS_pept        149980..150537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0148"
FT                   /product="Phosphonate metabolism, 1,5-bisphosphokinase
FT                   (PRPP-forming) PhnN"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67908"
FT                   /db_xref="GOA:Q222Z5"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z5"
FT                   /protein_id="ABD67908.1"
FT                   /translation="MSGLWVFVCGPSGAGKDSVMGWAATQLAARQDIVFARRMVTRPAL
FT                   PGSDHDPVTVRQFEHSMAAGGLVWRWEAHGFHYGIEARYAAQVAAGKIVVVNGSRAHAS
FT                   GLDATAQVRVVQIVADAAQLASRLEQRGRDAPHEVSRRLARNALFKDLRADHTILNQGA
FT                   LADAGRQLVDYLVAGALSSAWR"
FT   gene            complement(150598..151086)
FT                   /locus_tag="Rfer_0149"
FT   CDS_pept        complement(150598..151086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0149"
FT                   /product="N-carbamoyl-D-amino acid hydrolase"
FT                   /EC_number="3.5.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67909"
FT                   /db_xref="GOA:Q222Z4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z4"
FT                   /protein_id="ABD67909.1"
FT                   /translation="MIDRDNPSCPRYQWAICNDSLWAETFRVMGLQGVEMVLIGYNTPV
FT                   HNAPAPEHDDLSLFHNQLSMQASVYQNGTWVVGVAKAGMEEGVDSIGGSCIIAPSGEVV
FT                   ARCLTKGDEMAIARCDLDFCAIYKRTTFNFDLHRQPQAYGLITQRKGETLAADGTQTS"
FT   gene            complement(151079..152194)
FT                   /locus_tag="Rfer_0150"
FT   CDS_pept        complement(151079..152194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0150"
FT                   /product="putative DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67910"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z3"
FT                   /protein_id="ABD67910.1"
FT                   /translation="MAEPLKTQFGTEVPVRIAAMISRAWHAFDQDAFLKDALDGYTSLE
FT                   LMPRGRWIAQALHRHLPQDYEVALAVLMDSIGPKLDGTEDFGMASFFYLPHTCFVAAFG
FT                   LDHFEVSMRAQYELTQRFTAEFSIRPFLERHPQATLSRLKDWASDPSPHVRRLVSEGTR
FT                   PRLPWALRLRAFQQDPQPVLALLELLKDDPELYVRRSVANSLNDIGKDHPLLLVETARR
FT                   WLVDAPDERRWLVQHALRSAVKRGEAGALGVLGFGVSAMVSVSGARIAPQRVVMGGAVT
FT                   IAFDVCNTESRPQRALVDLRVHFVKANGKSSPKVFKLKVLDLQQQTTVRLSKTISLVVM
FT                   TTRKHYPGVHQVDVVINGTTQALGQFELAHD"
FT   gene            complement(152208..152903)
FT                   /locus_tag="Rfer_0151"
FT   CDS_pept        complement(152208..152903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0151"
FT                   /product="Helix-turn-helix, type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67911"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z2"
FT                   /protein_id="ABD67911.1"
FT                   /translation="MSKAERLFHLYALLRSRRTAMTAEAIAAVLEVSVRTVYRDVQALS
FT                   QSGAPIDGEAGVGYLLRPGFDLPPLMFTPEELLALMVGARMVQAFTDPDLARSARQSEQ
FT                   KIRSILTDSLKLNAERQPYRIPILDSDDGLREVHRTLRLACEGRKKVRAVYCDEQQQRT
FT                   ERVLWPLGIIGWTGRWTLLAWCETRSDYRNFRFDRFDAVACLDERFPPRPDVNITHYFE
FT                   TVLGVPDKD"
FT   gene            complement(152914..153213)
FT                   /locus_tag="Rfer_0152"
FT   CDS_pept        complement(152914..153213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67912"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z1"
FT                   /protein_id="ABD67912.1"
FT                   /translation="MIKTVEAFTYKLAVGTVPSAFVAANGKVNEWLKKQPGFLKRELSQ
FT                   LEDDSWLDIAHWKSAAEAKQAGEKFMTELSDCECMSMIDPDSNKMSHGELHLAI"
FT   gene            complement(153291..153830)
FT                   /locus_tag="Rfer_0153"
FT   CDS_pept        complement(153291..153830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67913"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Z0"
FT                   /protein_id="ABD67913.1"
FT                   /translation="MHYAAFFRNLNLGRPNAPTKVQLEQAFLDAGAQEAASFLTNGTLV
FT                   FSVGARRSPDRVLAKASKLLNSVCGLVEPGFLRSVPYLAGLVAADPFATVVDASVYEYC
FT                   VTFLHPAAEVPATLSLRSRRGDVEVFRFTGTEALSLSRKIGNTAGSPNALLEKQLGLPA
FT                   TTRNWNTVRRLALAHS"
FT   gene            complement(153968..154474)
FT                   /locus_tag="Rfer_0154"
FT   CDS_pept        complement(153968..154474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0154"
FT                   /product="DinB"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67914"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y9"
FT                   /protein_id="ABD67914.1"
FT                   /translation="MSQKILSSLFAQKSWANRELFDVLASMTSTDQAASLHTAIRTLNH
FT                   IYVVDRIFRAHLAGEKHPYTATNTPETPALGELHIAVAETDLWFEDYASKITGQALAES
FT                   LSFQFTDGDSGSMTREEMLFHVLTHGSYHRGNVGQILKGISVAPPRDLYTKFLHVHEPA
FT                   RREAE"
FT   gene            complement(154779..155309)
FT                   /pseudo
FT                   /locus_tag="Rfer_0155"
FT   gene            complement(155317..156342)
FT                   /locus_tag="Rfer_0156"
FT   CDS_pept        complement(155317..156342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67915"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y8"
FT                   /protein_id="ABD67915.1"
FT                   /translation="MTRISAGHVSRQSLSHVMNLLPPFDSSALSRLAERTEYETWFLEA
FT                   VYTLVEQELFPTWPDAVVYPVDKSKAQFLAYLRGNIILGDWRSGFLNAGAPLVFVSTFK
FT                   LLDMLIEWILEENGIPPTFRFQQKLQNLKSSLIFPQFIESRPWLKERLTGLYSTLEPLR
FT                   GTIIHDRHFTATDGAVRVSSSRKGIIGSAIDISATQLRKLTVTIMSVLRYVDGTWQLDE
FT                   FREKILRHELDELVTLHGLPLIGQKLPFHTCVRVYLKGSDPFDVDPMVIRRDIATRYVD
FT                   QDCSFDLRVLMVKGHEVVDAYLFPWTLVATARSDWHQGIDAQHFRTTIPEDIKPDHFDT
FT                   G"
FT   gene            complement(156648..157613)
FT                   /locus_tag="Rfer_0157"
FT   CDS_pept        complement(156648..157613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0157"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67916"
FT                   /db_xref="GOA:Q222Y7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y7"
FT                   /protein_id="ABD67916.1"
FT                   /translation="MPRYLNVALGQLGPIQRADSRTQVVARLCELMRQAHAVGAQLIVF
FT                   PELALTTFFPRWYIEDEAEINSFFEQSMPNAATQPLFDLSKALGVGFYLGYAELAQEAT
FT                   GAVRYNTSILVDRSGQIVAKYRKVHLPGHKEHEPWRRFQHLEKRYFTAGDGWEVTQAFG
FT                   GVVGMAICNDRRWAETYRVMGLQGVEMVLIGYNTPVHNAPAPEHDDLSLFHNQLSMQAG
FT                   AYQNGTWVVGVAKAGVEEGVDSIGGSCIIAPSGEVVARCLTKGDEMAIARCDLDFCAIY
FT                   KRTTFNFDLHRQPQAYGLITQRKGETLGADGTVWAAPSGV"
FT   gene            complement(157597..158868)
FT                   /locus_tag="Rfer_0158"
FT   CDS_pept        complement(157597..158868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0158"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67917"
FT                   /db_xref="GOA:Q222Y6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y6"
FT                   /protein_id="ABD67917.1"
FT                   /translation="MTSPQINAGRLLASLHALGQIGALPGGGVNRLALSDADREGRDWT
FT                   VARMRELSMRVDIDAIGNIVGTFPGTEDLPPVMVGSHIDTVRTGGLYDGNYGVLSGLEV
FT                   VTALREAGVQPRRPLAVAVFTNEEGARFQPDMMGSLVYVGGLPLPDALATCDADGVSVQ
FT                   AELQRIGYQGTAPVGAPLVDSYVELHIEQGPVLEQLGLQIGVVEGVQGISWTEFTVEGQ
FT                   SNHAGTTPMALRHDAALVAAQVAVFMRALSARLGGRQLATVGAVRLSPNLVNVIAQKAV
FT                   FTVDLRNTDSAALAQAESDLHAYAQQAAQAEGVRITSRTLARFEPVAFDPMVVNLVEQQ
FT                   TQALGCTYQRMPSGAGHDAQMLARVCPSAMVFVPSVGGLSHNVREHTAPADLQRGAQVL
FT                   LQVVLALANRPSQLLPLNFYAPLP"
FT   gene            complement(158865..160097)
FT                   /locus_tag="Rfer_0159"
FT   CDS_pept        complement(158865..160097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0159"
FT                   /product="Diaminopropionate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67918"
FT                   /db_xref="GOA:Q222Y5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y5"
FT                   /protein_id="ABD67918.1"
FT                   /translation="MPQLAKHPFTLLPNARFQQAEPYGAHRSTLLSASALAQAQTVITS
FT                   WPGYTVTRLCSLPVLARTAGVASIHYKDEATRFGLGSFKGLGGAYAVARLLCRELGQRL
FT                   GRPVSHADLQSDPALRQACGDITVTCATDGNHGRSVAWGAQMLGCRCVIYIHATVSEGR
FT                   KDAIARYGAQVVRTAGNYDDSVQQADRDAKTNGWFVISDTSYPGYMDIPRDVMQGYQLM
FT                   VHEAVSALPQWPTHVFVQAGVGGFAAAVCAYFWERSAEQRPVFVVVEPERADCLLQSAR
FT                   AGAVVAVKGDLDTLMAGLACGEVSLLAWDILATGANAFCTIPDAAAVDTMRLLASPQGG
FT                   DPVIVAGESAVAGLAAALLAAHDSTARASLGLGVESRVLLFGSEGDTDPALYQQLVGRS
FT                   AAQVLQDGASV"
FT   gene            complement(160112..160963)
FT                   /locus_tag="Rfer_0160"
FT   CDS_pept        complement(160112..160963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0160"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67919"
FT                   /db_xref="GOA:Q222Y4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y4"
FT                   /protein_id="ABD67919.1"
FT                   /translation="MTQIITLRERIQAHYEALSLVDRKLADVVLVHEKDLLAYSATELA
FT                   ALAGVSKASTARFFKRLGFADFLAFRQHQRKSAPQPSPLGRVAQQGLRANPLQQHVAQD
FT                   AQQLQALADAVTDQSVQQAAKLLAGARRVWVVGYRNGYMTASYARALLSQVRAEVHLLN
FT                   EGAGEDAELLAEIQRGDVLLAMDFRRRTRRLSQVVGIACDAGAALVLVSDARVSTLAAR
FT                   AQALFICPPQGEAIFDSYVGVISLINYLATATLAHLPQKARARMAAIEQVHAQLDDLEP
FT                   SL"
FT   gene            161181..161978
FT                   /locus_tag="Rfer_0161"
FT   CDS_pept        161181..161978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0161"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67920"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y3"
FT                   /protein_id="ABD67920.1"
FT                   /translation="MKFKLLSTLAGVFASAVLSLATPAHAADDSLSSILAKKSIALGVA
FT                   SDFPPYGYMGPDFKLTGVDVATAQLIADKLGVKAELVPVSTPNRIPYLQTKKIDLIVSA
FT                   LGKNPEREKVIDFTVAYAPFFQAVFGPKALSIKSFDDLAGKSIAVTRGTIQDDVLQKVA
FT                   PPTLKIQRFEDDATTVAAFISQQTQLLATGAAVAAAAVQKNPQVQAEYKLLLKDSPNFI
FT                   GVRKGETALMTKVNEILLAAKADGTLEKYSQKWLGRGTGVLPE"
FT   sig_peptide     161181..161261
FT                   /locus_tag="Rfer_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            162015..162677
FT                   /locus_tag="Rfer_0162"
FT   CDS_pept        162015..162677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0162"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67921"
FT                   /db_xref="GOA:Q222Y2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y2"
FT                   /protein_id="ABD67921.1"
FT                   /translation="MIEFNFGTVLAQWPMLLRGLGLTVTLTAFSALLGTLAGTACAWAR
FT                   LHGGPMLKRVVGAYVELVRNTPFIIQLFFIFFGLPSLGLRLSVEMASVLAMVLNLGAYA
FT                   CEIVRAGLQTTPRGQLEAAMSLALTPWQTFSRVVLPPALARIWPALVSQIIIVMLGSAV
FT                   CGQISAEELSQAANLISSRTFRSFESYIIVTGIYLLLAIALRQLLYWVGPRFIFSSR"
FT   sig_peptide     162015..162143
FT                   /locus_tag="Rfer_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.647) with cleavage site probability 0.484 at
FT                   residue 43"
FT   gene            162688..163332
FT                   /locus_tag="Rfer_0163"
FT   CDS_pept        162688..163332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0163"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67922"
FT                   /db_xref="GOA:Q222Y1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y1"
FT                   /protein_id="ABD67922.1"
FT                   /translation="MVQFSLWDIFTFLLGALRWTAALSLIAFIGGGLVGLGLLMLRFAK
FT                   LRGAATAVAWYVQIFQGTPLLMQLFLVYFGLALLGMDTSPLVAAAICLTLYASAYLTEI
FT                   WRGCVNAIPKGQWEASTSLALNFTQQMRHVILPQALHVAIAPTVGFLVQIIKGTALASV
FT                   IGFVELTKAGQMISNATYQPFLAYIFVGLLYFALCYPLSWWSQRLENRRLA"
FT   gene            163336..164094
FT                   /locus_tag="Rfer_0164"
FT   CDS_pept        163336..164094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0164"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67923"
FT                   /db_xref="GOA:Q222Y0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Y0"
FT                   /protein_id="ABD67923.1"
FT                   /translation="MTTSPNSPFALVDIRGLHKSFGATEVLKGIDLQVGRKEVVSIIGK
FT                   SGSGKSTLLRCINGLETFERGTLTVDGQALQHGDANAMRELRQQVGMIFQSFNLFPHLS
FT                   AGRNVMLAPTLVKDLPKEEAKARAQALLERVGLGSLFDRMPDQLSGGQQQRVAIARALA
FT                   MAPTVLLCDEITSALDPELVGEVLQVVEMLAVDGMTLILVTHEMAFARKVSDRVVFMHQ
FT                   GLIHEAGTPDEIFNRPQTPELRQFLSALRD"
FT   gene            164145..165929
FT                   /locus_tag="Rfer_0165"
FT   CDS_pept        164145..165929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0165"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67924"
FT                   /db_xref="GOA:Q222X9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X9"
FT                   /protein_id="ABD67924.1"
FT                   /translation="MATPPLTLDQLNAASLDDARAMVAGLYEHSPWIARAALQQRPFRS
FT                   LAQFKYALCQVATNAGKDAQLALLRAHPELAGRALADKSLTVESTHEPNKAGLTHCTPA
FT                   EFEKIQQLNSDYNARFGFPFILALRGPRGLGLQKAEIMATFERRLQSHPDHEFQEGLRN
FT                   VHRMAEIRLNDRFGRSIERGNLVWDWQEALAQYSDPGYAELGQLTVTYLTDAHRACAQR
FT                   ISNNMREAGCDKVHIDAVGNVVGRYKGTGASPKALMTGSHYDTVRNGGKYDGRLGIFVP
FT                   LACVQGLKRANKRLPFDLEIIAFAEEEGQRYKATFLGSGALTGDFKPDWLDQVDADGIS
FT                   MRQAMKQAGLCIDDIPKLKRIASDYMGFVEVHIEQGPVLSELNLPLGIVTSINASVRHT
FT                   GEMLGMTSHAGTTPMDRRRDAAAGVAELMLYVESRAAADSDSVGTVGILNVPGGSINVV
FT                   PGRCQFSLDLRAPTDAQRDAMASDVLARIEQIAKARGLHYHLTETLRASAAPSAPAWQQ
FT                   RWEAAVAALGLPLHRMPSGAGHDAMKLHDLLPQAMLFVRGENAGISHNPLESTSSDDMQ
FT                   LAVQAFEHLLNSLAQELS"
FT   gene            165970..167193
FT                   /locus_tag="Rfer_0166"
FT   CDS_pept        165970..167193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0166"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67925"
FT                   /db_xref="GOA:Q222X8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X8"
FT                   /protein_id="ABD67925.1"
FT                   /translation="MNHHEQLDAWIDTHFDEQVKFLQQLIQVPTDTPPGNNTPHAERAA
FT                   DLLDAMGLTTERHAVPHELVKAAGLQTITNLVVRRQYGVGRTIALNAHGDVVPPGEGWV
FT                   HGPYGGEIENGKIYGRAAAVSKCDFSTYAFAVRALESLGIALHGNVELLFTYDEEFGGE
FT                   VGPAWLLQNKLTKPDLMIAAGFSYQVVTAHNGCLQMQVTVHGKMAHAAIPETGIDALQG
FT                   ANKILTALYAQNTLYEQITSNVAGIKHPYLNVGSIEGGTNTNVVPARVTLKLDRRMIPE
FT                   ETPAEVEANIRQVIADAAALTPGITVEVKRILLANALKPLPGNKPLVQVLQKHASEVFG
FT                   ETIPVLGTPLYTDVRIFCEAGIPGVIYGAGPRTVLESNAKRADENLDLQDLRRATKVIA
FT                   RSLLDLLS"
FT   gene            167332..167970
FT                   /locus_tag="Rfer_0167"
FT   CDS_pept        167332..167970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0167"
FT                   /product="beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67926"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X7"
FT                   /protein_id="ABD67926.1"
FT                   /translation="MLRYLTVPVTPYQQNCSLLWCDQTMKTAVLDPGGDLERVLAQVAR
FT                   AGLVLDQIWLTHGHIDHAGGAAELALRFGLPIIGPHQADQFLIDGLALQGKMFGFAHVQ
FT                   TFTPTRWLNDGDTVKLGHSTLTVRHCPGHTPGHVVFYSSEANRAFVGDVLFAGSIGRTD
FT                   LPQGDHDTLIASITQRLWPMGNDTVFVPGHGPESTFGIERRSNPYVRDT"
FT   gene            168082..169398
FT                   /locus_tag="Rfer_0168"
FT   CDS_pept        168082..169398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67927"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X6"
FT                   /protein_id="ABD67927.1"
FT                   /translation="MKNRTSLHQLPQQNIFHKDDVFVLFGELFGRGYANGLVNEARKAG
FT                   MQIVGITVGRRDADNVLRPLNDQELAAAEAGLGGKIINVPLMAGFDLDAPAGEPTPTDL
FT                   LGSMTLKTWMDDKLDWAHIEKCREVGIRRFRDSVAEVMTLLNGMVPDGRNVFFAHTMAG
FT                   GIPKAKVFLAIANRVYKGRGDRFMSSQVLLESDLGKLILKNFDEVSANTFQHLIDASQT
FT                   IRARVETSGGQVRYSAYGYHGTEVLIDDSYEWQTYTNYTQGRAKMRLECIAQAAWSHNI
FT                   KATVYNCPEIRTNSSDIFAGVELPLILLLNALKKEGGGAWAEAQWQACRELLLEGVTLE
FT                   DVLQKVADFQGSEVMQGFRDFAAWPMPNSPAQADLTIGTSDEILKMHKDNKALITDLLS
FT                   SFVIEATGPLIFRESSAPAGPVLWLNHDIIARQLNQLHA"
FT   gene            169851..170921
FT                   /locus_tag="Rfer_0169"
FT   CDS_pept        169851..170921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0169"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67928"
FT                   /db_xref="GOA:Q222X5"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X5"
FT                   /protein_id="ABD67928.1"
FT                   /translation="MKTNLKTAITSALLLAAAAAALLGWGPWREQGLGEGFVSGNGRIE
FT                   ATEIAIATKLAGRVERILVAEGEFVKAGQPLAQMQIESLQAQREEALARLQQAQQAVSG
FT                   AEVQVAQQEANYQATLAVVAQRESDLDTAQRRLPRSEKLAQEGFFSSQLLDDDRAKVRS
FT                   LQASVSAAKSQAKAAQVGISAARNQISGAQANVRALEATLARIDVELADSELKSPRDGR
FT                   VQFLVAQPGEVLGGGGRVLNLVDLSDVYMTFFLPETVAGRVALGSDVRIVLDAAPQFVI
FT                   PAKVSFVASTAQFTPKTVETASERQKLMFRVRAQIDPGLLQRHLEQVKTGLPGVAWLKL
FT                   DSKAQWPSHLTVKAEP"
FT   sig_peptide     169851..169925
FT                   /locus_tag="Rfer_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.397 at
FT                   residue 25"
FT   gene            170918..173710
FT                   /locus_tag="Rfer_0170"
FT   CDS_pept        170918..173710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0170"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67929"
FT                   /db_xref="GOA:Q222X4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X4"
FT                   /protein_id="ABD67929.1"
FT                   /translation="MTLAPASPPVARLQGVTLRYKKNTALNDVTLDIPAGCMVGLIGPD
FT                   GVGKSSLLALVAGARAVQLGRVEVLGGDMARRLHRQAVCPNIAFMPQGLGKNLYPTLSV
FT                   EENLQFFARLFGHDVSERRRRIDGLTRSTGLHPFLARPVGKLSGGMKQKLGLCCALIHD
FT                   PDLLILDEPTTGVDPLARAQFWELITRIRGQHPGMSVVVATAYMEEAQRFDWLVAMDDG
FT                   RVLDTGTPTELLARTGHSTLESAFIAMLPEEKRRGHQRVEIVPLTLDDQAEVAIEARDL
FT                   TMRFGDFVAVDHVSFRIQRGEIFGFIGSNGCGKSTTMKMLTGLLPASEGQAWLFGKLVD
FT                   SRDMATRSRVGYMSQSFSLYGELTVQQNLALHARLFHVPDADLLSRVAESLARFGLREV
FT                   QDALPEQLPLGMRQRLSLAVATVHKPELLILDEPTSGVDPIARDNFWRLMIELARRDKV
FT                   TIFISTHFMNEAERCDRISLMHAGQVLESASPAQIMAKRGAATLEDAFIGYLKDADGDA
FT                   VDDTTGAPLSTETPAVVPAPDPVGAALGQTPAKGLAARLRRSLARIYSYQWRESLELQR
FT                   DPVRGALALLGSLLLMFVMGYGISMDVGNLRFAVLDRDQTTLSRDYTLNLAGSRYFVER
FT                   PPITDYAELDRRMRSGELSLALEIPPGFARDVARGQSVQIGAWIDGAMPQRAETVIGYA
FT                   QGMHQQWYAQQVRDQTGITPSSLISVETRYRYNPDVRSLPAMVPAVIPLLLLMLPAMLT
FT                   ALAVVREKELGSIINLYVTPVTRTEFLIGKQLPYLMLAMFNYGLMCLAAVTVFGVPMTG
FT                   SFATLTLAALIFSVCSTGMGLLASTVTRSQIAAMFFAMVGTMLPAVQFAGLINPVSSLE
FT                   GSGRWIGEIYPASHMLTISRGVFSKALGFADLQASFWPMLVAVPVIMGLAIVLLKKQEA
FT                   "
FT   gene            173712..174839
FT                   /locus_tag="Rfer_0171"
FT   CDS_pept        173712..174839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0171"
FT                   /product="ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67930"
FT                   /db_xref="GOA:Q222X3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X3"
FT                   /protein_id="ABD67930.1"
FT                   /translation="MRHHLANIYRLGIKELWSLWRDPMMLFLIVYTFTVAIYTAGTAMP
FT                   ETMHRAPIAVVDEDDSVLSARITAAFYPPQFTPPTRITLSEVDPGLDSGRYTFVLNIPP
FT                   NFQRDVLGGHAPQLQLNIDATRMSQAFAGNGAIQQIVMGEVNEFVQGYRGTTPMPVELA
FT                   TRARFNPALQPSWFGSLMEVINNITMLSIILTGAALIREREHGTVEHLLVMPVTPLEIM
FT                   LAKVWSMALVVLLAAVVSLTVVIQGVLKVPIEGSIALFLIGATLHLFATTSMGIFMATL
FT                   ARSMPQFGLLMMLTMMPLQMLSGGMTPRESMPVWVQQVMSLAPTTHFTELSQAILYRGA
FT                   GLAVVWTSFAALLLIGSALFALSLARFRKTISQMA"
FT   gene            175009..175545
FT                   /locus_tag="Rfer_0172"
FT   CDS_pept        175009..175545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67931"
FT                   /db_xref="GOA:Q222X2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X2"
FT                   /protein_id="ABD67931.1"
FT                   /translation="MARLLMLALKPPFERVAARHRGLLYGAAFVSALLLAGCAVEVENR
FT                   QAAQEVARLSKPPGSVYIGWRVFQGRCALCHGFVATGTAGAPDLLPIVREMGAHQFVSL
FT                   VLKRYDWNLPAAQAGSEGAAREALVEDIVQRKEQYMLTMPAWQGEPVASAHIMDLYAYL
FT                   SARAQGTQGPGRPAQ"
FT   gene            175699..176055
FT                   /locus_tag="Rfer_0173"
FT   CDS_pept        175699..176055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67932"
FT                   /db_xref="InterPro:IPR014229"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X1"
FT                   /protein_id="ABD67932.1"
FT                   /translation="MADIDNLFGKAISEIERMLNTKTVVGEPITVEGNTLIPLISVGFG
FT                   FGVGAGEGTDPKKGGGTGTGGGAAGGGGVKPVALIIINKDGVRVEPVKGGAASLLDKIA
FT                   DVAGKFAPNKPTAA"
FT   gene            176068..176676
FT                   /locus_tag="Rfer_0174"
FT   CDS_pept        176068..176676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67933"
FT                   /db_xref="GOA:Q222X0"
FT                   /db_xref="InterPro:IPR021338"
FT                   /db_xref="UniProtKB/TrEMBL:Q222X0"
FT                   /protein_id="ABD67933.1"
FT                   /translation="MGAVPVILAIIVGLPLLLLALPIDLAFRVEGIETFNGQIAIRWMF
FT                   GLVRFRVRIPGVNKSSRAPKVAPQATKVRVKPDKRSGRPNVLAVLRQAAFRRRVYRLAT
FT                   DLVRAAHLHRLHLRMRLGLGDPADTGRLWALVGPLNAVAQNLRNADVQIEAEYLDPVFE
FT                   FQARGRLLLVPLQFLILAIGFALSPASIRAWRTLKGRHA"
FT   gene            176669..176950
FT                   /locus_tag="Rfer_0175"
FT   CDS_pept        176669..176950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67934"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W9"
FT                   /protein_id="ABD67934.1"
FT                   /translation="MLERTRHTETVRAGTPVTHGAVMLLPIERVVLHSGRGDDRGSTRV
FT                   WFSAIKEPYALIVRDAGGLWAIDTDAAAVSLEALRQRVPELDTVLAAM"
FT   gene            176947..177093
FT                   /pseudo
FT                   /locus_tag="Rfer_0176"
FT   gene            177400..177918
FT                   /locus_tag="Rfer_0177"
FT   CDS_pept        177400..177918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W8"
FT                   /protein_id="ABD67935.1"
FT                   /translation="MTNSQTVHLIYGATAAGKSTYAKALATEKNAVRFAIDDWMHSLYG
FT                   QDKPEAMSMEWVMSRVARCQSRIWTTCLQILATGTDVVLELGLLREQVRDRMQAMVEEA
FT                   GHQASFSFVDADLQVRKQRVLHRNMEKGDTYSFNVTPAMFDAMERYFERPSQAELGRSL
FT                   VIAEDIKHG"
FT   gene            177911..178387
FT                   /locus_tag="Rfer_0178"
FT   CDS_pept        177911..178387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0178"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67936"
FT                   /db_xref="GOA:Q222W7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W7"
FT                   /protein_id="ABD67936.1"
FT                   /translation="MGKPTNVKFTTKNSSESLEFCLRLTRAYATLTRRLDNALSNLHGL
FT                   SFSDFMILYYLDRAPDSRLRRIDLAERLGVTASGVTRSLLPMEKLGLVSRQPDPRDARV
FT                   GYASLTDAGQQLLKYALASIEPIAKEAIQKVPAEQIGPFLLVLGELAGINLSNN"
FT   gene            178617..178910
FT                   /locus_tag="Rfer_0179"
FT   CDS_pept        178617..178910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0179"
FT                   /product="HicA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67937"
FT                   /db_xref="GOA:Q222W6"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W6"
FT                   /protein_id="ABD67937.1"
FT                   /translation="MLALSKDNAIILPMNSKHRKTLEALLADPVNGNIEWARIEALLVA
FT                   LGCRVIEGPGSAVTFEHNGRRANFHRPHPAKEALRYRVKAAREFIEKIGAST"
FT   gene            178907..179242
FT                   /locus_tag="Rfer_0180"
FT   CDS_pept        178907..179242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0180"
FT                   /product="HicB"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67938"
FT                   /db_xref="GOA:Q222W5"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W5"
FT                   /protein_id="ABD67938.1"
FT                   /translation="MNKMTYKGYTAQMEFDTEDKIIVGRVIDIDDIITFHGASVVEFEK
FT                   AMQTAIDGYLFACEQLGQSAEKPASGRLMLRIDPAVHAAAAKASARSGQSLNKWAEKAL
FT                   NQAAHAG"
FT   gene            complement(179328..180782)
FT                   /locus_tag="Rfer_0181"
FT   CDS_pept        complement(179328..180782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0181"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67939"
FT                   /db_xref="GOA:Q222W4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W4"
FT                   /protein_id="ABD67939.1"
FT                   /translation="MLNDMKPIHVNVAVIGAGTAGMGAYRAARAHTDSVLLIEGDVYGT
FT                   TCARVGCMPSKLLIAAAEAAHQARHTEAFGVQVKDITIDGAAVMARVQRERNRFVGFVL
FT                   ETVEAIPPCDRLKAKVSFQDANTLVTEHGQLIHAQRVVIATGSIPMLPPVLKGLSAHLL
FT                   TNESVFDLPTLPTSLAVFGPGILGMELAQAMSRLGVKVKVFGVGGGIAGIRDPAIRDYA
FT                   NKVLNEEFYLDASAQVKSVKEWAGGVEVHYLHRDGAWQTEPFEYVLAAAGRTPNLAGLV
FT                   LENTGLQLNERGVPVFDRFTQQCGSSAIFIAGDASNDIPLLHEAADQGRIAGENAGRYP
FT                   DIQPGLRRTPLAVVFTDPQIASVGFNLKQLNQQFKDRFAEGLVSFEDQGRSRVMLRNKG
FT                   ILKVYGEHGSGLFLGAEMFGPAAEHTGHLLAWAAQQRMTVSGMLEMPFYHPVIEEGLRT
FT                   ALRDLNHKLRIGPPVIERCMDCGPGA"
FT   sig_peptide     complement(180690..180782)
FT                   /locus_tag="Rfer_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.663) with cleavage site probability 0.516 at
FT                   residue 31"
FT   gene            180982..181188
FT                   /locus_tag="Rfer_0182"
FT   CDS_pept        180982..181188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67940"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W3"
FT                   /protein_id="ABD67940.1"
FT                   /translation="MKHSPNPRDKQAPHTGKVENDSNKQGEQAPTQLNQGQRTPDSRSD
FT                   RESHVGGSNQSQSRRGPVGTPKR"
FT   gene            complement(181202..182005)
FT                   /locus_tag="Rfer_0183"
FT   CDS_pept        complement(181202..182005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0183"
FT                   /product="Phosphonate uptake transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67941"
FT                   /db_xref="GOA:Q222W2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W2"
FT                   /protein_id="ABD67941.1"
FT                   /translation="MRAAPQPRPDFLEVQTPRTNLLGLLAWGLLLALLAGSWRGADMRP
FT                   FDLVRDAGNMATYAFDFFPPKFGDWRLYLQEMIVTLEIALWGTALAVVFAVPLGLLSSV
FT                   NITPWWIHQPIRRLMDAARAINEMVFAMLFIVAVGLGPFAGVLALFVHTTGILAKLFSE
FT                   AVESIDAQPVEGIRATGAHALEEIVYGIIPQVLPLWISYSLYRFESNVRSASVVGMVGA
FT                   GGIGVILWEIIRGFQYAETCAVMIIIIVTVTVIDVISARIRKSLI"
FT   gene            complement(182005..182973)
FT                   /locus_tag="Rfer_0184"
FT   CDS_pept        complement(182005..182973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0184"
FT                   /product="Phosphonate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67942"
FT                   /db_xref="GOA:Q222W1"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:Q222W1"
FT                   /protein_id="ABD67942.1"
FT                   /translation="MIKKLLASLAGAALIAIHPVSAQELKEINFGIISTESSQNLRSDW
FT                   QPVLDGMAKKTGMKVNAFFAPDYAGIIEGMRFNKVHVAWFGNKSAMEAVDRAGGEVFAQ
FT                   MVNADGTQGYYSHLIVHKDSPIKSLDDMLKQGKNLSFGNGDPNSTSGFLVPSYYVFAQN
FT                   KIDPKTFFKLTRSANHESNALAVANKQVDVATNNSENLDKLKEKLPEKFNDIRVIWTSP
FT                   LIPLDPLVIRKDLPEATKAKVRDFFYTYGQGGQQEKDNLFKLSKLSGFKASSNGQLIPI
FT                   RQLELFKARNKFEADANLAAADKQSKLADIDKQLAALGKVQ"
FT   sig_peptide     complement(182905..182973)
FT                   /locus_tag="Rfer_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(183015..183896)
FT                   /locus_tag="Rfer_0185"
FT   CDS_pept        complement(183015..183896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0185"
FT                   /product="Phosphonate ABC transporter PhnC, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67943"
FT                   /db_xref="GOA:Q222W0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q222W0"
FT                   /protein_id="ABD67943.1"
FT                   /translation="MGIAISINALNKTFRGGRKALHDIHLDIKAGEMVALIGASGSGKS
FT                   TLLRHMAGLMAGDGAGQGLIQIHGQTVQQNGRIAADIRRTRAGVGFVFQQFNLVDRLPV
FT                   IVNVLAGTLHRVPLWRSLLRWFTPSEVARGVEALRRVGIAECCAQRASTLSGGQQQRAA
FT                   IARAMVQGARVILADEPIASLDPESSRKVMDILARVNREDQCTVVVSLHQVNVAIKYCP
FT                   RTVALHQGRVVYDGPSVALTPTLLRELYGADADDILALGDHITSLQDNKPVAPHLVWPA
FT                   ALAARAPLASAA"
FT   gene            183947..185218
FT                   /locus_tag="Rfer_0186"
FT   CDS_pept        183947..185218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0186"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67944"
FT                   /db_xref="GOA:Q222V9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V9"
FT                   /protein_id="ABD67944.1"
FT                   /translation="MSVGSVICSSAASGLRVRACNAVKMQVSFYGSTPMNRHLWLLAIC
FT                   QGLFLTNNVTFIAINGLVGLSLAPLGWMATLPVMGYVVGGALSTGLVARTQHRFGRKVS
FT                   FQMGLLVALASSLLCAYAAVSRNFWLLCSATVVAGYYNANANLYRFAAAELTTLAWREE
FT                   AVSLVMAGGLIGAVLGPNLAAQTRTLTSVPFAGAYLALAGVALLAMLVLAFINFPPPPV
FT                   KKSTGSGRPLGEIMRQPVFIVAAAAGALSFGVMNLLMAATPLAMQQCSLPFSDVALVLE
FT                   WHVIGMFAPGFFTGHLIKRFGTLTIMGVGVALNALCILVALSGVDLQQFLIALFLLGVG
FT                   WNFLFTGSTTLSLQTYSPEEKDRAQGALNFFVFATLAVSSLASGVLVTTRGWQLLNVGS
FT                   LLPVACTAAALVWLWLRQVRARVA"
FT   sig_peptide     183947..184006
FT                   /locus_tag="Rfer_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.602) with cleavage site probability 0.560 at
FT                   residue 20"
FT   gene            complement(185215..186105)
FT                   /locus_tag="Rfer_0187"
FT   CDS_pept        complement(185215..186105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0187"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67945"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V8"
FT                   /protein_id="ABD67945.1"
FT                   /translation="MSLALDPRQRAMLQEMGVRVWLPAAAADLAAPALPAAVQAAPEAP
FT                   SNAIENVATNITTTGATAQKILKTSAPPETRGTATGSGVPATDVAGLDWPALTQAIATC
FT                   QACPLCIGRRTAVQAAPDAPRLADWLLVGEPPDDADEQAGAPFAGAAGQLLDNMLKALG
FT                   LSRHAGSGVAAPAAQATTAAYVTPIVKCRPAQTRNPTQAELASCENYLRREVALVQPKV
FT                   ILALGRFAAQGLLQGSLPGLAGTPLGQLRGQIYRYQGIPVIVSYPPSYLLRSPQHKARA
FT                   WVDLCQAQEALRRGG"
FT   gene            complement(186147..186614)
FT                   /locus_tag="Rfer_0188"
FT   CDS_pept        complement(186147..186614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0188"
FT                   /product="SSU ribosomal protein S18P alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67946"
FT                   /db_xref="GOA:Q222V7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V7"
FT                   /protein_id="ABD67946.1"
FT                   /translation="MSAVPKTVEVRFEPLTPGQLDAVLHVEQQAYAHPWGRRNFEDSLK
FT                   AGNQIQLLMAQDTLLGYFVAMKGVDEVHLLNITVAPDYQRQGWAQVLLDALTLWARGQG
FT                   AEWLWLEVRVGNARAIKVYEAHGFCRVGQRKNYYPGDDGQREDAIVMSLRL"
FT   gene            complement(186611..187330)
FT                   /locus_tag="Rfer_0189"
FT   CDS_pept        complement(186611..187330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0189"
FT                   /product="peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67947"
FT                   /db_xref="GOA:Q222V6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V6"
FT                   /protein_id="ABD67947.1"
FT                   /translation="MNLLAFDTSTDIMSVAVQRANAAGAATAQPSVWQHSGPGGAQTSA
FT                   QLIPTIQRLMAQAGLQFADLDAIVFGRGPGSFTGLRTACSVAQGLAFGANLKVLPIDTL
FT                   LAVAEEARFQQASALAHWQVLALLDARMDEMYAASYVFNSGKWKQIKDYSLIRPENLTQ
FT                   DDDCPLAGNVFANYGARLPGVAPRIEALPAACALLRLAPALLSAGGAVAAGQALPLYIR
FT                   DKVAKTTLERATEKAAP"
FT   gene            complement(187418..188383)
FT                   /locus_tag="Rfer_0190"
FT   CDS_pept        complement(187418..188383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0190"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67948"
FT                   /db_xref="GOA:Q222V5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V5"
FT                   /protein_id="ABD67948.1"
FT                   /translation="MVTVLVWTSFILIARASSDPARGGTLTPFDLAFCRIVGASLVLLP
FT                   WGALLVYRDRDRGIHQSSLLGVSPLSWRVTATVGLFGGLLYALLAYNGFVFAPAAHASV
FT                   LMPGSLPLWTALLAALILHDHITPVRALGLGLIVLGDLLVGGRSLIGAFDGGEVWKGDL
FT                   LFMLAALTWACYSVLARRHHLNAVRATIAITAFAFVTYVPVYTVLLLGGWVHGQVFSAP
FT                   LREVLFQAVFQGWGSVVVSGITFTKMIQHFGPVRSTMITALVPGLSALGAVLLLGEPLY
FT                   WNLAAGLVLVTLGILFGIRVALPVATKTIAAQAGSTVARG"
FT   gene            188463..189962
FT                   /locus_tag="Rfer_0191"
FT   CDS_pept        188463..189962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0191"
FT                   /product="D-Ala-D-Ala carboxypeptidase PBP3. Serine
FT                   peptidase. MEROPS family S13"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67949"
FT                   /db_xref="GOA:Q222V4"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V4"
FT                   /protein_id="ABD67949.1"
FT                   /translation="MARRWLDNRCMSSPIRLLAILIGALTLWPALAQNLPPEVDAALAR
FT                   ARVPRDAVSLLVMDAEGKLPPRLSHRATVPMSPASVMKLVTTYAALDLLGPAYSWRTPV
FT                   YVEGSVKNGTLFGNLYIKGQGDPKLVAERLWLLLRRVQGLGIQKIAGDVVLDHSAFEPL
FT                   DVDPASFDGEPLRPYNVAPDALLLNFKSVVMTFVPDLVANSASVQFEPPLYGVQMQASV
FT                   PLANGTNGTKGAQGTNGSCGDYRAALKADFSDPARIRFAGSYPASCLEKAWPVAYADPA
FT                   SYNARAVQGLWQQMGGQLGGTVRLGSVPPQALGLPPKFEVASPPLAEVIRDINKYSNNV
FT                   MAQQLFLTLSLNAQGQGTRAASRDLVQRWWQQRISATDVPTLDNGAGLSREARISAQAL
FT                   ARLLQTAYVSPLMPELMSSLPIAGVDGTLKRSQAQSQGRAHLKTGSLRDVVAVAGYVHA
FT                   ASGRRYVLVALINHPNANAARPALEALLDWTVRDNGAHVPD"
FT   sig_peptide     188463..188561
FT                   /locus_tag="Rfer_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.986 at
FT                   residue 33"
FT   gene            189949..190203
FT                   /locus_tag="Rfer_0192"
FT   CDS_pept        189949..190203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67950"
FT                   /db_xref="GOA:Q222V3"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V3"
FT                   /protein_id="ABD67950.1"
FT                   /translation="MSLTELFGYCAAVLTTISFVPQAWHTFKTRDVRGISLGMYSVFTF
FT                   GVACWLIYGLLLGAWPIVIANVVTLVLAGGILVMKLRFR"
FT   gene            190357..192348
FT                   /locus_tag="Rfer_0193"
FT   CDS_pept        190357..192348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67951"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V2"
FT                   /protein_id="ABD67951.1"
FT                   /translation="MKQFRVLATALAAALLVAACGGGGNGDQTPPVKYSAVVSFGDSLS
FT                   DAGTYNVGPIKNAGGGMFTVNGIAGAIGADTVPSDNWAQLVSASAVGKTSCSARVGGFG
FT                   VAETAVAGCTNYAQGGSRVTDPNGIGNASGGAVAAGTTTAGALTEPVVTQIANYVKDSG
FT                   GFTGNELITVLAGPNDLFAQLTKLTVDATAAGNAAGNTAFATAVVGALAADSTNPATAA
FT                   TAIGTAMPQAQAAAAKVAGATTTTIMQAAVTGAVQAAALAGNTKVMDMTYINGVVTTAK
FT                   DFATAAGTAAGNQTFAGTLIGALAADATTPATAGPIIQTAFVTEAAKGSAMNVVVGAAA
FT                   AAAAGQGNTKVVTDPTYVPTLVANATTAANAAGAAAGATAFATKLAGLLAADATVPATA
FT                   GPAIGAAMAAAKATASAAPGATADSVNTAVVTAAVQAAAAAGNTKVMNMTYINAIAASA
FT                   QASATTAGTAAGNQYVATTGAANAGVGVVTAAATLAGYVKDMVNKGAKHVVVLNLPDMS
FT                   LTPSARSTIIYNADGSIKDNSSQRLVLALVKAFNAELQKDLGVTLGVPANGVLLVDFFT
FT                   NMQNNVNDPGHYALTNTKDVACNLTAPANALATVGLDDGSSLVCNGSNLIAGDTSHYMF
FT                   ADKVHPTPYSHKLLSQVVNKIMIQAGWL"
FT   sig_peptide     190357..190437
FT                   /locus_tag="Rfer_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.655 at
FT                   residue 27"
FT   gene            192375..193058
FT                   /locus_tag="Rfer_0194"
FT   CDS_pept        192375..193058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0194"
FT                   /product="OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67952"
FT                   /db_xref="GOA:Q222V1"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V1"
FT                   /protein_id="ABD67952.1"
FT                   /translation="MKHQMKFLAIAAAAMLAAGSVCAQTAGTWMVRAGATRLAPVGPSG
FT                   CMTAPDYGDGSGCTRSNVSANTQLAGGITYMYTDNISVDVPLALPFKHDVIGAGSMEGA
FT                   GKLGEVKALPMTVFLQYRFLEANAKFRPYVGLGVTYAYFFDEQGSYHLTQTTNPGGPPT
FT                   SFTVDAKFILTPQIGATLALNDKWFIDVFYSKAKLSTTTHFSSGQTMPADLDPAAYGIA
FT                   VGYKF"
FT   sig_peptide     192375..192446
FT                   /locus_tag="Rfer_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.853 at
FT                   residue 24"
FT   gene            complement(193116..194285)
FT                   /locus_tag="Rfer_0195"
FT   CDS_pept        complement(193116..194285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0195"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67953"
FT                   /db_xref="GOA:Q222V0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q222V0"
FT                   /protein_id="ABD67953.1"
FT                   /translation="MILDGFAASSIALGAQRIRAGGLLGLPTETVYGLAADAENDTAVA
FT                   QIFTAKGRPADHPLIVHVRDAVCVGHFAAQVPDFADRLMQAFWPGPLTLILPRRPGVAS
FT                   AAAGGQDTIGLRCPSHPVAQMLLQALLQNGGQNPTHSESAKPQAKELASQPHGVWGIAA
FT                   PSANQFGRVSPTTAAHVQSEFGPDLLILDGGACTVGIESTIIDCTRGQPVLLRPGAITR
FT                   EQVQAACGLKVLLKDELATDAAPAPKASGTLESHYAPKATVRLMDAAALRAALARWVAD
FT                   EAAMGPAAGVAVATRARAQAPALPTIAVYARSVHPNQSSRLLSQHMPADATAAARELFA
FT                   VLRRLDAQGVQQIWIETPPAGAEWDGVRDRLQRAASQVGNPSWRDRRQP"
FT   gene            complement(194300..195514)
FT                   /locus_tag="Rfer_0196"
FT   CDS_pept        complement(194300..195514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0196"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67954"
FT                   /db_xref="GOA:Q222U9"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U9"
FT                   /protein_id="ABD67954.1"
FT                   /translation="MSGKTILPGTTGTAATAGSGQQTTLGVMGGGQLGRMFVQAAQAMG
FT                   YFTAVLDPDVISPAGLVSHYHIQSDYLDQQGLAQLMQRCAAITTEFENVPAPALVTLGA
FT                   HRPVAPGAEAVGIAQDRIKEKAHFVRCGVPVAPYAVIESAAQLAAVADDLLPGILKTAR
FT                   LGYDGKGQLRVSSRAELAAAWDELKNVACVLEKMLPLQAECSVIVARGWDGSCVNFAPQ
FT                   LNLHRDGILAVTQAYEGNMPSALVQQAVEATKSIANELRYVGVLCVEFFLLQDDSKAAQ
FT                   TLGSLIVNEMAPRPHNSGHYTLDACDLSQFDLQVRTLTGLPLLQPRQHSPAIMLNLLGD
FT                   LWIDGASPPWDQVLALPGAHLHLYGKLKASKGRKMGHLTFTGATVAEVRATALAAARLL
FT                   GIEAF"
FT   sig_peptide     complement(195452..195514)
FT                   /locus_tag="Rfer_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.644) with cleavage site probability 0.272 at
FT                   residue 21"
FT   gene            complement(195511..195978)
FT                   /locus_tag="Rfer_0197"
FT   CDS_pept        complement(195511..195978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0197"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67955"
FT                   /db_xref="GOA:Q222U8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U8"
FT                   /protein_id="ABD67955.1"
FT                   /translation="MGSSSDWDTMQHAVHILQQFGITHEARVVSAHRMPDDMFAYAETA
FT                   RARGLQAIIAGAGGAAHLPGMLAAKTTVPVLGVPVASRHLSGVDSLHSIVQMPKGVPVA
FT                   TFAIGAAGAANAALFAVAMLANHDTALRTQLDAFRAAQTETARGMTLPPRL"
FT   gene            196037..197017
FT                   /locus_tag="Rfer_0198"
FT   CDS_pept        196037..197017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0198"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67956"
FT                   /db_xref="GOA:Q222U7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U7"
FT                   /protein_id="ABD67956.1"
FT                   /translation="MAGCGLSRKLIKLNFTYPQPELPPMMNVTIANFDAEVVAASMTVP
FT                   VLVDFWAPWCGPCKVIGPLLEKLETAYAGRFKLVKIDSDQEQELSQAFGVRSIPTCVLM
FT                   FQGKPVDGFMGALPEGEIKAFLDKHLPAGEVLEAEVTAETVSDAPDENDPDAIREALQQ
FT                   AVLKNPDDEEARFNYVKRLLQEGRTDDAKVAFAPVIAKTALVRRFDSLQRWMDAIDFVA
FT                   DRADLTGAISGFDAKIAANKRDFDARFGKAQSLIAAQDWTDAMDELLEILMRDKSWADD
FT                   LARKTYIAILDIIEPPKVKVADGQIPPVDPVVASYRRRLSSVVLS"
FT   gene            complement(197046..198479)
FT                   /locus_tag="Rfer_0199"
FT   CDS_pept        complement(197046..198479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0199"
FT                   /product="Iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67957"
FT                   /db_xref="GOA:Q222U6"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U6"
FT                   /protein_id="ABD67957.1"
FT                   /translation="MSQVIKIHPMEDFKERSRGVLNDPGQRKNFRGAMDFLMAKRRAQF
FT                   PDPEELQGLRDLGSAIRRYSLAHLPRLLEQLEAKLTANGVRVHWAQTPDEANAIALGIA
FT                   QRVKAKRIIKGKSMVSEEVGFNHAMEAAGIEAFESDMGEYIVQLAGETPSHIIMPAIHK
FT                   TKQEIAKLFADEIAGVAYTEDVDALIRIGRKVLRHKFADADIGLSGVNFCVAETGTLCL
FT                   VENEGNGRMCTTVPRVHIAITGIEKVVEKLEHVPPLYSLLSRSATGQAVTTYFNLISGP
FT                   RQPGEKDGPEEVHLILLDNGRTQAYADEELRETLKCIRCGACMNHCPVYARIGGHAYGT
FT                   TYPGPIGAIISPHMLGLDATYPLAFASTLCGACVEVCPVKIPITDILVRLRNEAQARPD
FT                   SMEATLRGSGAARTTAGTAVWSVWAQVYSRLGLYKLASWFMSRGRALSPTEQGAWTRSR
FT                   TPLIPAPKRLRDLLKDRKP"
FT   gene            complement(198476..199150)
FT                   /locus_tag="Rfer_0200"
FT   CDS_pept        complement(198476..199150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0200"
FT                   /product="protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67958"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U5"
FT                   /protein_id="ABD67958.1"
FT                   /translation="MSARDSILARLRATSIAETLPLPDVKTWFDAHRRNEDTDQRVTRL
FT                   RAALQAVKTEVHDVSATDWIEALLRIAASKGLRNLLIGTGTAHGAALQARQPEHLKLLP
FT                   YADAIDSWRDVLFDDIDASLTLARSAIAEIGSLILWPNASEPRLMSLVPSVHFVLLDVA
FT                   TIHSDFHSAITTEGWKDGLPTNALLICGPSKTADIQQTLAYGAHGPRELVVLLRHAEGA
FT                   AA"
FT   gene            complement(199147..199950)
FT                   /locus_tag="Rfer_0201"
FT   CDS_pept        complement(199147..199950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0201"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67959"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U4"
FT                   /protein_id="ABD67959.1"
FT                   /translation="MEPTTQFPRQYPPKPRDVYLFATCLIDQFTPEAGLDTVRLLEREG
FT                   IKVHYLEQQTCCGQPAHSSGFPDEARAVALQQLNLFVEPWPVVIPSGSCGGMIRKHYPH
FT                   LFANDPVLHAKAVDLSERVYELSEFLVHVVNFSQPDLGTPCTVALHTSCHARREMGSHE
FT                   TSAALLDSLAHVNVVEQARIEECCGFGGTFAMRYPDISEAIATDKVAAIKDTGAERVVS
FT                   ADCGCLLNITGRAAKQDEVAGRTNPTLPGEHLASFLWRRTTQAAS"
FT   gene            complement(200101..200874)
FT                   /locus_tag="Rfer_0202"
FT   CDS_pept        complement(200101..200874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0202"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67960"
FT                   /db_xref="GOA:Q222U3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U3"
FT                   /protein_id="ABD67960.1"
FT                   /translation="MPARRPAITRLADTVAGELEKRILEGSLKPGDLLPSERDLAVELG
FT                   VSRPSLREAIQKLVAKGLLSTHHGSGTHVTDRLEAHFVDPWQDMLNGHPLLHQDLLEFR
FT                   QMLESQAACLAAERALDVDIQRLDAVYAALETTFASNDLQACIDQDVLFHQVIAEAAHN
FT                   VLIGHLSASLMRVIHGHISGSLAHLHAQPQRWEQLQSQHRAIWQAVREHRPEAAARAAR
FT                   SHIEFVRQSMEDSARQEERRLSAMRRLGTLAPVSV"
FT   gene            complement(200927..201844)
FT                   /locus_tag="Rfer_0203"
FT   CDS_pept        complement(200927..201844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0203"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67961"
FT                   /db_xref="GOA:Q222U2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q222U2"
FT                   /protein_id="ABD67961.1"
FT                   /translation="MNTSQPALHTSMLTSLPLLARGKVRDNYAVGIDRILMVASDRLSA
FT                   FDVIMGEPIPGKGALLTQMALFWFDKLGPKGLNLCPIHLTGDAPESVVTAAEVPQVTGR
FT                   SMLVKRLKPLPVEAVVRGYLAGSGWKEYQHNGAVCGVKLPAGLQNASKLPEPIYTPAAK
FT                   AAAGDHDENITFEQTVEMIGLDLATRIRDISIAIYKAASEIARAKGIIIADTKFEFGLD
FT                   ADGTLTLMDEVLTPDSSRFWPAESYQEGINPPSFDKQFVRDWLEQVQVNGKPWNKTPPA
FT                   PRVPDEVIAKTAAKYQEALTRLIG"
FT   gene            complement(202100..203164)
FT                   /locus_tag="Rfer_0204"
FT   CDS_pept        complement(202100..203164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0204"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67962"
FT                   /db_xref="GOA:Q222U1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U1"
FT                   /protein_id="ABD67962.1"
FT                   /translation="MALVSMRELLDHAALNGYGIPAFNVNNLEQVQAVMSAADEVGAPV
FT                   ILQASAGARKYAGEPFIKHLILAAIEAYPHIPLVMHQDHGQSPDVCQGAINLGFSSVMM
FT                   DGSLMSDGKTIASYDYNVEVTRKVVAMAHAVGVTVEGELGCLGSLETMKGDKEDGHGTE
FT                   ATMTREQMLTDPEQAADFVKRTQLDALAIAIGTSHGAYKFTRKPTGDILAIDRVMAINK
FT                   RIPNTHLVMHGSSSVPQESLAIINQFGGKMRETYGVPVEEIQKAIKFGVRKINIDTDIR
FT                   LAMTGAVRKYMFENPEKFDARDWLKPAREAAKALCKQRYLEFGCEGQGSKIKSHSLSVV
FT                   AGQYARGELAQVVK"
FT   gene            complement(203470..204900)
FT                   /locus_tag="Rfer_0205"
FT   CDS_pept        complement(203470..204900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0205"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67963"
FT                   /db_xref="GOA:Q222U0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q222U0"
FT                   /protein_id="ABD67963.1"
FT                   /translation="MPRRATKIVATLGPASSDPALLEQMIRSGVNVVRLNFSHGTAQDH
FT                   IDRARLVREAAKRAGREIAIMADLQGPKIRVGKFADGKVLLEPGQKFVLDAARTELGDI
FT                   DAVGLDYKALPNEVKAGDVLLLNDGLIVITVDAVQGAAIHTTVKLGGELSNNKGINKQG
FT                   GGLSAPALTAKDMDDIRTAMSFHADYVAVSFPKNATDMEMARQLCNVAAENGHRPGLIA
FT                   KIERAEAIPKLEEILLASDGIMVARGDLAVEVGNAVVPALQKRMIKLAREHDKVVITAT
FT                   QMMESMINNPVPTRAEVSDVANAVLDGTDAVMLSAETAAGKYPLETVVEMAKICHAAEG
FT                   GEDFKLEADFTGKTFKRIDQSIAMGALFTAHHLGAKAIVAMTDSGSTALWMSRHLIQVP
FT                   IYALTSKVATQRKMTLYRNVRPLFIDTSADRDTALNEAENYLKTRGIVQAGDIYAITCG
FT                   EPMGSPGGTNMLKICRVR"
FT   gene            complement(205013..205666)
FT                   /locus_tag="Rfer_0206"
FT   CDS_pept        complement(205013..205666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0206"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67964"
FT                   /db_xref="GOA:Q222T9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T9"
FT                   /protein_id="ABD67964.1"
FT                   /translation="MKTIASKTRTLVFGVSAVALLVSGCANMTETQRSSAIGAGVGALA
FT                   GAAIGDSREATVIGAGVGALGGYIWSTQMAKKKADMERATAGTGVDVMQTADNQLKLNI
FT                   PSDISFDINRFDIKPNMRPILDQFAQGLSSQPNTEIRIIGHTDSTGSDSINDPLSVNRA
FT                   ASARDYLVARGVDGRRIQINGRGSHEPIADNNTERGRAQNRRIEIFLAERSVAR"
FT   sig_peptide     complement(205577..205666)
FT                   /locus_tag="Rfer_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.350 at
FT                   residue 30"
FT   gene            complement(205907..206689)
FT                   /locus_tag="Rfer_0207"
FT   CDS_pept        complement(205907..206689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0207"
FT                   /product="protein of unknown function DUF558"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67965"
FT                   /db_xref="GOA:Q222T8"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T8"
FT                   /protein_id="ABD67965.1"
FT                   /translation="MPRFYCPTSLRCGDLLDLPASAARHVQVLRLQPGDSITLFNGGPG
FT                   WDERDSEHTQGGEFEASVTRMGRSDVQVKVGAYHAVEREAAHRVHLAVGMPANERMDWL
FT                   VEKATELGVASIQPLMTERSVLRLNPERAGKKQAHWQSVAVAACEQCGGNRVPVIHAVM
FT                   TLAAWIKAQPAQASDQRLLLSLRPGAQSVRAAVKAFADPASAGAHTEAITFLSGPEGGL
FT                   SPAEEDIALACGFAPVTLGARVLRAETAALAALAALLL"
FT   gene            complement(206825..207367)
FT                   /locus_tag="Rfer_0208"
FT   CDS_pept        complement(206825..207367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0208"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67966"
FT                   /db_xref="GOA:Q222T7"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T7"
FT                   /protein_id="ABD67966.1"
FT                   /translation="MTDNSPATVHDEAHSGPIKNPKQMLLAVTFSFVVPIFAIIGLVYY
FT                   VTMGNKPAATEANSEQAVAARIQKIGRIEIRDANRPLRTGEEVFKAQCTACHTAGLVGA
FT                   PKFGDAAAWAPRIQTGYDALLNSALKGKNAMVAQGGGEFQDLEVGRAVVYMVNAAGGKF
FT                   AEPQAAAAPAEAASAAK"
FT   gene            207459..207534
FT                   /locus_tag="Rfer_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            207459..207534
FT                   /locus_tag="Rfer_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(207470..207808)
FT                   /pseudo
FT                   /locus_tag="Rfer_0209"
FT   gene            complement(207965..208678)
FT                   /locus_tag="Rfer_0210"
FT   CDS_pept        complement(207965..208678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0210"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67967"
FT                   /db_xref="GOA:Q222T6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T6"
FT                   /protein_id="ABD67967.1"
FT                   /translation="MNRDLIVDARGIHAWYGSSHVLHGAQLQIARGQTVGLLGRNGMGK
FT                   STLIRTLLGHVAQRDGHITLFGKDASRFKPHKVARLGVAYVPEGRGVFPNLTVRENLVM
FT                   AARRGVDGRNDWSFERVMATFPRLKERLTNLGAQLSGGEQQMLSIGRALMTHPELIVLD
FT                   EATEGLAPLIVADIWRVIGEIRKSGIATLIVDRDYRRVLAHADQALVLQKGQVLLQGTA
FT                   EDVANDPALSTYLGV"
FT   gene            complement(208680..209417)
FT                   /locus_tag="Rfer_0211"
FT   CDS_pept        complement(208680..209417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0211"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67968"
FT                   /db_xref="GOA:Q222T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T5"
FT                   /protein_id="ABD67968.1"
FT                   /translation="MLLRGHEITRRWGGLLALNKVSLALQRGTVHAVIGTNGAGKSTLI
FT                   NILSGEIQPSSGKVELLGQDVTTWSQPRRARAGLGRSYQRNTIYPSFTVLENCRLAAQA
FT                   NVQKPWAWWSDAQRCSASMDSARAAATRAGLDDLLDRQAGLLSHGQKRQLEIAMCLATK
FT                   PQVLLLDEPLAGMGAEETERMLTLLAELKASHAILLVEHDMDAVFRIADCITVMVNGTV
FT                   IACGSPDFVRNSPEVRIAYLGEH"
FT   gene            complement(209419..210432)
FT                   /locus_tag="Rfer_0212"
FT   CDS_pept        complement(209419..210432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0212"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67969"
FT                   /db_xref="GOA:Q222T4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T4"
FT                   /protein_id="ABD67969.1"
FT                   /translation="MKSSKFFFVAAAFVLLALWPLMAGQYGVDLVTKIMVFAIFALSLE
FT                   LLVGSTGLVCFGQAAFFGIGAYATVLLTPQDGAPSLLWLLPACVLAAALYALLVGALSL
FT                   RTKGVYFIMVTLAFAQMAYYVVHDTPLGGGTDGIYLMAKPVVLGTLLDLDKPMAFYGFT
FT                   LACLTAVFGFLTLLLRSRFGRALAGIRVNEQRMRATGFSTYPYKLAAFVISGGMAGLAG
FT                   FLFAVKDGFVNPELISWHLSGEVLIMIILGGLGHLRGALIGAFAFALLQEFFKSEAIFG
FT                   EFAKHWHLGLGLSIIACVALLPRGLVGVPEQVITRLRGRSGRVRDDSVVEVSHESV"
FT   sig_peptide     complement(210361..210432)
FT                   /locus_tag="Rfer_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.801 at
FT                   residue 24"
FT   gene            complement(210447..211328)
FT                   /locus_tag="Rfer_0213"
FT   CDS_pept        complement(210447..211328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0213"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67970"
FT                   /db_xref="GOA:Q222T3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T3"
FT                   /protein_id="ABD67970.1"
FT                   /translation="MDLTTFLIQCLNALQYGLLLFLVASGLTLIFGIMGVINLAHGSFY
FT                   MIGAYMAYALAPIVGGTFSGGFFATLAVGLVLAVLLGYVLEWAFFSFLYERDHLQQVLM
FT                   TYGLILVFEELRSLLVGDDVHGVQAPDFLAGTLPLGELMTYPVYRLFISGVCLVLALAM
FT                   YFVFTRTRLGMMIRAGSANREMVQSLGIDIKFLYRVVFAAGVAIAVFAGMIAAPVSSVY
FT                   PGMGNTVLIICFVVVVIGGIGSIRGALLAALLIGVVDTFGKVLLPQASGVLVYVLMALI
FT                   LLVKPDGLFKAG"
FT   gene            complement(211341..212522)
FT                   /locus_tag="Rfer_0214"
FT   CDS_pept        complement(211341..212522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0214"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67971"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T2"
FT                   /protein_id="ABD67971.1"
FT                   /translation="MSSSHKTLISRAVATLALSALSALPTLAQGLPKLKVGLMLPYTGT
FT                   YAALGNAIENGFRLHIAEQGGKLGGREIEFVKVDDESDPSKATDNVNKLIKRDNVDVLI
FT                   GSVHSGVAMAMAKVAKDTGTVLIVPNAGADAVTGPMCASNIFRSSFSNWQPGYAMGEVV
FT                   AKKGHKKVVTITWKYAAGDESIRGFKESFEKGGGKVVKELNLPFPNVEFQALLTEIAAA
FT                   KPDAVYTFFAGGGAVKFVKDYAAAGLKKTIPLYGAGFLTDGTLDAQGADAADLLTTLHY
FT                   ADSLNTPRDNAFRLSYAKAYKLQPDVYAVQGYDAAQMLAVGLAAVKGDIGKKAEFTTAI
FT                   EKAKIDSPRGPFTLSRSHNPVQDIYLRQVGGKENKLASIASKALADPGRGCRL"
FT   sig_peptide     complement(212436..212522)
FT                   /locus_tag="Rfer_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 29"
FT   gene            complement(212519..213334)
FT                   /locus_tag="Rfer_0215"
FT   CDS_pept        complement(212519..213334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0215"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67972"
FT                   /db_xref="GOA:Q222T1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T1"
FT                   /protein_id="ABD67972.1"
FT                   /translation="MSEAFAFVEVDWAGRTVCIEHRWIAPERTTAPLIVFLHEGLGSLA
FT                   MWKDFPQRLCDAALCRGLVYSRPGYGRSTPRAAQEAWGLDFMHQQAHVVLPAFLHAVGI
FT                   DPVAQAPWLLGHSDGASIALLYAAQFAQAIAGAIVVAPHILVEELSLTSIAAARTAYLE
FT                   TDLRQRLAKYHDDPDSAFWGWNNIWLHPPFREWSIEAEIEAIRCPLLAAQGMDDEYGTL
FT                   EQIHGIARRVPQTELLELSDCGHSPHRDQAERLIAAASAFITQQTGDKP"
FT   gene            complement(213331..214929)
FT                   /locus_tag="Rfer_0216"
FT   CDS_pept        complement(213331..214929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0216"
FT                   /product="benzoate-CoA ligase"
FT                   /EC_number="6.2.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67973"
FT                   /db_xref="GOA:Q222T0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q222T0"
FT                   /protein_id="ABD67973.1"
FT                   /translation="MNASTTTDMPAVTPPGDSFNFAQHLLSCNSQRASKVAFIDDQGAL
FT                   SYGQLNERVRRVAAGLRSLGIKREERVLLLMHDCNDWPVSFLGAMYAGIVPVAVNTLLT
FT                   ADDYAYMLEHSRAQAVLVSGALLPALTAAMTKSDHEVGKVIVSRPVAPLHPAEVEYETF
FT                   VQAQSPLLKPAATSPDDPGFWLYSSGSTGRPKGAVHSHGNPYWTAELYGKAVLSLTERD
FT                   TCFSAAKLFFAYGLGNALSFPMSVGATTILMAERATPDATFKRWLGQVGGVKPTVFYGA
FT                   PTGFAGMLASPNLPARSDVALALVSSAGEALPAELGERFKRHFGVDIVDGIGSTEMLHI
FT                   FLSNTPQRVRYGTTGWPVPGYDIELRGEDGAAVPDGEPGDLYIHGPSAAMMYWGNRAKT
FT                   RETFQGGWTKSGDKYVRNSDGSYTYGGRSDDMLKVSGIYVSPFEVEATLVQHPSVLEAA
FT                   VIGVPDAQGLTKTKAFVVLKAGAQATEAELQAFVKDKLAPYKYPRQIAFVDDLPKTATG
FT                   KIQRFKLRELEAHAA"
FT   gene            complement(214978..216540)
FT                   /locus_tag="Rfer_0217"
FT   CDS_pept        complement(214978..216540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0217"
FT                   /product="3,4-dehydroadipyl-CoA semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67974"
FT                   /db_xref="GOA:Q222S9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S9"
FT                   /protein_id="ABD67974.1"
FT                   /translation="MTELIPNFFAGQWQTGSAAGTPLLDPVLGTELVRVDATGLDLAAG
FT                   FAFAREQGGAALRALNYRERAAMLAAAVKVLQANRDAYYEIATANSGTVKNDSAVDIDG
FT                   AIFTLGTYAKLGETLGERHHLLDSEATRLGKDPLFQSQHVLVPTRGVALFINAFNFPAW
FT                   GLWEKAAPALLSGVPVIVKPATATAWLTQRMVKDVVDAGILPSGALSVICGGSAGLMDA
FT                   LQAFDVVSFTGSAETAAVIRSHPAVAQRFVRVNIEADSVNSALLLPDAAPGSEAFDLLV
FT                   KEVVREMTVKSGQKCTAIRRIFVPEASYDAAAQAIAARLAKTTVGNPRNEAVRMGALVN
FT                   RAQLTSVRQGLDYLKQQAEMLHDGATHALVDADPAMACCVGPALLGVSDVDGADRVHDT
FT                   EVFGPVATLLPYRDTTHALSLVRRGQGSLVASLYGSDSASLGATALELADSHGRVHVIS
FT                   PDVGQLHTGHGNVMPQSLHGGPGRAGGGEELGGLRALGFYHRRSAVQASTAVLATLQPP
FT                   QAA"
FT   gene            complement(216546..217010)
FT                   /locus_tag="Rfer_0218"
FT   CDS_pept        complement(216546..217010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67975"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S8"
FT                   /protein_id="ABD67975.1"
FT                   /translation="MPSTQFREQIAELSAQLAGRPLDASLDAWLNAKHGVETPTFEHLK
FT                   QSCQAGVSEGWLCDREGGGIRYGRIFKPAPDLHGFSVDVVDMQDIAGPHHTHPNGEIDL
FT                   IMPLDAGAQFDGRPAGWLVCPPGSSHRPTVTGGRALVLYLLPEGSITFTR"
FT   gene            217100..218074
FT                   /locus_tag="Rfer_0219"
FT   CDS_pept        217100..218074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0219"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67976"
FT                   /db_xref="GOA:Q222S7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S7"
FT                   /protein_id="ABD67976.1"
FT                   /translation="MSSTILHTSGFTPSISSADQDSSPTFVNPAEGGGDGEKNPFLAAL
FT                   GERVRALRARRGMTRKALAMVADVSERHLANLEYGVGNASILVLLQVAGALQCSLGELI
FT                   GDVTTSSPEWLMIRELLEQRDDATLQRVRIAIGEMLGTGGGNAGLSPRIALIGLRGAGK
FT                   STLGQMLADDLGFPFVELSREIEKFAGCSVSEIQALYGVSAYRRYERRALEEAIQIYPE
FT                   AVIATPGGLVSDAATFNELLAHCTTVWLQADPEDHMKRVTAQGDLRPMAASKEAMEDLK
FT                   GILHGRAPFYSKAQFKLDTSAQPLGPTFNALRDMVRKVLQLPA"
FT   gene            218122..219849
FT                   /locus_tag="Rfer_0220"
FT   CDS_pept        218122..219849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0220"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoyl-CoA ring
FT                   cleavage enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67977"
FT                   /db_xref="GOA:Q222S6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017633"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S6"
FT                   /protein_id="ABD67977.1"
FT                   /translation="MHYDACTDVDKCIFMLLTRGEQNVSTPSRVEYQITPSQYKHWKLE
FT                   FNGPVATLKADFDENAGLRPGYKLKLNSYDLGVDIELNDAISRIRFEHPEVRTVVVTSA
FT                   RDRVFCSGANIFMLGVSSHAWKVNFCKFTNETRNGLEDSSAHSGLKFLAAVNGACAGGG
FT                   YELALACDEIILVDDRSSAVSLPEVPLLGVLPGTGGLTRITDKRHVRHDLADLFCTSAE
FT                   GVRGDKAVAWRLVDAVAKPAVFAQKVQERALALAAQSDRPADAKGVALTPLERSIEADA
FT                   LRYTHVTVEIDRAKRTATFTVKAPTGVQPSDIAGIEAAGAAWYPLAMARELEDAILNMR
FT                   TNETEIGTWLIKTEGEAKAVLAMDATLLAHKNHWLVRETLGLLRRTFSRLDVSSRSLFA
FT                   LIEAGSCFAGTLLELALACDRSYQLVLPNDEASTPRITVTETNFGLYPMATTQSRLGRR
FT                   FYDEQSALDSVRARIGEALDADAAFALGLVTSNPDDIDWADEVRIAIEERVSMSPDSLT
FT                   GLEANLRFNGQENMSTRIFGRLTAWQNWIFQRPNAVGEKGALKVYGKGDKAAFDWNRV"
FT   gene            219922..221349
FT                   /locus_tag="Rfer_0221"
FT   CDS_pept        219922..221349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0221"
FT                   /product="benzoyl-CoA oxygenase, component B"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67978"
FT                   /db_xref="GOA:Q222S5"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S5"
FT                   /protein_id="ABD67978.1"
FT                   /translation="MSSITYSDKIPNNVNLSEDRTLQRALEQWQPNYLKWWGDMGPDDS
FT                   QNFDVYLRTAVSVDPQGWAQFGHVKMPDYRWGIFLNPAEKDRKIHFGDHKGEDAWQDVP
FT                   GEYRANLRRIIVTQGDTEPASVEQQRHLGLTAPSQYDLRNLFQVNVEEGRHLWAMVYLL
FT                   HKYFGRDGREEGEALLARRSGQENNPRILQAFNEETPDWLSFFMFTYFTDRDGKFQLCA
FT                   LAESSFDPLARTTKFMLTEEAHHMFVGESGISRIIQRTCQAMNEMKTDDVSKLRAAGVI
FT                   DLPTIQRYLNFHFSVTIDLFGADESSNAATFYNTGLKGRFEEGKRMDDHQLKGGTYKVL
FT                   NVQGGQLVEKEVPMLNALNEVLRDDYIKDSIGGVERWNKVIEKSGIPFKLKVPHKAFHR
FT                   NIGALAQVKVSPEGRVLSDAEWKANVDNWLPSETDRAFVGSLMGRVVEAGKFANWIAPP
FT                   MLGINRQSADFEYVRFN"
FT   gene            221364..222635
FT                   /locus_tag="Rfer_0222"
FT   CDS_pept        221364..222635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0222"
FT                   /product="benzoyl-CoA oxygenase, component A"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67979"
FT                   /db_xref="GOA:Q222S4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR015701"
FT                   /db_xref="InterPro:IPR017634"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S4"
FT                   /protein_id="ABD67979.1"
FT                   /translation="MDMSDLQAIKQHLIDPEICIRCNTCEAICPVAAITHDTRNYVVDA
FT                   DKCNLCMDCISPCPTGSIDNWRNMPRVGAYSVEEQLTWDELPPELTVEQLAELGVAADT
FT                   PPVEAPVPQSAAGVPDSFNSAQYGATLPPWSAAHAYTNLYGPKAAEKTITATVAGNVRV
FT                   TAVGHEYDTHHVVLDFGSLPLPVLEGQSIGIIPRGVDASGRPHHARQYSVASPRNGERP
FT                   GYNNLSLTIKRVLQDHQGNAVRGVGSNYMCDLQVGDKVQVIGPFGASFLMPNQPRSHIV
FT                   MICTGTGSAPMRAMTEWRRRLRQSGKFEGGKLMLFFGARTKEELPYFGPLQNLPKDFID
FT                   INFAFSRTPEQPKRYVQDLMRERAADLADLLADSNTYFYVCGLKSMEEGVVLALRDVAQ
FT                   QAGLSWETMGAALKAEGRLHLETY"
FT   gene            222635..223432
FT                   /locus_tag="Rfer_0223"
FT   CDS_pept        222635..223432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0223"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67980"
FT                   /db_xref="GOA:Q222S3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S3"
FT                   /protein_id="ABD67980.1"
FT                   /translation="MRVWETLVLSQRAPGVAQVTMARPAVFNAFDETMITELGEVFTEL
FT                   ADDASVRVVVLAGDGKHFSAGADLQWMQRASAASTQWNLQDARRFAAMLAGIENCPKPT
FT                   VARIQGAALGGGVGLTCACDIAIATENAYFAVSEAKFGILPAVIGPYLVNAVGKRQAKR
FT                   LALTTTRITAAQAQVMGLVQQVVAGDALDVAVDASVTELLAGGPQAQSEIKQLYAQLEV
FT                   GPVSAEVRELTAQTISRVRGTDEAREGFAAFLGKRAANWIPKA"
FT   gene            223456..224937
FT                   /locus_tag="Rfer_0224"
FT   CDS_pept        223456..224937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0224"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67981"
FT                   /db_xref="GOA:Q222S2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S2"
FT                   /protein_id="ABD67981.1"
FT                   /translation="MLVVGAGIMGVGIAQVAAQAGHTVLLFDARDGAAEQAREKLAKTF
FT                   EGLVAKGKLSADDAAQTLSRIEPIASLDAAAGVRLVVEAIVEKLDAKRGLFQQLEAIIA
FT                   TDCVLASNTSSISVTAIANGLQHPQRLVGMHFFNPVPLMKLVEVVSGLQTAAAVAAAIF
FT                   DLSKDWGKVPVSARSTPGFIVNRIARPYYAEALALLQEQAAAPAVLDACLRAAGFRMGP
FT                   CELMDLIGHDTNFSVTQSVFEANFYDKRYVPSLVQRELVDGGLLGRKSGRGFYDYAEGV
FT                   SAPELETVEPVLLPTAQLLRVYGQGPVADRLAASLVQAGQAFLRVPSSDWVGLGVEGAQ
FT                   LRLTDGRTATQLGVEVAVFDLPLNGASGAALAWAPSLRASSAWTRAAPRWLATLGFKPQ
FT                   RVADAPALVVARTLAMLINEAADAVQQGVCTQDGADAAMKLGVNYPAGPFEWLAQWSTP
FT                   AVLGVLDALDNHYRGERYRVSPWLRQRPWMDSEAS"
FT   gene            224934..225389
FT                   /locus_tag="Rfer_0225"
FT   CDS_pept        224934..225389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0225"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67982"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S1"
FT                   /protein_id="ABD67982.1"
FT                   /translation="MKFADFYAGQIIQAGPVAVSEAEVIGFASAYDPQWFHTDADAAQH
FT                   GRFGGLIASGWHTCGLAMRLVADAALHGSESFASPGLAYVKWPHPVRPGDHLSLTATVL
FT                   ESRRSSGKSHLGILRWRWQLFNNKGTEVLDLEATSLFDLSTSTSIPP"
FT   gene            225386..226588
FT                   /locus_tag="Rfer_0226"
FT   CDS_pept        225386..226588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0226"
FT                   /product="Beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67983"
FT                   /db_xref="GOA:Q222S0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q222S0"
FT                   /protein_id="ABD67983.1"
FT                   /translation="MTHAFICDAIRTPFGRYGGALSGVRADDLGAIPLRALMARNPQVD
FT                   WAALTDVLLGCANQAGEDNRNVARMSALLAGLPQEVPGATINRLCGSSLDAVGAAARAI
FT                   KSGEAQLMIAGGVESMSRAPFVMPKMDAAFSRSNAVYDTTIGWRFVNKLMKAQYGVDSM
FT                   PETAENVATDFHIEREAQDLMALRSQQNALRAQQSGFFDVEITPVSISQKKGDPLLVTQ
FT                   DEHPRATTLESLAKLKGVVRPDGTVTAGNASGVNDGACALLLANEAAAARYGLSPRARV
FT                   VGMAAAGVAPRIMGFGPAPATRKVLELTGLSLAQMDVIELNEAFAAQGLAVLRDLGLAD
FT                   DDARVNPNGGAIALGHPLGASGARLVTTAVNQLHRSAGRYALCTMCIGVGQGIALVLER
FT                   V"
FT   gene            complement(226601..227182)
FT                   /locus_tag="Rfer_0227"
FT   CDS_pept        complement(226601..227182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0227"
FT                   /product="Hemerythrin HHE cation binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67984"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R9"
FT                   /protein_id="ABD67984.1"
FT                   /translation="MSRESLRIIHDEHDALSAMLRSIGMMVDRGPGNEPESFFDVLRAM
FT                   LFYIDEFPERLHHTKETELLFPRVVRLAPETAQAIEQLDKDHTRGESAVRELQHLLLAW
FT                   ELVGDSRRVAFETAVKVYLAFYLEHMRLEETVILPVAQKVLSAADWDELDAAFATNCDP
FT                   LTGKYPRDPAYDRLFTRIVSQAPAPIGLGA"
FT   gene            complement(227325..228827)
FT                   /locus_tag="Rfer_0228"
FT   CDS_pept        complement(227325..228827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0228"
FT                   /product="benzoyl-CoA oxygenase, component B"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67985"
FT                   /db_xref="GOA:Q222R8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R8"
FT                   /protein_id="ABD67985.1"
FT                   /translation="MSEPTPTEIIEPVEAIQNDAFVAVSYDDLIPNNVDLSSDKQLQRA
FT                   LEGWQPNYIDWWKDMGPEGFQNADVYLRTAVGVDPSGWAKFGHVKMPDYRWGILLAPKE
FT                   EGRTIPCGRHKGEPAWQEVPGEYRSLLRRLIVVQGDTEPASVEQQRFLGATAPSLYDMR
FT                   NLFQVNVEEGRHLWAMVYLLVKYFGRDGREEAQALLERRSGQQDNPRILGAFNERTPDW
FT                   LSFFMFTYFTDRDGKMQLAALAQSGFDPLSRSCRFMLTEEAHHLFVGETGVGRTIEATC
FT                   LAMKAAGITDPYAKEAIRKLGVIDLPTLQKKANFHMSVTRDLFGSEISSNAASAFSTGL
FT                   KGRFNETALDDDHQLENATYPVQRVIDGQLVTEEVPALRAINSRLLDDYIADCQGGIDR
FT                   WNKVIEKCGIAFRFSQPHKGFNRRIGEFAETHVSPAGELLSAQAWHAGKSDWLCSDEDH
FT                   TFINSLMKPCVQPGQYASWIAPPRVGINNQPKDFEYVRIEHS"
FT   gene            complement(228957..229271)
FT                   /locus_tag="Rfer_0229"
FT   CDS_pept        complement(228957..229271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67986"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R7"
FT                   /protein_id="ABD67986.1"
FT                   /translation="MQHRCRGARDRFGPRVIDLLCLPAPPLKTMDATPQIPFIDTINTR
FT                   YLETLLGYNARRDSLVGTAQSHHRWKHLHCDVPPYMTHPAASSLQQTGTKVHIFVCGTL
FT                   "
FT   gene            complement(229420..230013)
FT                   /locus_tag="Rfer_0230"
FT   CDS_pept        complement(229420..230013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0230"
FT                   /product="transcriptional regulator, XRE family with cupin
FT                   sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67987"
FT                   /db_xref="GOA:Q222R6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R6"
FT                   /protein_id="ABD67987.1"
FT                   /translation="MKKQTTASADAQKMGLGMQVRQRRRIKGLTLTELSQQSGLSVGLL
FT                   SQIERGLSSPSLKSMTQICTALGVPLSWLFDNGPLENPAEKGLVVRRGSRRRLDLGTYG
FT                   VTKELLSPDLGGEMQIYLVSIRPGGQSGPETYTHRGEEGGLVLTGTLELTVDDRIVLLY
FT                   EGDSFRFRSSLAHRFANPGTTQANVVWANSLAFY"
FT   gene            230160..231443
FT                   /locus_tag="Rfer_0231"
FT   CDS_pept        230160..231443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0231"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67988"
FT                   /db_xref="GOA:Q222R5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R5"
FT                   /protein_id="ABD67988.1"
FT                   /translation="MSQPNCSSLWASTAAPDIEASALQGTVPADVVIVGAGFTGCAAAL
FT                   AMAQRGARVRLLEANVVGWGASGRTGGQVIPGLKFDPDEIEAMFGPDLGPRMVNAVGSV
FT                   GDEVFGLIEQHAISCDAQRKGWLQPAFSTRSLDLALRRCDSWQRRGADVAPVGRSEMAR
FT                   LLGTDHYLGGWEDRRAGHVQPMSYVRGLAGAAQRAGAVIHIDSPALSLTRQGAKWRVST
FT                   PQGAVDADQVLLATNGYTDGLWPGLARTVVPMMSFQAATIPISEDLGKSILPEGHAASD
FT                   TRRLLWYFRRDAHGRLTMGGRAPYREDLGAADADYVRNAVNRLYPQFKNTPFEFHWAGR
FT                   VAMTQDHIPHLNRLDNGLWAALGYNGRGVGMATLFGRYLADLASGVPAQDIPFPVTSMR
FT                   PIQGYPFTRLVARALVSYYRIRDQLEAV"
FT   gene            231496..232242
FT                   /locus_tag="Rfer_0232"
FT   CDS_pept        231496..232242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0232"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67989"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R4"
FT                   /protein_id="ABD67989.1"
FT                   /translation="MSRLLRLFTLCLVFIGSLASAQAPLRVGSTPSGIPFTFLDTKTNK
FT                   ISGVMVDLISEIGKDQGFAVEINAMAWGSLIAALQGNKIDVIAAAMYITPPRQEVVDFS
FT                   DPIYTYGEGLFVAASDAKDYKTYEDLKGEVVGVQIGTAYVKPLQASGLFKEVKVYDSIS
FT                   DIMRDVNLGRIKAGFGDYPIVAYQLGQGAFPETRLVKGYKSVWVGSVGIAVRKGDKATI
FT                   DKINAALRKFKADGTIDRVLARWNLK"
FT   sig_peptide     231496..231561
FT                   /locus_tag="Rfer_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.963 at
FT                   residue 22"
FT   gene            232263..232916
FT                   /locus_tag="Rfer_0233"
FT   CDS_pept        232263..232916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0233"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67990"
FT                   /db_xref="GOA:Q222R3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R3"
FT                   /protein_id="ABD67990.1"
FT                   /translation="MAAFALKDLIEFAPILAQGAVVTVEVFACGLIVATLLGLVWALMR
FT                   VSGVAALAVFSKGLINTIRGIPILVQLFFIYFVLPDVGIQLSAFQAGFIGLGFAYSCYM
FT                   AEVFRGGIEAVDPGQVEAAKSLGMGRAMTMWRVVLPQAFKVALPPYGNTCIMLIKDTSQ
FT                   ASIITVTELTFQSKVIAASTFKNAEVFTLVALFYLLLCIPLIMIVGRLEKRFGR"
FT   gene            232916..233647
FT                   /locus_tag="Rfer_0234"
FT   CDS_pept        232916..233647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0234"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67991"
FT                   /db_xref="GOA:Q222R2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R2"
FT                   /protein_id="ABD67991.1"
FT                   /translation="MISIRNIRKSFGSNLVLDDISLDVSQGEVVCVIGASGSGKSTLLR
FT                   CVNGLETYDAGDITVDGQRVDHVGRQMVAIREKVAMVFQRFNLFPHRTALENVMEGPIY
FT                   VKRESRESAMRNARALLAQVGLAGKEDAYPASLSGGQQQRVAIARALAMQPRAILFDEP
FT                   TSALDPELVGEVLSVMRALANQGMTMMVVTHEMGFAREVADRVIFIDRGHIVEQGPARA
FT                   VLAAPQHERTQDFLRRVTHPM"
FT   gene            233909..234439
FT                   /locus_tag="Rfer_0235"
FT   CDS_pept        233909..234439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0235"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67992"
FT                   /db_xref="GOA:Q222R1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R1"
FT                   /protein_id="ABD67992.1"
FT                   /translation="MREFIDPTDRRLAKLLSSDAQDSVNQLADKLQLSPPTVRTRLRSL
FT                   IEKNVLKIVGLLNLSERPELIAAVVGINANAQGHMDDLMKKIAELPFVTSVSLVTGRFD
FT                   LIVEVLVAGDVQDLYRVTSELLPKVAGPGVVSRSETFVVMKSHNKWINLPRGCWEQGGN
FT                   EEQLTTLSKPKKR"
FT   gene            234503..235303
FT                   /locus_tag="Rfer_0236"
FT   CDS_pept        234503..235303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0236"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67993"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q222R0"
FT                   /protein_id="ABD67993.1"
FT                   /translation="MKMSNFLPAILLACAGFAGVAATAHASTLDDIQKRGELRIAVQTQ
FT                   GPPFSMIDKNGERTGSSVELAKLMAKEMGVKAVFLDLDWDGLLPALISGKADLLAADMT
FT                   PTLARATKVAFTKPFIYIGPVVAAKAGSKFTSTAACKAPGTKIAVLFGSTGEKLAKTVF
FT                   EKGEIKSYKGGGTLLLDAVKNGQADCLLNDSSAVAGQAAGYPAGTFKVMPELLAKEPLA
FT                   YATRYDSLDLLTWINLFIDQTTLDGRLQQNLDYWVNSAKWKEAH"
FT   sig_peptide     234503..234583
FT                   /locus_tag="Rfer_0236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.969 at
FT                   residue 27"
FT   gene            235386..236054
FT                   /locus_tag="Rfer_0237"
FT   CDS_pept        235386..236054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0237"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67994"
FT                   /db_xref="GOA:Q222Q9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q9"
FT                   /protein_id="ABD67994.1"
FT                   /translation="MLLNLNFRVIGETLPEFWVGFVSTLSISLTAFAGAIAIGIIACAM
FT                   SIQPSRLVRAPAVAYVDVIRATPLLAQLYFLYFGLPSFGVIMPETVIGIIALSINSGAY
FT                   VSEIIRSGIMSIPHGQVEASASSGMNYWQQMRLIILPQALRPMVSPLIGQAIVLVKDSS
FT                   LLSLISVLELTRAGQTLANDRFMPVEGLATTAVGYLIIYFGLKLMAAAWMRINHPSERH
FT                   "
FT   sig_peptide     235386..235487
FT                   /locus_tag="Rfer_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.713) with cleavage site probability 0.697 at
FT                   residue 34"
FT   gene            236065..236715
FT                   /locus_tag="Rfer_0238"
FT   CDS_pept        236065..236715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0238"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67995"
FT                   /db_xref="GOA:Q222Q8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q8"
FT                   /protein_id="ABD67995.1"
FT                   /translation="MTMFLEQIHGIAQYYPVILKGIGVTLALSFIGIVAGTLIGFVLGI
FT                   GRASSHKLLSLVVGAYTDIFRGTPVLVQVFVVFFILPEAGIELDSFTAGALALSNIAAC
FT                   FISEIVASGIRAVPIGQVEAAASAGLTRLQQLRLVVMPQATRMIVPSLVGQFVLLVKDS
FT                   SVVSAIGLLDLTRSGWIIVQSVPNGMLVFSVVGIGYFLICYPLLHLSRRMEKT"
FT   gene            236787..237512
FT                   /locus_tag="Rfer_0239"
FT   CDS_pept        236787..237512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0239"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67996"
FT                   /db_xref="GOA:Q222Q7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q7"
FT                   /protein_id="ABD67996.1"
FT                   /translation="MIKFNELNKWYGAHHVLQNINLEVAKGEVVVVCGPSGSGKSTLIR
FT                   CVNGLEKFQSGTLIVDGLSVANEANLRQLRMELGFVFQQFNLYPHKTALENVTLAPIHV
FT                   RKLPRKEAISRGREILEKVGLGDKFDAYPQQLSGGQQQRVAIARSLCMQPKVMLFDEPT
FT                   SALDPEMINEVLDVMVSLAKDGMTMIVVTHEMGFARKVADRVVFIDKGVIVEVAEPEAF
FT                   FTAPKNERTREFLGKILQH"
FT   gene            237561..238838
FT                   /locus_tag="Rfer_0240"
FT   CDS_pept        237561..238838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0240"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67997"
FT                   /db_xref="GOA:Q222Q6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q6"
FT                   /protein_id="ABD67997.1"
FT                   /translation="MSHTGNTGTESKRSIAIIGAGVVGAASALALAAEGYLVTVFDHGE
FT                   IGAGTSSGNAGGIVTGAVTPTATPGVLRSIPSYILDPHGAAVLRPSYFFQVLPWLLRFI
FT                   EAGRPTRVSTIARALDPLVSKAMQSHLALADVSGSRDLIRPVGWLKVYGSDAGFSETEL
FT                   ERELMTRHGVNFSVLTADEVADLEPKLNKNSYTRGLFQPDSGFVNYPMGLTQAYFEGAR
FT                   QRQAQYIQECVLEVRPSEGGGISIKTDKTSRRFDSVVVAAGAWSKKFAKQIGDSVSLDT
FT                   ERGYHISFGSTGDELLRRPVGFPEKHCVLSPMHDGISLVSGDELAGLTAPPDYRRIRAL
FT                   APFARSVLPGLAEQTIQREWMGYRPSTPDSLPVIGRSPSCRNVFYAFGHGHLGLTLAAI
FT                   TAQLIAGMVSGRPDPFDLSPYRIDRF"
FT   sig_peptide     237561..237659
FT                   /locus_tag="Rfer_0240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 33"
FT   gene            238882..239595
FT                   /locus_tag="Rfer_0241"
FT   CDS_pept        238882..239595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67998"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q5"
FT                   /protein_id="ABD67998.1"
FT                   /translation="MINETESAKIGILCWETGQVPRGLQQLESLRGNSTNPASYGYPVR
FT                   LHPVRGANVHTILENPDQTVLGTMIADARTMVSEGIKAITTSCGFNAIFQRELVESVGV
FT                   PVFTSSLLQVPLARRICGLQSEICIITANAGALRSEHLTSVGIAGTDGLHILGLEQCAE
FT                   WNRMFAEPDAEIDLDVIEQEVLGTARRALDEHPGIRAFALECTDLPPYSAAIRSQSGLP
FT                   VFDFITMVNYLHSTL"
FT   gene            239737..240939
FT                   /locus_tag="Rfer_0242"
FT   CDS_pept        239737..240939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD67999"
FT                   /db_xref="GOA:Q222Q4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q4"
FT                   /protein_id="ABD67999.1"
FT                   /translation="MRRNMTNLIGDGLAKIEACAQASLALLQHNLTPHGILAASRTEAA
FT                   IARRYTRIFARDAAICVLAMCGSGDELLEQGAVDSLDVLATQQAGNGQIPKYVDPEGQD
FT                   ADFWYLGCIDSTLWWLIAVDHVHRQGVIDPERWQVEVQRAIAWLLAQEHQHFRLLQQNE
FT                   ASDWADIMPRSGYVLYSNALWYEVKRRYGLTSIQTTHHHFNHLFNPFQRDLPEYHRARL
FT                   LQHYARRGQRDPGLYLSFVNLSFAGNEGDVFGNLLAILCGLASESTGHRIVKTIIAANA
FT                   SQPYPIRVVLHPLSRQHELWRPYMARHQQNLMHQYHNGGIWPFVGGFWVMALVRLGLRE
FT                   LAWQELTRLSSVNELDDWRFTEWFHGHSLQPMGMAGQSWNAAAFLLARRAVLGVSSFSA
FT                   P"
FT   gene            complement(241060..241338)
FT                   /locus_tag="Rfer_0243"
FT   CDS_pept        complement(241060..241338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68000"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q3"
FT                   /protein_id="ABD68000.1"
FT                   /translation="MPLWQRVGKIIQGEPQVADASAFYNQLQERLNQNQPLAADALAKL
FT                   GAQRTEAILAALKEAGVDPARAAAAAPEKVESDVGKPVPLKLGLVAK"
FT   gene            complement(241500..242285)
FT                   /locus_tag="Rfer_0244"
FT   CDS_pept        complement(241500..242285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0244"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68001"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q2"
FT                   /protein_id="ABD68001.1"
FT                   /translation="MNHNIVARKMLLPCESKCWLRLCVEIFFGRTELIDPIRMLVGAML
FT                   FLILGVATAQTAGAGIKGTAHDPGIWSFGFEQQVCVMCHAPHNTNTQGPLWNRAANNTS
FT                   YTLYASSTMNATPGQPGSVSKLCLSCHDGTVGVLDYGGATGGMTLAEASSCTNPLGCSG
FT                   VLGTNLSNDHPIGITYDAALATADKGLNDPSTKTVTIGSTASRSGTIATMMLSGGKVEC
FT                   SSCHDVHNIYTVAGSTGTSKGLVKVGMAGSSLCLQCHTK"
FT   gene            242779..243378
FT                   /locus_tag="Rfer_0245"
FT   CDS_pept        242779..243378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68002"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q1"
FT                   /protein_id="ABD68002.1"
FT                   /translation="MLFLTIRFLAGVLTTVSMAGFSPAAHSQESTESRSVQDSRKVALQ
FT                   VSQDLRTQLIREMQLSGPLRSLVACKYTCPEILSMQSRKTGWRVAAVSLKPRNSALGMA
FT                   DAWEQKVIADFDRRVAKGEKGETLEFVEIVSEPQGRYFRYAKAMMVERLCLQCHGSSDQ
FT                   RPDSVKAQLATDYPFDQAVDFRIGQVYGIVSIKRGV"
FT   sig_peptide     242779..242862
FT                   /locus_tag="Rfer_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            243487..244908
FT                   /locus_tag="Rfer_0246"
FT   CDS_pept        243487..244908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0246"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68003"
FT                   /db_xref="GOA:Q222Q0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q222Q0"
FT                   /protein_id="ABD68003.1"
FT                   /translation="MALVAYVGAGDLILSQERSNLLLYFSEMERIYTTESALGKTTYAV
FT                   SHSMLKLEERFFSNDSLPPAFEEHIALDVELIQAGLMGLQDYYPWLKKRNDRLDQDMAR
FT                   LRTEPSHGSMVSLREHGKELSSELDQITRELRERKSLLWQRYRNEYDIMSFTAAVMTLV
FT                   GALIFGALIALFLTRLASDIRRLATRALDIVVGYRGPPVEVTRDDEVGDLMKAINRMQS
FT                   ELRLRERQLEISREQRFHKEKMAAIGSLAAAVAHEINNPIAAIAGIAQSLKDSGRHASC
FT                   AEFGIDPSDLILEQAKRITAISRQIAELTAPHSPEHELLDLNSLVRNTCNFIAYDKRFD
FT                   KIEMALNLDSQIPAINAIADHLTQVLMNLLINAADALEDVHQRSPTIWVATLATKSELL
FT                   LTVSDNGKGMDSSVLAHAFDEAYTTKPPNKGRGLGLFLCKSLLESCGNRIELESTLGVG
FT                   TSVRVRLTLASHPGA"
FT   gene            244915..246318
FT                   /locus_tag="Rfer_0247"
FT   CDS_pept        244915..246318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0247"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68004"
FT                   /db_xref="GOA:Q222P9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P9"
FT                   /protein_id="ABD68004.1"
FT                   /translation="MPSLNVLVVDDEPALRQILAAAVIKAGYSVEQANGVKQAATMLSR
FT                   GDFDVALCDIKMPDGNGIELVRNCRAAGIETTFIMVTGFASIETAVEALQAGASDYITK
FT                   PVRYEEVAHRLSQIDALRGLREENKALRKVVSDSSPKLYRFTSPGMLEVERLAGKVAPT
FT                   DCTVLITGESGTGKGVVARLINDQSKRRTGPFLQVNCSAVPEHLLESEFFGHTKGAFTG
FT                   ADHARKGLFLQANGGTLFLDEIGELPLHMQTKLLHMVEDKEVRALGSEQVRHVDTRIIA
FT                   ATNADLVNLVKEGKFREDLYFRLSMFQIQIPPLNERQTDMPGLIRFLLHNLCPSGLGTM
FT                   EIDPLAEEILLAHRWPGNVRELENVITRACILAEDNRISVADLPATIIQTNLPKTLAGA
FT                   AIGSNGSLRDQMRKLELEILQRAIEGAGGDRKLAAQKLGIGLSSLYRKFDEFQPDALSS
FT                   GDAAPVHPS"
FT   gene            246341..247348
FT                   /locus_tag="Rfer_0248"
FT   CDS_pept        246341..247348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0248"
FT                   /product="putative hydrolase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68005"
FT                   /db_xref="GOA:Q222P8"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P8"
FT                   /protein_id="ABD68005.1"
FT                   /translation="MDFKLIHVLKWGLLALTAIVTFESLAVGSDASVTLGTRVVAGKIT
FT                   EWQVPVPKFARDPAIGRDGNVYFAVRSGDQIARFDPKLKIFQDWNVPVGTQPLGVVVAR
FT                   DGKVLFGGFGNGTVGELDPSTGKIKIYLIPSVDSNPYTLVLDGEDNIWFTLRKVGKVAR
FT                   LERASGKITEYPIGDKPYSVALDQSGNVWVTRMAADRIVRLEPKTGKVTELLLGSGSHP
FT                   RRTAVAPDGMLWVSLYGTGKLVKIDPTVCRVIKEYALPGGPNAGPYAVNADANGRIWVS
FT                   EIQTDSVIMLDPRSEDIQIFKLPTKNTGIRNAAIDSEGHYWYVGSQAGKLGVIE"
FT   sig_peptide     246341..246421
FT                   /locus_tag="Rfer_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.874) with cleavage site probability 0.720 at
FT                   residue 27"
FT   gene            complement(247380..247940)
FT                   /locus_tag="Rfer_0249"
FT   CDS_pept        complement(247380..247940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68006"
FT                   /db_xref="GOA:Q222P7"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P7"
FT                   /protein_id="ABD68006.1"
FT                   /translation="MIPVAASTSSRPAYRRQINYVDKSIQRSLLIALVVLEVALVCVST
FT                   WVTYWHLNNLLEESLYRVHLVQTEPILTRLVTEGFAVLGVFALVNLTALMVAQKIWSRH
FT                   ENLVLKDFTKLIAKTRKLDFSSDPSSHPQTEVLALAMAWRAQERTRFTAIRNQVAKLEA
FT                   SVSAGKSPQTLLLAVEDLNKLLS"
FT   gene            complement(247937..248677)
FT                   /locus_tag="Rfer_0250"
FT   CDS_pept        complement(247937..248677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68007"
FT                   /db_xref="GOA:Q222P6"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P6"
FT                   /protein_id="ABD68007.1"
FT                   /translation="MAALLHADVGRGNGHPARTDCGVCHLAGPNVDQDQASKLVSSQEL
FT                   LCARCHARAIEVSHPSGFAPKRSLPAEYPLDWKGDLTCSTCHLPHGREPGLLRGKKHGK
FT                   DFCLTCHDQAFFRSMKDAGTSMVISGHLDVSRGRSTIDIDVHSLHCLGCHAGSHSDGGS
FT                   VSIGSSGVLRHASGAAPHPIGRSYRDASKRGGFQPENQLAQKKILLSDGRISCISCHEA
FT                   YKKEHGKLVVSNERSALCLACHAK"
FT   gene            complement(248715..249260)
FT                   /locus_tag="Rfer_0251"
FT   CDS_pept        complement(248715..249260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68008"
FT                   /db_xref="GOA:Q222P5"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P5"
FT                   /protein_id="ABD68008.1"
FT                   /translation="MRKSHHVHVAPDVRMVAKIGLRVAVASFLGLLLVLILVSDGKASG
FT                   YRQIISAFALSKVSLGPAMLVFGFALVSFAGITAWLFSIYASFRIAGPLYRISRNLELL
FT                   INHGLVAPLPIRHTDSLQREWEEFEASVSALRAQHEELKQALGEVENALAPISEAEDST
FT                   ALATGIARLKKAEQLVNL"
FT   gene            249684..250364
FT                   /locus_tag="Rfer_0252"
FT   CDS_pept        249684..250364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0252"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68009"
FT                   /db_xref="GOA:Q222P4"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P4"
FT                   /protein_id="ABD68009.1"
FT                   /translation="MKWLMAIVYMLLLSPALYGGSVIGTRHDLSTAGTPQVCEFCHTPH
FT                   GANTNLQAPLWNRAETTQVFTLYGSPTMNVAVGQPRVASRLCLSCHDGVNASTVVHGNS
FT                   VSTKHDLVKPPGHPAPDMTSEPNCERCHSDMYGGKKRTLVLGTDLSNDHPISIDYPTAA
FT                   QDSAFKAPTDAQKGWGGTSPNEVKLYAGAVECGSCHNVHSNDFAPFLRKSNAASALCTT
FT                   CHAK"
FT   sig_peptide     249684..249743
FT                   /locus_tag="Rfer_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.962 at
FT                   residue 20"
FT   gene            250410..251522
FT                   /locus_tag="Rfer_0253"
FT   CDS_pept        250410..251522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68010"
FT                   /db_xref="GOA:Q222P3"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P3"
FT                   /protein_id="ABD68010.1"
FT                   /translation="MTPTRGAFAVLFSFALAVSTGLFAQTTQPKSSAASADVLAEKAAA
FT                   APAGRASAPRSLVPLPAKPAPTSSHAPFEAGDCKICHQNADPKHPGPVFKKGPALCLDC
FT                   HEEFNGVMKRAHTHAPARTDCTSCHNPHNSVFSKLLHLEPRALCVSCHEKIGKLHDSAK
FT                   VPHKALTTGKYCSNCHNPHGSTVEKLLIQLPFDLCVNCHSVDTMADANGKKLQNIKAWL
FT                   LDNPKQHGPVASKDCNDCHEPHGGDLFRLINQDYPPEFYAPYDAKNYGLCFGCHREKAF
FT                   STAQTATLTSFRNGATNLHYLHLQQSGRGRTCRACHEVHAAKQDHLIRDGVPYGSGGWI
FT                   LKLNYKKTATGGSCEKTCHAEKSYANRTAP"
FT   sig_peptide     250410..250484
FT                   /locus_tag="Rfer_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            251525..252337
FT                   /locus_tag="Rfer_0254"
FT   CDS_pept        251525..252337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0254"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68011"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P2"
FT                   /protein_id="ABD68011.1"
FT                   /translation="MNIAALLVLVGLVAVFQPASAAHAAIGTPVASTEMPTLEGGKAQV
FT                   MGNVEANVLVFFRPDQPRSAGALRELARCQKDFAGKSVRWVAVVPSSASLPGVMTLMRD
FT                   TSFAAPVLLDNGDALYGSLGLDLHPVVVIVGRDQKLAAFEPFRVLDYCTVISARIRHVL
FT                   REISDAELGAVLDPPKATQGGNEQVARRYRAFAEVQFKNKDYDKALVSVRKGLAKDPLL
FT                   APAHALLGQILLAQGNCADAVPAFNQALLLDGASTVARDGLERCKSAR"
FT   sig_peptide     251525..251599
FT                   /locus_tag="Rfer_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.940 at
FT                   residue 25"
FT   gene            252623..253312
FT                   /locus_tag="Rfer_0255"
FT   CDS_pept        252623..253312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0255"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68012"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P1"
FT                   /protein_id="ABD68012.1"
FT                   /translation="MKSQLRCLKWAGLAAASLLLTLGATSAQAAIGTIVGSVHDFSTTG
FT                   PNATYKGTSTQVCIYCHAPHNTGSTLLWNRATNGATYSLYSSTVSSTMNATTGQPGAVS
FT                   KLCLSCHDGTVAIDSFGGATGSKMVTGAPLLGTDLSNDHPIGFPYNAALVTADPGLRAV
FT                   STAATIGTGNVGTIESKMLFGASGAATVECASCHDVHNSTSGTAVQAKLLKVTTVGSAL
FT                   CTTCHIK"
FT   sig_peptide     252623..252712
FT                   /locus_tag="Rfer_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            253580..254734
FT                   /locus_tag="Rfer_0256"
FT   CDS_pept        253580..254734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0256"
FT                   /product="NHL repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68013"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:Q222P0"
FT                   /protein_id="ABD68013.1"
FT                   /translation="MPNSSTTMFLPTRLRFFSALLGALMLLSGCVTQPTKAPLQKEAVF
FT                   YPRAPDAPRVQHLATFASARDLETAKESGGLKDFLLGEEKVEDALVRPYGVAMSDSKIY
FT                   VADSRGPGLAVFDLKTRKFSLMSGSGAGRMQRPINVAIDADDTKYVTDTARNQVLVYDK
FT                   GDRYLAAYGGKDEFKPVDVAIAGDRLYVVDIEHHEVQVLDKRSGKLQFKFGKSDVDKEK
FT                   SLHQPTNLAVGRDGDIYVVETGNFRVARFTPEGKFVRHYGEAGQAPGQFARPKGIAMDR
FT                   SGRMYVSDAAFQNVQIFDGQGRVLMAFGQPGGDLPGLNLPAGVAIDYDNVALFRSLADP
FT                   KFSIEHLILVVSQFGPNQVDVFGFGKMAGVDYPQDEKLESKPVP"
FT   sig_peptide     253580..253678
FT                   /locus_tag="Rfer_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.576 at
FT                   residue 33"
FT   gene            254793..256850
FT                   /locus_tag="Rfer_0257"
FT   CDS_pept        254793..256850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68014"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N9"
FT                   /protein_id="ABD68014.1"
FT                   /translation="MPNRAACLITRLAIGVALLPVVSSCWAQASAPLRLKSASEIAPFR
FT                   IIGIDGYVKARYLTDDSSSVGAAGGTPVRATQSNLSEEIYLMTHSYIYHPSLLLLDLGG
FT                   GPIIDKSQDGGDGVGTSARRQMFNLNGRATFLRDKPYTGAFFYDRSNQTQSMGPAQQMF
FT                   NENTRYGATFSLLSPVTPVPMQVELTRSTSQGKGAEQVMDDRIDQLRIKMDATISKLGG
FT                   STFQFVGTRQDSASGSSGLPIQASRSASDRANLDTRLKFGSTNEYELSNAVALNRSSFT
FT                   GGQGSLANQKDASFGLDLRGRHSEELQTYGRYNVNASRQDGQSMTLNAASAGLSYRVNP
FT                   DLSGALAVRGEVNRASQLSSTFYAIDGSAQYRQTLPLGQATAGYNVSYSQRDQQATSLQ
FT                   TKMLGEHVTLGSTSFVSLSKPQIIASTVVVTNLTRTQTFVEGGDYLLSQIGLELRIQRL
FT                   IGGNILDGQEVLIDYDYSSGGSYAASQLDNTLSLSWSYKSYLNFFVRHLASTPRLESGS
FT                   PTSPLNSVNSTFYGARTDIPLSLLTQEFLLGGSAEREVRRETISSYRRANLEAYVQTDL
FT                   PLVRSGNIHIGARQMQVNYEDSPLQAVKLTAVDIRLWARIGYGIDLSAEASRHRDTGAP
FT                   ELREGSAASVRAQWRQRKLLWTLDLTRVHDAQGLAERTRTYGQLLLRRDF"
FT   sig_peptide     254793..254876
FT                   /locus_tag="Rfer_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.939 at
FT                   residue 28"
FT   gene            256853..257884
FT                   /locus_tag="Rfer_0258"
FT   CDS_pept        256853..257884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0258"
FT                   /product="NHL repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68015"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N8"
FT                   /protein_id="ABD68015.1"
FT                   /translation="MTRAYRFAMALGLLLALGVLGACAPLPPKPADQAPLAWPDLPNPP
FT                   RITFVRQFSKPDDFSIGKGFFQRLGDLLFGARGERLIRPLAVVTNNGVVFVADPGANGV
FT                   HRFDQTKARYDLIVGEGGQALPSPVALALGSAGEVYLTDSNRAQVLVIQPGAAMATPLA
FT                   LPDMAQPTGIAFDKSNGNLYVVDTGAHRVNVFKPDGTLVFSFGARGDGAGQFNYPTMIW
FT                   FDRGGRLYVTDSLNFRIQMFSRNGKYLSGFGQVGDGLGDNIRPKSVATDSHGHVYVVDA
FT                   LHNALQIFDVLGRYLLSVGSIGNDRGEFWLPAGIFIDENDLIYIADSYNQRVQVFRYIG
FT                   GPS"
FT   sig_peptide     256853..256921
FT                   /locus_tag="Rfer_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.529 at
FT                   residue 23"
FT   gene            257923..259638
FT                   /locus_tag="Rfer_0259"
FT   CDS_pept        257923..259638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68016"
FT                   /db_xref="GOA:Q222N7"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N7"
FT                   /protein_id="ABD68016.1"
FT                   /translation="MVLLLWAGAPAQSASIVANKHNLSATGPGTIKATSEGEVCVFCHV
FT                   PHNSRATGPLWNRDQPVGSYTPYTSSTRKISAPGQPTGASLLCLSCHDGTIALGKVSSR
FT                   TANIAIAGGKNNFLLGDQSYIGTDLSDDHPVSFLYSSVLSNTELRTPTGAVKLDASGQM
FT                   QCTSCHSPHDNANGKFLVVSNIKSGLCTNCHNKSYWAASDHQTSTKTWNGVGTNPWLHT
FT                   TNTPQNVTNNACESCHRPHTAPGRQQLLNSATEETNCLVCHSGTVATSAKNIQIELNKT
FT                   SQHSVGAYLNVHDAGEANLMTTAHVECQDCHNPHSANSTAGSAPGTTPIALPGSLSNVR
FT                   GITISGAAVSPVTAEYQICLRCHGDSTSRTPASRTARVIVQTNTRLEFDTANPSYHPIA
FT                   GVGKATGVTGKTVPSLIAPWTTTSVMNCSDCHNNNAGPNTGGTGPNGPHGSTNPLLLER
FT                   SYVVTDPATESAANYALCYKCHSRTAIIGTGAGSFKEHNKHIVGETTSCNVCHDPHGIS
FT                   STQGTALSNSRLINFQTGVVTKSGAQAIRWERVGTTGGRCYLSCHGKDHNGLSY"
FT   gene            259727..260365
FT                   /locus_tag="Rfer_0260"
FT   CDS_pept        259727..260365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68017"
FT                   /db_xref="GOA:Q222N6"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N6"
FT                   /protein_id="ABD68017.1"
FT                   /translation="MKNTPSLKASLAWALALTFTFALPVLAQNRDKDKDKDKACLECHA
FT                   AVAQKKVVHAAVHMGCNSCHNEVELNTVPHKSRSKTAKERSAENAAMCANCHDKKLFEG
FT                   KVVHAPIAAGECNDCHDPHASDNLGLLKKEPATLCLDCHPDIKKGPHVVAGFTRSGHPL
FT                   GDEKKEAKDPLRSGKKFYCGSCHEPHSSERPKLNRFGLGMVACQKCHEK"
FT   sig_peptide     259727..259810
FT                   /locus_tag="Rfer_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(260475..263909)
FT                   /locus_tag="Rfer_0261"
FT   CDS_pept        complement(260475..263909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0261"
FT                   /product="protein of unknown function DUF748"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68018"
FT                   /db_xref="GOA:Q222N5"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N5"
FT                   /protein_id="ABD68018.1"
FT                   /translation="MARQSLQWTNIRWKRWVAGAAGLLAAYTVAGFWLVPPLIKHQVPQ
FT                   FGQTELARQATIGEVRFNPFTLRLEAQDLRLAEADGTPLFAVGKLAVALQWKSLIRRAW
FT                   SFSDIRITAPSANLAIAPDGKFNLAELLATLERRPHEASTDASLPRVIVEQLALEQGTV
FT                   DMHDRRAGYDNTFAPIDFSLSNFSTLPEQNDAHTFTAQSARGGKMRWKGTASVNPIRAS
FT                   GEVTLENASLPELAVYLKSYTRARVAAGQLSATLPYSLSYADGKFEASLEGAKVSLRDL
FT                   ALAREGVTDSFAALTRLDINDVNADLARRQVTVGEVRADGGKLSVKRDAKGELDLTNLM
FT                   IASAGPAASGPAAAVAVNNWKLAVKQVLFDQMAVSAVDETAKPPLKLNAGKVRLQLQVA
FT                   AEQAGANFQLKLSQAALSLAGLTLASGAQAPFKLAQLGFSDGMLDLAARQASIGRLYAE
FT                   GGQLQLVRARDGKLNLMELLPRSSAIGPQAAAAAGKPWVAVAKTVELSKFGADVADEGA
FT                   GVKVQVTDLALKLEGASSDLKQTVKFNTDLKLREGGQFTAQGSVVPANGEVQADVRLKQ
FT                   LALAPLQPLLAHYLKLKIARGNVSAQGLLTTGAGTAKSPSLRYVGALNVAGLTLNEEDG
FT                   GLFAAWKNASADKFTASLNPNRLDVPELRIVEPNATLIIEDDRSFNAARLLVQPNAGAK
FT                   VEVPTQAKAKADDDPFPVRIRRLRLQNAKLDFTDLSLRPQFSAKIYELNGVINGLSSNR
FT                   EARSQIELDGRVDEFGLARIRGELNPFAPRNNTDINVVFKNVDMVPASPYSMKFAGYKV
FT                   AEGKISLDLQYKIRDSQLEGANQIVIDKLTLGERVDSPDALKLPLQLAIAILKDSEGRI
FT                   DLGLPISGNLSDPQFSYGAIIWKAIGNLLTRIVTAPFRALGSLLGVSGEKLESIDFDAG
FT                   SDRLLPPEREKLKQVAQILGKRAQLKLSVPAQYSETADGAALRAGAVRVEIARRAGIKL
FT                   QAGEEPGPLNLSDRAVRGAMRDLYAERFGEAELDKQKKAAEGGGAPAAAASMPDTKTAA
FT                   AQAKLPLWQRVGKMIQGEPQVADASAFYNQLQERLNQNQPLAADALAKLGAQRAEAILA
FT                   ALKEAGVDPARADAAAPEKVESDIGKPVPLKLGLVAK"
FT   sig_peptide     complement(263817..263909)
FT                   /locus_tag="Rfer_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.857) with cleavage site probability 0.651 at
FT                   residue 31"
FT   gene            complement(264127..266178)
FT                   /locus_tag="Rfer_0262"
FT   CDS_pept        complement(264127..266178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0262"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68019"
FT                   /db_xref="GOA:Q222N4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N4"
FT                   /protein_id="ABD68019.1"
FT                   /translation="MRTYFLAPTQPNVGLTSVSLGLLRALQRRGLKVAFVKPITKRTAD
FT                   TEPSVLFARSICHLQNTPDPLPMSLVTQRVSSGQTDELLEEIVSLAMSCTKEADVLLVE
FT                   GIHADPSRIFIPRLSGQIARSLQADVVLVASAADAQGIAETNYLIAQIRNVGRNVVGVI
FT                   FNRAPADFDEAAAAMQLDGVPIWGVVKNNPALSAPRMIDVARHLGAEVMIEGDIATRRM
FT                   LETVLCGRSVAEVIPRLKPGTLVVTAGDRDDVILATALAASNGVELAGLMLTHHSAISP
FT                   RIERFASLAFHSGLPVLRTDGDSYETAASISRLPLAVPQDDLARMDNVIESVAEQLDGN
FT                   MIFAGLERAAPARVSPPAFRHQLIQKARAANKRIVLPEGDEPRTIRAAVICTEKGIARC
FT                   VLLGKRKVIHSVADALGIELPKGLEILEPSEIAERYVAPMVELRKSKGLTPGQALVALE
FT                   DTVVLGTMMLAVGEVDGLVSGAVHTTASTVRPALQLIKTAPGSSIVSSCFFMLMPEQVL
FT                   VYADCAINPNPTAQELADIAKQSADSALAFGIEPKVAMISYSTGESGSGDDVEKVRTAT
FT                   ALAHARWPELVLDGPMQYDAAAVREVGEQKAPGSAVAGQATVFIFPDLNTGNTTYKAVQ
FT                   RSAKVVSVGPMLQGLRKPVNDLSRGALVDDIVFTIALTAIQAEAMARQ"
FT   gene            complement(266435..266890)
FT                   /locus_tag="Rfer_0263"
FT   CDS_pept        complement(266435..266890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0263"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68020"
FT                   /db_xref="GOA:Q222N3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N3"
FT                   /protein_id="ABD68020.1"
FT                   /translation="MDEITKISFVEEVDTSYLETLMGYNSRRAALAIIGVFLERMAKYE
FT                   LRPVDFSVLSLVSHNPGITSRQLCNALGVLAPNLVGMVTALEKRGLITRCPHPHDGRAM
FT                   GLHLTEDGKTLLKAAEETASKLEFDCTPNLSSAERKTLIRLLKKIYK"
FT   gene            complement(267006..268715)
FT                   /locus_tag="Rfer_0264"
FT   CDS_pept        complement(267006..268715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0264"
FT                   /product="acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68021"
FT                   /db_xref="GOA:Q222N2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N2"
FT                   /protein_id="ABD68021.1"
FT                   /translation="MRYEPPLQDIQFILHEVLNAPACLQSLPTFAEVDADLMHQVLDEA
FT                   GKFVGEVIAPLNRSGDEVGCQFANGQVTTPPGFKAAYQAFWQAGWPALACAVEDGGQGL
FT                   PGLLEAVLYEMLSAANHGWTMAPGLLHGAYECVKHHASDELKTRYLGKIATGEWLATMC
FT                   LTEPQAGSDLGLVRTKAQPQADGSCRLSGTKIFISGGEHDLTDNIVHLVLARLPDAPPG
FT                   PKGLSLFLSPKFMPDGARNPVHCERIEEKMGLHGSATCVMRFDEATGWIVGEPGRGLNA
FT                   MFVMMNAARLHVGLQGIGLLDAAWQKADAYAKERRQMRAPVRGTSAAEADLIVEHPAMR
FT                   RILDTQRAWIDGGRVLAYKTALELDVIKHHPNSKRKAEAERWCSLVTPVLKAAWTAQAF
FT                   NGASDCLQVFGGHGYVREWGIEQIVRDSRVAMIYEGTNEIQAIDLLVRKVLPDGGAGLT
FT                   ALLQQLSDDLVCSEVADKAFQTQVTVLCDLTRQLVAASALDRQLPYWVADDYLHAVAMT
FT                   LLAWAWSQIRPAVPADVQGSDAARWLLPAAALQLWILPGFAMRVQIVADRLP"
FT   gene            complement(268733..269854)
FT                   /locus_tag="Rfer_0265"
FT   CDS_pept        complement(268733..269854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0265"
FT                   /product="porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68022"
FT                   /db_xref="GOA:Q222N1"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N1"
FT                   /protein_id="ABD68022.1"
FT                   /translation="MKISSLITLSGLLATGAVQAQTQSATLYGMIDTGVEAVSNVSGAG
FT                   TLTRMPSTTGILPSRLGFRGKEDLGGGLSAVYTLEMGFAPDTGASGQGGRLFGRQSTVG
FT                   FSGDWGAVTLGRQWTMLFWSILDSDIVGPAVYGLGSLDSYIPNSRIDNSLAYKGKFGNV
FT                   TVGGTYSLGRDTVNAGPSPAGTNCAGESGADTQACREWSALVKYDTASWGAAVAYDSLN
FT                   GRTPASGTDVVLPAGLTSSAKSDARLMLNGYVKFSDVKLAGGVIRRTNDGSATKPKSDL
FT                   WYVGASYPLSPAWTIDGTYAKLSYKDIANFDSSLLVVRSLYKMSKRTTLYVQLGGISND
FT                   SLANVSVSGGAPGSNPALGDSQTGVMLGMNHAF"
FT   sig_peptide     complement(269792..269854)
FT                   /locus_tag="Rfer_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 21"
FT   gene            complement(269984..270733)
FT                   /locus_tag="Rfer_0266"
FT   CDS_pept        complement(269984..270733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0266"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68023"
FT                   /db_xref="GOA:Q222N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222N0"
FT                   /protein_id="ABD68023.1"
FT                   /translation="MKPPVLTVKGLRAGYGRAEVLHGIDLQAFQGSVITVIGPNGAGKS
FT                   TFLNALMGVLPAQGQIEFEGQPINTLSLEERVMLGIALVPEKRELFGSMSVEDNLVLGA
FT                   FRQVRLRNPKWREQMDVVFDLFPRLKERRTQAAGTLSGGERQMLAVGRAMMSRPTLLML
FT                   DEPSLGLAPLVVKEIFRTIDTLRKTGVTTLLVEQNARAALEAADDGYVLEMGEIALHGP
FT                   AQDLATDPRVIDTYLGAARKKDTATRP"
FT   gene            complement(270735..272531)
FT                   /locus_tag="Rfer_0267"
FT   CDS_pept        complement(270735..272531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0267"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68024"
FT                   /db_xref="GOA:Q222M9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M9"
FT                   /protein_id="ABD68024.1"
FT                   /translation="MSFTTQLQHWAHNAKIQRVVVVACMLLYAVSPVPEFWITQLNYIA
FT                   LYSLVILGLVLLTGIGGLTSFGQAAFVGIGAYTSAYLTVHMGWSPWLTVFAGLFITGIS
FT                   ALVVGWITLRMSGHYLPLATIAWGLSLYYLMGNLDALGKYDGILGVPALTVWGWDISQG
FT                   RSFFVLAWGMVLFAAFALLNLMDSRTGRAIKAMRASTLMAEAMGVDTLRHKVGIFLIAA
FT                   LFASLSGWLFAHFQRTVNPSPFGLKMGIEYLFMTVLGGAGYVWGAISGAVMTKLLEDEL
FT                   QVLLPKLLGTSGSYEVIVFGIVLVLVLKYLPDGVWSLVGRFLPKPNRVEDWHAAAALPE
FT                   RAKPALGDTVLEVKDIRKQFGGLTAVNNIGFSIQAGQIVGLIGPNGAGKSTTFNLITGV
FT                   LGLSSGEVKFRGQTISGLPSREIARRGMSRTFQHVKMIPEMTVLENVALGAQLRGSKGA
FT                   LSSMLRLDRAEEQSLLREAARQLERIGMGHAMHELAGNLAMGPQRLLEIARALCSDPAL
FT                   LLLDEPAAGLRHKEKQALAAVLRQLRSEGMSILLVEHDMDLVMDVTDHIVVMEFGTLLM
FT                   QGTPEEVQQSPKVRAAYLGVEH"
FT   gene            complement(272533..273570)
FT                   /locus_tag="Rfer_0268"
FT   CDS_pept        complement(272533..273570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0268"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68025"
FT                   /db_xref="GOA:Q222M8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M8"
FT                   /protein_id="ABD68025.1"
FT                   /translation="MDFSIASILLLDGITNGAVYALLGLATVLVFSVTRVIFIPQGEFV
FT                   AYGALTLAIFQTGKVPGTVWLLLIMAVLAALMDARLSWQHTGDAKRALKAGLSALAAPL
FT                   VVSLLSIWAAPHQLPLLVQALLTVAIVTAFGPLVYRLAYQSLADASSLVLLIVSVGVHF
FT                   AMTGLGLLFFGAEGFRNPSFWDERLNLGPLAITGQAIIIVLTSLAMIVLLWQFFNRTLY
FT                   GKALQATAVNRLGARLMGISTHGAGQATFAMAALIGALSGLLIGPTTTVFYDSGFLIGL
FT                   KGFVAAVMGGLHSYPLAALGALFVGLVESFGSFWASAFKEVIVFTLVLPILLWRSVAGG
FT                   NEEEH"
FT   gene            complement(273660..274793)
FT                   /locus_tag="Rfer_0269"
FT   CDS_pept        complement(273660..274793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0269"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68026"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M7"
FT                   /protein_id="ABD68026.1"
FT                   /translation="MKAFKTLIATAAAALVTGSALADITIGISLPLSGPASGLGIPMGN
FT                   QIKLWPTSIAGEKLKVIVLDDATDPTNGVKNAKRFVTEDKADIIMGSAATPVAIPMAAV
FT                   AAEAETVQIAFSPAVLPPGKDAWTFRLPQSNDVMAHAMVALMKKQGVKTVGFLGYTDAY
FT                   GESWLKEFTAQANANGIKLIGTERFARSDTSVTAQALKLVAANPDAMLIVASGSGAAMP
FT                   HMAVVDRGYKGKIYQTHAAASRDLMRVGGKAVEGAYVVSGPAVIAEQLPDSHPSKKVAI
FT                   DFVQQYEKAYGPGSRNQFAGHSYDAVLILEKVVPVALKKGKPGTKEFRAALRDAMETMG
FT                   RTVVSHGVLNWTHDNHWGFTNETGVMLKVVNGDWKVE"
FT   sig_peptide     complement(274725..274793)
FT                   /locus_tag="Rfer_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(274861..275277)
FT                   /locus_tag="Rfer_0270"
FT   CDS_pept        complement(274861..275277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0270"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase"
FT                   /EC_number="3.1.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68027"
FT                   /db_xref="GOA:Q222M6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M6"
FT                   /protein_id="ABD68027.1"
FT                   /translation="MSKTVVYEVNVMFGDCDPAGIVFFPNFAKWMDASSLNFFIQSGVP
FT                   PWRELVKTTGIIGTPLLEINTKFLRPATYGETLQIHTSIEEWRDKVFVHRHLIKRGDEL
FT                   LCEGTEVRAFCMRLPDSDRIKAIPVPADIKALCC"
FT   gene            complement(275287..276051)
FT                   /locus_tag="Rfer_0271"
FT   CDS_pept        complement(275287..276051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0271"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68028"
FT                   /db_xref="GOA:Q222M5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M5"
FT                   /protein_id="ABD68028.1"
FT                   /translation="MNIQGQAALVTGGGSGLGEATARELARLGAKVAILDVNLANAEKV
FT                   AAEIGGVACQCDVTSPDSVQAAIDTATAAHGPARILMQIAGIGSAKRVVGKDGNAAPLE
FT                   DFVRVVNVNLIGTYNVARLFAAACAKLEPMEDGERGAMVFTASVAAFDGQVGQQAYSAS
FT                   KAGVAGMTLPMARDLAQHGIRVCTIAPGLFATPLMKTLPEAVQVSLAASIPFPQRLGKP
FT                   EEFAQLAAHIVSNCHLNGEVIRLDGALRMAPR"
FT   gene            complement(276153..277403)
FT                   /locus_tag="Rfer_0272"
FT   CDS_pept        complement(276153..277403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0272"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68029"
FT                   /db_xref="GOA:Q222M4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M4"
FT                   /protein_id="ABD68029.1"
FT                   /translation="MASKGFFNAFDDIWMLDGMRTPLVDYCGALGHISPTDLGIKAARA
FT                   ALERAAVPAAHINSVLTGNMAPGDFEQFMLPRHIGLYAGVPQDVPALMAQRICGTGFEL
FT                   FRQAGEQIESSCADVTLVVGTESMTRNPIAAFEHRTGFKLGAPVGFKDYMWEALNDSAA
FT                   GINMIQTAENLAKQYGITREEVDAFASSSFAKAVAAQQSGFHAGEIVPVVSENFALEGY
FT                   ATRAIKLQGKSSEVALDTHARISPVEVLAKLRSVYPGGVQTGGNSAALVDAAAAVVVAS
FT                   GGYVRAEGKKPLARVVAAAVVGVPPEIMGIGPAPAIRLLLERAGLTLDQIGRFEINEAQ
FT                   GAQTLSVGRELGLDLSKLNVNGGAIALGHPLACTGVRLTLTLAREMQRSHVRYGVSSAC
FT                   IGGGQGIALLLENPLTV"
FT   gene            complement(277417..279276)
FT                   /locus_tag="Rfer_0273"
FT   CDS_pept        complement(277417..279276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0273"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68030"
FT                   /db_xref="GOA:Q222M3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M3"
FT                   /protein_id="ABD68030.1"
FT                   /translation="MTEPKFRPLTFGVTRVDLRDGAPGVHYLKAEQALQDYPERITDRL
FT                   AHWAATAPDRIYIAQREKLPDGSKGEWKCITYGQAWRHARCIAQALIHRGLSTKNPVVI
FT                   LSENDLEHALLALGCLVAGVPFVPTSPAYSLVSVDYDKLRHVIKTVTPGLVFAADATRY
FT                   AKAINAALPADIEVVLTQGQIDGRDHTTFADLLNTPVTPAVDAAMQATGPDTIVKFLFT
FT                   SGSTSLPKAVINTQRMWCANQQQMAQSMPVLAQEPLVLVDWLPWNHTFGGNHNFGMVLY
FT                   HGGTLYIDDGKPTPALMAETLRNLREIAPTVYFNVPTGFEAIAAAMQTDDVLRKNLLSR
FT                   VKMFFYAGAAMAQPIWDSLFESEEREIGERIVMSTGLGMTESGPFAIFVTNPNVKAGDL
FT                   GVPTPGMDLKLVDVDGKTEVRYRGPNITPGYWRAPNETAKHFDEEGYFCSGDAVKWIDE
FT                   TDVHQGLKFDGRIAEDFKLATGTFVSVGPLRAKIIAAGAPYIQDVVLTGINLKEVGAMV
FT                   FPTQAVRALSGLPASTPMADVLTRAPVLDQFQKVMNELNKIATGSASRIARMCLLAEPP
FT                   TLDRGEVTDKGSINQRAVLTHRAETVAALHDDSLASILKPQSL"
FT   gene            complement(279359..280141)
FT                   /locus_tag="Rfer_0274"
FT   CDS_pept        complement(279359..280141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0274"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68031"
FT                   /db_xref="GOA:Q222M2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M2"
FT                   /protein_id="ABD68031.1"
FT                   /translation="MDKKHIHFELYGEQQEVAIIRLTRGSKRNALNDGLILALRGLFEK
FT                   MPASVRAAVIDGEGEHFCAGLDLSELQERDASQGVFHSRMWHAALEHVQYGPVPVIAAL
FT                   HGAVVGGGLELASACHIRVADDTTFYALPEGSRGIFVGGGGAVRIPRLIGTARMTDMML
FT                   TGRVFNAQDGERIGLAQYLVPAGTAFDKACELAVRIAGNAPMTNYALTHVLPRIADQPA
FT                   DQGFMTEAMMAAIAQSAPAAKERVRAFLEGRADKVRIA"
FT   gene            280255..281118
FT                   /locus_tag="Rfer_0275"
FT   CDS_pept        280255..281118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0275"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68032"
FT                   /db_xref="GOA:Q222M1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M1"
FT                   /protein_id="ABD68032.1"
FT                   /translation="MDVKNLVAIDIHTHAEVSCWNPFDSYGEEYDRAADKYFRNSRRPT
FT                   IAETIAYYRERKIGLIMFTVDAETQMGRRRIPNEEIAEAAKANSDMMMAFASIDPHKGK
FT                   MGAREARKLIEEFGIKGFKFHPTVQGYHPYDKMAWPIYEVIAEYKMPAIFHTGHSGIGS
FT                   GMRCGGGLRLAYSNPMHLDDVAVDFPDMQIVMAHPSFPWQDEALSVATHKPNVWIDLSG
FT                   WSPKYFPKQLVQYANTLLKDRILFGSDYPLITPDRWMKDFEEAGFKPEVMPGILKDNAV
FT                   RLLGLG"
FT   gene            281156..281860
FT                   /locus_tag="Rfer_0276"
FT   CDS_pept        281156..281860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68033"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q222M0"
FT                   /protein_id="ABD68033.1"
FT                   /translation="MNPSTILPQADVLDHAGLNRQHVFDLAALPPDLVAPLEPVPHERQ
FT                   LILFGHAGRRLWECVQAEGIHSAHPIDEYSVRTVERWLAQALPQVRSRVVFPGAQRIGL
FT                   QRLGAIAGWHRAAPFMVGIDSVWGSWFAYRVAILTDTALPPSAPIDNGYPCDSCVNKPC
FT                   ISACPAGALVSGSFNLQACNTGRLAADSDCALGCTARSACPVGAEHRYDESQIRHSAAG
FT                   SLATIRSYPACP"
FT   gene            complement(281882..282772)
FT                   /locus_tag="Rfer_0277"
FT   CDS_pept        complement(281882..282772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0277"
FT                   /product="NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68034"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L9"
FT                   /protein_id="ABD68034.1"
FT                   /translation="MTSTLLVTGASGHLGQRVIHHLLETLKVAPQRIIATTRKPETLKD
FT                   LAAKGITVRGADFDDAASLRSAFAGADRLLLISTDALDRPGRRLAQQQAAVAAAQQAGV
FT                   AHVVYTSMPLPENSPLLIAPDHAGTEKALASSALKGWTLLRNHWYFENLFMWLPSALAS
FT                   GQWYSAAEQGKVAHIARDDLARAAAAALLKDTGKNTYTLSGAEAFTTEQIAQQVSQATG
FT                   KPLQVVPVPLAGLIQGMVSAGFPEPLAAVFASFDTNTAAGRVAEVTGDFQKLTGVAPQP
FT                   FAGWLSANAAALAAL"
FT   gene            282960..283346
FT                   /locus_tag="Rfer_0278"
FT   CDS_pept        282960..283346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0278"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68035"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L8"
FT                   /protein_id="ABD68035.1"
FT                   /translation="MAVHKSKVDWAERCPIRDVLERMGDRWSMLVLFTLGDHQSLRFSV
FT                   LKTTIGDISQRMLSQTLRRLEQDGLVLRTAHATVPPRVDYELTALGQSFLLPMRNLLHW
FT                   AEQNHQQVRDARVAYVPPPRHEAL"
FT   gene            283566..284042
FT                   /locus_tag="Rfer_0279"
FT   CDS_pept        283566..284042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0279"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68036"
FT                   /db_xref="GOA:Q222L7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L7"
FT                   /protein_id="ABD68036.1"
FT                   /translation="MTQATSQAPAFTLYDEPGHLIRRAQQIAVSKFHEVHGRQVTPIQY
FT                   AILRTLFESPGVDQVTLAQLIALDTSSTADIATRLEAKGWILREVLPRRQRSLSLTPAG
FT                   EAVLQGMRSGIEQMYLGMMDSLDAAEQREFMRLLRKFVHLNDQQNQADEPKTKG"
FT   gene            284179..285234
FT                   /locus_tag="Rfer_0280"
FT   CDS_pept        284179..285234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0280"
FT                   /product="Rieske (2Fe-2S) protein"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68037"
FT                   /db_xref="GOA:Q222L6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L6"
FT                   /protein_id="ABD68037.1"
FT                   /translation="MFPKNTWYVAATPNEIDEKPLGRTICGERIAFYRGEENKVAAVED
FT                   FCPHRGAPLSLGYVSEGKLVCGYHGLEMGCQGKTIAMPGQRVRGFPAIKAYPVVERYGF
FT                   IWVWPGDAAQADEAKIPHMAWYDNPEWAYGGGLYHINCDYRLMIDNLMDLTHETYVHAS
FT                   SIGQKEIDETPCKTTVEGDTVVTSRFMSGIQPPPFWQMALRANHLADDVPVDRWQICRF
FT                   TPPSHVMIEVGVAHQGHGGYDAPNDKKAYSVVVDFITPETETSIHYFWGMARKFNPADK
FT                   ALTASIREGQGKIFGEDLEMLERQQQNLLAHPERALLMLNIDAGGVQSRRILERVIAQE
FT                   KQGAGPVGTSV"
FT   gene            285245..286216
FT                   /locus_tag="Rfer_0281"
FT   CDS_pept        285245..286216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0281"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68038"
FT                   /db_xref="GOA:Q222L5"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L5"
FT                   /protein_id="ABD68038.1"
FT                   /translation="MSSTSALSVRVARKATVATDICTLELVAAQDGTALPGFSAGSHVD
FT                   VHLPGGLTRPYSLCNDPKETHRYLIGVLRDPASRGGSQAVHEQVQEGQVLQISAPKNHF
FT                   PLAHDAKHSLLLGGGIGITPILCMAERLANTGADFELHYCTRSIERTAFRERIAASSFA
FT                   DQVQFHFDDGDAAQKLNLATLLCAPKAGCHLYVCGPKGFMDAVLKTARDIGWPEGRLHY
FT                   EFFAAEVLKSEADASFEVKLASSGRIITVAKDQTVTKALSDAGVEVQTACEQGVCGTCL
FT                   TRVLEGVPDHKDQYLTPEEQAANDQFLPCCSRAKTARLVLDL"
FT   gene            complement(286528..287214)
FT                   /locus_tag="Rfer_0282"
FT   CDS_pept        complement(286528..287214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0282"
FT                   /product="protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68039"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L4"
FT                   /protein_id="ABD68039.1"
FT                   /translation="MNTSVPVNKLAEVEAGDFGVWLTQVLASFRGSAGTDVPCGSCRGC
FT                   CTSSYFIHVRPSDLKTIGAVPKSLLTAAPGLPQGYKLIGFTSNGFCALLKNGDCSIYSS
FT                   RLQTCRDYDCRVFTAAGINAGGADKAAINQRVQEWQFSYATGQDQQIHNAIKKAASFIV
FT                   KNRAAFPGGRAPVAPSDIAVLAIKVHGVFLLPEMGSQTPSEIAEAIIRASREFEASRST
FT                   DGTEKQ"
FT   gene            287482..287922
FT                   /locus_tag="Rfer_0283"
FT   CDS_pept        287482..287922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0283"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68040"
FT                   /db_xref="GOA:Q222L3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L3"
FT                   /protein_id="ABD68040.1"
FT                   /translation="MKGQALELISEIHLDWKRHVARALAPHGITPKQIFLLRKLKESAT
FT                   LTPSEVAVLIHGDRPSTTSMLDTLERSGWICRQRDPSNGKRVIITMTDAGMEKLASVPE
FT                   RLWRSGKVPSDPESCLERDEREELTRLLQKMHRCMNANPQER"
FT   gene            287927..288817
FT                   /locus_tag="Rfer_0284"
FT   CDS_pept        287927..288817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0284"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68041"
FT                   /db_xref="GOA:Q222L2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L2"
FT                   /protein_id="ABD68041.1"
FT                   /translation="MLAWLAYLTASVVWGSTFLAIAFAIETFTPFGLSAVRFIPAGILA
FT                   LLIGQIRKERFPSWREIPHIALVGITLLGVCMGLIGWAEGRVSSGVTAALGATVPLFLA
FT                   LMDPRGLDPKAWCGLGMGFLGVLVLLWPSGQGPALSGAAALVLSASLWAYGTLYGKRHA
FT                   DESGHFSQIGVEMLVAGVLSLLAASLTGGISHGTWNPRSLLAVGYLITFGSILAYSAYI
FT                   YLSKVWPCAKAGTYAYWNPIVGVLLGCWFRGETFHARMLPGLACILLGVALVQIPWPKA
FT                   LRFGSANQGAKQISR"
FT   sig_peptide     287927..288001
FT                   /locus_tag="Rfer_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.861) with cleavage site probability 0.671 at
FT                   residue 25"
FT   gene            288839..289435
FT                   /locus_tag="Rfer_0285"
FT   CDS_pept        288839..289435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68042"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L1"
FT                   /protein_id="ABD68042.1"
FT                   /translation="MGMEIDLVIHVFWGQFGTRTAYREREQYIAFFFIPRKVKGRSRVE
FT                   VVEQGGMTVAGVLVQAPWQRLWDEVPKAWQQVFQRAPELQALQQGPFMDVSLGLVDSAY
FT                   LQLVGVRLREGAAVPRGFTAVHIPAQKLLRHRHVGPAAGIADSFGAMYAWARRHGVALG
FT                   DFKLDFGYLPSGDETEHELLAGLLPEVAWRSAHAG"
FT   gene            289475..289825
FT                   /pseudo
FT                   /locus_tag="Rfer_0286"
FT   gene            289813..290361
FT                   /pseudo
FT                   /locus_tag="Rfer_0287"
FT   gene            290698..291870
FT                   /locus_tag="Rfer_0288"
FT   CDS_pept        290698..291870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0288"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68043"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q222L0"
FT                   /protein_id="ABD68043.1"
FT                   /translation="MNKRQFIHAIALAVSLLAASNSIAQGNTFKIGLILPMTGQQASTG
FT                   RQIEAAAKLYMAQNGDTVAGKKVGLIVKDDTSIPDVTKRLAQDLVVNDKVNVLAGFGIT
FT                   PSALATAPIATQSKTPLVVMAAATSSITQASPYVVRTSFTLAQAAVAMGDWAPKNGIKK
FT                   VVTLVSDYGPGIDAEKYFKERFLFNGGQVPESLRVPLRNPDFAPFLQKVRDLKPDALFV
FT                   FVPSGAGAAVMKQFLERGMDKAGIKLIGTGDVTDDDQLNGMGDGALGVVTSHHYSTAHP
FT                   SAVNKKFVEAFGKANPGLRPNFMAVGGYDGMRVIYEALKATKGQGGGDALLAAMKGQIF
FT                   ESPRGPMFIDAQTRDVVHNIYLRKVEKKDGQLYNVEFDVIKDVKDPGKAK"
FT   sig_peptide     290698..290772
FT                   /locus_tag="Rfer_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.934 at
FT                   residue 25"
FT   gene            291939..292811
FT                   /locus_tag="Rfer_0289"
FT   CDS_pept        291939..292811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0289"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68044"
FT                   /db_xref="GOA:Q222K9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K9"
FT                   /protein_id="ABD68044.1"
FT                   /translation="MLTILFDGIAYGMLLFILAVGLAVTMGLMNFINLAHGAFAMVGGY
FT                   ITVLLMQKFGVPFLLCLPLAFVGSALLGALLERTLYRPLYHKPHLDQVLFSIGLTFMAV
FT                   ASADYFIGSGQQIIQLPEWLKGRTEFGDGAWMLGMGHYRLFIIAVCAALTVALQYVLTK
FT                   TRFGSRLRASVDDQRVAAGMGINVNLVFLTTFAVGSGLAGLGGALGAEVLGLDPSFPLK
FT                   FMIYFLIVVAVGGTSSITGPLLAALLLGIADVAGKYYIPKLGGFIVYSLMIAILIWRPQ
FT                   GLFVRKGGK"
FT   sig_peptide     291939..292061
FT                   /locus_tag="Rfer_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.645) with cleavage site probability 0.391 at
FT                   residue 41"
FT   gene            292811..293788
FT                   /locus_tag="Rfer_0290"
FT   CDS_pept        292811..293788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0290"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68045"
FT                   /db_xref="GOA:Q222K8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K8"
FT                   /protein_id="ABD68045.1"
FT                   /translation="MSNTQDLLRQTGRWKRWEVPLWLLALASPLLLSGHALIINEIAIV
FT                   ALFALSLDLILGFTGIVSLGHAAFFGMGAYSAALFAKLVMPDPLVGLAVGIACAALLGA
FT                   LCSATILRGTDLTRLMVTLGVALILGELANKLDWLTGGADGLQGVMMGPLLGQFEFDLT
FT                   GRTAAWYSLTVLLVVFVITRRFVNSPFGATLKAIRDNRLRAMAIGIAVNSRMALVYTVA
FT                   AALAGAAGALLAQTTGFASLDLFEFHRSADVMLILVIGGVGWLYGGITGAIVFKLMQDA
FT                   ISSITPQYWTFWIGLFLVVLVLVGRERLIRPWTWFGKGKTGGAA"
FT   gene            293785..294591
FT                   /locus_tag="Rfer_0291"
FT   CDS_pept        293785..294591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0291"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68046"
FT                   /db_xref="GOA:Q222K7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K7"
FT                   /protein_id="ABD68046.1"
FT                   /translation="MSDTVLSAQGLVMKFGGITATNNVTLDLKQGARHALIGPNGAGKT
FT                   TLINLLTGVLQPTSGKIVLEGQDITTLAPYQRVRRGMVRTFQINQLFDTLTPLETLAMV
FT                   VSQQQGLGNKWWQALGANQRVTERCEQLLEQFHLTAVMTQPTRVLAYGKRRLLEIAIAL
FT                   ACEPRVLLLDEPVAGVPAGEREELLQTVAALPADVSILLIEHDMDLVFSFAKRMTVLVN
FT                   GTVLTEGDPDQIAHDPQVKAVYLGHGDEINDAMGGMMASAGGTHHG"
FT   gene            294584..295321
FT                   /locus_tag="Rfer_0292"
FT   CDS_pept        294584..295321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0292"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68047"
FT                   /db_xref="GOA:Q222K6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K6"
FT                   /protein_id="ABD68047.1"
FT                   /translation="MGELLKVENLSAGYGEAVVLHGVSLSIAEGQTLALLGRNGTGKTT
FT                   LINTLAGATRQHGGSISLGTGATSVTLHKLPSHERAAAGIGWVPQERNIFKSLTVHENL
FT                   TAVARPARAGRASRPWTPERVYELFPRLAERKSNLGTQLSGGEQQMLALGRALVLNPTL
FT                   LLLDEPCEGLAPIIVQELLRAIRRITRDEGLSAIIVEQHPQAILAISDTAAVLDRGTVV
FT                   HTGTARSLQEQPALLDKLLGVAR"
FT   gene            295389..296012
FT                   /locus_tag="Rfer_0293"
FT   CDS_pept        295389..296012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0293"
FT                   /product="Hemerythrin HHE cation binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68048"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K5"
FT                   /protein_id="ABD68048.1"
FT                   /translation="MTPDLQPSPKEHTMEPSSIHIIRDEHATLAAMLRSLGMMVARGPG
FT                   AHPQNFFDVLRAMLFYIDEFPERLHHPKETELLFPKVAARSPETAALIAQLDREHELGE
FT                   SNVRELQHLLLAWELLGESRREPFDVAAKRYLSFYLEHMRLEETVILPAAMKVLSAADW
FT                   KDIDAAFETNCDPLTGQYPRDPLYDQLFTRIVNHAPAPIGLGED"
FT   gene            complement(296062..296913)
FT                   /locus_tag="Rfer_0294"
FT   CDS_pept        complement(296062..296913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0294"
FT                   /product="Protocatechuate 4,5-dioxygenase"
FT                   /EC_number="1.13.11.8"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68049"
FT                   /db_xref="GOA:Q222K4"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K4"
FT                   /protein_id="ABD68049.1"
FT                   /translation="MAKIIGGLGTSHIPAIGGAIHKGLQQDPYWKPFFDGFPPIHEWLK
FT                   AQKPDVMVIFYNDHGLNFFLDKMPTFAVGAAPQYVNSDEGWGIPSLEALKGEVDLSWQI
FT                   INHLVDKEFDITTCQELLVDHACSLPLKLFFPEGNYPVTVVPVCINTVQFPLPKAHRVY
FT                   TLGRAVGEAVAAWDSSKKVAFIASGGLSHQLEGTRAGFINKDFDLKFMESLLTNPEWAT
FT                   QFSIHELVEKTGTQGIELLTWLAMRAALTVGEGAGVRKVHSNYHIPISNTATGLLALEK
FT                   VS"
FT   gene            complement(296929..297282)
FT                   /locus_tag="Rfer_0295"
FT   CDS_pept        complement(296929..297282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0295"
FT                   /product="Extradiol ring-cleavage dioxygenase LigAB, LigA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68050"
FT                   /db_xref="GOA:Q222K3"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K3"
FT                   /protein_id="ABD68050.1"
FT                   /translation="MVSRTPLPQIPGTNPFDGELAKKGYALNKMCFSFNSAENRAEFKN
FT                   DEEAYMRKYGLTKPQAAAIRAKNVLQLLDAGGNAYYLAKFAGIFGLDMQDIGAQQTGMT
FT                   KEEFKAKLVAAGK"
FT   gene            297415..298338
FT                   /locus_tag="Rfer_0296"
FT   CDS_pept        297415..298338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0296"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68051"
FT                   /db_xref="GOA:Q222K2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K2"
FT                   /protein_id="ABD68051.1"
FT                   /translation="MSKFNYTDLDGHLLQLLVAVVEVGSITGAAQRLGVTQSAVSHLLD
FT                   KLRAITGDALFVKSGRGIVATAHAEQLAGKARELLMAMEGFAMSGAFDPARWRCTFTIA
FT                   ANDFQRDVLLPPLMAQLRQEAPGVTLRVIPSNIPSLEMLRQEHCQLVISPRPPVGGDVM
FT                   QKRLFEDSYRVYYDPNQRDAPQTLADYLAAEHITVVYEPKRALDLDQWLAGRGVQRQFR
FT                   VMVPGMAALPAFMRGSQLLATAPGLLQQHLFKDLASAPVPLDCPKMPMYMIWHLRYQND
FT                   PAHQWLRAGLSQISLKVASTELAAPS"
FT   gene            complement(298346..299269)
FT                   /locus_tag="Rfer_0297"
FT   CDS_pept        complement(298346..299269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0297"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68052"
FT                   /db_xref="GOA:Q222K1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K1"
FT                   /protein_id="ABD68052.1"
FT                   /translation="MTISNKTRVPKRKAQAIPTFALYGESVTSAQDMLHIEDVQSRSQL
FT                   YQWEIEPHVHHGLYQVLWLQQGTADVLLDERREAVRGPTAIVVPPGVVHGFRFAPATDG
FT                   LVLTLSAKFLEAGEFQAVGEAFRALFAAPGLLPFEPGQVTAVRLNALFRELLAEFLLPG
FT                   SDGSPVPVWLARSLVWRLAQASARGQQVQGKRAYGHQALFTRFLLLVEQHFLEHWPLER
FT                   YASRLGLSTPRLNRLVREQRGVSALELVHERLTREACRRLIYIAAPAARLAAELGFEDP
FT                   AYFSRFFKRRMGVSPQRYRSEHGGQD"
FT   gene            299379..300557
FT                   /locus_tag="Rfer_0298"
FT   CDS_pept        299379..300557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0298"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68053"
FT                   /db_xref="GOA:Q222K0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q222K0"
FT                   /protein_id="ABD68053.1"
FT                   /translation="MFSFDPYAPAVDANPFPFYKTLRDEHPCFWSPEADMWILSRYADI
FT                   VSAGQDAQTYSSASGNLMTELPGRAGATLGTTDAPRHDRLRGLIQHAFMKRNLESLSEP
FT                   IRDIAREVAESLRGKKQFDFISEFSSKFTVRVLFAALGLPTGAEVTVPESTVRDKAVMM
FT                   VQSDPVTRTKGPEHIAAYNWMQDYAAGVIAERRASPRNDLISHFSMAEIDGDKLDEREV
FT                   LLTTTTLIMAGIESLGGFMAMFALNMADFADARRQCVANPALLADAVEESLRFNTSAQR
FT                   FRRRLMKDVTLHGQTMKAGDFVCLAYGSGNRDERQYPNPDAYDITRKPRGHLGFGGGVH
FT                   ACLGTAIARLAVKIAFDEFHKVVPEYHRVQEQLPWMPSSTFRSPLVLELAVV"
FT   gene            300562..300885
FT                   /locus_tag="Rfer_0299"
FT   CDS_pept        300562..300885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0299"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68054"
FT                   /db_xref="GOA:Q222J9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J9"
FT                   /protein_id="ABD68054.1"
FT                   /translation="MANITYIEASGQATTLKLADGWSLMQGATANGVDGILGECGGSCA
FT                   CATCHCYVDEARLADLPPASDNELAMLDNVAAERRPGSRLACQIKASAALDGLIIHLPD
FT                   MQE"
FT   gene            300889..302124
FT                   /locus_tag="Rfer_0300"
FT   CDS_pept        300889..302124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0300"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68055"
FT                   /db_xref="GOA:Q222J8"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J8"
FT                   /protein_id="ABD68055.1"
FT                   /translation="MTAHIVIIGAGQAGVQTAEALRAGGFAGAITLLGDEPHGPYHRPP
FT                   LSKAWLAGDIGAEQLVMRAPEALARKNIALRTHTQVNAIDRAARQVKLADGSALSYSGL
FT                   VLATGSTPRRLPLPGGDAKGVLALRSRMDASAIAERMAMCIEQQLPVVVIGGGFIGLEV
FT                   AATARKKGLRVTVLEAAPRLLGRVLAPLLSDWYAQLHRSHGVNLVLGAQITALEADRQG
FT                   TVSGVRMADGTLHPAALVVVGIGVSANEQLARDAGLACERGIVVDACGRTSDPVIVAAG
FT                   DCAARRLPDGSLLRLESVQNAIEQGKSVAAALLGQERPFTATPWFWSDQYDKKLQMAGL
FT                   SGGADQWAVRGDMDSGSFSVYHLRAGQLLAVDSVNASRDHLQARKLLDAGVSPTPAQVG
FT                   DAAFDLGTLLLK"
FT   gene            complement(302177..302497)
FT                   /locus_tag="Rfer_0301"
FT   CDS_pept        complement(302177..302497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68056"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J7"
FT                   /protein_id="ABD68056.1"
FT                   /translation="MKPSIKGAAKRLTFSLFVVSALGGCAVYGPVAPGPYTYTTDAYGQ
FT                   PVYATPPVSAYPYYSPYYYDPVYIAPPVSLNFGFGFPLWGGHHSFDRGGRGGPRGSGRG
FT                   HR"
FT   gene            complement(302713..303717)
FT                   /locus_tag="Rfer_0302"
FT   CDS_pept        complement(302713..303717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0302"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68057"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J6"
FT                   /protein_id="ABD68057.1"
FT                   /translation="MHLRKLGPFQVSAIGLGCMNLSHAYGAPVSAEQGERVLLSALDAG
FT                   VTLFDTAALYGFGANEILVGRVLKPHRQKFTLASKCGMQGVDVNGDGKLLRVIDGRPQT
FT                   IRKTCEDSLRRLQTDVIDLYYLHRWDKKVPVEDSVGALSDLVRKGHIRSIGLSEVSAAT
FT                   LRRAHAVHPIAAVQTEYSLWTRNPEIAVLDACKELGVAFVAFSPVARGFLCGQLQDVNT
FT                   LDAKDIRRSMPRFAPDTYAANLKLLPAYQQVAQEVGCSPAQLALAWLLHRGEHIIPIPG
FT                   TTSVAHLAEDLAAVDLRLSPAVMARLDALINQKNVVGSRYNAQGNSEVDTEDF"
FT   sig_peptide     complement(303643..303717)
FT                   /locus_tag="Rfer_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.790 at
FT                   residue 25"
FT   gene            303859..304545
FT                   /locus_tag="Rfer_0303"
FT   CDS_pept        303859..304545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0303"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68058"
FT                   /db_xref="GOA:Q222J5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J5"
FT                   /protein_id="ABD68058.1"
FT                   /translation="MWPAYWYCRHALISLLHAGINCCMMLVMRNSPSNIRTAAKEASHE
FT                   RIVDAAARAIRRSGYDGTGVADIMKEAGLTHGAFYAHFASREAMLAEAADRAGAEANAA
FT                   AASVIAAVPPERALQALMQVYLSKEHLESIETGCPISALGSEMPRQSPEVRRAATRRIK
FT                   EMVDLVARQFPDWGQPGAHERALVTVATMVGTLMLARAVNDSALSDALRSATLKSLSLA
FT                   KPASTD"
FT   gene            304645..305646
FT                   /locus_tag="Rfer_0304"
FT   CDS_pept        304645..305646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0304"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68059"
FT                   /db_xref="GOA:Q222J4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J4"
FT                   /protein_id="ABD68059.1"
FT                   /translation="MKAFTIDRYGKKSALRLADVPTPELRDDEILVQVHAAGVNLVDAK
FT                   VRNGEFKLIVPYRLPLILGHDVAGEVVKVGRRVRQFKPGDAVYARPDDLRIGTFAEFVP
FT                   VKEASLALKPKGLTMEEAASIPLVALTAWQALVEKAKLKKGQKVFIQAGSGGVGTFAIQ
FT                   LAKHLGATVATTTSSGNVALVKSLGADVVIDYKTQDFEDVLRDYDVVLNSQDNKTLVKS
FT                   LSVLKPGGKLISISGPPDPAFGKEIKAPGFVRLVMRLLSAGVRRKAKRLGVDFSFLFMK
FT                   ANGSQLREITRLLDAGVIRPVVDRVFPFAETNAALAYVEAGRAKGKVVVKVK"
FT   gene            305681..306385
FT                   /locus_tag="Rfer_0305"
FT   CDS_pept        305681..306385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0305"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68060"
FT                   /db_xref="GOA:Q222J3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J3"
FT                   /protein_id="ABD68060.1"
FT                   /translation="MKIENAVVLVTGANRGIGLAFARELLARGARKVYATARDPATVTL
FT                   AGVQALQLDVTNAWQVAAAAHQAADVTLVINNAGIAQPGGFLAQDSEAVARRIFETNFF
FT                   GMLNMSKAFAPVLKANGGGALLNVLSVASWVNGGELAAYSASKSAAWSLTNALRHELAG
FT                   QKTQVLGLHMAYVDTDLTRGFEVPKSSAEEIVQRALDGLETGAEEVLADALTQQVRQGL
FT                   TAPRPGYLPQAN"
FT   gene            306423..307499
FT                   /locus_tag="Rfer_0306"
FT   CDS_pept        306423..307499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0306"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68061"
FT                   /db_xref="GOA:Q222J2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J2"
FT                   /protein_id="ABD68061.1"
FT                   /translation="MLFTPLKASSLQLSNRVVMSPLTRSRASQDNIPTALMAEYYGQRA
FT                   TAGLIITEGTSPSPNGLGYPRMPGLFNAVQVAGWKQVTDAVHAKGGKIVIQLMHTGRVT
FT                   HVANLPAGAEVVGPSADPCPGEMITDAQGMQPHSTPWAMTQADITTAVDEYVQSAKLAI
FT                   EAGFDGVELHAANGYLIEQFLNANVNKRTDGYGSSIEGRNRFALEVARATAAAIGADKV
FT                   GIRLSPHGVLGGTGTFPEVDAQYLALTDALSSLELAYIHVLDHSALGTPPVPEATKKAL
FT                   RAAFKGTFILAGGFDRASAEAALAEGRADLIAFGRPFIANPDWVARMRNGAAVSALDMS
FT                   TFYTPGPKGYTDYPSLGA"
FT   gene            307517..308485
FT                   /locus_tag="Rfer_0307"
FT   CDS_pept        307517..308485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0307"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68062"
FT                   /db_xref="GOA:Q222J1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J1"
FT                   /protein_id="ABD68062.1"
FT                   /translation="MQHFLKAALVGLAMAATLLPASVSAADAVSTGMPQALQTSGQTLG
FT                   NSWKSVATQTITAGDISFAYRELGKQNGGTPVVLLAHLAAVLDNWDPRIMDGIAAKHHV
FT                   IAFDNRGIGASSGSPSNAMEQMADDAVTFIKAMGFQQVDLLGFSMGGMVAQEIVLKEPQ
FT                   LVRKMILAGTGPAGGEGISSVSGVTFYDMLRGFFTGQDAKQYLFFTRTPNGIEAGKAFL
FT                   ERLKERSENRDKDISVSAFLAQLQALRAWGQKEPADLSVVKQPVLVVNGDADRMVPTPN
FT                   THDLARRLPNSTLIIYPDAGHGGIFQFHAEFVPSALEFLAR"
FT   sig_peptide     307517..307594
FT                   /locus_tag="Rfer_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 26"
FT   gene            308539..309339
FT                   /locus_tag="Rfer_0308"
FT   CDS_pept        308539..309339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0308"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68063"
FT                   /db_xref="GOA:Q222J0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222J0"
FT                   /protein_id="ABD68063.1"
FT                   /translation="MTNPSSKKVALITGASSGIGAVYADRLAARGYDLILVARRADRLE
FT                   ALCTQISKAHGIKAEPVVADLTKDQDVARIETILATHGDVHVLVNNAGVARLAPAAQTS
FT                   ANDALTQIALNITALTRLTQAVMPAFVARNQGLIINIASALAVHSLPISAIYSGTKAFV
FT                   LQYSRGLQQELAETGVKVQLVLPAATATELWDLSGVPLAALNKETLMTTEHMVDAALAG
FT                   LDQGEMITWPSVADASLWDKYEAARTELFAGTQAGTPAPRYKIG"
FT   sig_peptide     308539..308613
FT                   /locus_tag="Rfer_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            309384..310370
FT                   /locus_tag="Rfer_0309"
FT   CDS_pept        309384..310370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0309"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68064"
FT                   /db_xref="GOA:Q222I9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I9"
FT                   /protein_id="ABD68064.1"
FT                   /translation="MTFQALLASKTGDKITTSVVSLSDADLMPGDVVVDIDYSTVNYKD
FT                   AIAITGRAEVIRQFPLIPGIDFAGTVKTSSYPGIAAGDRVVANGWGLSQTHHGGYAQQA
FT                   RVKGEWLIKLPAALSTKDAMAIGTAGYTAMLSVMALEHGGLTPQHGDILVTGANGGVGS
FT                   VAIALLSGLGYRVVASTGRLEESEYLRSLGAADIIDRRTLSEPGAPIAGEKWAGAVDSV
FT                   GSHTLANVLAQTKYRGVVTACGLAQGMDLPASVLPFILRNVTLAGIDSVNAPQQVRIEA
FT                   WSRLARDLDLAKLARATHVVGLAEVPTVAAQMLEGRVQGRVVVDVNA"
FT   gene            310357..311211
FT                   /locus_tag="Rfer_0310"
FT   CDS_pept        310357..311211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0310"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68065"
FT                   /db_xref="GOA:Q222I8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I8"
FT                   /protein_id="ABD68065.1"
FT                   /translation="MSTHESVEANMSTNTTVKMAKRALVTGASSGIGAAIARELAALGI
FT                   DLVLTARRRAALEAVAASCKGVKVEIVTADLGKPDAAHALWAAATASGPIDILINNAGF
FT                   GYFRRFDEVDWARDAELVQLNMTSLVALARCFVDAHRAGTTPAHMLNIASTGAYQSVPN
FT                   MALYAASKAFVRNFSEALHDEYRGTPLSVTCICPGGTETAFHAASGGGDYSWIANASTK
FT                   SAEFVAHAAVRAMLAGKRTVVPGLFNQLSTFGVRFLSRRVASKVATQVLGKPRLALPVR
FT                   SAT"
FT   gene            311249..312094
FT                   /locus_tag="Rfer_0311"
FT   CDS_pept        311249..312094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0311"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68066"
FT                   /db_xref="GOA:Q222I7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I7"
FT                   /protein_id="ABD68066.1"
FT                   /translation="MSYNHLTATTRFVEVDGDKFAYRRWGNATSDQPPMLLLQHFRGGM
FT                   DHWDPLMTDGLAEGREVILYNGRGIASSGGKPRTRIEDMADDAAAFVRALGLQQIDLLG
FT                   FSLGGFQALDLTWRHPTLVRKLMLLGTGPRGGNPDMEQRVLTTAVNPVPDFEDFLYLFF
FT                   GRSAQAEQAAKAFWERRHQRKDQDPPSSQEAGIAQIEANILYLPRLSEDDPFAYLRGVH
FT                   HPTFILNGVNDVMVPTINSFYMARNMPNAQLFIYPDAGHAAQFQYPQRFLRHAVQFLSE
FT                   "
FT   gene            312148..312546
FT                   /locus_tag="Rfer_0312"
FT   CDS_pept        312148..312546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68067"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I6"
FT                   /protein_id="ABD68067.1"
FT                   /translation="MLKFKFLLWALAQMLQRKIKHSPDCAQYVGAKRLLFQIRTASGAG
FT                   RHYVIENGAIQSFAGLSPNAQFTLSFTNAAKGFSILSAKDAQAAFIRGVGSKDLTISGD
FT                   FREVMWFQGLTAFLQPPKIVSPYDRTAF"
FT   gene            312554..313798
FT                   /locus_tag="Rfer_0313"
FT   CDS_pept        312554..313798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0313"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68068"
FT                   /db_xref="GOA:Q222I5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I5"
FT                   /protein_id="ABD68068.1"
FT                   /translation="MKTDLLNQPLTLRNGTVLRNRLAKAAMSETLATYDNRPTPDFVRL
FT                   YRRWGSSGLGMILTGNVMIDRRALGEPGNVAIEDETDLSVLRQWAQAATEQGTAIWVQL
FT                   NHPGKQSTKGLNAYNLAPSAVPFREDMAAIFETPREATPSEIQDIIERFGRSAAICKKA
FT                   GFSGVQIHGAHGYLVSQFLSPHHNRRNDEWGGTSEKRRRFVLAVYAEIRRQVGPDFPVA
FT                   IKLNSADFQRGGFTEEESLETIRALADAGIDLIEISGGTYEMPAMGGATQEPQKVSTVA
FT                   REAYFIEFAEKVRAAVKVPLMVTGGFRTAAGMNAALRSGALDVVGLARLLAIDPDAPAA
FT                   LLQGRDSPQQVRPIKTGIKAVDRMGMMEVWWYERQLKRIARGQSPRPNESGLSAFLKSA
FT                   ASSGWGTFRTRRMRA"
FT   gene            313865..315076
FT                   /locus_tag="Rfer_0314"
FT   CDS_pept        313865..315076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0314"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68069"
FT                   /db_xref="GOA:Q222I4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I4"
FT                   /protein_id="ABD68069.1"
FT                   /translation="MFHSVRRPDLLIIVLASAGILMVTMGIRQSFGLFVSPVNTSTGLG
FT                   VVTISFALAIGQFTWGAVQPVAGAIADHYGPRPVLIAGLVILALGCLITPFVSSGFGLA
FT                   ASLGLLASVGSGMGSFSVLIGAAARRLPVESRGAASGIINAGGSFGQFVFAPLLQKLIQ
FT                   SIGWMGAIGSMAIVALAAIPLVSRVTGTQPALDAHGVHNGGLKRAILDALKNPSYLLLH
FT                   AGFFTCGFHIAFLVTHLPGEVGLCGLPPNVASWSLALIGIANILGSLIAGSFVAKYRSK
FT                   YILSVMYGSRTLLILGYLMMPKVEWTYYLFAIGLGLTWLATVPPTAAIVGKLFGTRYLA
FT                   TLFGLTLLSHQIGGFLGAWLGGISMSQFGDFTWMWYADMVLAALAALLNLPIREERVKR
FT                   LVTA"
FT   gene            315154..315717
FT                   /locus_tag="Rfer_0315"
FT   CDS_pept        315154..315717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0315"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68070"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I3"
FT                   /protein_id="ABD68070.1"
FT                   /translation="MNVDQVVANWMAEEEETCAHLIAPDIATKEQLAGLSGMEFFERIR
FT                   TGKLPPAPIGETLDFVAIRIEPGSVVFQGRPHRRHYNPLGTVHGGWFATLLDTAVGCAV
FT                   HSTLQAGKGFTTLELKVNMVRALTDRVPLIRAIGKLVHAGRQVATAEGRIVGPDGKLYA
FT                   HATTTCLIFDHPKVKMGSGTAPSR"
FT   gene            316023..316151
FT                   /locus_tag="Rfer_0316"
FT   CDS_pept        316023..316151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68071"
FT                   /db_xref="GOA:Q222I2"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I2"
FT                   /protein_id="ABD68071.1"
FT                   /translation="MKVKHIVILAVQPNKVTVPHPKKDLPQPTQRSILKQAGLADH"
FT   gene            316169..316427
FT                   /pseudo
FT                   /locus_tag="Rfer_0317"
FT   gene            complement(316348..317961)
FT                   /locus_tag="Rfer_0318"
FT   CDS_pept        complement(316348..317961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0318"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68072"
FT                   /db_xref="GOA:Q222I1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I1"
FT                   /protein_id="ABD68072.1"
FT                   /translation="MKFDFDWLVIGSGFGGSVSALRLTEKGYSVGVLERGRRFRDEDLA
FT                   ESAWQLGRFVWAPILGLKGVMRMRVFRHVFFPSQSAVGGGSTVYGGVLYRARDKFFENA
FT                   QWRGLGDWARELRPHYEQAERMLGVSTVPFTSTNQRLALSMARHFGREDDFVLSPTGVY
FT                   FGDPGVTVKDPFFGGQGPDRTGCMRCGSCMVGCRTGAMNTLTKNYLWFAEKLGAQIKAE
FT                   REVVDVRPIGAADGSEGYQVTTQRPGAWFGRGRQVHTARGIVLAGGTLGTNELLANCKL
FT                   SGSLPRISDRLGDLVRTNSESVLNVRLPTDMETWKDVTASSCVRLDDETQIEFLTYGRR
FT                   ADLMGMMYTLLVGRGNRVTRPLKWLGAITHHPVQWLKTLWPFGWSRHMVTLLVMQTLDN
FT                   AIALKPRKRWLGGGWRVVTEQNRERPNPTYIDVANQATQWLARHTGGIAQSNIVEALAN
FT                   IPTTAHVLGGAVIGADASSGVIDQQLRIFGYKNMLVCDGSAMPANPGVNPALTITALAE
FT                   YAMSHVPSATTHRLGTAGQP"
FT   gene            complement(318065..318766)
FT                   /locus_tag="Rfer_0319"
FT   CDS_pept        complement(318065..318766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0319"
FT                   /product="OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68073"
FT                   /db_xref="GOA:Q222I0"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q222I0"
FT                   /protein_id="ABD68073.1"
FT                   /translation="MYTKRLNPICAATLAIAASLPMAAHADDPDNIFRIGYAHVGFDLK
FT                   SSDLTGPPGTTPPGLRINVKDLDILALSYERRLSPNWGVQFQAGIPPTLTTVGAGAAVP
FT                   VGTVAKARIWFPTVLARYTFTGVPTVRPYVGVGVTYTFFTDEEVTTGYTAALQGSSSSM
FT                   KLEDSWSPYVRLGVEYPIDKNWIVNVEYSTFQIKSTATVVTQTPGLGPIPRRVDIKDTP
FT                   QIFGVTIGYRF"
FT   sig_peptide     complement(318686..318766)
FT                   /locus_tag="Rfer_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(318867..319670)
FT                   /locus_tag="Rfer_0320"
FT   CDS_pept        complement(318867..319670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0320"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68074"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H9"
FT                   /protein_id="ABD68074.1"
FT                   /translation="MTGSAHQSRPAIFVTGAATGIGRACAERFARHGWFVGLYDIDADG
FT                   AAEVAATLEHGCVVAGALDVTDPDAWRVALAQFWEKSGQRLDVLFNNAGVLTAGPFETV
FT                   ELARHQGMLNVNVLGMINGCHSAFDYLRRTPGARVINMASATAIYGQPDLVTYSATKFA
FT                   VRGFTEGLELEWHRHGIRVSDVWPSFVRTDMAKKFERIASAKSLGVRLMPDDVAATVWA
FT                   CATSQSLVPKTHWTVGLQARLLAIATSVSPAPISRWVVRQLAHQT"
FT   gene            complement(319673..321184)
FT                   /locus_tag="Rfer_0321"
FT   CDS_pept        complement(319673..321184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0321"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68075"
FT                   /db_xref="GOA:Q222H8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H8"
FT                   /protein_id="ABD68075.1"
FT                   /translation="MPNSIADKETSMSPSKQEMTRFSDLPSSRAAAAPDAPCIADASAA
FT                   LSNSDFHLCVLRAAGVFETHGIKAGDVVALMLPNQAEFVVAMFAAWHLGAAMTPINPAL
FT                   TQKEASHQIVDSRAKLLINSTGEAVVAGVTTLPATAQKDGPRHEGKPVDDPSALALLIY
FT                   TSGTTGLPKGVMLDHANIEAMTEMGREGLQITSADHCLLILPLFHVNGIVVSVLTPLAS
FT                   GAHVTIRRRFDIDTFFADIERLRPTFFSAVPTIYTMLGALPSDVRPDVSSLRYGVCGAA
FT                   PASAELLTGFEARYGFPLVEAYGLSEGTCGSTLNPVDGVRKAGTVGLPLPGQKIAIADG
FT                   KGAHLPPGSTGEVLVAGPNVMRGYLNQPDATAKTIVNGWLHTGDIGRIDDDGYLSIVGR
FT                   LKEMIIRGGENIYPKEIEDVLVEHPSVLEAAVVGAPDERLGEIVVAFVSRRPGATVTVD
FT                   ALNAHCASRLARHKLPAIIHIIESLPKNAVGKIAKPVLREQVRGQ"
FT   gene            complement(321278..321745)
FT                   /locus_tag="Rfer_0322"
FT   CDS_pept        complement(321278..321745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68076"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H7"
FT                   /protein_id="ABD68076.1"
FT                   /translation="MKEPIVMKLNTLALVTLSAACMALPASANEASPTGLWKNIDDATG
FT                   KPRGMIRITESNGTLQGKIEKLFPAPNEDLNPTCKKCEGTLKDAPVIGLTILSGMSKEG
FT                   DQYAGGQILDPDNGKTYRSQLRLIEDGKKLEVRGYIGVPLLGRSQTWVRQE"
FT   sig_peptide     complement(321659..321745)
FT                   /locus_tag="Rfer_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.958 at
FT                   residue 29"
FT   gene            complement(321747..322697)
FT                   /locus_tag="Rfer_0323"
FT   CDS_pept        complement(321747..322697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0323"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68077"
FT                   /db_xref="GOA:Q222H6"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H6"
FT                   /protein_id="ABD68077.1"
FT                   /translation="MNRSSKQHMQVVRHDVRFDSGETYCSAWLFLPVGVERPPVVVLGH
FT                   GLGAIREMRLDAFAERFAAQGIAALAFTYRYFGDSGGQPRQLMSVPRQLEDWEAALNFV
FT                   KSRQDLDDSRLAVWGSSFGGGHSITMASRHPELRAAVAQCPFSDGLASATAQGLIAGMK
FT                   GSMRLLPLAMRDFAARRKGRAPVTVPIAGDPGQLALMSTHDALNGYLKLVPKGSEFVNH
FT                   VAARVIPEIVRYRPGLSAHKIKCPILFCVSETDTVTPPGRTLVLARRAPRGDIKCYNAG
FT                   HFDFYLGAVFEQLVSDQSRFLVEHLVPTTPHPISH"
FT   gene            complement(322694..323668)
FT                   /locus_tag="Rfer_0324"
FT   CDS_pept        complement(322694..323668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0324"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68078"
FT                   /db_xref="GOA:Q222H5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H5"
FT                   /protein_id="ABD68078.1"
FT                   /translation="MSNTPPMPGRINVESLDSVWVAHLDGGAFGLMGLNMAEELAALLD
FT                   RVEANAAVDAVVFTGMHPGRFIGHADVRWLQEGGASIPRLGLGTSSAVARASKAVRGVP
FT                   GLEAIAGLTPLDGGMQLDKLHETFFRMNRSGVIFIAALNGSALGLGSEFAQACDVRLMA
FT                   DGDFFIGQPEVLLGINPGGGGTQRLPRLVGNHRALLLMLEGRPVPPRKALEIGYIDEVV
FT                   PPDELLERAIARARYLGCRPRKARQAIKRAVYIGGSATLEEGLHMERTEFIHISPSETA
FT                   QTLMSEYLRRTDQDGDVPFYNPEILEETLQHGSLPVQGKGSNK"
FT   gene            323822..324535
FT                   /locus_tag="Rfer_0325"
FT   CDS_pept        323822..324535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0325"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68079"
FT                   /db_xref="GOA:Q222H4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H4"
FT                   /protein_id="ABD68079.1"
FT                   /translation="MVNPDPRSRLLKAAIRLLATHGPTEIKARSVSSEAGLSTMGVYTH
FT                   FGGVSELLQAVAEEGFRQQADIFRQVANTQDAMTDLCAIALACRDFAMRNAHLYDLMFG
FT                   LSIQGRYGPVRGESTTAPKVGADAFMASYSHLRGGCERLIKGNCVRQMEPDLMAAQLWS
FT                   TLHGFILLELGGHFAATLNPPIEILVPMCINLVVGLGADRERAKASAAIAVADWASRQC
FT                   DTKSMAQFLNAVNTI"
FT   gene            325664..326134
FT                   /locus_tag="Rfer_0326"
FT   CDS_pept        325664..326134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0326"
FT                   /product="CreA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68080"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H3"
FT                   /protein_id="ABD68080.1"
FT                   /translation="MKLRHTIAFAISIPFASATIAQQIGEVDTAFKLLGPDHKIVVEAF
FT                   DDPKVAGITCYVSRSKAGGLKGALGVATEKSESSIACRQVGLISSTVPIPKSEEVFSES
FT                   RSLLFKKMRVVRMVDPTRQVLLYLTYSDKLVDGSPKNSLTAVPLNGAKLQFK"
FT   sig_peptide     325664..325729
FT                   /locus_tag="Rfer_0326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.959 at
FT                   residue 22"
FT   gene            complement(326141..327445)
FT                   /locus_tag="Rfer_0327"
FT   CDS_pept        complement(326141..327445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0327"
FT                   /product="Lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68081"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H2"
FT                   /protein_id="ABD68081.1"
FT                   /translation="MATTPYFFAPAGHGLVPALLAILALAGCASTPSVEPGAAAPSTTS
FT                   ANPTPAGATPATLDAVENSQKFARWVAEFSATARTAGIDEATLHIAFDNARFLPRVIES
FT                   DRAQPEFTRTPWDYLDTAVSALRVTRGQDKLLQLRQQIDPIAVRYGVPTEVLLAIWGME
FT                   SSYGSFVGDLPTIDALATLGFEGRREAWARNQLLVALKILQSHDIVRVQMVGSWAGAMG
FT                   QTQFLPSVFLAYAVDADGDGRRDIWGSVPDVMASTANFLVGSGWQAGQPWGAEVRLPPG
FT                   FDYARTDADVRQPTAAWVGAGVQAMDGTVLPSFADGSILLPAGARGPAFLVGSNFRTIL
FT                   RYNNSTSYALGVHLLAQRLAGGPAIQAAWPRDLHALTSDQMLALQTALNARGFDSGTPN
FT                   GKMGPATQRGIRRYQRSLDLPTDGYPTLDLLQRLQ"
FT   gene            complement(327448..328236)
FT                   /locus_tag="Rfer_0328"
FT   CDS_pept        complement(327448..328236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68082"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H1"
FT                   /protein_id="ABD68082.1"
FT                   /translation="MHIVVNEDLKAYIDPLTPDEHDALERSLLAEGCRDALVLWGDVLV
FT                   DGHNRYGICQKHGIPFQTLQSTLFTSMEDVHLWMIDQHLGRRSVSDFQRGVLALRKREI
FT                   LNDRRLKAAPPVGPGSTAPAFETTDASTPAAPATTEPLKSREDIAKAARLSSSQVVLIE
FT                   KIQKQAAPEVVAAVKSGAISLNAAAAVATLPEQEQVAAAQGGKELLRQAAKRVRESKKR
FT                   APVDEAQDSAEDSVAALKARVTELEAENAKLRAQLATLMG"
FT   gene            complement(328325..329281)
FT                   /locus_tag="Rfer_0329"
FT   CDS_pept        complement(328325..329281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0329"
FT                   /product="oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68083"
FT                   /db_xref="GOA:Q222H0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222H0"
FT                   /protein_id="ABD68083.1"
FT                   /translation="MSKIIKVALAGAGAFGIKHLDGIQNIDGVEVVSLVSRDLEKTKEV
FT                   AARYGIKHVTTELADSLALPEVDAVILCTPTQMHAAQSIACLKAGKHVQVEIPLADTLH
FT                   GALEVAAMQEQTGLVAMCGHTRRFNPSHQYVHRQIAAGKFNIQQMDVQTYFFRRTNMNA
FT                   LGQARSWTDHLLWHHAAHTVDLFAYQCGSPIVKANAVQGPIHPVLGIAMDMSIQLKAAN
FT                   GAICTLSLSFNNDGPLGTFFRYIGDTATYIARYDDLFTAKEEKIDVSQVDVSMNGIELQ
FT                   DREFFAAIREGRAPNSSVAQLLPCYQVLHDLEQQLLS"
FT   gene            complement(329282..330163)
FT                   /locus_tag="Rfer_0330"
FT   CDS_pept        complement(329282..330163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0330"
FT                   /product="Protocatechuate 4,5-dioxygenase"
FT                   /EC_number="1.13.11.8"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68084"
FT                   /db_xref="GOA:Q222G9"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR034937"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G9"
FT                   /protein_id="ABD68084.1"
FT                   /translation="MAKITASVYTSHVPAIGAAIDLGKTQEPYWQPLFKGYEFSKQWMK
FT                   DNKPDVIFLVYNDHATAFSLDMIPTFAIGTAAQFLPADEGFGPRPVPKVIGHPDLASHI
FT                   AHSVIQQDFDLTIVNKMEVDHGLTVPLSLMCGQPDAWPCPVIPFAVNVVQYPVPSGQRC
FT                   FNLGKAIRKAVESYDQDLKVQIWGTGGMSHQLQGPRAGLINKEFDNAFLDRLIADPQGQ
FT                   ASVPHIDYVREAGSEGVELVMWLIARGAMDDVAGNAANSIATHAGSVRVRHRFYHVPAS
FT                   NTAVGHLILENI"
FT   gene            complement(330166..330609)
FT                   /locus_tag="Rfer_0331"
FT   CDS_pept        complement(330166..330609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0331"
FT                   /product="Protocatechuate 4,5-dioxygenase"
FT                   /EC_number="1.13.11.8"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68085"
FT                   /db_xref="GOA:Q222G8"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR014159"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G8"
FT                   /protein_id="ABD68085.1"
FT                   /translation="MALDKPYKDIPGTIIFDADQSRKGYHLNQFCMSLMKAENRERFKR
FT                   DQRAYLDEWPMSEEQKQAVLDMDLNRAMALGGNIYFLAKIGATHGKSFQQMAGSMTGMS
FT                   EEEYRAMMLAGGRSIEGNRHLGEDGDAQPQHQPQGQAGRKASV"
FT   gene            complement(330617..331558)
FT                   /locus_tag="Rfer_0332"
FT   CDS_pept        complement(330617..331558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0332"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68086"
FT                   /db_xref="GOA:Q222G7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G7"
FT                   /protein_id="ABD68086.1"
FT                   /translation="MSKPTTGDFTQSEAFTKTPGWLDWYSGPAKPRFQLPAGSVDAHCH
FT                   VFGPGAEFPYAPERKYTPCDASKAQLFALRDHLGFEKNVIVQATCHGADNRALVDALRS
FT                   SKGKARGVATVKRSVSDAELQAMHDAGVRGVRFNFVKRLVDFTPKDELMEIAARIKAWG
FT                   WHVVIYFEAVDLPELWDFFTALPTTVVVDHMGRPDVSLPVDGPQFALFQKFMREHGNVW
FT                   SKVSCPERLSLTGPKALNGEQNAYRDVIPFAKAIVEEFSDRVLWGTDWPHPNLKDHMPD
FT                   DGLLVDFIPHIAPTPELQRKLLVDNPNRLYWS"
FT   gene            331910..332434
FT                   /locus_tag="Rfer_0333"
FT   CDS_pept        331910..332434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68087"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G6"
FT                   /protein_id="ABD68087.1"
FT                   /translation="MPHLDSMDLHALVKNVYESAGMKLSDAVVREMESADYGACRFEVD
FT                   AKRVVFRVAKTTPTKVGQFVTLWKRPQPSGVIAPIDANDPVDFVVVYTSNTESCGQFVF
FT                   DKSILIKMGILSSQKHAGKRAIRVYPPWSHPVAKQAVKTQSWQLPYFLELAEDGSTDLA
FT                   RARKLFACDHV"
FT   gene            332553..333386
FT                   /locus_tag="Rfer_0334"
FT   CDS_pept        332553..333386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0334"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68088"
FT                   /db_xref="GOA:Q222G5"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G5"
FT                   /protein_id="ABD68088.1"
FT                   /translation="MEVAPLKLHQFGSTHGKLVIYFHGAPGAPEEGQLFDLEAKKHGLT
FT                   VLCLDRFAIHPSITGEAYYRLLAEEIAKEAGGQAVDFIGFSIGAFIALQTCRYMPNGVT
FT                   SLHLVSAAAPLEAGEFLPAMAGQQVFQLAKAAPVLFLLLSYWQSLLAWLAPKALFRLLF
FT                   ASAEGADKALAADPEFQARITAILRSCFLGRVRGYARDVGAYVQPWSATLADIAVPTHL
FT                   WHGDADNWSPPQMAHYLASAIPGAASAQSFSGLSHYSCLYRAVPEICRVLGRAYT"
FT   gene            333633..335267
FT                   /locus_tag="Rfer_0335"
FT   CDS_pept        333633..335267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68089"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G4"
FT                   /protein_id="ABD68089.1"
FT                   /translation="MSAAWPRIQPRRYPDSTTSGHFNQRRRRTMKAITRSKGVTDTERV
FT                   LARLCDQTFLDLWSYPSLYTSEGRKGDKGVGKELCDMLVVFGSDLLIFSDKDISFNAEI
FT                   DVTIAWPRWRRKSIDESKSQLYGAYKWLKEHPGKLYFDPQCQKPFPFIEPGTDYRIHLI
FT                   AVTKNTQKAAAELFGMNSSGSFILYSVDADEIDDHPFSVLDDRSKPYVHVFDEVTLELV
FT                   LRELDTAPDFIKYLKVKEDAIRRGRIRVITGEEELLAVYMKQGGPMVDKPFAEYEKAAP
FT                   AEFEIIQIPEGEWADYVNSGARARLKQLHKGSYFWDELISRFTKAILTATAPNPLNASV
FT                   NMHETAVRMLASETRFTRGQLAKEYQAKIRGTPSHVRTSKIFRSPITPHACIILVIIPQ
FT                   DVGQTSDEYRARRLDLLYAYGLVAKLKMPDLTIFTMIGTEPGGSELRSEDVLALKIEKL
FT                   GPEEVAQAQTLMKDGKILSHVWHEKPAGNAVISAFKAPKKNTTYRNKMFTPGRNDPCPC
FT                   NSGLKFKKCCFGRNEDIGVLYGLAKPR"
FT   gene            complement(335656..336582)
FT                   /locus_tag="Rfer_0336"
FT   CDS_pept        complement(335656..336582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0336"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68090"
FT                   /db_xref="GOA:Q222G3"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G3"
FT                   /protein_id="ABD68090.1"
FT                   /translation="MNNPIDWKVGLVGYGEVGRILAEDLRAQGVAVSAYDIKLDQPATA
FT                   APLQAHAAQHGVQLATNSAALAAQADFIVSAVTASQTVGVAQACAPAVQPGTFFLDFNS
FT                   ASPGAKQRAASLIDAAGGRYVEGAVMTSVPPYRIKVPLLLGGVFATELAPLINSLGFAA
FT                   KVASDKLGVASATKMCRSVMIKGLEAMVIESFTTARHYGVEDAVVASLYETFPGIDWEK
FT                   QAAYFFQRVIEHGRRRSEEVREVAETVVDAGLTPWSATGTAERQTWVADGADQGWFGEK
FT                   GTPEFARSADWRVEADRMLAHSRLKSD"
FT   gene            complement(336627..337310)
FT                   /locus_tag="Rfer_0337"
FT   CDS_pept        complement(336627..337310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0337"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68091"
FT                   /db_xref="GOA:Q222G2"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G2"
FT                   /protein_id="ABD68091.1"
FT                   /translation="MNQLGIVKRNITRAEPAAVEKLSRFGVATIHEAMGRVGLMKPYMR
FT                   PIYNEARICGTAVTVLLQPGDNWMMHVAAEQLQPGDVAVAACTTDNADGFFGDLLATSF
FT                   QARGAVGLIIDGGVRDVKDLTEMKFPVFSKAIHAKGTIKATLGSVNVPVVCAGAQVNPG
FT                   DVVIADIDGVVVVPAAIAQKVADAAEAREANEGDKRAIFASGVLGLDYYKMREGLAKAG
FT                   LRYID"
FT   gene            complement(337394..338422)
FT                   /locus_tag="Rfer_0338"
FT   CDS_pept        complement(337394..338422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0338"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68092"
FT                   /db_xref="GOA:Q222G1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G1"
FT                   /protein_id="ABD68092.1"
FT                   /translation="MIIDCHGHYTTAPKALETWRNQQIAGIKDPSSMPKIADLKISDDE
FT                   LIETIETNQLRLMKERGSDLTLFSPRASFMAHHIGDFNVSSTWAAICNELCYRVSTLFP
FT                   DHFVPVAMLPQSPGVDPATCIPELEKCVKEYGAVGINLNPDPSGGHWTSPPLSDKHWYP
FT                   IYEKMVEYDLPAMIHVSTSCNACFHTTGAHYLNADTTAFMQCLTSDLFKEFPTLKFLIP
FT                   HGGGAVPYHWGRFRGLAQELKKPLLQDHLLNNIFFDTCVYHQPGIDLLNTVIPVKNVLF
FT                   ASEMIGAVRGIDPETGNYYDDTKRYIEASKILSDADRQQIFEANARRVFPRLDALLTAK
FT                   SQ"
FT   gene            complement(338499..339704)
FT                   /locus_tag="Rfer_0339"
FT   CDS_pept        complement(338499..339704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0339"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68093"
FT                   /db_xref="GOA:Q222G0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q222G0"
FT                   /protein_id="ABD68093.1"
FT                   /translation="MSLSIRTQVAIIGAGPSGLLLGQLLHKAGIDAVIVERVSGDYVLG
FT                   RIRAGVLEQVTIDLLDEAGVGTRMHREGLVHGGFDMLYGGKRHRIDMNGLTGGKNVMVY
FT                   GQTEVTHDLMDARAFAGLPTYYEASDVQVADFDTTHPRVTFTHQGQAVTLSCDFIAGCD
FT                   GFHGVCRASVPRKSIQEFEKVYPFGWLGLLSDTPPVHDELIYVNSPRGFALCSQRSKTR
FT                   SRYYLQVPLTDRLQDWTDDAFWQELRLRLDDDARAQLVTGPSLEKSIAPLRSFVTEPMR
FT                   FGRLFLAGDAAHIVPPTGAKGLNLAATDVKYLCNALVDFYQNRSEEGIDSYSARCLRRI
FT                   WKAERFSWWFTSLMHRFPDDGPITARFQEAELDYLIHSHAGSLSIAENYVGLPLDFAEP
FT                   TR"
FT   gene            complement(339778..340488)
FT                   /locus_tag="Rfer_0340"
FT   CDS_pept        complement(339778..340488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0340"
FT                   /product="putative ABC transporter, periplasmic molybdate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68094"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F9"
FT                   /protein_id="ABD68094.1"
FT                   /translation="MQVTATPSVAPLTGISSMATRQLLAELTTAYAERSGQTVLVESVG
FT                   GVDAAKRVQAGEVFDLVVLASDAMAKLMAAGHLRADSLTPLVHSGVAVAVRAGTPAPDI
FT                   SSEDALRQAVLAAPTLSYSTGPSGVALARLFERWGIAERIKDRIVTAPPGVPVGSLVAK
FT                   GEVALGFQQLSELIHVQGISIVGPLPSTIQITTTFSAAMTSGCTRPAEVQALLDFMASP
FT                   EAAEAKQRQGMEPA"
FT   sig_peptide     complement(340411..340488)
FT                   /locus_tag="Rfer_0340"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.759) with cleavage site probability 0.710 at
FT                   residue 26"
FT   gene            340563..341504
FT                   /locus_tag="Rfer_0341"
FT   CDS_pept        340563..341504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0341"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68095"
FT                   /db_xref="GOA:Q222F8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F8"
FT                   /protein_id="ABD68095.1"
FT                   /translation="MDASLFPIIAMDLKQLEYFVRVAELGSFTRAAIALDVAQPALSRQ
FT                   VRLLEVELRQNLLTRNGRGALPTEAGKLLLAHGRGILHQVERAREELGRVRGSLAGRVA
FT                   VGLPTSLARVLTVPLIRAFRIELPDATLAISEGLSVPMQESLIAGRLDIAVLYNAQPTA
FT                   EIEITPLLEEDLLLVQRRPPGLPEDPPPGPITLRELGQLPLVIPTRPNAIRMHVESELA
FT                   NIGCRLNIALEIDGVSAILDLVADGAGYAVLSRNAVSSSIRPSAFSVRTITAPVLRTKV
FT                   SMATSSLRPTTLTQQTTLKLLHKTICKIVGPI"
FT   gene            341657..342703
FT                   /locus_tag="Rfer_0342"
FT   CDS_pept        341657..342703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0342"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68096"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F7"
FT                   /protein_id="ABD68096.1"
FT                   /translation="MTYHANPTRYDAMPYRSCGRSGLKLPAVSLGLWHNFGDATPMATQ
FT                   RAMLRTAFDLGITHFDLANNYGPPYGSAETNFGEHLRRDFKPYRDELIISSKAGWDMWP
FT                   GPYGQGGGSRKYLLASLDQSLKRMGLDYVDIFYSHRFDPDTPLEETCGALASAVQQGKA
FT                   LYVGISSYSAAKTREAAAILKNMGVAPLIHQPSYSLLNRWVEEDLLDALDDTGMGCIAF
FT                   SALAQGLLTDKYLNGVPADSRINRPGGGSLKAEHLSEQNLTHVRALNQIALERGQSLAQ
FT                   MATAWVLRDKRVTSALIGASRPAQIIELVEALQNMQFSAAELAAIDQHAVEGGINLWQR
FT                   PATDQRPT"
FT   gene            342770..343639
FT                   /locus_tag="Rfer_0343"
FT   CDS_pept        342770..343639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0343"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68097"
FT                   /db_xref="GOA:Q222F6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F6"
FT                   /protein_id="ABD68097.1"
FT                   /translation="MKANFYALAAICLWASLAALGVLLKHVPPFLLTGIALGLGSILAW
FT                   PFVFKNPRQWRVAPSTLFLGVSSLFGYHFFLFIALRMAPAVEVNLINYLWPLLIVVLAP
FT                   LYVPGIRLRAVHFMAAALGFAGAALAIWGGRVSTDASANLTSSATGWGYLLALAAAIVW
FT                   ANYSLQTKRVALSGKGFSTTAIGLFGLLAGLLSLACHWVLEPPVQLTGHDWLLLLAMGL
FT                   GPLGAAFFLWDKALKLGDVRHVGILSYLTPLASTVLLMQVTGRALSWSVALAAALIIGA
FT                   ALLGTRKN"
FT   sig_peptide     342770..342835
FT                   /locus_tag="Rfer_0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.790 at
FT                   residue 22"
FT   gene            343667..344866
FT                   /locus_tag="Rfer_0344"
FT   CDS_pept        343667..344866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0344"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68098"
FT                   /db_xref="GOA:Q222F5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F5"
FT                   /protein_id="ABD68098.1"
FT                   /translation="MIQLNDIQTAATRLQGQLLRTPCVASRTLSDITGAQVFLKFENLQ
FT                   FTASFKERGACNKLAQLSAEERQRGVIAMSAGNHAQGVAYHAQRLGLRAVIVMPRFTPG
FT                   VKVERTRGFGAEIVLHGDTLDEARAHALALAEQQQLIFVHPYDDADIVAGQGTVALEML
FT                   QDVPDLDALVVSVGGGGLIAGMATAAKAIKPDIEIIGVQTVRFPAMFNAIKGTHHPQGS
FT                   SSIAEGIAVGTPGQIPLAIIARLVNDLVLVDEGDIEQAIVMLLEVEKTLVEGAGAAGLA
FT                   ALLKYPERFKGKKVGLVLSGGNIDPLLLAAIIERGMVRAGRLARIRVSARDIPGTLAKI
FT                   TTTVAEAGANINEVHHQRAFTTLAAQNVEVELVIQTRGPQHIAEVLAQLHQAGLEAQLI
FT                   "
FT   gene            344882..345097
FT                   /locus_tag="Rfer_0345"
FT   CDS_pept        344882..345097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68099"
FT                   /db_xref="GOA:Q222F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F4"
FT                   /protein_id="ABD68099.1"
FT                   /translation="MDNRRDLVGVGKIQRIAQPNTRGITMSSPASHEQAPETDAVEGVL
FT                   PYMPIVLPLAGAVLIFLLAFIAVSMA"
FT   gene            345267..346187
FT                   /locus_tag="Rfer_0346"
FT   CDS_pept        345267..346187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0346"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68100"
FT                   /db_xref="GOA:Q222F3"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F3"
FT                   /protein_id="ABD68100.1"
FT                   /translation="MGLGQFSYANNSNRFLAVPELAAQPFAVVGVPFDGAVTHRPGARF
FT                   GPQEIRRASLMLCDGSHPFFGVSPIGHLGDALDMRLPNASPLADVRQQIQAQAAALMAG
FT                   HHCVFLGGDHSVTLPLLRAARAQHGELALVHFDAHCDTWTDHFGEPSGHGTWAYEAMAE
FT                   GLVSPRHTVQIGLRSSGERAAREYVQDQGGLIFTARQLRGLDGAGLQPVIAQIRTRLGQ
FT                   RPCYLTLDIDCLDPAFAPGTGTPEPGGLSSSQVLTLLEELAPLNMIGMDCVEVAPAYDH
FT                   AELTSSAAATLVWTYLCGQVAKVLL"
FT   gene            346200..347501
FT                   /locus_tag="Rfer_0347"
FT   CDS_pept        346200..347501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0347"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68101"
FT                   /db_xref="GOA:Q222F2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F2"
FT                   /protein_id="ABD68101.1"
FT                   /translation="MLLASDTQLNQKSYYEASVQRAPVGPPLRGELNADVLVVGAGFAG
FT                   LSAAIELAQRGYQVVVLEADRVCSGASGRNGGQAIVGFSGGQAPFDQQLGQAHARLAWD
FT                   MTVEGLAMIDERVKAFQIDCDHVKGYLYLADSRRKARALEAELTTLERDYGFVTELVKG
FT                   ADVQRHIQSPRYCAAAFERQSGHLHPLKYGLGLARAAKALGVQIFEHSAVLAIKRGSRL
FT                   MARTGAGVVTAKFGVLAGNCTLAEYGPAVAPDITPRIMPVGTYIIGTAPLAPGLCRRLI
FT                   PSNASACDNNFILDYFRFSADHRMLFGGRVSYTTRTPAHLQDTLARRMGEVFPALRQVP
FT                   IDFVWGGFVDISMNRAPDFGRLGDNLYYLQGFSGHGVALTGLAGRVVAQAVAGQAERFD
FT                   VFAKLQHRKFPGGPLLRRPSLVLGMLYHRLRDAL"
FT   gene            complement(347496..348983)
FT                   /locus_tag="Rfer_0348"
FT   CDS_pept        complement(347496..348983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0348"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68102"
FT                   /db_xref="GOA:Q222F1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F1"
FT                   /protein_id="ABD68102.1"
FT                   /translation="MLSEYLLTEIARLGLQTKLPLHRQLYEALRRAMLDGKLCAGQRLP
FT                   SSRELTQDLGLSRNTVVAALNQLAVEGYLVSHIGSGTFVNDSVPKVAPRHRTAHEKQGA
FT                   TLSRRGRALATTFCATQLEIQPFTPGIADFSAFPVALWQRLQNKHWRMTYPDMLDYNFS
FT                   GGYWPLRRAVADYLRVFRSVPLDVDQVIITSGTQQSMELCAQLLADHSDTVWLEDPAYW
FT                   GAIKAFMATGLNLHSVPVDQEGIAPQAEDEAVPPRLIYVTPSHQYPTGAVMSLARRHQI
FT                   LSIARRHKAWVLEDDYDSEFRFSGPPISSLAGLDTDQRVLYLGSFSKVLYPGLKLGYLV
FT                   VPKTLVPPFKQAHYDLNRPGQMPLQAALAEFIEMGYFASALRRARQGYAERRQCLLAAL
FT                   QPCLGPYAHISGAEQGLHLCVRLPPTLDDKALAQRLGELGLTVRALSAYCLRRTDAKGL
FT                   VIGYGYATLTDIAHYGPLVAKAIAGALACLTPKLESL"
FT   gene            349070..349891
FT                   /locus_tag="Rfer_0349"
FT   CDS_pept        349070..349891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0349"
FT                   /product="peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68103"
FT                   /db_xref="GOA:Q222F0"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q222F0"
FT                   /protein_id="ABD68103.1"
FT                   /translation="MTKPPSGVRRPTTQSAKRKPVVLMSMGAQERHGHPYQVMTVKYIR
FT                   PLIEHAGCVPVLAPTCFGTQDIEQYLSMVDGVYLTGAGTNIDPALYGQPNLTPEKAQDK
FT                   DRDLFDLPTIRMALAMGLPLLGVCRGMQEMNVAFGGDIHQQLYTIPKLKDHREDPAAPV
FT                   SEQYAASHKVRLVPGTWFAGLMQQDEIAVNSLHGQCIKTLGHGLQALAHAEDGVIEAIH
FT                   LPEFAQFTLGVQWHPEWMAAQNPHSIRLFEAFGAACRARQCARWSGSEHVL"
FT   gene            349914..351281
FT                   /locus_tag="Rfer_0350"
FT   CDS_pept        349914..351281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0350"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68104"
FT                   /db_xref="GOA:Q222E9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E9"
FT                   /protein_id="ABD68104.1"
FT                   /translation="MNDKKTMNFNDLEQWLNERRVTEVECLVPDLTGVARGKILPRAKF
FT                   TEDRGMRLPQAIVAMGVTGEFPESGPYYDVIDPTDKDMQLRPDPTTVRIVPWATDPTAQ
FT                   VIHDCFDHQGNLVPYAPRTVLRRVCDLFAAQGLQPIVAPELEFYLTARNTDPNTLLRAP
FT                   VGRSGRSETSRQAYSIDAVNEFDPLFEEIYDFCDKMELNVDTLIHEVGAGQMEINFFHA
FT                   EPLGLADEVFFFKRTVRESALRHDMYATFMAKPIAGEPGSAMHVHQSLLDVATGKNVFS
FT                   NEDGTPSETFMHYIGGLQRYIPAAMVLVAPYVNSYRRLSRNSAAPINIEWGYDNRTVGI
FT                   RSPISSPQARRVENRVIGADANPYVAMAMTLACGYLGIKNKIKPKPEMKGDAYLAPYSL
FT                   PRSLGEALDWLRRESDLHEVLGKEFITVYSEIKELEFDEFMKVISPWEREHLLLHV"
FT   gene            351343..352779
FT                   /locus_tag="Rfer_0351"
FT   CDS_pept        351343..352779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0351"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68105"
FT                   /db_xref="GOA:Q222E8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E8"
FT                   /protein_id="ABD68105.1"
FT                   /translation="MNPSTLIPPPAWVRRTEQYDTQALQALDSAHFIHPFTDHGDLATR
FT                   GARVITRAEGVYIWDSEGEKLLDAMSGLWCVNVGYGRKELADAAYQQMMTLPFYNSFFQ
FT                   TTNVPAVKLAARLASLAPEVDGRSFQHVFYSSSGSESNDSNVRMVRRYWDLLGQPQRKV
FT                   IISRLNAYHGSTMAGASLGGMSGMHAQGDLPIPKITHIGQPYFFENGLPGESEAEFGLR
FT                   AAGWLEAKIVEVGADKVAAFIAEPIQGAGGVIIPPATYWPEIQRIVDKYNILLVSDEVI
FT                   CAFGRLGHWFAYEKFGYKPDLVTFAKAVTSGYIPLGGVMVGDRVAKVLIEKGGEFNHGY
FT                   TYSGHPVACAVGLANLAIMEREQLPQRVRDDIGPYLARGFEKIAEHALVGVAETCGFTA
FT                   GLVLVKNKKRRERFAEALGVGMMCRGHCFQNGLIMRAVGDRMIIAPPLTMTHDDIDEML
FT                   RLIRQALDLTQQELHQKGLI"
FT   gene            352870..354039
FT                   /locus_tag="Rfer_0352"
FT   CDS_pept        352870..354039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0352"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68106"
FT                   /db_xref="GOA:Q222E7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E7"
FT                   /protein_id="ABD68106.1"
FT                   /translation="MMKKYLWSFALSALVLAACGKKEEPPAPVAVPATVVSAPAPVAQN
FT                   SEEKVLNIYNWPDYIPEGMMAAFEKESGIKVNYDTFETNEALHAKLVAGNTGYDIVVPG
FT                   SVFAKPQIEGGMFQPLDKAKIKNLGNLDSNIMATLAKNTDPGNKYLVPWAWGFTTVGIN
FT                   KTKVAKALGKTPMPENAWDLVFKPEYTSKLKSCGIAYLDSPTEIIPAALHYIGKDAYSN
FT                   DPADYKLANEMLAKVRKDVRIFSSTMIDDIAGGKACVAIGWSGDINIAANRAKENKSKD
FT                   VIESLLPSTGALIFFDTMAITKDAKHPNNALAFIDFYLRPENAARMANEMNYPTANKAA
FT                   MDKIKPEIAGNKTIFVESDYFAKMIAPSSFTNEAREAMATVYNSFKKGK"
FT   sig_peptide     352870..352932
FT                   /locus_tag="Rfer_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.448 at
FT                   residue 21"
FT   gene            354137..355237
FT                   /locus_tag="Rfer_0353"
FT   CDS_pept        354137..355237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0353"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68107"
FT                   /db_xref="GOA:Q222E6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E6"
FT                   /protein_id="ABD68107.1"
FT                   /translation="MADAGSRDNYLVTEKLVKRFDEAVAVDEVDLSIKQGEIFALLGSS
FT                   GCGKSTLLRMLAGFETPTSGRILLSGQDVARLAPYERPFNMMFQSYALFPHLDIWENIA
FT                   FGLKREGLPKSDIQQRVGEMLDLVQLTPYAKRKPHQLSGGQQQRVALARSLAKKPKVLL
FT                   LDEPLGALDKKLREQTQFELVNIIEKVGVTCVMVTHDQEEAMTMAGRIAVMSKGRVLQV
FT                   GSPEEVYEHPSSRFVADFIGNVNLFDGRLSIDQPDHCAVATSMGEIHVSHGVSGALNMP
FT                   SAIAVRPEKIEINRERPAADHNVFAGKVKEIAYFGSYNTFIVQTEDGKRVKITEANTSR
FT                   HELSHITWEDDVFFWWSDGAGVVLRD"
FT   gene            355250..356167
FT                   /locus_tag="Rfer_0354"
FT   CDS_pept        355250..356167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0354"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68108"
FT                   /db_xref="GOA:Q222E5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E5"
FT                   /protein_id="ABD68108.1"
FT                   /translation="MAKLNLTLPGRRFVIGVPAVWLVLFFMLPFLILLYISFVDMGNDI
FT                   SPFKPIWDSETGLLKLKYENYYSIFQSSDGSGLFQTIYIEAYVRSIWYALCTAVLCLVI
FT                   GYPFSYFIARSAPNLRPALLMMVMLPFWTSFLLRVYAWKGILADQGVLNQMLLALGLIT
FT                   EPMQMLYTDVSMLVGMTYVYLPFMVLPLYANLVKMDIRLLEAAYDLGASPFKAFWLVTV
FT                   PLSKAGIIAGFMLVFIPCVGEFVIPSLLGGPENIMIGRVVWDEMFTSNNWPRASALAVV
FT                   MIGLIVVPLAVYYHFTGDAAEVRR"
FT   gene            356177..357037
FT                   /locus_tag="Rfer_0355"
FT   CDS_pept        356177..357037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0355"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68109"
FT                   /db_xref="GOA:Q222E4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E4"
FT                   /protein_id="ABD68109.1"
FT                   /translation="MKKLLNRYFGKAWLAVTFLFLYLPLFFMLVFSFNNTRQDAVFTGF
FT                   SLRWYEALTRDTKIVDGFWLSVQVATAAGVASAVLATFAAFVLVRYRRFAGRTLFSGMV
FT                   NAPLVMPEVVIGLSLLLLMVGVQNALGWPQRGMLTIVLGHMLLGMAYGTVVVQSRLLEM
FT                   DRAIEEAAMDLGAKPFQVFFLVTLPNILQAVLAAYLLAFTLSFDDVVIAEFLSGPGVNT
FT                   LPQVIFGYARRGINPTIYAAATLLIASVTLVVITYSVWVARQTRKREREIAAATRAELL
FT                   ALQAQ"
FT   sig_peptide     356177..356275
FT                   /locus_tag="Rfer_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.860 at
FT                   residue 33"
FT   gene            357099..358568
FT                   /locus_tag="Rfer_0356"
FT   CDS_pept        357099..358568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0356"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68110"
FT                   /db_xref="GOA:Q222E3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E3"
FT                   /protein_id="ABD68110.1"
FT                   /translation="MANHQFDGRALINGQRVDARDGATFDCISPVDGRLLTVVACCGQA
FT                   DVDAAVAAARAAFEDRRWRGMAPAARKRVMIKFADQLLAHADELALMETLDMGKPIQYA
FT                   RAVDVNSAANCIRWYGEAVDKIYDEIAPTASTGLALIQREPVGVVGVIVPWNYPMIMAA
FT                   WKIAPALAAGNSVVLKPSEKSPLTALRLGDLALQAGIPPGVFNVVTGYGAQAGSPLALH
FT                   TDVDCIAFTGSTRVGKQIHIMAAQSNLKRAWTELGGKSPNIVFADCPNLDKAVEAAVGS
FT                   IFFNQGESCNAPSRLFVEAGIKEQFLEKALALVPGFAPGNPLDPATVMGAIVDKTQMDS
FT                   VLRYIEVGQREGAKLLAGGAQALQETGGCYVQPTIFDGVKNDMTIAREEIFGPVLSVLS
FT                   FTDAADVVRQANQSVYGLQAAVWTRDINKAHGVARALRAGTVHVNQYDEDDITVPFGGF
FT                   KQSGVGRDKSLHAFDKYTETKTTWIRIDSPV"
FT   gene            358911..359345
FT                   /locus_tag="Rfer_0357"
FT   CDS_pept        358911..359345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68111"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E2"
FT                   /protein_id="ABD68111.1"
FT                   /translation="MKWITRSHVHVDRVACPWLISRFIDSTAEFLFVPKNQIDKVAQET
FT                   GAIPFDAPGVELGHHEGRCSFESIILKYDLKEPGLLRLAKIVHAADVGADIDQDPLARG
FT                   LEAIASGYSLRFPDDLENLRHQFEVYDALYAWCRLDVAGA"
FT   gene            359352..360584
FT                   /locus_tag="Rfer_0358"
FT   CDS_pept        359352..360584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0358"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68112"
FT                   /db_xref="GOA:Q222E1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E1"
FT                   /protein_id="ABD68112.1"
FT                   /translation="MDLKILFTTRVVRLFCYGFLSLLLALYLAQVGLTDPQIGLLFSLT
FT                   LAGDAAVSLWLTTSADRFGRRRTLQIGALLMLGAGLVFILTDNIVLLMAAAIVGVISPS
FT                   GNEIGPFLPVEQAGLSQIVPSQKRTQVFAWYNLAGSFATAMGALCGGWVVQILQGRGWL
FT                   ALDAYRVVLGAYAAGGLVLTLLFLTLSPAVEVQERAPVGTRLVLGLHRSRAVVLRLSAL
FT                   FALDAFAGGLILQSMIAYWFHIKFGVDTGLLGSLFFGANVLAGISALLAVPLAKRFGLI
FT                   NTMVFTHVPSNLLLILVPLMPNLPLAIGLLLARFSISQMDVPTRQSYTMAVVSADERSA
FT                   AAGVTGIARSVGASLAPVLTGIFLTNPALFSLPFFLCGGLKLVYDLALYRSFKAVKPPE
FT                   ETLSQSGAKFP"
FT   gene            complement(360780..361451)
FT                   /locus_tag="Rfer_0359"
FT   CDS_pept        complement(360780..361451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0359"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68113"
FT                   /db_xref="GOA:Q222E0"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR033580"
FT                   /db_xref="UniProtKB/TrEMBL:Q222E0"
FT                   /protein_id="ABD68113.1"
FT                   /translation="MTLLFENYGAALVAFVLFAVFHSVGAHEPLKHALARWTSPFWVDH
FT                   FWRVAYCSLSFGALYGGVSALLWGRNGGNNVWLVDYPDWLWQALTILHLGSIGLLYAAF
FT                   LQSDYLEFLGLKQAWRGLRVLAGRAVEPTPVALFGSQRLVTTGVYAWVRHPMLAGGLLF
FT                   LLTSGPSANNLVYTLMYTGYMLLGGYYEERRMVKIFGDDYLSYRIRVGAFCPRFWRRQV
FT                   T"
FT   sig_peptide     complement(361371..361451)
FT                   /locus_tag="Rfer_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.992 at
FT                   residue 27"
FT   gene            complement(361474..361956)
FT                   /locus_tag="Rfer_0360"
FT   CDS_pept        complement(361474..361956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0360"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68114"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D9"
FT                   /protein_id="ABD68114.1"
FT                   /translation="MKNESLWTVVLATVLAPAVMAAGSPSTSSRPAPTRQAAQPSDFEL
FT                   GVKAVQARDFERALPLFEKVTRAEPRNADAWNYLGFSQRQLRHFDQSLAAYQKALALNP
FT                   NHRGAIEYLGELYLDLGEPDKAREQLAKLQSLCPKGCSEFDDLSKAVGAFQAKPKS"
FT   sig_peptide     complement(361891..361956)
FT                   /locus_tag="Rfer_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.977 at
FT                   residue 22"
FT   gene            complement(362149..363120)
FT                   /locus_tag="Rfer_0361"
FT   CDS_pept        complement(362149..363120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0361"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68115"
FT                   /db_xref="GOA:Q222D8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D8"
FT                   /protein_id="ABD68115.1"
FT                   /translation="MTSDRTLRQSGKPWRTLPAAWLGLMLLLGGCGSAPPLAAPTPMPV
FT                   ATPAAKAKPVIGLVLGGGAAKGFAHIGVIKALEAQGIKPDLVIGTSAGSLIGALYAAGK
FT                   SGFELQALAIPLNEFQVSDWVLPDRGMIKGEALARFVNTAVGNRPLEKLPRKFGVVATD
FT                   LASGEPVVFRVGDTGTAVRASSSVPGVFQPVSIRGHEYVDGGLSSPVPVRFAREMGATF
FT                   VIAVDISDKPLNSKLNSTFDILMQSVTIMGQTIARYELPLADVVIRPNIAQLEVLDFTT
FT                   RHIAVLEGEKAAARVMPALKEKLARFGEPQVTQTSGTAVARP"
FT   sig_peptide     complement(363004..363120)
FT                   /locus_tag="Rfer_0361"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 39"
FT   gene            complement(363177..364391)
FT                   /locus_tag="Rfer_0362"
FT   CDS_pept        complement(363177..364391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0362"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68116"
FT                   /db_xref="GOA:Q222D7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D7"
FT                   /protein_id="ABD68116.1"
FT                   /translation="MASGKILVAQGGGPTAVINQSLVGVALEARRFSQVAHIYGARHGV
FT                   RGIVDEEFVDLTQETSHNLELVANTPSSALGSTRDKPDIAYCQEIFRVLQAHQIEHFFY
FT                   IGGNDSSDTVRIVSQEAQKAGYPLRSIHIPKTIDNDLVGNDHTPGFPSAARFVAQAFAG
FT                   ANLDNAALPGVYVGVVMGRHAGFLTAASALGKKFPDDGPHLIYLPERTFVLEQFLLDVK
FT                   TTYERYGRCVIAVSEGIHDAQGTPIAALLAKEMEHDAHGNVQLSGNGALADLLCDEIKA
FT                   RLKIKRVRGDTFGYLQRSFIGCVSDVDQREAREVGEKAVQFAMWGGHDGSVAIKRTGFY
FT                   SVDYELLPLDAVAGKTRVMEDEFIAASGTDVTDAFRMYLRPLLGSGMPDAFRLRHNPVA
FT                   KVLHR"
FT   gene            364629..365120
FT                   /locus_tag="Rfer_0363"
FT   CDS_pept        364629..365120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0363"
FT                   /product="Hemerythrin HHE cation binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68117"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D6"
FT                   /protein_id="ABD68117.1"
FT                   /translation="MSAFPEPFSFVTLDACHQQMQMHLAELAALVRQMETSGVDAKAQH
FT                   QAGAIEAFFSSTARQHHAEEEKNVFPPLLLSGNADLVAAVHALHQDHGWIEENWIELGP
FT                   QLRAIALGNNWFDADEFKHGAEVFVALCQEHIALEEALVYPEAKARLAQAMASRSKRAP
FT                   "
FT   gene            complement(365140..366093)
FT                   /locus_tag="Rfer_0364"
FT   CDS_pept        complement(365140..366093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0364"
FT                   /product="response regulator receiver modulated CheW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68118"
FT                   /db_xref="GOA:Q222D5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D5"
FT                   /protein_id="ABD68118.1"
FT                   /translation="MNQAMRDIDERTNLTGNSMFELLLFRLGQAPGSQRRELFGINVFK
FT                   VREIMVMPEITVMVNAPPAVMGVANIRGQMIPVINLPAVTGCNPTQGLGILLVTEFART
FT                   TQAFAVEEVNEIVRLEWKHVLSAEGNGGGLVTSIARLDGNAENTRLAQVLDVEQILRDV
FT                   FPPPPQALNDDAMLPKLQLPPGTVILAADDSAVARMMIEQGLTAMEVPYIMAKTGQEAW
FT                   DRLQALSVQAATEGKTAQDKVALVLTDLEMPEMDGFTLTRNIKQDVRFRSIPVVIHSSL
FT                   TGSANEGHVKSVGADAYVAKFVAEELAATIRQVLTR"
FT   gene            complement(366160..367530)
FT                   /locus_tag="Rfer_0365"
FT   CDS_pept        complement(366160..367530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0365"
FT                   /product="MltA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68119"
FT                   /db_xref="GOA:Q222D4"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D4"
FT                   /protein_id="ABD68119.1"
FT                   /translation="MSRRADDHGLMVSFVSRRRQVFSTDDVDFGAAASSGVVGAAGNSP
FT                   RRRPENMVHQTISSSSSKAPSASSKSKLMNRLRSTVLNTWIVGMLVACSSVPIPPQQPA
FT                   APTEMAAPPVGARPDDAGPLPEPIVRAKSRWTAVRWAELPGFEDDTLFEAWNAWIKSCE
FT                   RPGPVFAPLCSEVRRLSIGDEPQRRAWLQARLQPYRIDTLAGDAEGLLTAYFEPVLDAT
FT                   RSASADFSVPLYQPPPGLAQNLPWYTREQIDTSARAQAALKGREIVFLSDPIDALVLQI
FT                   QGSGRVRIRQPDGSQTLARLAYAGSNGQPYKSVGRWLLDQGAVRDASWPAIKAWLAQNP
FT                   GRVNELLWSNPRTVFFREEAMSELDAAWGPKGAQGVPLTPGRSIAVDPGSIPYGTPVWL
FT                   ASHGPGLNLQKLVLAQDTGSAIVGGVRADYFAGWGPVAAELAGRLKQPLRLWVLWPK"
FT   gene            complement(367514..371659)
FT                   /locus_tag="Rfer_0366"
FT   CDS_pept        complement(367514..371659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68120"
FT                   /db_xref="GOA:Q222D3"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D3"
FT                   /protein_id="ABD68120.1"
FT                   /translation="MIDLTPVPSSLLKTWTIVARWSLGLVLAAWFVFGLTWGALHWLIV
FT                   PRIGEFRPQLEAYAARALGVPVRIGAITAQSSGMIPSFELTDVELFDEQGREALRLPRV
FT                   LAALSPRSVWRLGFEQLYVERPQLSIRRALDGKIRVAGLDFSQTSDTGSSAVDWFFSQL
FT                   EFVIRDGSILWTDELRAAPTLALQQVDLVVRNAGRRHNLRFDATPPPLWGERFSVRGLM
FT                   TQPLLSRHRGHWRDWQGQLYAAFARVDLSELQRYADVGVDLRQGKGALRAWVDVSRGQV
FT                   TGGTADVALSEVNVTLGAQLQALELLSVSGRLSGRLPANGFQLSTQALAFDTRDGLRWP
FT                   GGNVSVDYTAAEGRVAARGELKADKLDLQALSQIADRLPIDPVTRAALLTYAPKGLVER
FT                   IQASWQGPMGAFSQYAAKGLVNQLELAANTLNMAPGQGLPPQDSPGVRGASIDFDFNQS
FT                   SGKASISLSNGAVVVPGIFDEPVIPVTQLSTEAKWQVKGDHIAVQLPNLKFSNADAQGE
FT                   AQIKWETSDPAKSSGHSRFPGVLDLQATLSRADGTRVHRYLPSLIGRPVRDYVRDAVTA
FT                   GTASGVKARVKGDLNNMPFRDPKQGEFRVSADVKNATLVYVPRSIQAAQALPWPALTQL
FT                   SGELVFDRAQLQVRGAHARMGAASNLQVSKVDALIAELSNATVTVTAEVQGALAEALGI
FT                   VKGSPLGSMIGNALDRAVASGSADYKLKLSLPIAALEKSTVLGSVTLRNNDFQITPETP
FT                   KLTGARGVVNFSDSGFSIVGGQARLLGGEARLEGGSVAPAGATASRAATSVLIRASGTV
FT                   SAEGLRQAQELGFAARMAQHASGSTAYTAVLGFRGGAPELTVSSNLQGLSLSLPAPLNK
FT                   SAQALLPFRLETALLAQALPPGRGAAPPMRDQLTLNLGPLASISYIRDLSGPEPRVTRG
FT                   SIGVGLSPQESATLPDEGVVANINLSTVDLDAWGALLERAAGSSLTDAALATATPQATP
FT                   GAAGAASAALSYLPTSMAVRAQTLTFGGRTLHNVVVGGSREGMLWRANLAATELNGYLE
FT                   YRQPSDLGEGRLYARLARLTIAPSTARDMEALLEEQPAGIPALDIVVEDFELRGKRLGR
FT                   VEVEAINRGSSAVAPGNLAREWRLNKFNIIAPEAVLTATGNWAALGALTPPKANARRRT
FT                   VMNFKLAVADGGELLTRFGMPGVVRKGRGQMEGQVAWMGSPISLDYPSMTGAFTVNMES
FT                   GQFLKADPGMAKLLGVLSLQALPRRLTLDFRDVFSEGFSFDFVRGDVTIEQGIAKTNNL
FT                   QMKGVNAAVLMEGRADIEKETQDLKVIVVPEINAGTASLIATVINPAIGIGTFLAQMFL
FT                   RKPLTEAATQEFHIDGSWADPQINRVQRKTGGANVAPR"
FT   gene            371675..374404
FT                   /locus_tag="Rfer_0367"
FT   CDS_pept        371675..374404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0367"
FT                   /product="Glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68121"
FT                   /db_xref="GOA:Q222D2"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D2"
FT                   /protein_id="ABD68121.1"
FT                   /translation="MTGIMTGPALSAHSRFGQRIRRRFESQLHLLPPGLPSPASMAQAC
FT                   DALRALGLDSASALRTTRQLVLERLLCLDCDQQAPLQQVTQAMTDLAEFALNTACAEVE
FT                   LTLDQTHGAPTTAAGARAQLWIVGMGKLGARELNVSSDIDLIYVYDEDGDTAGDSQGRG
FT                   RISNQEYFAKAVRAIYALVGDTTEHGFVFRVDLALRPNGNSGPPAVSLDALEQYLHVQG
FT                   REWERFAWLKSRVVAPLGCVADGSTLALRNVVMPFVFRRYLDYSVFDALRVLHRQIREH
FT                   ASKRSAGHPERANDVKLSRGGIREIEFIVQLLQVVRGGQFPELRTRATLRALPRLVKAG
FT                   LMPKNTAQALADAYVFLRQVEHRIQYLDDQQTHVLPTQDQDLTWIASTLGFATACQLLH
FT                   QLDAHREVVAEEFDKLLGGGADQSCKGCNGGNGAKSAAAPGFDEVLEQLADQFRQRVAN
FT                   WREHPRVLALKEESRTRLLRLIARTAQWVREGRATEAAAVRLVDWMEPLLRRESYLALL
FT                   LERPNVHERLLRLLDAARWPARYLLLHPGVIDELASADFLDERFSASDFEHELDHRRAA
FT                   LAGTGEDDDETLLNLLRRAHHAEVFRTLARDVEGKLTVEAVADDLSSLAEAVLRVTTRW
FT                   CWSRLKNRHRETPQFAIIAYGKLGGKELGYGSDLDLVFVFDDDDERAPEVYASLVRKLI
FT                   NWLTVKTGEGDLYEIDTALRPNGNAGLLITSFDAYANYQQQRGSNTAWTWEHQAMTRAR
FT                   FVLGDDTLRQRFDVIRKSVISAPRQAEGLKTEIKAMRERLRDAHAGKEGYFDVKYSPGG
FT                   MIDAEFVMQYLVLSQSAQLPELLDNLGNIALLERAEVMGLLPVGVGHAAASAYRTLRQV
FT                   QHRARLNDEPYQVRLPQLQAERDAVLALWHAVFGAALP"
FT   gene            374558..376585
FT                   /locus_tag="Rfer_0368"
FT   CDS_pept        374558..376585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0368"
FT                   /product="Ribonucleoside-triphosphate reductase, anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68122"
FT                   /db_xref="GOA:Q222D1"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D1"
FT                   /protein_id="ABD68122.1"
FT                   /translation="MSATKPPVFSHIIKRDGGIKPFDGAKIAHALARAAQVSGEFDDTE
FT                   AQRLTHYLVLPKIKVHGQVTPHIEQIQDAVESALFDAGYPKTLRAYIVYREQHHKLRSD
FT                   RKTLVDVESSMNEYLQQLDWRVNANANQGYSLGGLILNVSGKVIANYWLNHVYPPEVGA
FT                   AHRSAAIHIHDLDMLAGYCAGWSLRTLLHEGLNGVPGKVESGPPKHLSSAVGQIVNFLG
FT                   TLQNEWAGAQAFSSFDTYMAPYVRQDKLSYDEVRQSLQELIYNLNVPSRWGTQTPFTNL
FT                   TFDWVCPQDLREQIPVIAGKEMAFSYGELQPEMDMINRAYIEIMMAGDAKGRVFTFPIP
FT                   TYNITEDFDWYSTNAELLFEMTAKYGLPYFQNFINSELKPNMIRSMCCRLQLDLRELLK
FT                   RGNGLFGSAEQTGSLGVVTINCARLGYLHRGDEAAMLAALDALLELGRDSLEIKRKVIQ
FT                   RHMDNGLFPYTKRYLGTLRNHFSTLGVNGINEMIRNFTQDKYDISGEWGHAFAVRLLDH
FT                   VRARMLEFQDQTGHMYNLEATPAEGTTYRFAKEDAKQFPDILQAGTKDMPYYTNSSQLP
FT                   VGFTDDPFEALELQDDLQRKYTGGTVLHLYMTEPLSSAEACRQLVKRSLSRFHLPYITV
FT                   TPTFSICPKHGYLGGRHDFCPKCDADLISRKQLETNTQGD"
FT   gene            376587..376790
FT                   /locus_tag="Rfer_0369"
FT   CDS_pept        376587..376790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68123"
FT                   /db_xref="GOA:Q222D0"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:Q222D0"
FT                   /protein_id="ABD68123.1"
FT                   /translation="MTDLSEQQLLTPQAVVLRDDERQRCEVWTRVMGYHRPMSSFNTGK
FT                   KGEFHERTYFDERCCSPSQPDA"
FT   gene            376804..377520
FT                   /locus_tag="Rfer_0370"
FT   CDS_pept        376804..377520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0370"
FT                   /product="Ribonucleoside-triphosphate reductase,
FT                   anaerobic-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68124"
FT                   /db_xref="GOA:Q222C9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C9"
FT                   /protein_id="ABD68124.1"
FT                   /translation="MAAGAPALTLKVGGITPFSATDYPGKLAAVVFVQGCPWRCGYCHN
FT                   PHLQPRTGSSLVSWSAVLALLKRRVGLIDAVVFSGGEPTMDPGLLDAMRAVRSLGFGVG
FT                   LHSAGMYPRRLAEVLELVDWVGLDVKSSWPGYDAITGIADSARQARASAQLVLASGIAH
FT                   EFRTTVHPALHTEADILALAKTLQAMGVRHYVLQVFRATGCGDARLNAGSTLGYPGAEL
FT                   LAQVAALFDSFTLRQV"
FT   gene            377600..378751
FT                   /locus_tag="Rfer_0371"
FT   CDS_pept        377600..378751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0371"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68125"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C8"
FT                   /protein_id="ABD68125.1"
FT                   /translation="MKLAISYPMSLRLTAAAALGLTTAVAFAQDVQIVRIAHAGPTSGG
FT                   IAHIGKDTENGVRLAIDELNAQALVIGGKKIKFELAAEDDAGDPRQATTVAQKLCDSHV
FT                   AGVVGHLQSGTTIPASMVYNKCGLPHITAAATNPDVTKHGYPTTFRLIANDNALGAALA
FT                   YFAHDALKLKTVAVIDDRTAYGQGLADVFKATAQQKGMRIVAEEFTNDKATDFMAILTA
FT                   IKSKKPDAIFYGGLDAQAGPMLRQMEQLGMSNVRYFGGDALCTEKLPELSSKAGTLKNV
FT                   TCATGGASVQKMQGGAAWKKKYDARFPGQFQIYSPYAYDATFVLADAMKRANSVDPKVY
FT                   VPFIGKTHYKGVTANIAFTSKGELTQPSVTLYTYKDDVRAALN"
FT   sig_peptide     377600..377686
FT                   /locus_tag="Rfer_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(378824..378899)
FT                   /locus_tag="Rfer_R0002"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(378824..378899)
FT                   /locus_tag="Rfer_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(378967..380472)
FT                   /locus_tag="Rfer_0372"
FT   CDS_pept        complement(378967..380472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0372"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68126"
FT                   /db_xref="GOA:Q222C7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C7"
FT                   /protein_id="ABD68126.1"
FT                   /translation="MNELPLIQHLIDGQLVAGGTRSVDVFNPATGQAEKRVLLADKHTV
FT                   EQAIASAHAAYPAWRATPPLKRARVMSKLKTLLEDNAERLCALLTAEHGKVLSDSMGEL
FT                   QRGIENVEYASYAPELLKGEHSKNVGPSMDSWSEFQPLGVTAGITPFNFPVMVPLWMWP
FT                   MAIACGNTFVLKPSERDPSSALLVAELALQAGLPPGVLNVVNGDKEAVDALLTDKRVQA
FT                   ISFVGSTPIAEYIYATGCAHGKRVQALGGAKNHAVVMPDADIANAVNALMGAAYGSCGE
FT                   RCMAIPLVVAVGDATADAVLAGLKAEIAKMKVGPGTDSANDMGPLVTKAHLDKVKGFVD
FT                   QGVQEGATLVVDGRNVQVAGHESGYFMGACLFDHVKPGMKIYQEEIFGPVLGVVRVKTL
FT                   QEGMDLINAHEYGNGTCIFTRDGEAARYFSDHILVGMVGVNVPLPVPVAYHSFGGWKRS
FT                   LFGDLSAYGPDAVRFYTKRKTITQRWPSAGVREGAVFSFPTNR"
FT   gene            complement(380484..381833)
FT                   /locus_tag="Rfer_0373"
FT   CDS_pept        complement(380484..381833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0373"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68127"
FT                   /db_xref="GOA:Q222C6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C6"
FT                   /protein_id="ABD68127.1"
FT                   /translation="MKMNDVQTLATPRLDAAWLDAHWMPFSGNREFKANPRMMASAKGC
FT                   YYTDSHGKQIFDGLSGLWCCGLGHGRNEITEAVTQQMATMDYSPAFQFGHPLSFALANK
FT                   LKELTPAGLDYVFFTGSGSESADTSLKMARAYWRAKGQATKTRLIGREKGYHGVNFGGV
FT                   SVGGIGGVRKMFGQGIEADHLPHTQLAGNAFSRGMPDKGAELADDLLNLIALHDASNIA
FT                   AVIVEPFSGSAGVIIPPKGYLQRLREICTANNILLIFDEVITGFGRAGAYTGAEAFGVT
FT                   PDIMNLAKQISNGAQPIGAVLAKKEIYDTFMAAGGPDYMLEFAHGYTYSAHPVTCAAAL
FT                   ATLDILVKENMIDRVKALAPHFENAVHSLKGVRHITDIRNYGLAAGFTIDALPGEPAKR
FT                   PFEIAMAMLKKGFYVRYGGDTIQLAPPFISTPAQIDSLVNALGETINQTA"
FT   gene            381979..382932
FT                   /locus_tag="Rfer_0374"
FT   CDS_pept        381979..382932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0374"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68128"
FT                   /db_xref="GOA:Q222C5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C5"
FT                   /protein_id="ABD68128.1"
FT                   /translation="MQVKSRAALGQLSDMDIRLLRVFKSVAECGGMAAAELDLNIGVST
FT                   VSRHIKDLETRLGLTLCRRGRAGFALTAEGEQIYAETLRLLAGVDAFRSRVDEIHQRMG
FT                   GELHIAVFDKTASNPAAHISSAIARFAEQAPDVSLHLHVAPLNTIERGVLDGQFQVGVI
FT                   PGHRSSDTLTYDELFTETMFLYCGAQHALFPDGQAVQEPADWDALRKHAFAGLGYHSPN
FT                   MEISQRVHLVRKATGYDQESIATLILSGNYLGFLPDHYADGFVRNGQMRAVKPALFRYS
FT                   CSFFSIVRASPQPSRVSRAFRDCLLAAHRGVSAGAG"
FT   gene            complement(382956..383330)
FT                   /locus_tag="Rfer_0375"
FT   CDS_pept        complement(382956..383330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68129"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C4"
FT                   /protein_id="ABD68129.1"
FT                   /translation="MTLQYQLKGGNYHLYDLSSPASKVTGEHRLRLSTDTVAIAFDAST
FT                   GALHEHGNPARIHSWATTARRRLRAAGSLDSANDIVVVSGPLPVDEINKCLRVEGYCRR
FT                   MFTRLATLPHGKLLGRQAAY"
FT   gene            complement(383437..384039)
FT                   /locus_tag="Rfer_0376"
FT   CDS_pept        complement(383437..384039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68130"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C3"
FT                   /protein_id="ABD68130.1"
FT                   /translation="MNEKIRQLLDQMSTLEDDLRREVQAQEASALYQIKGKRVEFEAAI
FT                   RQAHRQLKTSFFRWLVTNRPQNLITGPIIYSMIVPIVMLDLCVSFYQATCFPIYGITKV
FT                   RRSDYIVFDRQQLGYLNFIEKFHCTYCAYGNGLIAYVSEIIGRTEEYFCPIKHARKMLG
FT                   AHSRYARFLAYGEAQDYEAKLEQFRVRLGDKQPPERT"
FT   gene            384176..385441
FT                   /locus_tag="Rfer_0377"
FT   CDS_pept        384176..385441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0377"
FT                   /product="putative membrane anion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68131"
FT                   /db_xref="GOA:Q222C2"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C2"
FT                   /protein_id="ABD68131.1"
FT                   /translation="MMLGHGAPDWGVVAIFVTVYLGMILGGLPRLKLDRSGVALLGAIG
FT                   VIGLEVMTTGQAAQAVDWPTIVLLFSFMVLSAQMRLGGFYTTVTHRVAALPLGRGGLLA
FT                   ALIAVAAALSAVFSNDIVCLAMTPVVARLCLQRRLDPVPFLLGLACAANIGSAATLIGN
FT                   PQNMLIGSVLQLPFGAYVRQALPPVLMSLAVLWVWLVWGPQARVASLPRLKLPPDLAAE
FT                   LRAGEPFDAWQSIKGLVVAAALLLVFLFTDWPREVAALVGAGVLLLSRRFHSSRVMGLV
FT                   DWDVLVLFMGLFVVNHAFESTGLAAQAVTWLGAQGVHLADPGPLVVAGVGLSNLLSNVP
FT                   AVMLLLPHLKGVEAGVTLALVSTLAGNLLLVGSIANLIVVDLAQRSGVIIDWRAHARVG
FT                   IPVTLMTLAIVWLWLSGMLTVG"
FT   gene            complement(385562..386215)
FT                   /locus_tag="Rfer_0378"
FT   CDS_pept        complement(385562..386215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0378"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68132"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C1"
FT                   /protein_id="ABD68132.1"
FT                   /translation="MKKLLLLSAAMVSSGLSLAQEVGHVISATPVMQQVGIPRQVCSTE
FT                   QVAVQPAKSGAGAVMGAIAGGAMGNAVGGGGGKAAATMLGIVGGAVLGDRIEGAPAAEI
FT                   QNVQRCAMQTFFENRPVAYNVVYEFGGKQYSVQMPNDPGPTIELQITPVGAGTPWQEPA
FT                   NATSYVQPSYGPPANVVLMPPAYPGYYARPYYPPVGIEFDFGYRGGYGGRRHWR"
FT   sig_peptide     complement(386156..386215)
FT                   /locus_tag="Rfer_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(386337..389411)
FT                   /locus_tag="Rfer_0379"
FT   CDS_pept        complement(386337..389411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0379"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68133"
FT                   /db_xref="GOA:Q222C0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q222C0"
FT                   /protein_id="ABD68133.1"
FT                   /translation="MNFSELFIRRPVMTVLLNLAIVLAGVIGFRSIPVAALPSYDTPVI
FT                   NVFAALPGANPETMASSVALPLEKQFQTVPGLKTISSTSTLGRTSLTLEFDEGRNVDAA
FT                   AVDVQAALLRAQRSLPQDMTATPSYRKVNPADAPVLLISMTSPSLAPSDLQDFAEHLIS
FT                   PTLSTIDGVAQVNVFGSKRYAVRVSVHPEALAVRNIGLDELSTALRAANVNTPVGTLDG
FT                   PRQTLMLQANRQLQNAADFADLIVSNRGGNPVRLKEVAQVEDSLETLKSWATFNGENSI
FT                   TLAVQRQPGANTVRVVDAIRQALPNLQSQMPQSVKLVPFLDRSVSVREALHDVSLTLLG
FT                   TIALVVLVIFLFLRRFVATMIPMLSLPVSLVGAVALLWGFSYSLDNISLLGLTLAVGLV
FT                   VDDAIVVLENIMRHVENGEAPFPAALKGAREVGFTIISISTSLIAVFIPIFFMPGVIGL
FT                   LFHEFAVVVGLAIIVSAFVSLTLVPMLASRFLTGEAHKKPPGAVVRSFARGFDRLLAGY
FT                   TRLLDIALGHRTLVLLLALATLVGTVWLANIIPKGFFPEEDIGQIQVSTEASEDTSFPE
FT                   MVRLQEQAAAIIRLDPNVAAVSSFNGGSGAQNTGRMFIALKPSNQRQTMKKVVEGLRRK
FT                   LRELAGISVFMRPVQNLQLGGRPSKAQYQYVLQSVRADELNSWASKLQDSLSADPLFRD
FT                   VTSDAQLRGLQAQLKIDRDSANKLGVSIDGIRTALYSAFGERQVSTIYLPTDSYQVIME
FT                   VQADAKEDERALGGIYVRSNTGALVPISNFTTVERTLGPTAINHVGQLQAVTVSFNLAP
FT                   GAALGAATAKIDAARAAIQMPSSIITSYGGDAAVFKSSQGSQLVLIIAALLVIYVLLGV
FT                   LYESYIHPITIIAGLPSAAVGALVTLMLFGQDLTLIATIGIVMLVGIVKKNAIMMIDFA
FT                   LDAQRHQGMAAAQAIREACILRFRPIMMTTMAALMGALPIALGLGAGAELRQPLGLAVV
FT                   GGLVFSQAITLFITPVIYLALDRFSGTGPVLTAES"
FT   sig_peptide     complement(389304..389411)
FT                   /locus_tag="Rfer_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.650) with cleavage site probability 0.400 at
FT                   residue 36"
FT   gene            complement(389408..390610)
FT                   /locus_tag="Rfer_0380"
FT   CDS_pept        complement(389408..390610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0380"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68134"
FT                   /db_xref="GOA:Q222B9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B9"
FT                   /protein_id="ABD68134.1"
FT                   /translation="MNARHFFLTLTGGLLALGLGGCTAKTDAPAPAASSSAPAKPSAAA
FT                   LPAVTITTVRAQQRDLPVLYSATGTVMALASVDIKSQVTSVVSKIHIQDGQFVKAGELL
FT                   FTLDSRTDEANLAKARAQLAKDSALRADAQRQLARAQQLYSQNFISQGAVDTAQAQLDS
FT                   MAASVVADQAAIEAARVAVSYARISAPNAGRAGAVNVSQGSVVQANLTSLVTITQLDPI
FT                   AVGFNLPQRTLADTLSALKNGGAAVKATIADGGASFIGHLNFVDNAIDSSSGSVKVKAV
FT                   FANPQGKLWPGAFVDISQTVNTLKDAIVIPQATIIPNARGTMVYVVEAGKAVLRPVRVV
FT                   LAQGDDAAVTGVKAGESIVLDGKQNLRPNSPVLEQARAPAGGASGPAGGAAASQQRPTA
FT                   S"
FT   sig_peptide     complement(390536..390610)
FT                   /locus_tag="Rfer_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.914 at
FT                   residue 25"
FT   gene            390864..391364
FT                   /locus_tag="Rfer_0381"
FT   CDS_pept        390864..391364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68135"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B8"
FT                   /protein_id="ABD68135.1"
FT                   /translation="MKITRIFAALPVLLLALVACTTTGSGGGQLAGPGAQEEPVAFSWT
FT                   STDGGMSGAMTAALPNASYQGRFFQITQQTRGEVLTPLWTHWNRGWYDWPYWSGPEFQP
FT                   YPATQFITFYSGKVVATLESPGNQRMRCRFHLVEPVRGMSGGGEGQCQLSDGRLVRATF
FT                   PGK"
FT   sig_peptide     390864..390959
FT                   /locus_tag="Rfer_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.495 at
FT                   residue 32"
FT   gene            391417..392076
FT                   /locus_tag="Rfer_0382"
FT   CDS_pept        391417..392076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68136"
FT                   /db_xref="GOA:Q222B7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B7"
FT                   /protein_id="ABD68136.1"
FT                   /translation="MNTLTKMALGLIGQLKPQPADGDAASTTYLPAANTTGGLPLMQAL
FT                   AQRQSQREFDPAPLPLQMLSDLLWAAAGINRSELAGRTAPSAMNAQEVDVYVALPEGLY
FT                   RYAAPTQTLHLVRATDVRRVTGYQDFVDTAPLDLVLVADHARMKLVPAAQREAFAFAAA
FT                   GAMAQNVYLYCASAGLATVIRAWLDRDALAQAMGLNNDQQVLLSQTVGRPKTVATA"
FT   gene            complement(392077..392457)
FT                   /locus_tag="Rfer_0383"
FT   CDS_pept        complement(392077..392457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0383"
FT                   /product="glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68137"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B6"
FT                   /protein_id="ABD68137.1"
FT                   /translation="MKPTYFDLTVRDLARARVFFEKVLGWRFERFPMPYEYYRIQAGPE
FT                   GEPGIDGGIGRIKDTPLSGGNPLTQVTVPVPNLDVVTSLVQANGGRIVEAKMPIPGVGW
FT                   YATCAEPGGLFFGLIQADENAK"
FT   gene            complement(392468..392719)
FT                   /locus_tag="Rfer_0384"
FT   CDS_pept        complement(392468..392719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0384"
FT                   /product="phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68138"
FT                   /db_xref="GOA:Q222B5"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B5"
FT                   /protein_id="ABD68138.1"
FT                   /translation="MSTDRAALMATVLTLLRAIAPEVEPGTLTPERPLRQQVDLDSMDW
FT                   LNFLLSLHERFGVSIPESDYAGLVCLNDVVNYLQARLK"
FT   gene            complement(392716..393969)
FT                   /locus_tag="Rfer_0385"
FT   CDS_pept        complement(392716..393969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0385"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68139"
FT                   /db_xref="GOA:Q222B4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B4"
FT                   /protein_id="ABD68139.1"
FT                   /translation="MIEFKLPSLGADMDEGTLLEWHIKPGDVVKRGQVVAVVDTSKAAV
FT                   DVEIWHDGVVHELRVAVGEKVPVDTVLATLLAPGEVAAAPAAASAAAPEPRAAAAAAPV
FT                   ARPAPATQRALEPDQLPATTRHPASPAARRRAKELGMDPDTVPGTGAQGSVTLADIEAA
FT                   AHAAPAPGAAPSPALASDRQKAMRKAIAAAMSRSKREIPHYYLSETIPMTRALDWLRQR
FT                   NEGLPMTERILTAALLLKAVAAALQRTPELNGFYRDGQFEPSVAVHAGVAISLRGGGLV
FT                   APALHDVGAKPLAQLMRELADLVKRARAGSLRSSEMMDPTITITNLGEQSVQSVFGVIY
FT                   PPQVALVGLGGIAVRPWVEGGKVHALPLLCATLAADHRASDGHRGALFLAELRELLQQP
FT                   QTLADATKPNPIQPGDTT"
FT   gene            complement(393966..394955)
FT                   /locus_tag="Rfer_0386"
FT   CDS_pept        complement(393966..394955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0386"
FT                   /product="Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68140"
FT                   /db_xref="GOA:Q222B3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B3"
FT                   /protein_id="ABD68140.1"
FT                   /translation="MGRRISYRDALREALRAALQSDPRVFLMGEDVGCYGGTYAVSKGL
FT                   LEEFGPERIRDTPLSELGFVGAGIGAALGGMRPIVEIMTVNFSLLALDPIVNSAAMLHH
FT                   MSGGQFSVPLVIRMATGAGRQVAAQHSNSFECWYAHVPGLRVLAPATVEDARGMLQAAL
FT                   ADPDPVLIFEHAQLYNSEGELPDDESAAVDIAGARVRRTGSDISLITYGGCLPKALQAA
FT                   DELASLGISAEVIDLRVLRPLDDATVMASVRRCRRAVVVDEGWRSGSLAAEVMARISEQ
FT                   AFFDLDAPPARVCSEEVPIPYARHLEEAALPQVPKIVAAVQAVMGAAA"
FT   gene            complement(394955..395959)
FT                   /locus_tag="Rfer_0387"
FT   CDS_pept        complement(394955..395959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0387"
FT                   /product="Pyruvate dehydrogenase (lipoamide)"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68141"
FT                   /db_xref="GOA:Q222B2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B2"
FT                   /protein_id="ABD68141.1"
FT                   /translation="MKVPAPPSGPVPWDKPFALSLLSDMLRIRRMEERAAELYGQQKIR
FT                   GFLHLYIGEEAVAAGALRALSADDKVVATYREHGHALLHGLKMDTIMAEMFGRQDGCSR
FT                   GRGGSMHLFDRAHHFFGGQAIVGGGLPLATGLALADKLLKRRALTACFFGEGAVAEGAF
FT                   HEAMNLAALWRLPVLFCCENNLYAMGTALARSESQTDLCLKAASYGMEVMTVDGMDVVA
FT                   VHEAVRFAAQKVREASAPMFVELRTYRFRAHSMFDPDLYRAKQEIEAWKTRGPVHTFTA
FT                   RLKLQGILSEDEFLALDASAQAEVEAAVAFAEGSNWEPVEDLLRDVHTPAGAA"
FT   gene            complement(395956..397764)
FT                   /locus_tag="Rfer_0388"
FT   CDS_pept        complement(395956..397764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0388"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68142"
FT                   /db_xref="GOA:Q222B1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B1"
FT                   /protein_id="ABD68142.1"
FT                   /translation="MLSQGRRMERPVVIHKVASDLRLSPNWVDYEAGRRVDVWADARHA
FT                   LQGLPGGGLNLGFEAVDRQAAGALRDHVALRFVARNAPPLDLRYFELAQQTNRFANVLR
FT                   SLGVGKGDHLFVLAGRIPELYVAVLGALKNGSVVTPLFSAFGPEPIAARIQLGAGRVLV
FT                   TTDALYQRKVKQIRAQTPTLVHVLLVAEDGGITNEPDTLDLGTLMASASDTFSTVETQP
FT                   DDPALLHFTSGTTGTPKGALHVHEAVVTHFATGRYALDLHPQDRYWCTADPGWVTGTSY
FT                   GIIAPLLQGVTSLIDREEFDAERWYTLLEQERISVWYTAPTAIRMLMKAGTELAQRHSH
FT                   PDLRFIASVGEPLNPEAVWWGQEALGLPIHDNWWQTETGGIMIANTPAFDIKPGSMGRP
FT                   LPGIDACIVEHLEAEGEPARVRVIEEANVEGELALKRGWPSMFRAYLNNEARYRKCFAG
FT                   ELYLTGDLAKRDADGYYWFVGRADDVIKSAGHLIGPFEVESVLMEHPAVAEAGVIGKPD
FT                   PVVGEVVKAFVSLKDGYQAGETLRLDISAHARRRLGAAVAPKEIVFLPTLPRTRSGKIM
FT                   RRLLKARELGLPEGDTSTLEGGAWTK"
FT   gene            complement(397785..398237)
FT                   /locus_tag="Rfer_0389"
FT   CDS_pept        complement(397785..398237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0389"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68143"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q222B0"
FT                   /protein_id="ABD68143.1"
FT                   /translation="MASQLKDFATSMVAVVEPETPTLLVAQLMRKHHIGALVVVDTHEK
FT                   TRPIGIVTDRDLVLELMAEGLDPAVFTAGDIMSVDLVLATPEMDAMDAVQLMKTHRLRR
FT                   LVITDDKGRLVGIVTMEDVLELLARELANLAAGLAGARDREINERD"
FT   gene            complement(398245..398898)
FT                   /locus_tag="Rfer_0390"
FT   CDS_pept        complement(398245..398898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0390"
FT                   /product="transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68144"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A9"
FT                   /protein_id="ABD68144.1"
FT                   /translation="MKTDSELKKDVLAEMLWDPLIPEARVGVSVTDGVVTLTGHLDTYA
FT                   EKVAAKRAVERVSGVKAIAVELDVIPAGIHQRSDTEIAAAVEHALSWNTSVPQDRVKVT
FT                   VEKGWVTLSGELDWNFQRRAVERMTRPLKGVVGIVDNIRLKALPVPANLSARIQDALTR
FT                   QAQREAKRIEISMDGSVATLRGHVHSWAERNAAEGATWSAPGVSRVNNQLTIEA"
FT   gene            399063..400100
FT                   /locus_tag="Rfer_0391"
FT   CDS_pept        399063..400100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68145"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A8"
FT                   /protein_id="ABD68145.1"
FT                   /translation="MPDIEAKLKFLRSPASYGSLGQQVELIETHMSWVFVLEQRVFKLK
FT                   KPVCFPFLDFSTLQAREFYCREEVRLNARLAPGVYLGVVALQWQDGAFALVPEAQWPAP
FT                   GETVDWLVVMRRLPRQRMLSELIARHSVARSDIDALLALLGAFYRAAPAAPVSANDYVS
FT                   RLRHEQALNREVLLRPQFVLQDVRLAIERLDAALAQCTDLLRARASRRHVLDGHGDLRP
FT                   DHVCLLDPPVVIDCLEFNPQLRQVDPFDEVAYLGLECDLAGAPWIGSQLVAGIADALGD
FT                   HPGPSLMHFYTAYRAMLRARLAMAHLLDPRPRSPERWPAQSERYIAHALVALDAFNQTM
FT                   HLQTP"
FT   gene            complement(400069..401055)
FT                   /locus_tag="Rfer_0392"
FT   CDS_pept        complement(400069..401055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0392"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68146"
FT                   /db_xref="GOA:Q222A7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A7"
FT                   /protein_id="ABD68146.1"
FT                   /translation="MARHELAQGMLLYSLDSDDTFAQGLAASLGVKLAPHEYRRFEDGE
FT                   HKLRPLLDPRGSDTFVVHSLHGDAQNSPHDKLCQLLMFIATLREHGAARVAAVVPYLAY
FT                   ARKDRQTKPFDPVSLRYVAQLFEAVGTTQLMVLEAHNVAAFQNAFRCPTMHLEAHQAFN
FT                   AMALELAGDARLAVASPDPGGVKRAQLWRESLETTLLRPVGFAMVDKRRSAGVVSSENL
FT                   VAGEVDGMRVLLLDDLIASGETMRRAALALRQSGAREVLACVAHGLFTGSAAQVLTDDS
FT                   IARIIITDSVPPFRLPLACAARRKLSIASAVPLFAQAIKASAGAWSG"
FT   gene            401220..401630
FT                   /locus_tag="Rfer_0393"
FT   CDS_pept        401220..401630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68147"
FT                   /db_xref="GOA:Q222A6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A6"
FT                   /protein_id="ABD68147.1"
FT                   /translation="MKQSTVFLAGSLVALTVVSSTSFAQGSVDFGKNEYMASCASCHGA
FT                   SAKGDGAMRTYLTKAPTDLTIMAKRNAGVFPTQYAWEVIDGRTSAAIGSHGAREMPVWG
FT                   YVYRAEDSQPADLHARTRIGSLLDYLARIQVK"
FT   sig_peptide     401220..401294
FT                   /locus_tag="Rfer_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            401649..402272
FT                   /locus_tag="Rfer_0394"
FT   CDS_pept        401649..402272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0394"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68148"
FT                   /db_xref="GOA:Q222A5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A5"
FT                   /protein_id="ABD68148.1"
FT                   /translation="MFRDRDEAAGRLAEKLKSYRGKNPLILAIPRGAVPMAKIVADKLG
FT                   GELDVVLVRKLRAPHQPELALGSVNESGWTYLADFAQLYGGSSDYLEGEKRTQMETIRQ
FT                   RRAQYTPIRPPIDPAGRIVIVIDDGLATGATMISALHGLRAMKPAQLICAIPVSPPDTL
FT                   AKVADLADEVVCLEAPPFFQAVGQFYQHFPQVDDDEVIELLKEA"
FT   gene            complement(402305..402952)
FT                   /locus_tag="Rfer_0395"
FT   CDS_pept        complement(402305..402952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0395"
FT                   /product="dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68149"
FT                   /db_xref="GOA:Q222A4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A4"
FT                   /protein_id="ABD68149.1"
FT                   /translation="MKPTHAQLVHIPVDDVHIEGMLELPPGPLGIVLFAHGSGSSRHSP
FT                   RNNYVARVLHEKGIGTLLMDLLTVAEDLDYQTRFDIALLTHRLLVATRWVRLEAATRQL
FT                   PIGYFGASTGAAAALQAAAALGDNIQAVVSRGGRPDLAGNQSLEQVKSPTLLLVGGRDE
FT                   DVIELNREAYARLPCTKELSIVPGATHLFEEAGTLEEVARQAAVWFNQYLKN"
FT   gene            complement(402972..404048)
FT                   /locus_tag="Rfer_0396"
FT   CDS_pept        complement(402972..404048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0396"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68150"
FT                   /db_xref="GOA:Q222A3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A3"
FT                   /protein_id="ABD68150.1"
FT                   /translation="MQESSYPGRYWHWLDDGRMQCDLCPRDCRLHEGQRGACFVRMRQG
FT                   GQMILTTYGRSSGFCIDPIEKKPLNHFYPGSSVLSFGTAGCNLACKFCQNWDISKSRDM
FT                   DRLMDQASPEAIAMEAVKYGCKSVAFTYNDPVIFAEYAMDVADSCHARGVQAVAVTAGY
FT                   MHDQPRRDFYAKMDAANVDLKAFTDDFYFKLTGSHLQPVLDTLVYLKRETRVWFEITTL
FT                   LIPGHNDSNEEITAMSRWVMQELGPDVPLHFSAFHPDHKMPDVPATPAATLVRARNIAL
FT                   KAGLHYVYTGNVHHAEGDTTFCPSCHAPLIVRDWYQINQYRLDTNGHCPDCGAAVAGRF
FT                   DAQAGDFGRQRIPIAIGA"
FT   gene            complement(404048..404689)
FT                   /locus_tag="Rfer_0397"
FT   CDS_pept        complement(404048..404689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0397"
FT                   /product="AMMECR1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68151"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A2"
FT                   /protein_id="ABD68151.1"
FT                   /translation="MSKSHTKPHTAAHPDSHGAAAKGHTLLPIARATISTALGRPLEAP
FT                   EQALWLQESGACFVTLTQRGQLRGCIGTLEARRALLADVKANALAAAFADPRFSPLVAA
FT                   ELEHTEIEVSLLSAMQAMQFENEAHALAQLQPGIDGVVFEFAHYRSTFLPQVWEQLPSV
FT                   PEFMAHLKHKAGLPPGFWAPGVRLQRYSVSKWKETDLRPATAKAPNQENL"
FT   gene            complement(404670..405494)
FT                   /locus_tag="Rfer_0398"
FT   CDS_pept        complement(404670..405494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0398"
FT                   /product="protein of unknown function DUF52"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68152"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A1"
FT                   /protein_id="ABD68152.1"
FT                   /translation="MSLVRPPAVAGTFYPGQASVLLNDVTTLLTQARPGANLREPAPKA
FT                   LIVPHAGYIYSGATAARAYAELAGGRASIQRVVLLGPVHRVPVRGLALPGVDAFATPLG
FT                   RIEVDQDAVAAIAHLPQVVVSRAAHAQEHSLEVQLPFLQAVLDDFKLVPLAVGDATPAQ
FT                   VAEVIEALWGGDETLIVISSDLSHFLPYGTAQAVDSETVQNMMQLNSSITHHQACGGTP
FT                   VNGLLQAARQHHLQPELLGLCNSGDTAGDKSRVVGYAALAFRQELSDVQISH"
FT   gene            405634..406542
FT                   /locus_tag="Rfer_0399"
FT   CDS_pept        405634..406542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0399"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68153"
FT                   /db_xref="GOA:Q222A0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q222A0"
FT                   /protein_id="ABD68153.1"
FT                   /translation="MSTFDPDALECLAAIVEEGGFERAAVRLSITQSAVSQRLRSLEVQ
FT                   VGTVLIVRSRPLKPTSAGRLLLKHALQTRLLRADLQRDLKDLAPGAAGSGGDVERISIA
FT                   INADSIATWALAALSELARRGLGLEIITDDQDFTIEWLREGRVLGCVTTLKQALRSCKM
FT                   VPLGAMRYVAVAETAYAAAHCPDGLSPHNFRHVPFIAFNRKDDLQGEFIAHVFHLKHVA
FT                   LSQLYVPSSEGQVSAVLAGWGVSVLPELQVREHLRSGRLVNLAPGHVLPVDLYWHCWNL
FT                   DSVVLDALTAALTEAAAVALR"
FT   gene            406565..407182
FT                   /locus_tag="Rfer_0400"
FT   CDS_pept        406565..407182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0400"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68154"
FT                   /db_xref="GOA:Q221Z9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z9"
FT                   /protein_id="ABD68154.1"
FT                   /translation="MNPDNAVRTSFKQQMLQAREEAIIQTANRLLAEKGFEAMTVDEVA
FT                   LQAGIAKASLYKHFASKEELAAAATARVMRRARDFIRALPEQAPPLDKLRAVLRWTLEV
FT                   KLAGDMPSLPSRNSTLRTALIGNQDCMEGWMEVSDRLRAWIEAAQAAGALNPALPAVAV
FT                   LYTFFARACDPALEFLRIGGRYQDEQIVTLVLSTCFEGLNAR"
FT   gene            complement(407247..407669)
FT                   /locus_tag="Rfer_0401"
FT   CDS_pept        complement(407247..407669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0401"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68155"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z8"
FT                   /protein_id="ABD68155.1"
FT                   /translation="MKILLAVDGSAYTKKMLAYLTTHDELFSPGNEYFVLTVQPGIPAR
FT                   ARAAVGKQVMDKYYMDEAERVLAPVAKFLLRHGIDAKSDWKIGHAGETIAQFADKGKFD
FT                   MIIMGSHGHGTLVNLVMGSVATEVLAHCTVPVLLVR"
FT   gene            complement(407783..408622)
FT                   /locus_tag="Rfer_0402"
FT   CDS_pept        complement(407783..408622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0402"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68156"
FT                   /db_xref="GOA:Q221Z7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z7"
FT                   /protein_id="ABD68156.1"
FT                   /translation="MTDSTLSTFVALDGDNLAVQDWPLASQQVLRGVVLLVHGLGEHAG
FT                   RYDRLAGRLNDWGFAVRGYDQYGHGESGGPRGGLPTDTRLLDDLSDIVDSTRARMDPHT
FT                   PLILLGHSMGGLVAARFVALGLRPVQALVLSSPALDPGLNAIQKLLLAVLPKIAPDLRI
FT                   GNGLDASLISHDSTVVAAYQADKLVHDRVSARLARFIADGGPATLAQAASWSVPTLLLY
FT                   AGADRLVNPAGSRAFAAAAPKTVLSAHCFEALYHEIFNELDAAPVFAELKKWLDARF"
FT   gene            complement(408622..410157)
FT                   /locus_tag="Rfer_0403"
FT   CDS_pept        complement(408622..410157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0403"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68157"
FT                   /db_xref="GOA:Q221Z6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z6"
FT                   /protein_id="ABD68157.1"
FT                   /translation="MAVRRGMITGIVDKPRKEFGMNVRIPAPALNTTQALNQISRAWDD
FT                   DLVAQLSDYIAIPAKSPMFDADWVQHGFIDTVVRNAASWVEAQKVAGLTLEIIRLPGRT
FT                   PVLFFEVAASTGSANHAVSNQTVLMYGHLDKQPEVTGWRSDLGPWTPKYEDGKLYGRGG
FT                   ADDGYAIYAAITAIQALKSQHVAHPRIVGLIETCEESGSYDLPPYIDALRARLGDVALV
FT                   ICLDSGAGNYDQLWLTNSLRGMASGTLKVEVLTEGVHSGDASGLVPSSFRILRHLLDRL
FT                   EDSATGRLLPAPFHCEVPFERLRQAQATAAILGEELYKRFPWAHADCGGASQTMLPTTT
FT                   DPLQALLSRTWTPTLSVTGAEGLPELKSAGNVLRPFTAFKLSLRLPPLVEAGQAVQQLK
FT                   ALLEDNAPYQARVSFVPDSHASGWNAPSTAPWFEQALNAASQDYFGAPCGYIGQGGTIP
FT                   LMSMLSSGFPKAQMMVCGVLGPKSNAHGPNEFLHVPYAKKLTAAVAQVIAQVP"
FT   gene            complement(410237..411358)
FT                   /locus_tag="Rfer_0404"
FT   CDS_pept        complement(410237..411358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0404"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68158"
FT                   /db_xref="GOA:Q221Z5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z5"
FT                   /protein_id="ABD68158.1"
FT                   /translation="MPHRTATLFDPVHAGDLTLANRIVMAPLTRNRAPDAIPTPLMAQY
FT                   YTQRASAGLIISEATAISHQGQGYADVPGLYGSEQLEGWKHVTHGVHGAGGKIVVQLWH
FT                   VGRVSHTSLQPEGGQPVAPSAIAAKTKTVLLQDGVPVFVDTSEPRALQAYELPDIVHTY
FT                   QAAARNAVQTAGFDGVEIHAANGYLLDQFLKAGSNLRRDDYGGSIENRARLLLEVMQAV
FT                   TTAVGAGRVGIRLSPVTPANDAFDPDPQPLFDYVVRELATFKLAYVHIIEGATAGAREL
FT                   PERPFDYTGLRRAYRAAGGKGAWMVNNGLDKELAQAAIADGADLVAFGRLFIANPDLVA
FT                   RLRRGGPFNKWDSSTFYGGGAKGYTDYPTLKGA"
FT   gene            complement(411439..412020)
FT                   /locus_tag="Rfer_0405"
FT   CDS_pept        complement(411439..412020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0405"
FT                   /product="Methionine biosynthesis MetW"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68159"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z4"
FT                   /protein_id="ABD68159.1"
FT                   /translation="MSDPHTMDALARLVPEGARVLDLGCGDGAMLAHLQQTRGCSGYGI
FT                   EINDANVLACVKRGVNVIQLNLDEGLSMFEDASFDVVLQIDTLQHLRNAEVMLRETVRV
FT                   GRVGIVAFPNFAHWPNRLSILSGRMPVTRRLPYQWFDTPNIRVGTHADLGILAGRNGLT
FT                   VLDSFGLQNAKVVRRLPNLLAGTSVYKLSR"
FT   gene            complement(412017..413159)
FT                   /locus_tag="Rfer_0406"
FT   CDS_pept        complement(412017..413159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0406"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68160"
FT                   /db_xref="GOA:Q221Z3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z3"
FT                   /protein_id="ABD68160.1"
FT                   /translation="MKMIATPQSMQFDTVLPLQSGASLRGYALSFETYGELNADKSNAV
FT                   LICHALNASHHVAGSYAGQDKSEGWWDNMIGPGKPLDTDKFFVIGVNNLGSCFGSTGPM
FT                   HINPDTGRVYGADFPVVTVEDWVNAQARLLDALGIQTLAAVMGGSLGGMQALSWALQYP
FT                   ERVRHAVVIASAPNLTAENIAFNEVARRAIVTDPDFHGGHFYAHGTVPKRGLRIARMIG
FT                   HITYLSDDVMNEKFGRQLIAAGKGGAQDDYLFSTLEAEFQIESYLRYQGDKFAEYFDAN
FT                   TYLLITRALDYFDPARTYGGDLSHALARASCKFLLVSFTTDWRFAPKRSREIVKALLHN
FT                   RRDVSYAEIDAPHGHDAFLLDDPRYMGVLRSYFDSIKEPA"
FT   gene            complement(413213..415174)
FT                   /locus_tag="Rfer_0407"
FT   CDS_pept        complement(413213..415174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0407"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68161"
FT                   /db_xref="GOA:Q221Z2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z2"
FT                   /protein_id="ABD68161.1"
FT                   /translation="MQQTLESVFGYPQFRPGQEAVISAVLAGRSAAAIFPTGSGKSLCY
FT                   QLPALLLPHLTLVVSPLLALMQDQLAYLTRHGIAAASIDSAQSREQTQSVMAQARTGQL
FT                   KILMISVERLKNERFRNFIAQVPISLLVVDEAHCISEWGHNFRPDYLKLPHYQRQFGIP
FT                   QTLLLTATATPPVVADMQTRFAIAAHDVVTTGFYRPNLHLLVEAVSGRDKLQRLLEWLS
FT                   MRANQPTIVYVTLQKTAEQVARHLSQHGLGAHAYHAGMPHEQRESIQKQFMAGRLNCIV
FT                   AAIAFGMGIDKSDIRNVVHFDLPKSIEGYSQEIGRAGRDGLPSDCLALANRDSLQVLEN
FT                   FVYGDTPEAGGIRCVLDEILAVAPAKPWELSLNALSEQSNIRLLPLKTLLVQLELRGII
FT                   ASRYAYFAEYRFKYLMEPEALLAHFKGERQQFVQAILRCARPARTWCTLDFEALYQTCQ
FT                   AEHSRVVTALDYLAAQGWIELEAKQMTEVYAVLAPGFDAQTLSLELLAYFQAKERSEIA
FT                   RIHAMLAFFAGEQCLSQHLAAYFGDSAAPLQCGHCSVCHGQVAHLPAPAPRAALAGQNF
FT                   PALCGDLMARHRALGPSPMSADSLTRFLCGVAAPLLTQLKARSLAGFAALENHPYAEVR
FT                   QWVGQQLANLEPGRPPTD"
FT   gene            415421..415744
FT                   /locus_tag="Rfer_0408"
FT   CDS_pept        415421..415744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68162"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z1"
FT                   /protein_id="ABD68162.1"
FT                   /translation="MKHKVPVTGAASEPALAQEGPDAGGEDERIMARPDGYYWLALDGK
FT                   QEFGPFESMELAQADRDASEGQDSGPGETLQEAEEEIGMSTWIDPETGEPAEGQSPPRL
FT                   EEE"
FT   sig_peptide     415421..415474
FT                   /locus_tag="Rfer_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.987 at
FT                   residue 18"
FT   gene            complement(415810..416631)
FT                   /locus_tag="Rfer_0409"
FT   CDS_pept        complement(415810..416631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0409"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68163"
FT                   /db_xref="GOA:Q221Z0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Z0"
FT                   /protein_id="ABD68163.1"
FT                   /translation="MRSLPSKAKNLQIAPFSDTLPAPIVFRSAYVPAEGMYPQHRHAWG
FT                   EFVYSFSGVMEVKLADHHYLAPPQYGIWLPPDVEHVGLNRYEAVHCSLYIAPQGCGNLP
FT                   RAACALTVSPLVRALLEHLRQQPPEQPGTLQDERLLRVLVDQLALAPCAGSYLPSSDDA
FT                   LLGAVLRMLEEQPGDNRSLPELAHAVHTTERTLMRRARRDLGMSFVEWRQRLRVVKAMP
FT                   LLEAGQTVETIALDLGYGSASAFITMFKRLVGTTPDEFRKGADGRINAGTK"
FT   gene            416735..417676
FT                   /locus_tag="Rfer_0410"
FT   CDS_pept        416735..417676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0410"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68164"
FT                   /db_xref="GOA:Q221Y9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y9"
FT                   /protein_id="ABD68164.1"
FT                   /translation="MDTRKALDGQAIALMLVLCMVWGLQQVVLKATAADIAPVFQIALR
FT                   SGAAAVLVGLLMAVRGERMALADGIWRPGLVVGLLFGLEFLLLGEGLRHTCASHMVVFL
FT                   YTAPIFAALGLHWKLPTERLGALQWLGIALAFAGIALAFLGRSRGAVAEPAQMLWGDFL
FT                   GLLAGLAWGATTVVVRCSSLAKAPATQTLLYQLLGAFVLLMAAAYATGQAHFRPTPQVW
FT                   ASLVFHSLVVSFASFLAWFWLLRKYLASRLGVFSFMTPLFGIAFGAWLLHEPIEPGFLL
FT                   GAVPVLVGIVLVSGGGWVLQMLSGLGLRRKNV"
FT   gene            complement(417922..421053)
FT                   /locus_tag="Rfer_0411"
FT   CDS_pept        complement(417922..421053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0411"
FT                   /product="Heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68165"
FT                   /db_xref="GOA:Q221Y8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y8"
FT                   /protein_id="ABD68165.1"
FT                   /translation="MLSRIIDWSGRNRFLVLLATLFIVVGGIFAVLRTPIDALPDLSDV
FT                   QVIVYTEYPGQAPQVVEDQVTYPLTTSMLSVPKSKVVRGFSFFGASFVYIIFEDGTDIY
FT                   WARSRVLEYLNFASGRMPKGITPQIGPDATGVGWVYQYALLAKDKTLAELRSIQDWYVR
FT                   YQLTKAHGVAEVASVGGFVQTYQVTVDPVKLRAYGIPLMKVAQVIRDSNRDVGGRAVEM
FT                   AETEYMVRGKGYLRGKGDIELLVVKSDKGTPVLIRDIARVELTPDERRGLTELNGEGEV
FT                   VSGIAMSRYGQNALEVISNLKAKIAEIGPGLPAGVTVQTVYDRSELINRAIDTLKRTLL
FT                   EESLIVAVVCVVFLMHVRSALVAILMLPVGILMAFIAMRLLGMSSNLMSLGGIAIAIGA
FT                   MIDAAIVMIENAHKHLERLPEDHTKLQRFEAMLEACKEVGPALFFSLLIITVSFLPVFA
FT                   LEGQEGRLFSPLAYTKTFSMASAALLSITLVPVLMLLFIRGKVMPEARNPVNRALIWAY
FT                   RPIIAGVMRWKKLTIFLALVALAVSYYPASKLGSEFMPTLNEGSLLYMPASLPGMSITK
FT                   AAELLQTQDKIIKSFPEVTSVYGKAGRANTATDPAPTEMFETVINLKPESEWRAGLTID
FT                   KLIAEMDKALQFPGVANSWTMPIKARIDMLSTGIRTPIGIKVFGKDLDEMEKLARQIEA
FT                   VVKTVPGTSSAFAERITGGFYLNIEPDREQLARYGLSVGDLLDVVGTALGGEMVTTTVE
FT                   GRERYGVTVRYPRELRSDPQQIATQVLVPTMEGAMIPLGQLAKVIVAKGAPGIRTENAL
FT                   LSAYIYVDIRDRDIGSYVRDAKKAVAEQVSFPSGYYVTWSGQFENMERALETMKIVIPV
FT                   TLLSIFMLLYLNFRRITETLIVMLSVPFALVGGIWLMWALGYNLSVAVAVGFIALAGVA
FT                   AETGVIMLIYLDHAWEDVKDKCRQSNRAPTVTDLYGAVMEGAVERVRPKMMTVVAIMAG
FT                   LLPIMWGTGTGSEVMSRIAAPMVGGMISSTVLTLAVIPAIYALVKQWRLTRGME"
FT   sig_peptide     complement(420961..421053)
FT                   /locus_tag="Rfer_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.850) with cleavage site probability 0.794 at
FT                   residue 31"
FT   gene            complement(421066..422679)
FT                   /locus_tag="Rfer_0412"
FT   CDS_pept        complement(421066..422679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0412"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68166"
FT                   /db_xref="GOA:Q221Y7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y7"
FT                   /protein_id="ABD68166.1"
FT                   /translation="MKQGTGIAVAVMAAVIAAGAGYWLGHKGPASQAQGTVSATAAAVD
FT                   TGAGSTSRKLLYYRNPMGLPDTSPTPKKDPMGMDYIAVYAGGADEEPAAANQVRISTEK
FT                   VQKLGVRVEAAQLRALDKSVRASGRIEPDERRVYAISPKFEGYVERLHVNVTGQAVGKG
FT                   QPLFEVYSPELVSAQREYAIAAQGVATLKDAGGQAQSGMQQLAGASLQRLRNWDISEAQ
FT                   IKALTQSGATTRTLTFRSPVSGIVMEKKAVQGMRFMPGEALYQIADLSTVWVIADVFEQ
FT                   DIGLVKNGAKATVSINAYPDKAFAGRVTYVYPTLKAETRTVAVRVELANPGLLLKPGMF
FT                   AQVELPVTAKGQVITVPVSAVIDSGTRQIVLIQQAPGRFEPREVKLGARSDTHVEVREG
FT                   VKEGEQVVVAANFLIDAESNLKAALGGLGSAAPAPATAASATAVAAPATQAAAPAKAVG
FT                   HQATGTVDGVDLKAGTVSLSHGPIASLKWPAMTMEFKTANAALLQALKPGAKVTVEFIE
FT                   RQPGEWVITSAKPADPHAGQ"
FT   sig_peptide     complement(422620..422679)
FT                   /locus_tag="Rfer_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.650 at
FT                   residue 20"
FT   gene            complement(422676..423947)
FT                   /locus_tag="Rfer_0413"
FT   CDS_pept        complement(422676..423947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0413"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68167"
FT                   /db_xref="GOA:Q221Y6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y6"
FT                   /protein_id="ABD68167.1"
FT                   /translation="MQHVLRAGAIAAVLVMAVPAGVLAGEALPGASLQTLLELAQASNP
FT                   EYTSMRFEAQAAAERVKPAGALMDPKFRIEWMDITKMGEQNPTLWPSDVGSTKYTLMQD
FT                   IPWFGKRDLKRDIAHFDAEGSQGKALGTWLELAARVKTLQAQRYYLRGNKELTQEILDL
FT                   MARLEQVAQSRYAGGLAAQQDVIRAQVEQTNMRNELVMIESESLQVDARLNALLARPAM
FT                   AALAAPESLRPLPAQSLLDAAKLEERVRNRNPQLFVEEARIQAAQKSRDLTYKNRYPDF
FT                   TLSISPTQTQTNVKEWGLMLEVNIPLQQSSRRAMEREAEAMLSAARARKEAAANQVLAE
FT                   LAQNLAAIEAARRTELLASSSLLPQADLTFSSAMASYENGKLDFATLLDAQRQIRQAKQ
FT                   SRIKAQFEGQMRLAEIEKLLGEDL"
FT   sig_peptide     complement(423873..423947)
FT                   /locus_tag="Rfer_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(423952..424608)
FT                   /locus_tag="Rfer_0414"
FT   CDS_pept        complement(423952..424608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0414"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68168"
FT                   /db_xref="GOA:Q221Y5"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y5"
FT                   /protein_id="ABD68168.1"
FT                   /translation="MKQKSIFTLAAVLLIAAFIVGAFFYKNQKTEQAAQLAAKNQTALV
FT                   RADAPSFGNADAPVHIVEFFDPACGTCREFYPLVKNLMAAHPGKIRLTMRYAPFHPGSD
FT                   QVVKVMEAARKQGQFQQTLEALFASQTVWVQNHTAHVDLIWSPLGTLGLDMERVKSDMN
FT                   SPEIARTIAQDLADAKTMNVTMTPEYFVNGKPLPSFGFEQLQTLVDEALVNTNTK"
FT   sig_peptide     complement(424540..424608)
FT                   /locus_tag="Rfer_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.828 at
FT                   residue 23"
FT   gene            complement(424605..425024)
FT                   /locus_tag="Rfer_0415"
FT   CDS_pept        complement(424605..425024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0415"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68169"
FT                   /db_xref="GOA:Q221Y4"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y4"
FT                   /protein_id="ABD68169.1"
FT                   /translation="MKTSPWTLVFGAWLIAAMATLGALFMSEIMGFAPCVLCWYQRIFM
FT                   FPLVFILAAGLFPFDPKVLRYALPLAAVGLLVAGFHLLLVAGYIPENLAPCRQGIPCST
FT                   VQVQWLGFITIPLLSFFAFLVVNALLITTYLKTPK"
FT   sig_peptide     complement(424956..425024)
FT                   /locus_tag="Rfer_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.735 at
FT                   residue 23"
FT   gene            complement(425053..425403)
FT                   /locus_tag="Rfer_0416"
FT   CDS_pept        complement(425053..425403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68170"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y3"
FT                   /protein_id="ABD68170.1"
FT                   /translation="MTTRFHSVLLLALATTGFALPAVAQTDHNMHGMPVAMPAAKTAEA
FT                   ALGEGLVKKIDKTKGTVTLAHGALPNGMPPMTMAYKVKDAAWLDKMTVGQKIRFATDPA
FT                   DGMTVSRFEPAK"
FT   sig_peptide     complement(425329..425403)
FT                   /locus_tag="Rfer_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            425835..426116
FT                   /locus_tag="Rfer_0417"
FT   CDS_pept        425835..426116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68171"
FT                   /db_xref="GOA:Q221Y2"
FT                   /db_xref="InterPro:IPR021604"
FT                   /db_xref="InterPro:IPR038644"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y2"
FT                   /protein_id="ABD68171.1"
FT                   /translation="MSIRKSLIALSLVATALSAAAAGDSDIVQSVQLKDGTTMHHYKDG
FT                   KMSMEGKNGNIVFMKEGMTMETTDGKTITMSGNEVARLYMQKKLENKK"
FT   sig_peptide     425835..425900
FT                   /locus_tag="Rfer_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.718 at
FT                   residue 22"
FT   gene            complement(426224..428674)
FT                   /locus_tag="Rfer_0418"
FT   CDS_pept        complement(426224..428674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0418"
FT                   /product="Heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68172"
FT                   /db_xref="GOA:Q221Y1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y1"
FT                   /protein_id="ABD68172.1"
FT                   /translation="MNHPVHPAASPEHPLAESGPGAGAAPPLKDPVCGMTVTAQSPHQL
FT                   VHDGRMFYFCSAKCQGKFAADPLRYLSPASPMAASPSPELLASRSPSPADATIYTCPMH
FT                   PEVRQDHPGNCPKCGMTLEPELPTLEDDENPELHDFQRRFWWTLPLTAIVFVLAMLGHR
FT                   LQWMDMAVQSWVELLIATPIVLWAGWPFFVRGWQSVVKRSPNMWTLIGLGTGAAFVYSV
FT                   VATVAPQVFPASFISMGRVAVYFEAAAVIISLTLLGQVLELKARSQTSAAIKSLLGLAP
FT                   KTARRIRADGSEEDVPLSHVHVGDVLRIRPGEKVPVDGTVTEGSSSVDESMLTGEPLPV
FT                   SKRVGDKVIGATLNTSGALVMRSERVGSSTVLAQIVQMVAQAQRSKAPMQRMADLVAGY
FT                   FVMTVVAIAALTFFAWGFFGPEPSWVFGLINAVAVLIIACPCALGLATPMSIMVATGRG
FT                   ATQGVLFRDAAAIENLRKIDTLIIDKTGTLTEGHPAFDRAVPAPGFAADEVLRLAASLD
FT                   QGSEHPLAETIVRAARERGMTLDKPEGFDSVSGIGVRGRVAGHQLALGNSTLMEQTGVP
FT                   LAPLVSQAEALRAEGASVMHLAVDGQLAGLLAVSDPIKSSTPEALATLKAAGLRIVMAT
FT                   GDGLTTARAVAARLGLDEVYGEVKPADKLILVERLQKEGRVVAMAGDGINDAPALAQAN
FT                   VGIAMGTGTDVAMNSAQVTLVKGDLRGIAIARALSNATVANMKQNLLFALLYNALGIPI
FT                   AAGVLYPLTGWLLSPLIAALAMSFSSVSVIGNALRLKRARLGGLLEPGKAKAPATPSDI
FT                   ERST"
FT   gene            complement(428717..429361)
FT                   /locus_tag="Rfer_0419"
FT   CDS_pept        complement(428717..429361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68173"
FT                   /db_xref="GOA:Q221Y0"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Y0"
FT                   /protein_id="ABD68173.1"
FT                   /translation="MNQDPAAYGLWSLVVFNSAIFIMFAYSFFKPATARDWRTFSAFSA
FT                   FIVALFVEMYGFPLTIYLFSGWLQTRYPGLDLLSHNTGHLWSTLLGEKGDPHFGPLHIA
FT                   SYVFLGFGFYLLSSAWKVLYEAQRQNVLAVTGPYARIRHPQYVAFVLIMLGFLLQWPTL
FT                   LTLAMFPILLLMYARLAITEEAQMRKQFGAEFETYAAHTPRFLPSWRRRSA"
FT   gene            complement(429358..429639)
FT                   /locus_tag="Rfer_0420"
FT   CDS_pept        complement(429358..429639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68174"
FT                   /db_xref="GOA:Q221X9"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X9"
FT                   /protein_id="ABD68174.1"
FT                   /translation="MNHLHKEHEAPHSFWASRYAIGLIVFGAVAGYFLLTEHLAHTVGA
FT                   LPYLLLLACPLMHIFMHHGHGNHGGHDSRPGDNNAEAGPVQPKPGEPS"
FT   gene            complement(429697..430179)
FT                   /locus_tag="Rfer_0421"
FT   CDS_pept        complement(429697..430179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68175"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X8"
FT                   /protein_id="ABD68175.1"
FT                   /translation="MYRISLAIRGVNQPNQESVMTHFRFIPLAAVLTSAVLLAACNTAP
FT                   TTPMGASASSMATPDHMARMDTQMKTMQAMHDRMINAKTPQERSKLMAEHMKAMQDGMA
FT                   MMGDMSSAGMGDMKGMPGMTGDMGAHHKMMAKRMEMMQMMMQMMMDRQSADMPMAK"
FT   sig_peptide     complement(430006..430179)
FT                   /locus_tag="Rfer_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.750) with cleavage site probability 0.510 at
FT                   residue 58"
FT   gene            430626..431309
FT                   /locus_tag="Rfer_0422"
FT   CDS_pept        430626..431309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0422"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68176"
FT                   /db_xref="GOA:Q221X7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X7"
FT                   /protein_id="ABD68176.1"
FT                   /translation="MKILIVEDEPKTGDYLKQGLGEAGFVVDLLRDGTDGLHHALTEDY
FT                   DLAILDVMLPGMDGWAVLAGIRKAGKDMPVLFLSARDHVDDRVKGLELGADDYLVKPFA
FT                   FSELLARVRTLLRRGGKGSSTEFLRAADLELDLLRRRVTRAGKRIDLTSKEFALLELLL
FT                   RRQDEVLPRSLIASQVWDMNFDSDTNVIEVAMRRLRAKVDDNFEPKLIRTVRGMGYVLE
FT                   SPACA"
FT   gene            431306..432694
FT                   /locus_tag="Rfer_0423"
FT   CDS_pept        431306..432694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0423"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68177"
FT                   /db_xref="GOA:Q221X6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X6"
FT                   /protein_id="ABD68177.1"
FT                   /translation="MIGRTSITRRLALLFVTASSAVLLALGFVIATSVEKHFEQQDMEV
FT                   LSGKMELARHALKTFKSQDDLDRISQLLDNSLVGHHGLELIVFGPNHALLYATPNANFP
FT                   FDMMAARAAQSPHRPMTWLLGDQTYRGIAAELPTGISERSRVVVAVALDIAHHQAFMRS
FT                   FQQTLWFFVAGAALLTGLLGWLIARRGLAPLRAMREQAQVVTAQQLSHRLQVETVPVEL
FT                   AELAQSLNDMLARLEDAFHRISDFSSDIAHELRTPVSNLMTQTQVVLSRARDADEYRSI
FT                   LESNAEEFERMARMISDMLLLAKADNGLVVPSRETLHVAAEVLALFDYYDAGAEERGLG
FT                   LSVEGDGEVSADRLMLRRALGNLLSNAVRHSTAHTTVRVRVHTDQDAVSIGMENTGDGI
FT                   AQEHLERVFDRFFRVDPSRQRSTEGTGLGLAITKSIVVAHGGTITVASIGKVTTFTIRL
FT                   PRVP"
FT   sig_peptide     431306..431401
FT                   /locus_tag="Rfer_0423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.433 at
FT                   residue 32"
FT   gene            432858..433322
FT                   /locus_tag="Rfer_0424"
FT   CDS_pept        432858..433322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68178"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X5"
FT                   /protein_id="ABD68178.1"
FT                   /translation="MKTKFAAITLVLASGLIAGTPALADVTRAQVKTELAEAIRTGDML
FT                   APGNRGLKLNELYPSRYPAKQVQASLTREQVKAELAQAIRTGDMLASGEQSRKLNELYP
FT                   SRYPAKQVQATLSREQVKAELAEAIRTGNFMISDNGQKCNEAHPSMHPSV"
FT   sig_peptide     432858..432932
FT                   /locus_tag="Rfer_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(433434..433916)
FT                   /locus_tag="Rfer_0425"
FT   CDS_pept        complement(433434..433916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68179"
FT                   /db_xref="GOA:Q221X4"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X4"
FT                   /protein_id="ABD68179.1"
FT                   /translation="MSAINSPAWLGTLRTYVVLVTLLNLGWEILQLPLYTIWSTGSHRD
FT                   IVFALLHCTAGDVLIAVCSLVFSLLMAGRQEWPDSRFKTIALITIQLGLGYTVYSEWHN
FT                   TTVTQSWAYSAAMPRLLGIGLAPVAQWLFVPGFVFWWIYRRLPVGPSTLMDSHSLK"
FT   gene            434107..434565
FT                   /locus_tag="Rfer_0426"
FT   CDS_pept        434107..434565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68180"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X3"
FT                   /protein_id="ABD68180.1"
FT                   /translation="MKYFFSSRRTRYTAAVMLFVWLMSLGIGVANACLVQHNPAKDEFL
FT                   GHTRSGYMSKATIERERALDNFAKAHVQAGENDKLPEKLACLNFCAAEQDTLVKDHADT
FT                   LVAQDIVPVLFLTWLLMPALDPIPQPEAFGSLTWSEPPVSIRYLRFTI"
FT   sig_peptide     434107..434205
FT                   /locus_tag="Rfer_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            435022..435318
FT                   /locus_tag="Rfer_0427"
FT   CDS_pept        435022..435318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0427"
FT                   /product="unusual protein kinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68181"
FT                   /db_xref="GOA:Q221X2"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X2"
FT                   /protein_id="ABD68181.1"
FT                   /translation="MLALRRDLLPTAYIEELELLHDQLPAMDIDMVRATVEAELGAPLT
FT                   KFFSAFGETPLAAATIAQVHVATLLKCSFAPRWQMSPISGYRMSSLRAREKPC"
FT   gene            435321..436244
FT                   /locus_tag="Rfer_0428"
FT   CDS_pept        435321..436244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0428"
FT                   /product="unusual protein kinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68182"
FT                   /db_xref="GOA:Q221X1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X1"
FT                   /protein_id="ABD68182.1"
FT                   /translation="MEYSPGERVDLYAKSHPQALPRVVNTLVKLMLHSIFEEGLFHADP
FT                   HPGNVFVLPDGRLSLLDFGNTGDLDEPMRESLTLLLEAVVKGDARAATEAYLEMAPASE
FT                   KVNHVALLVDIKAVLYEIRRTNLEDVSIGSAFEALLRAGSRNGVHKPGEFVLLTRAFAI
FT                   LESMIGLLAPGYNHMESFREEISRLTAQHFSPERIKDKTTKLAREMERLVTEAPGDTRR
FT                   VLRRFAEGNLGRLPGLEAVGRRFNRNLERLTGAIAFAALVIGGSMLLMTPMGGWHDTLG
FT                   NTLIISGFVGIVIIYLRALRRDLDQR"
FT   gene            436356..436691
FT                   /locus_tag="Rfer_0429"
FT   CDS_pept        436356..436691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0429"
FT                   /product="heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68183"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q221X0"
FT                   /protein_id="ABD68183.1"
FT                   /translation="MECEATLYEILEVSPHASAQVIRAAYRCLAQCNHPDKNPGSAAAS
FT                   ERQAQINFAYGVLSDPGKRRRDDQRMGAQQESDIERRGSDQAMPAHPKAMNDTPPVSRA
FT                   FVFRPFK"
FT   gene            complement(436720..437631)
FT                   /locus_tag="Rfer_0430"
FT   CDS_pept        complement(436720..437631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0430"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68184"
FT                   /db_xref="GOA:Q221W9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W9"
FT                   /protein_id="ABD68184.1"
FT                   /translation="MMNDSTSSLKVGFIGVGMMGCGMAKHVLAKGHPVALLIRKKADEE
FT                   RCADLLTHGAQPLKTAAEVAATADVIIICVTGSPQVEEVVFGDTGILQTLKPGCVVVDC
FT                   STSLPDSTRRVAQAIAAKGGQFLDAAMTGTPKHADEGKLNLLVGGDPEVLTSVRPVFAL
FT                   FAENIFYCGAVSAGHTTKLLHQFVVLGNAAILAEAFSCASKTGVNLEVLCDVIASGGAN
FT                   STAFQRFRPYVLEGNDQLFRFSLANAHKDMHYYAQMTGEAQAVSLIGDTVHNVYTMAGN
FT                   LGYKTAFVPHLLSSFNRLNGSS"
FT   gene            complement(437708..437895)
FT                   /pseudo
FT                   /locus_tag="Rfer_0431"
FT   gene            complement(437894..438148)
FT                   /pseudo
FT                   /locus_tag="Rfer_0432"
FT   gene            438300..439064
FT                   /locus_tag="Rfer_0433"
FT   CDS_pept        438300..439064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0433"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68185"
FT                   /db_xref="GOA:Q221W8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W8"
FT                   /protein_id="ABD68185.1"
FT                   /translation="MTVFAQYPSLTDRTVLITGGATSIGACLVEQFTAQGAKVGFIDID
FT                   TAAGSTLASALAGARHAPLFVHADLTDIAALESAIEKVRQHFGPINALLNNAANDRRHT
FT                   IEETTSETWDAGIAVNLKHQFFAARNVAPDMRKAGGGSIVNFGSLSWMLKQGGMPVYTT
FT                   SKSAVQGLTRSLARDFGPFNIRVNTLVPGWVMTEKQLRLWVDDAARADIARGQCINQPV
FT                   LAEHIARMALFLAADDSAMCTAQNFVVDGGWV"
FT   gene            complement(439184..440509)
FT                   /locus_tag="Rfer_0434"
FT   CDS_pept        complement(439184..440509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0434"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68186"
FT                   /db_xref="GOA:Q221W7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W7"
FT                   /protein_id="ABD68186.1"
FT                   /translation="MPLSVSASPADGGNDASGQSHVRIHVGLRGGHVIQPVLSLPRSAR
FT                   LATNVHFFLNGLAFATWGVHVPTFKHLHGLSEAEVALAMLAAGVGALVAVLWAGALVGR
FT                   FGARAVCAVSGLMTAAAVGALLQLPSYWTGVMGLFVFGVANSLFDVAMNAHAVEVEAAY
FT                   GRPIMSSCHGFFSLGGLGGAALASLLAVAGVAATTHTLWVAIGAAALTIAVVPAMLPDR
FT                   AQTSDETGYSFMRPRGVIVLLGAMAALGLVAEGAMYDWSVLYLRESLASPQALAALAYA
FT                   SFSVAMAIGRFAGDRARARLGALTLLSVGGTLAASAMLAVLLIGHPVAALAGFALVGLG
FT                   ISNVVPVLFSCASRVPGISPAHGISGVASLGYLGFLSGPPIIGAVAQVATLPVALCLVA
FT                   LFAAALAVLARRVLPIMGELGTSTDDKASRSVPVGQEPRQHG"
FT   gene            complement(440514..441404)
FT                   /locus_tag="Rfer_0435"
FT   CDS_pept        complement(440514..441404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0435"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68187"
FT                   /db_xref="GOA:Q221W6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W6"
FT                   /protein_id="ABD68187.1"
FT                   /translation="MKKNIIVTGGSGMAGKWVVKDLLDHGHQVMNLDRTVLPNSAARTM
FT                   ITDLTDAGQVFNALCSTTVRHEFSESIKPAPIDAIIHFAAIPRIMTHPDNEVFRINVMS
FT                   TYNVLDAASKYGIKKVIIASSETTYGIVFADTYRMPEYLPLDEEYPVDPMDSYAMSKVI
FT                   NEATAKAFHARTGSDIYCLRIGNVIDPVDYAKFPEYFKDPGFRRRITWSYIDARDLATA
FT                   ARLGVDKDGLGFQVMNVAADDVSSDLPTAELLKRFYPTVPVKKTLGEFETLLSNEKIKR
FT                   LLGFKQQYNWRSHVK"
FT   gene            complement(441465..442124)
FT                   /locus_tag="Rfer_0436"
FT   CDS_pept        complement(441465..442124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0436"
FT                   /product="Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68188"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W5"
FT                   /protein_id="ABD68188.1"
FT                   /translation="MRTVVVVHTGPATIQPIKQQFQQILPDVRVINIMDDSLLNDVMAA
FT                   GHLTEAVTGRIFSYMQLGQQMGAVALLNACSSVGEAASAARAAISIPIIKIDDTMAERA
FT                   VASGPRIGVVATVKTTLEPTVRLIKAKAEAAGKSVAVTEALAEGGFQALLDGKSELHDE
FT                   IVKRTIQSLAGKVDVIVLAQVSMARLVPSLTDMKVPVLSSPQSGVEAVRDALASRH"
FT   gene            complement(442155..443660)
FT                   /locus_tag="Rfer_0437"
FT   CDS_pept        complement(442155..443660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0437"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68189"
FT                   /db_xref="GOA:Q221W4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W4"
FT                   /protein_id="ABD68189.1"
FT                   /translation="MVPYLQVKNISKTFAGVKALNRVSLHVASGEVLAIAGENGAGKST
FT                   LMKIMTGVYQPDPGGEIWINGVLVPHLTGTAHARQLGVCIIYQELSVVDNLTIAENIFL
FT                   SKEISNRLGFLDRRAMHAATRQLLDSLDMQLDAGTRVGDLSIGQKQMVEIAKAISNQSK
FT                   IVIMDEPTASLSHHEAMVLKEIIRKLRSEGIGIIYITHRLEEIFDLADRVTVLRDGACV
FT                   ATLPVEQLDRARLVKMMVDREQSDLYGDYQCHATQKVALEAKGLTLKHRTAHTVSVRDC
FT                   SFRVHEGEILGFFGLVGAGRTELMEMVFGLRPYHGTIELGGQPVAIHSPRAAIDHGLGF
FT                   VTEDRKSGGLVLGMNIRENFSLTHLDTYSTLSFISRLAETFGCQKFVLRLGIKTPSVEQ
FT                   TVGNLSGGNQQKVVIAKWVARSPKVLIVDEPTRGIDIAAKADVHRLLQELASRGMAVIV
FT                   VSSDLPEVLAISDRVIVLREGAITAKLSRQQATQHVVMEAAAA"
FT   gene            complement(443711..444706)
FT                   /locus_tag="Rfer_0438"
FT   CDS_pept        complement(443711..444706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0438"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68190"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W3"
FT                   /protein_id="ABD68190.1"
FT                   /translation="MLQKAFIFNLHTKRDIMKKLPPLFQFALLAIPLTLAVQMNATAKD
FT                   VKDLRIAVIPKVAVPFFDDCNNGAKAAADKLGVQYQWVVPQNTQGSTQVRILEDLISKK
FT                   VDGIAISVNEPKSVEAAIKKAVASGIKVVTFDSDSANSGRSMYIGTINSAAGETMGESM
FT                   AKAIDGEGEVAILTGQLGAANLNERITGIKKSLSKYPKIKVVATEGTEDDLAKAVSTTE
FT                   SLFRGHPALKGIFGVSQVGGPAVSKVMATKEFGSKKGAVKVFAFDDLPDTVKGVKEGYI
FT                   QGIMVQRPVTMGKLAVEHLVDQITGKEPAPKDVDTGVNVVTSQNLGSYTK"
FT   sig_peptide     complement(444575..444706)
FT                   /locus_tag="Rfer_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.990 at
FT                   residue 44"
FT   gene            complement(444751..445749)
FT                   /locus_tag="Rfer_0439"
FT   CDS_pept        complement(444751..445749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0439"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68191"
FT                   /db_xref="GOA:Q221W2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W2"
FT                   /protein_id="ABD68191.1"
FT                   /translation="MDVGLTQPNRRTAPSLGRTLLDLFRAKEMSVLLAVILVGGGIAMV
FT                   TPYFLTTDNLMGVFRSFSLTAIMSIGMVMVIITGGIDLSVGSVMGLSGLVTALAFQNGF
FT                   STVVSVSCGLGVGFLFGLTNGLLVTAGRLPPFIATLGTLSIGRGLMYIVTKGVPATPET
FT                   PEAFSVIGQGYIGSVPAPVIIMLVLALIFSVIMTFTTFGRHVYATGGNEQAAWLSGVNT
FT                   SRIKLTVYTLSGTISALAGIVAFSRYLSAEPASGFGVELDVIAAAAIGGASLAGGVGSV
FT                   MGAILGAALTGIIANGVVLMNINTYAQQAITGAVILIAVSIDVWRNARKER"
FT   gene            complement(446021..447088)
FT                   /locus_tag="Rfer_0440"
FT   CDS_pept        complement(446021..447088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0440"
FT                   /product="Tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68192"
FT                   /db_xref="GOA:Q221W1"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W1"
FT                   /protein_id="ABD68192.1"
FT                   /translation="MKTYEIACIPGDGIGKEIVPAGQTVLAALAASRNTFKFEFENFGW
FT                   GGDWYRRHGEMMPANGLDALRNKDAILFGSAGDPDILDHITLWGLRLKICQGFDQYANV
FT                   RPTRILPGIDAPLKRCTPEDLNWVIVRENSEGEYAGVGGRVHQGHPLEVATDLSVMTRA
FT                   GVERIMRYAFKLAQSRPRKLLTVVTKSNAQRHAMVMWDEIAAQISKEFPDVKWDKELVD
FT                   AATARMVNRPATLDTLVATNLHADILSDLAAALAGSLGIAPTGNIDPERRYPSMFEPIH
FT                   GSAFDIMGKGLANPVGTFWSCVMLLEHLGEEAAAAQLMAVIEQVTADPALHTRDLGGSA
FT                   TTAEVTQAVCARIAA"
FT   gene            447187..448128
FT                   /locus_tag="Rfer_0441"
FT   CDS_pept        447187..448128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68193"
FT                   /db_xref="GOA:Q221W0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q221W0"
FT                   /protein_id="ABD68193.1"
FT                   /translation="MPTPASAPSEMAFFSLLVRSGSFSAAARELDITTPAVSKRLAQME
FT                   ARLGVQLLNRTTRRIGLTPEGEVYLEHARRILADIGDMEQLVSNSVAAPKGLLRVNATL
FT                   GFGRSHIAPLISDFAKRYPEVQIQLQLTVNPPSLTEDAFDVCIRFGEPPDARMIARRIA
FT                   SNRRLICAAPAYLTRQGTPQVPNDLAQHNCICIRQGEEAYGIWHLRSGQRSETVKVRGT
FT                   LSTNDGEIAVNWALAGHGLIMRAEWDIAKYLASGRLRQVLANWQTPGADIHAVYPQSLQ
FT                   TAARVRAFVDFVVNAFSASNPLGQVLQEEISS"
FT   sig_peptide     447187..447270
FT                   /locus_tag="Rfer_0441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.834) with cleavage site probability 0.818 at
FT                   residue 28"
FT   gene            448413..449267
FT                   /locus_tag="Rfer_0442"
FT   CDS_pept        448413..449267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0442"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68194"
FT                   /db_xref="GOA:Q221V9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V9"
FT                   /protein_id="ABD68194.1"
FT                   /translation="MTHAALTSGSVAVITGGAAGIGLAAAKRMAQLGLRVCIADLGTDR
FT                   LIRAAQEVVLLAAGGTDDVMTLETDVSRVEDLRRLEEVVRDRFGGTDILMNNAGIQPGS
FT                   AMFGPAGNWERVLDVNLWGVIHSTQIFVPAMIKRGRPGLVINTGSKQGITTPPGDPAYN
FT                   VSKAGLKAFTEALQHELRNTPNCRINAHLLIPGFVFTDLTAQGRTEKPAGAWTPEQTVD
FT                   FMMERLEAGDFYILCPDNDVPRSLDERRILWAAGDVVENRPPLSRWHPDYAKAFEAFSQ
FT                   KKS"
FT   sig_peptide     448413..448487
FT                   /locus_tag="Rfer_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.556 at
FT                   residue 25"
FT   gene            complement(449277..450074)
FT                   /locus_tag="Rfer_0443"
FT   CDS_pept        complement(449277..450074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0443"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68195"
FT                   /db_xref="GOA:Q221V8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V8"
FT                   /protein_id="ABD68195.1"
FT                   /translation="MPKFAANLSMLYPELDFLDRFAAAAQDGFKAVEYLFPYAYKSREI
FT                   AARLRAHGLQQVLFNAPPGDWDAGERGLACLPGREAEFRAGIGKALDYAAALDCPRVHV
FT                   MAGLLPAGSERATLRPTYVSQLRWAALEAAKQGVDVLIEPINTRDIPGFYLNRQDDAHA
FT                   LLAEVGEPNLKVQMDLYHCQIVEGDLAMKMRQYLPSGNVGHVQIAGVPQRHEPDLGELN
FT                   YPYLFSVLDELGYTGWVGCEYRPQAGMKPGGTSAGLGWLKPYL"
FT   gene            complement(450080..450754)
FT                   /locus_tag="Rfer_0444"
FT   CDS_pept        complement(450080..450754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0444"
FT                   /product="class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68196"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V7"
FT                   /protein_id="ABD68196.1"
FT                   /translation="MNENEAREEICRVGRSLFERGYVHATAGNISVRLDESEGGGFLIT
FT                   PTDACLGFLDPARLARLDAQAQQLSGDKASKTIALHSHIYRATAQFDPNTRCVIHTHST
FT                   HCVALTLQPGNKELLPAVTPYFVMKVGHVPVIAYHRPGAPEAAQLVAQAISRYGQAGTP
FT                   IRAVMLERLGPNVWHDSPAAAMATLEELEETARLGSLSALAPEPLTESQIDELRQTFGA
FT                   RW"
FT   gene            complement(450751..452022)
FT                   /locus_tag="Rfer_0445"
FT   CDS_pept        complement(450751..452022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0445"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68197"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V6"
FT                   /protein_id="ABD68197.1"
FT                   /translation="MKKILLGCIADDFTGATDLANNLVRAGLRVVQAMGVPAQPLDADA
FT                   DAVVVALKSRTLPVDEAIAQSLAALRWLQAQGAQQIYFKYCSTFDSTAQGNIGPVAEAL
FT                   MDALGTDFTIATPAFPDNQRTVFKGHLFVGDVLLNESGMQNHPLTPMTDANLVRVLQGQ
FT                   CRRPVGLIDYKVVAQGEAAIRTRIDQLRAQGVGLAVVDAISNDDLLRLGAALSDMPLVT
FT                   GGSGVAIGLPANFGIAPSSTASALPRATGLQAVVSGSCSLATNRQVLAFIQAGRPALGI
FT                   DALQIAAGVDVTTQALAWAAPLLSQGPVLIYSTADANAVKAVQAQLGVEEAGAMVERTL
FT                   AAIALGLVALGVRQLVVAGGETSGACVQALNITQMKIGPQIDPGVPWCHAQADAAPGAG
FT                   LHLTLKSGNFGADDFFSKAFALLA"
FT   gene            complement(452019..452909)
FT                   /locus_tag="Rfer_0446"
FT   CDS_pept        complement(452019..452909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0446"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68198"
FT                   /db_xref="GOA:Q221V5"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V5"
FT                   /protein_id="ABD68198.1"
FT                   /translation="MTTNVGVIGLGAMGSGMARSLRRRGSQVHVFDVRAEAAQAFAADG
FT                   GVACASAAELAAQCSVIVSVVVNAAQTESVLFGEGGCAAAMKRGSVFVMCSTVDPNWSI
FT                   ALEARLAALGIFYIDAPISGGAAKAASGEMTMMTAGKPEAYAAVGPLLDAMAAKVYRLG
FT                   EQAGAGSKVKIINQLLAGVHIAAAAEAMALGLREGVDAKALYEVITHSAGNSWMFENRM
FT                   AHVLSGDYTPLSAVDIFVKDLGLVLDVARASKFPLPLSSTAHQMFMQASTAGFAREDDS
FT                   AVIKIFPGIELPKKS"
FT   gene            complement(453032..453826)
FT                   /locus_tag="Rfer_0447"
FT   CDS_pept        complement(453032..453826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0447"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68199"
FT                   /db_xref="GOA:Q221V4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V4"
FT                   /protein_id="ABD68199.1"
FT                   /translation="MNLTPPMTAQFKPITPGAYLSDQVADALAAEIRAGRLAVGAKLPT
FT                   EAALVEQFAVSRTVVREAVSRLKSLGLVDSRQGSGVYVKEVGFSPLNFDAKSTVSRQAV
FT                   IQMVEVRRALEAEVAGLAAQRRTQADIKRIGKSIALLDKAVQAGGDGVDEDVQYHRAIA
FT                   EAARNPFLIGTLEYLGQFLRGATRVTRANEARRADFARQVSAEHDKILRAIEAGDAAAA
FT                   RKAAARHMDNAILRIEQADPAFWQQAGVQLARPLVFGLPPRS"
FT   gene            complement(453878..455155)
FT                   /locus_tag="Rfer_0448"
FT   CDS_pept        complement(453878..455155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0448"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68200"
FT                   /db_xref="GOA:Q221V3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V3"
FT                   /protein_id="ABD68200.1"
FT                   /translation="MTAVMLSTMVLCFALTISVAVSIGLASILGIQASNAHMLISVKEM
FT                   FNAINKFPLAAIPFFILAGNIMETGGISRRLVDFAKSLVGGVQGGLPMTCVLTCMIFAS
FT                   VSGSSVATTFAIGTILIPALIKHGYPTTWAAALQATSAELGVIIPPSIPMILYGVSAEV
FT                   SIGELFIAGFGPGFFISGALMLFVWGYCKYKGWGKNDGDGRLSVGKATWKAGWALLMPV
FT                   IILGGIYGGIFTPTEASAVAVFYALMVGLVIYREIKFPDLYNILRKSVLSSAVIMFIIA
FT                   NAGLFAFLITRAGVPEAIGLWLQDVLKTPAYFLLGVNAALFVIGMFIETGAAIIVLAPI
FT                   LAPVAIHFGIDPVHFGLVMVVNLALGMITPPFGVNLFAACTVARISLDRMIKDLIPFVL
FT                   VVLACLMVISYVPALSLGLRDLVYAR"
FT   sig_peptide     complement(455045..455155)
FT                   /locus_tag="Rfer_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.391 at
FT                   residue 37"
FT   gene            complement(455152..455646)
FT                   /locus_tag="Rfer_0449"
FT   CDS_pept        complement(455152..455646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0449"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68201"
FT                   /db_xref="GOA:Q221V2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V2"
FT                   /protein_id="ABD68201.1"
FT                   /translation="MKENFLRLERWTSGLSLYTACAMLMLAASLAMFQIVTRFVLEIPA
FT                   EWTEVLIRFSLIWMVFLGIPTAFRQGAMVSVDVLYRWSPPRIRRLLDWIVCLAAAGLIC
FT                   IIIWWGWDYAVRGRVQSMAGLESLSMFWAYLAMPVGGVFSLIGIFGNLLDTQRLELETA
FT                   V"
FT   sig_peptide     complement(455551..455646)
FT                   /locus_tag="Rfer_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.682 at
FT                   residue 32"
FT   gene            complement(455735..456706)
FT                   /locus_tag="Rfer_0450"
FT   CDS_pept        complement(455735..456706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0450"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68202"
FT                   /db_xref="GOA:Q221V1"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V1"
FT                   /protein_id="ABD68202.1"
FT                   /translation="MKLRKLVIGLSLALGLAATAAAQTVMKINIAIAQNSHQGIAIDTF
FT                   AKEVGTQTNGRYKIETFYNASLGSERESIEAVQLGTQELTFTSTGPVPNFVPEAKILDV
FT                   PFLFRDKAHARAVLDGPIGQDMLAKFDSKGFKALAWGENGMRNMTNSKHTIKTPDDLKG
FT                   LKIRTMENPVHVAAYKGLGIVTTPMAMAEVFTALQQGTVDGQENPLSVIMAAKLDQVQK
FT                   YVSLTGHVYSPAIFLMNKAAFDKLSPADQKVFLEAAKVAVKANRARVDADDAMGVTYLR
FT                   GKGMEVTESLDKSKFVAKLAPVYADFEKQFGKANMDKIRNYK"
FT   sig_peptide     complement(456638..456706)
FT                   /locus_tag="Rfer_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.651 at
FT                   residue 23"
FT   gene            complement(456764..457819)
FT                   /locus_tag="Rfer_0451"
FT   CDS_pept        complement(456764..457819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0451"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68203"
FT                   /db_xref="GOA:Q221V0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221V0"
FT                   /protein_id="ABD68203.1"
FT                   /translation="MLKPSAQATGPCHIVITGGAGFLGVRLARTLLAQGQLSLAGAAPV
FT                   EIARITLVDRAAPPNDLMADARVSALTGDLNELLEDKSAAAPVVAKDTAIVFHLAAAVS
FT                   GECEANFDLGMRSNFAATLALLGACRALQTKPILVFASSLAVFGDTPEQPLPSAIEDNT
FT                   LPTPQSSYGIQKFIGEQLVADYTRKGFVQGRSVRLMTVSVRPGTPNGAASSFLSGMLRE
FT                   PLAGVRATCPVPADTPVALSSPARTIQGLIRAAEASDQAWGPRTALTLPALTTTPGEMA
FT                   AALERVAGTAATALIDWTPDPAICNIVKTWPARIHAVRASGLGLLPEDSFDDIIREYIR
FT                   ENTYAIKLPVR"
FT   gene            complement(457845..459287)
FT                   /locus_tag="Rfer_0452"
FT   CDS_pept        complement(457845..459287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0452"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68204"
FT                   /db_xref="GOA:Q221U9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U9"
FT                   /protein_id="ABD68204.1"
FT                   /translation="MAIQKHDNLINGQWVVGAHYAPNINPSNIADVIGDYTQADAAQLD
FT                   AAVKAAQAALPAWSTGNIQARADALDKIGTEILARREELGTLLAREEGKTLPEGIGEVS
FT                   RAGNIFKFFAGECLRLSGEIVPSVRSGVSVEITREPVGVIGLITPWNFPIAIPAWKTAP
FT                   ALAYGNCVVLKPADLVPGCAWALAEIISRSGIPAGVFNLVMGRGSVIGDPLVNHPGINA
FT                   ISFTGSQGVGNRIAQQCAANLKKVQLEMGGKNPQVILDDADLAQAVELSVQSAFFSTGQ
FT                   RCTAASRLIVTDGIYPKFLGAMKQRMAGLKIGDALGAGIDIGPVSSRAQLEQDLSYVEI
FT                   GKAEGGLLVAGGERLKLSAEGFYLAPALLTDTTAAMRINREEVFGPVASIIRVKGYEEA
FT                   LREANNTPYGLSSGIATTSLKYASHFKRHSQAGMVMVNLPTAGVDYHVPFGGRKGSSYG
FT                   SREQGRYAQEFFTTVKTTYIAS"
FT   gene            complement(459314..460243)
FT                   /locus_tag="Rfer_0453"
FT   CDS_pept        complement(459314..460243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0453"
FT                   /product="2-dehydro-3-deoxy-L-arabinonate dehydratase"
FT                   /EC_number="4.2.1.43"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68205"
FT                   /db_xref="GOA:Q221U8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U8"
FT                   /protein_id="ABD68205.1"
FT                   /translation="MTQTNQARFKGVFPVVPTTFFENGELDLASQKRCVDFMIDAGSNG
FT                   LCLLANFSEQFLLSDDERDVLTRTMLEHVAGRVPVIVTTTHFSTQVCAQRSRRAEDLGA
FT                   AMVMVMPPYHGATFRVSEERIYEFYAGLSDAIDIPIMIQDAPASGTVLSAAFLARMATE
FT                   IKQVAYFKIETAGAASKLRELIRLGGAAIEGPWDGEEAITLLPDLDAGATGAMTGGAYP
FT                   DGIRLIVDAYCAGRREEAIAHYQQWLPLINYENRQGGILSAKALMKEGGVIACEAPRHP
FT                   WPSMHPAVRAGLIETAQRLNPMVLRWGK"
FT   gene            complement(460260..461288)
FT                   /locus_tag="Rfer_0454"
FT   CDS_pept        complement(460260..461288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0454"
FT                   /product="pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68206"
FT                   /db_xref="GOA:Q221U7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221U7"
FT                   /protein_id="ABD68206.1"
FT                   /translation="MTVKGKRITVHDMTLRDGMHPKRHQMTLDQMKAVATGLDAAGVPL
FT                   IEVTHGDGLGGASVNYGFPAHTDEEYLGTVIPLLKLAKVSALLIPGIGTVDHLRMAKDL
FT                   GVHTIRVATHCTEADVSEQHISLARQLEMDTVGFLMMAHKADSQRLISQARLMESYGAN
FT                   CIYITDSAGYMLPAEVKEKTSAVRAALRPETELGFHGHHNLAMGVANSVVAVESGATRI
FT                   DAAAAGLGAGAGNTPMEVFIAVCNRMGIATGVDLFKMQDVAEDIVVPMMDHPIRIDRDA
FT                   LILGYAGVYSSFLLFAKRAEKKYGVSAREILIELGRRGMVGGQEDMIEDAAMTMAKARG
FT                   PI"
FT   gene            complement(461303..462223)
FT                   /locus_tag="Rfer_0455"
FT   CDS_pept        complement(461303..462223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0455"
FT                   /product="Semialdehyde dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68207"
FT                   /db_xref="GOA:Q221U6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221U6"
FT                   /protein_id="ABD68207.1"
FT                   /translation="MSKKIKCALIGPGNIGTDLLYKLRRSPVLDPVWMVGVDPTSEGLK
FT                   RARELGLKTTEQGVDGLLPHVLADGVQIAFDATSAYVHAENSRRLTELGVLVIDLTPAA
FT                   IGPFCVPPVNLLALVGRRVMNVNMVTCGGQATIPMIAAISRVQPVRYGEIVATISSKSA
FT                   GPGTRKNIDEFTRTTSRAIEQVGGAAKGKAIIIINPAEPPLVMRDTVHCLTETEPDQAK
FT                   ITASIHAMIKEVQKYVPGYKLVNGPVFDDKRVSVFLEVEGLGDFLPKYSGNLDIMTAAA
FT                   ARTAEMFAEEILAGRINLQPMATVA"
FT   gene            complement(462257..463996)
FT                   /locus_tag="Rfer_0456"
FT   CDS_pept        complement(462257..463996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0456"
FT                   /product="L-arabinonate dehydratase"
FT                   /EC_number="4.2.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68208"
FT                   /db_xref="GOA:Q221U5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U5"
FT                   /protein_id="ABD68208.1"
FT                   /translation="MSTPPKRVLRSAAWFGAADKNGFMYRSWMKNQGIPDHEFQGKPII
FT                   GICNTWSELTPCNAHFRKIAEHVKRGISEAGGFPVEFPVFSNGESNLRPTAMLTRNLAS
FT                   MDVEESIRGNPMDAVVLLVGCDKTTPALLMGAASCDIPTIVVTGGPMLNGKHEGRDIGS
FT                   GTVVWQLHEAVKAGKISLNEFMSAEAGMSRSAGTCNTMGTASTMACMAEALGTSLPHNA
FT                   AIPAVDARRYVLAHMSGMRIVDMVWEDLKLSKILTREAFENAIRVNAAVGGSTNAAIHL
FT                   KAIAARIGVPLELDDWTTVGKGTPTLVDLQPSGRFLMEDFYYAGGLPAVLRRMGEGGLL
FT                   PHKDALTVNGKSIWENVLDAPIHNPEVIRPLDKPLVADGSICVLRGNLAPRGAVLKPSA
FT                   ATPALMKHRGKAVVFEDIDHYKARIGDPDLEIDADSVMVLKNCGPKGYPGMAEVGNMGL
FT                   PPKLLAQGITDMVRISDARMSGTAYGTVVLHVAPEAAAGGPLAIVRDGDWIALDSYAGK
FT                   LDLEISEAEIAQRQAELQAKPAAPAKGGYQQLYIDRVLQADEGCDFDFLVGCRGAEVPR
FT                   HSH"
FT   gene            464120..465106
FT                   /locus_tag="Rfer_0457"
FT   CDS_pept        464120..465106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0457"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68209"
FT                   /db_xref="GOA:Q221U4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U4"
FT                   /protein_id="ABD68209.1"
FT                   /translation="MSAEYPATDTSRPMNDHDPDAARRTRTKLKTRQMFLLLALDEARN
FT                   LHQAAKETNMSQPAASKMLKDIEELFGVPFFDRLPRGVRPTLYGETMIRHVRMALTNLS
FT                   QGQDSIATLQAGLSGQVDIGVIITPSTTLVPQAIARTKQEAPRLCIGVEVGTSNELVER
FT                   LKRGQLDFLIARIREQEDDLDLLYEDLSEETECAVARVGHPLLARSDLGLNDLAAAGWI
FT                   LSPRGSILRHRFDMMFRRIELETPANVVEATAISVITSLLQQTDFLHVMPLEVARYYVR
FT                   CSELAILPIELPCKMDSFGVIARRDQLLSPGAKLLLQHLRTIAAEIY"
FT   gene            complement(465204..468317)
FT                   /locus_tag="Rfer_0458"
FT   CDS_pept        complement(465204..468317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0458"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68210"
FT                   /db_xref="GOA:Q221U3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U3"
FT                   /protein_id="ABD68210.1"
FT                   /translation="MQPFQQGRFVMPILAKPMRPALVGIVVFLLAGLVAGGLVYRSEQH
FT                   RRQLAQSRALAMAADHAQSLQQNLQQALGPAQFEQVVARGYDYVLWRIDPASQQRQIIA
FT                   QSAKVPLDAVDFELKVPNAKWTLSVAPTTGWADPQGLSLKVALAALFSVLLAYSAKQAG
FT                   AARVRANELQVDVNAQAVELVALNQRLQSTLDALPDLLFETDMDGRYLAYHSPRSELLG
FT                   KTLHRVLPVAVADICLAAVHEANAVGYSHGKQIQLALPDGAHWFELSASRKPGLPGDAP
FT                   TFIVLSRDITERKKAEIKIERLTKLYAALSQCNQAIVRCSDASELFPIICRDAVNFGGM
FT                   KMAWIGMLDEADQLIKPAASFGSGVEYLEGIEISVDLSGDKGRGPTGTSIREDRPFWCQ
FT                   DFQHDDATAAWHERGERFGWGASASLPLHLKDRVIGAFTLYAGEACAFDEAAQNLLLEM
FT                   ALDISFALDRFADERERKIMQDDLRDSEERYRKAFQTSPDAVNITRLVDGLYVDVNTGF
FT                   ERITGWRHDEVVGKTATELNLWGNPADRMRLVDALQSEGRCNNLEATFVKKNGDIFHGL
FT                   MSAEKVRFKDVDCILSITRDITEKKLAEAQIQQLAHFDQLTGLPNRSQLHDRFRYALSL
FT                   AQRHGDQLAIMFLDLDHFKNINDTLGHSVGDQLLVDVSRRLKAALREEDSLSRLGGDEF
FT                   ILLLPGTDEAQASQVATKLLAAVAQPCQIEQNELVSTVSIGIALYPNDGQDFETLSKNA
FT                   DAAMYRVKQASRNDFRFFTQEMQTHSARTLQLVNALRHALPRHEFELHFQPQVALQDGH
FT                   IVGAEALLRWRHPELGMISPAEFIPIAEDSGQILAIGEWVLRTAVRQLKQWLDAGLRPM
FT                   VIAVNLSAVQFRHPNLMALVTRILDEAALPPEFLELELTEAAAMDDPPAAIAIMNKLDE
FT                   HGIRMSIDDFGTGYSSLSYLKKFKVNKLKIDQSFVRDISDDPDDKAIVTAIINLASSLG
FT                   MHTIAEGVETASQLAFLRLQGCDEVQGYYVSKPLPKDQFEAFVRNSIS"
FT   gene            complement(468409..470265)
FT                   /locus_tag="Rfer_0459"
FT   CDS_pept        complement(468409..470265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0459"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68211"
FT                   /db_xref="GOA:Q221U2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U2"
FT                   /protein_id="ABD68211.1"
FT                   /translation="MILSIHLILQEVFGYDAFRGPQQAIIEHVVAGGDALVLMPTGGGK
FT                   SLCYQIPAIAREQAGQGITVVISPLIALMHDQVGALHEAGIKAEFLNSTLSGEQATQVE
FT                   RRLLRGDITLLYAAPERVTTPRFLAQLDSLYERGKLSLFAIDEAHCVSQWGHDFRPEYR
FT                   ALTVLHERYGSVPRIALTATADALTRADIVERLQLQDARLFISSFDRPNISYTIVEKRD
FT                   ATQQLLRFITSEHMGDAGIVYCQSRKRVEDIANLLCDEGIAALPYHAGLEAKVRQANQD
FT                   QFLRSEGIVMVATIAFGMGIDKPDVRFVAHLDMPKNIEGYYQETGRAGRDGQAAQAWMC
FT                   YGLQDVVNQRRMIDESPAGEEFKQGLRGKLDALLGLAEATDCRRVRLLHYFDEESKACG
FT                   NCDNCLHPPAVWDGTDAARKLLSTIYRVQQMGGSYGAVHIMDILRGKSTEKVTQRGHET
FT                   LSTFGIGADLSEVQLRGVLRQLIAIGAVAVDAQAFNTLQLTDASRAVLRGEVPVQLRAS
FT                   VSSPAERKAKRSSAVHAGSVGKTPIALDAAAQTRYTALKAWRGEVAKEHNLPAYVIFHD
FT                   ATLAAIAERAPLSLDDLQGISGIGAKKLEAYGEEVLRVMVSV"
FT   gene            470422..471468
FT                   /locus_tag="Rfer_0460"
FT   CDS_pept        470422..471468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0460"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68212"
FT                   /db_xref="GOA:Q221U1"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U1"
FT                   /protein_id="ABD68212.1"
FT                   /translation="MKALHYTRGQKLPEILQHRIMVLDGAMGTMIQRFKLGEAQYRGER
FT                   FKDFHKDVKGNNELLSLTRPDVITDIHERYLAAGADMIETNTFGATRVAQADYDMADLA
FT                   FEMNLASAKLARAACDKFSTPDKPRFVLGALGPTPKTASISPDVNDPGARNVTFEQLRA
FT                   AYYEQVEALVQGGADALLVETIFDTLNAKAALFAIDEFFEASGQQLPIIISGTVTDASG
FT                   RILSGQTVTAFWHSVRHAQPLAVGLNCALGAALMRPYIQELAKAAPDTFISCYPNAGLP
FT                   NPMSDTGFDETPADTSRLIGEFAAEGLVNIVGGCCGTTPEHIGAIHDKVAPLAGRVLQR
FT                   NVFYPEAA"
FT   gene            471491..472396
FT                   /locus_tag="Rfer_0461"
FT   CDS_pept        471491..472396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0461"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68213"
FT                   /db_xref="GOA:Q221U0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q221U0"
FT                   /protein_id="ABD68213.1"
FT                   /translation="MPAPDLSKGVAFVRGQYVPIGEASIPITDWGFLRSDATYDVVTVW
FT                   DGSFFRLDAHLERFMRSCQRWRLDPGLTPGQITGVLSQCVRLSGLRASYVEMICTRGQP
FT                   PWGSRDPRLAVNQFYAFAVPYVWLANAQQREAGLHLMISDVQRIPATSVDPSAKNYHWN
FT                   DLTMGLLGALDAGADSVVLVDSVGNVVEGPGFNVFCVSHGALVTPSEGMLEGVSRRTVI
FT                   EMARALGLETQLRALPADELRGAEEVFISTSGGGVLPVSRVDKRPVGDGRPGPITQRLV
FT                   QTYWAWHADPVYSQPIDYSL"
FT   gene            472859..473620
FT                   /locus_tag="Rfer_0462"
FT   CDS_pept        472859..473620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0462"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68214"
FT                   /db_xref="GOA:Q221T9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T9"
FT                   /protein_id="ABD68214.1"
FT                   /translation="MNQRTLKDLLYEQVARIGKAVSSPKRLELLELLAQGEKTVDVMAT
FT                   ELSADIKLISAHLKALRDARLVTSRRDGKYVVYRLTGGDVAGLLVTLREVAEEHLLELR
FT                   LALDQMVADPARLASVGREALLEQARRGDVVVIDVRPLAEYEAAHLPFARSMPMAEIEK
FT                   RLAELPFDKDIVAYCRGPFCLLSDEAVVLLAAKGYRVRKILDGVSEWQAAGLPVQASAG
FT                   EPSQPRTGITPQEPVRKNFNPLQSTIKPGGQ"
FT   gene            473622..473975
FT                   /locus_tag="Rfer_0463"
FT   CDS_pept        473622..473975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0463"
FT                   /product="DsrE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68215"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T8"
FT                   /protein_id="ABD68215.1"
FT                   /translation="MVKYLFILNDPPYGTERSYNGLRLARSLLKAGDAEVKLFLIGDAA
FT                   ACAKAGQKVPQGYYNLGDMLGMIERAGGAIGVCGSCIDARGISETDLVKGASRSSMDEL
FT                   AAWTQWSDKVLVF"
FT   gene            474022..474159
FT                   /locus_tag="Rfer_0464"
FT   CDS_pept        474022..474159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0464"
FT                   /product="cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68216"
FT                   /db_xref="GOA:Q221T7"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T7"
FT                   /protein_id="ABD68216.1"
FT                   /translation="MNQLIYLDYNATTPVAPEVLEATLPFLRVHFGNPSSARPFGRISA
FT                   "
FT   gene            474592..475233
FT                   /locus_tag="Rfer_0465"
FT   CDS_pept        474592..475233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0465"
FT                   /product="protein of unknown function DUF1555"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68217"
FT                   /db_xref="GOA:Q221T6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T6"
FT                   /protein_id="ABD68217.1"
FT                   /translation="MKLNFARCTFAHSMKTMGCVAALFLGLLGVAPSSSATVLTATDAS
FT                   WKVTAGDLGPSGWNGNAIFNDSGWASATELSPWPGYVAKVIWSGGGQFSQSETQIWARG
FT                   IFNLSALPLSAVLNNGFDDDGDIYVNGNLVVSDHNGFANNSFADITSHLVIGDNLIAFT
FT                   AIDNYLQWGYNHGAAVQVDATFAQVPEPMSLALLGLGLAGLAFVRRRAKI"
FT   sig_peptide     474592..474702
FT                   /locus_tag="Rfer_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.580 at
FT                   residue 37"
FT   gene            475587..478484
FT                   /locus_tag="Rfer_0466"
FT   CDS_pept        475587..478484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0466"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68218"
FT                   /db_xref="GOA:Q221T5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T5"
FT                   /protein_id="ABD68218.1"
FT                   /translation="MSEIIAPSMKLSGLEPLTIGLALSADAPSPSAGDRAEDLSPIASF
FT                   VNIGERTNVTGSKAFARMILNGEFDQALSVARQQVENGAQIIDINMDEAMLDSQAAMVK
FT                   FLNLIASEPDISRVPVMIDSSKWSVIEAGLRCVQGKPVVNSISMKEGVDAFKHQAKLLR
FT                   RYGAAAVVMAFDEQGQADTYERKIGICERAYRILVDEVGFPPEDIIFDPNIFAIATGIE
FT                   EHNNYAVDFINATRWIKQHLPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIKAGM
FT                   DMGIVNAGMVGVYDDLEPELRERVEDVVLNRRPDAGERLVEIAETAKSGAKDESKKLEW
FT                   RGTPEHPVSVEQRLSHAMVHGITDFIVPDTEEAYQAILAKGGRPLHVIEGPLMAGMSIV
FT                   GDLFGQGKMFLPQVVKSARVMKQAVAHLIPYIEEEKRLDEAAGRDVATKGKIIIATVKG
FT                   DVHDIGKNIVTVVLQCNNFDVVNMGVMVPCHEILARAKVEGADIIGLSGLITPSLEEMA
FT                   YVAGEMQKDDYFRIKKIPLLIGGATTSRVHTAVKVAPHYAGPVVYVPDASRSVGVVQNL
FT                   LGDAASGFVAELNTDYERVRQQHANKKQIPLWPLAKARANKTPVDWSAYQPTTPKFIGR
FT                   RVFKNFDLGELAGFIDWGPFFQTWDLAGPFPAILDDEVVGVEAKKIYADGQAMLKKIIE
FT                   GRWLTANGVLGLYPANTVNDDDIELYTDETRSTVAMTWYGLRQQAAKEEIDGVMRPSRC
FT                   LADFVAPKIATENIASDAMKTGATGQKGLNKPGNAETVIPAQASIRDYIGVFAVTAGIG
FT                   IEKKEAQFLAAHDDYSAILLKSLADRLAEAFAECLHKKVRTDLWGYAPDEALPAKDLIA
FT                   EKYQGIRPAPGYPACPDHSVKKDMFELLQCGDIGMGVTESLAMTPAASVSGFYIGHPDS
FT                   TYFSVGKIGDDQLKDLAMRRGMDEKALQRLLAPNL"
FT   gene            complement(478488..479699)
FT                   /locus_tag="Rfer_0467"
FT   CDS_pept        complement(478488..479699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0467"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68219"
FT                   /db_xref="GOA:Q221T4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T4"
FT                   /protein_id="ABD68219.1"
FT                   /translation="MQAPPPINLRLVGWLSLAQLISWGSIFYTFALVMAPVERDLGLSR
FT                   AESSLAFSLALLVEGLLAYPVGRWIDRGHERIVMTGGSVLAGVCLLLQGSVTGMVGFYA
FT                   VWAGLGAAMAAVLYAPAFAVVTRRFPLDFRRAIILMTFLGGLASTVFIPLTAWLMALWG
FT                   WRHAFIALAALHLLVCAPLHALALRGAPRPSPRVAAADPQTVKGVTDFIFSAPFLLIGV
FT                   FVVLLMAVTVALPAHMVSLLRENGLREVWVIAIPAGIGVIQVLGRLLLYFFEHHVDPHL
FT                   ANRLIPCLIPLGLLALLAAPLSADGQVGAVLLFVLLYGLGNGMLTIVKGTAIAQYVNRD
FT                   HVATLNGALGLPLALARAAAPLLLGLLWTAQAGYTHGLWLLLALSVLGVGALMLAQQLA
FT                   LRSR"
FT   gene            complement(479815..480579)
FT                   /locus_tag="Rfer_0468"
FT   CDS_pept        complement(479815..480579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0468"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68220"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T3"
FT                   /protein_id="ABD68220.1"
FT                   /translation="MQHVVFNQKGGVGKSTITCNLAAISAWQGLRTLVIDLDAQGNSTR
FT                   YLLGADAPDELPNVAEFFDQSLKFTIRDKPPGDFIVNSPWEGLDLMASNPLLDELHGKL
FT                   ESRHKIYKLRDALLQLADDYDQIYIDTPPALNFYTRSALMAAQGCLIPFDCDDFSRRAL
FT                   YTLLENVAEIKADHNADLQVEGIIVNQFQPRANLPQRLVQELIDEGLPVLQPYLSSSVK
FT                   IRESHEQSSPMIFLEPNHKLTLEFVALHDALL"
FT   gene            480726..483020
FT                   /locus_tag="Rfer_0469"
FT   CDS_pept        480726..483020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0469"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68221"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T2"
FT                   /protein_id="ABD68221.1"
FT                   /translation="MCDHSLSYCPDTLAAHDPDPSRELGPALVQANLPDTAEKLGLFGR
FT                   WWCEPQTGQWVLSTGAASLLDVGAGLHPTGHSCFEQVVPDDVLRLMAGLREPGQAIACE
FT                   FRIINEFDGLRWLRMVSEPHLAPGQALQTGVVVDVTSSRLAAMRERFCFESTQFLIGTP
FT                   TLGEAVTKVIQLVCDNLGWECGAYWSLEQSQMGEHRLACQHEWHQPDCPLASFIADTAA
FT                   IRLAPGEDLVGNVWRTMQPAWVEDMVNDQDFVRRKSAHACGLQSGYAFAVSYVTVGGRR
FT                   HSHGVLEFYSSLSRQREAQLPGLAATIGELIAQTVQRLEQQELIRQLAQVDDLTGLANR
FT                   KHFHHLLDAACLSATASSTSFAVLNIDLDRFKQINDAFGHEAGNLVLHEFAQRLQRLGP
FT                   AGSALGRLGGDEFALLVTPAGSAAQLQALGERVLLAARQPFLFERQELTMSASVGISIF
FT                   PDDGWTGSELMRCADAAMYRRKHGGRNGLSFFSSGTSGTLAEQRSALARQLTMEAELQR
FT                   ALVNHEFFLAYQPVFGRDAEHMVAVEALIRWRRPGGDVVPPDLFIPVAEQSGLIVQIGR
FT                   WVVKQACHDLAQLHRAGFTDLQVNVNMAAPEFVNPNLPGELMAVLQACGVAPRHLCLEL
FT                   TEGLVMKQPDKVIPVMVALRQLGCKVSLDDFGMGHSSLSRMKMLPISSLKIDRSFVSGL
FT                   PDDRGDAAIVRTILDLGRHMKLQVIAEGVETDAQLLFLRQFGCTLIQGFLLGRPKTVPE
FT                   LMAAHPQTTRD"
FT   gene            483032..485578
FT                   /locus_tag="Rfer_0470"
FT   CDS_pept        483032..485578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0470"
FT                   /product="CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68222"
FT                   /db_xref="GOA:Q221T1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T1"
FT                   /protein_id="ABD68222.1"
FT                   /translation="MTHTAAPLQIDTYLPYMRDVIRCEQSLHELNLMWRMIESSAKMNC
FT                   PVEAKTILPTMAATREGFNRLEQELVASLVNEKIATVLDEIGTKAQYVIDIVVRNLYER
FT                   TADVGFLATDNELCAFVAGLTDQQSAIRQRLRAYRNKYTVYDEIMLLDTAGNVLVQIDE
FT                   STPLEGSVDPLLAQTLASNTYVETFRATDLRPAKKQALIYSRRMLHPDTGVVVGVLCLC
FT                   FNFEQEMAGIFQSHRDPAGRSNMMLLDGSNRVIESADALWIPPGAVVPVNTASNPALMM
FT                   FAGREYLVRTYPAGGYQGYPGPPGWQGQVMIPVDVAFTGGARSTLTTLDPGVAAGLLSH
FT                   AQSFSPPLYEIMAAAENIQRVVWNGQVMTTGQRGEQMKLKTILDQISETGARSNELFSK
FT                   SIADLYETVLASSLRDSEFVSHLLVDLLDRNLYERSDDCRWWALTPELQAALAAPAAPQ
FT                   RDGEMVERITGILEYINRLYTVYTCIFVYDASGCIVASTQPDQDGGTVLGTFIEADTLA
FT                   QVRALRSEQDYCVTPFAPSPLYGGRPTYVYHAAIRDPNDDASVVGGIGIVFDSKPELDA
FT                   MLRSGLGHKAGMNALFVDRRGCVIASTDPTRPVGTRLEMDQTLLALPNGSSASRIVIHD
FT                   GHYAIMGCTVSSGYREFKVSDGYREDVLALVFDSFGEVRERPGVGHQGHTVLQSDLTAI
FT                   GGFEFATFFVDGALFALPAEHVLEALPAAKISTVSRGERKACIGLLGLQHEAVNHGSVW
FT                   VFDLGYLLHGQPSVIDKSSQVIIVRYGGQTIGLLVDALHDVPAFNQSQIMHSPFTGQAD
FT                   GALVKHFIKANGGQLLIQTVDVSSLFAVLMNRKAMA"
FT   gene            complement(485575..487107)
FT                   /locus_tag="Rfer_0471"
FT   CDS_pept        complement(485575..487107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0471"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68223"
FT                   /db_xref="GOA:Q221T0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q221T0"
FT                   /protein_id="ABD68223.1"
FT                   /translation="MSLSLVQSRALLGLDASAVTVEVHLANGLPSFTLVGLADVEVKEA
FT                   RERVRSAIQNSGLEFPHNKRITVNLAPADLPKDSGRFDLPIALGILAASGQIDAARLAG
FT                   YEFAGELSLSGELRPVRGALAMSLALHASRVVTQLVLPPGSAEEAALVPDAQVYSARHL
FT                   LDVVQHFLPQDDNAPPAEPAAGWSRVTAAPQPELVRYLDLADVKGQLGAKRALEIAAAG
FT                   GHSLLLMGPPGSGKSMLAQRFAGLLPTMTTLEALQSAAVASLGGRFSLDKWAQRPTCSP
FT                   HHTASAVALVGGGSPPRPGEISLAHHGVLFLDELPEFPRAALEALREPLESGVITISRA
FT                   ARRAEFPARFQLIGAMNPCPCGYLGSKQKVCRCTPDQVARYQSKLSGPLVDRIDLHVEV
FT                   PALPAADLLQAAAGEATAVIRARCTAARERAMARQGKANQALQGQEIDHYLLLDDAAAK
FT                   FLNLAAARLGWSARSTHRALKVARTIADLAGASSTQVTHVAEAMQYRRALRA"
FT   gene            487365..487703
FT                   /locus_tag="Rfer_0472"
FT   CDS_pept        487365..487703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0472"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="GlnB; GlnK"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68224"
FT                   /db_xref="GOA:Q221S9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S9"
FT                   /protein_id="ABD68224.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVADELVERVIETIEGAARTGKIGDGKIFVYDVEQVVRIRT
FT                   GETGKEAL"
FT   gene            487723..489291
FT                   /locus_tag="Rfer_0473"
FT   CDS_pept        487723..489291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0473"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68225"
FT                   /db_xref="GOA:Q221S8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S8"
FT                   /protein_id="ABD68225.1"
FT                   /translation="MRKLTMKKLLLSFALGLSLLAGGSAALAQAPAATAEPAAASASAA
FT                   PAEAKPAEAAAPAASVAPAAAATPAAAAAAPAPVPNKGDTAWMMVSTLLVILMTVPGLA
FT                   LFYGGLVRSKNMLSVLMQVMVTFSLIVVLWFIYGYSLAFTEGNAFIGGFDRLFMKGIWD
FT                   NVAGTFANGATFSKGVVIPEIVFAAFQATFAGITCTLIVGAFAERMKFSAVLMFMALWF
FT                   TFSYAPIAHMVWFWMGPDAYGAKDVVDAMNAKAGYLWQSGALDFAGGTVVHINAAVAGL
FT                   VGAYMVGKRIGYGRESMAPHSLTLTMVGASLLWVGWFGFNAGSALEANGFAALAFINTF
FT                   GATAAAVLAWSVGEALMRGKASILGAASGAVAGLVAITPAAGNVGVGGALVIGTVAGFA
FT                   CLWGVNGLKKLIGADDSLDVFGVHGVGGIVGALLTGVFNSPALGGPGYVADWVTATMVT
FT                   SADYSIASQVWIQAKAVLTTIVWSGVVSFVAYKIVDLTIGLRVSEEDEREGLDITSHGE
FT                   TAYSN"
FT   sig_peptide     487723..487809
FT                   /locus_tag="Rfer_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.784 at
FT                   residue 29"
FT   gene            complement(489734..490618)
FT                   /locus_tag="Rfer_0474"
FT   CDS_pept        complement(489734..490618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0474"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68226"
FT                   /db_xref="GOA:Q221S7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S7"
FT                   /protein_id="ABD68226.1"
FT                   /translation="MELLNDMALFVEVVNAKGFRGAADATGVPNSTVSRRIALLEKAIG
FT                   LRLLHRTTRRVELTEAGRIYYERCRRIVDEARIAHEQLGEMLAQPSGVLRASLPVDFAS
FT                   IYLAPIITEFAQHYPGIRFEFDLTPRRVDLITEPFDVAIRVGDLPDSTLIARQLASIKA
FT                   EVFASPGYLAKAGEPQIPSDLSKHECLGFPKVEHWVLQSGVHTEQVPVSGRYVLNNVGM
FT                   FRRLATLDQGLILLPRAVVAEDIQLGRLRHVLPGWHGKPQPVYALTETRLLPAKTQRFI
FT                   EFVRDRIATMSAV"
FT   gene            490720..491613
FT                   /locus_tag="Rfer_0475"
FT   CDS_pept        490720..491613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0475"
FT                   /product="putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68227"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S6"
FT                   /protein_id="ABD68227.1"
FT                   /translation="MKKDPSLQLSASRFNPSEVAGKKVAIIGGTGGIGRALAREMATHG
FT                   AHVTVVGQTFRDAGVPNIEFVQADLSLMHEARRVASSLPAETLDLVIFTTGIFAARKRQ
FT                   ETLEGLERDMAVSFLSRQVILQGIAHRLGVQLSKGHRKSRVFIMGYPGTGQAGTLGDLN
FT                   SESAYSAMSAHMNTVAGNEMLVLDSAQRYPNINTYGLNPGLIKTDIRINLLGGNKFLFA
FT                   LLEGLIGVFTPTAETYARRIVPLMLNSQINGFTGTLFNNKGQAIHPSAGLTGAHIRAFL
FT                   TESRTLVERAVDSQVA"
FT   gene            491652..492716
FT                   /locus_tag="Rfer_0476"
FT   CDS_pept        491652..492716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0476"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68228"
FT                   /db_xref="GOA:Q221S5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S5"
FT                   /protein_id="ABD68228.1"
FT                   /translation="MTSLFNTIQLGRVTLSNRLAMAPMTRSRAQFDGTPGASAATYYAQ
FT                   RASVGLIITEGTQPSEDGQGYMLTPGIYTDAHVAGWRTVSDAVHDRGGRLFIQLMHAGR
FT                   LSHPDNTPHHRQSVAPSAIESGAQMFTPTGLQPAPAPRALSLNEIRQTTTDFRFAAKRA
FT                   IEAGADGVEIHGANAYLVQQFLAPSSNSRTDAYGGPIENRARFAIEVAQAIAEEIGADR
FT                   TAIRLSPGTTLWGIDEGPEGPALYRYLVAELNRLGPAYLHIMHQGDVPLLADIRRLWTG
FT                   TLMVNHPGRAREQIGSDLNGGLADLESYGQMVLANPDFVERLKVDAPMNIADRNSFFGG
FT                   NDAGYIDYRTIGGK"
FT   gene            complement(492997..494610)
FT                   /locus_tag="Rfer_0477"
FT   CDS_pept        complement(492997..494610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0477"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68229"
FT                   /db_xref="GOA:Q221S4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S4"
FT                   /protein_id="ABD68229.1"
FT                   /translation="MTFSLPQANTLIIDDFQGMRTMLRDFVRLMGVTRIDTASNGHEAI
FT                   NQLSANKYDIVICDYNLGPGANGQQVLEEAKLRNFVGVSTIWVMVTAEKTTDMVMGAAE
FT                   VKPDDYLLKPINQVLLQSRLEKLITRKQSLGAIEAAIRTQDYSAAIALCDQQLNARAVN
FT                   PQEVLRIKSDLLLTLGDYPAARTLFESVLALRSVAWAKTGLGKVLFYGQDYAGAVQLFQ
FT                   QVLQENRMYMEAADWLAKTLDAMGDSAQAQQVLEDAVQLSPNSPIRQKTLGDTAYRNGA
FT                   LDVAQAAFEKTIKISEFSPHKNPAVYARLARVFSDQDSPEEALNILKRSKADFRYNPAA
FT                   ALQTAAAESLVYQKMGQVQKAEAAMLDAERLMEQLADKVSPEMTMEVAKALFKLGKKDK
FT                   ACGLLRDLVKNNHEDGELSRQIGAVFEGENMAEEGQTLIKASRNEVIDINNQGVTLAKQ
FT                   GDFQQAVKLLRTAAQQLPHNEVISVNLCGLLIGLMQQKGKTEDLVLETRELLGRVREMN
FT                   PVNQKYRAYALALARLTNEH"
FT   gene            complement(494634..495326)
FT                   /locus_tag="Rfer_0478"
FT   CDS_pept        complement(494634..495326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0478"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68230"
FT                   /db_xref="GOA:Q221S3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S3"
FT                   /protein_id="ABD68230.1"
FT                   /translation="MTTEDISFTDFIASSIHDMKNSLNVQVNGLETIADACRARFDDDT
FT                   LAALGPIIHQAHRMNANLIQLLSLYKLGKSIYPVDIAEQSVADVIAETLLHNRSVMEFK
FT                   GITMDVDCDEGCYWYFDRDLVTGILLNALNNAYSYTTDKIRIAARIEGGFLELRVEDNG
FT                   RGYPDTMLQSDGMAANKGVNFSSGSTGLGFYFSSRVAQMHKNGARQGSLTIENGGAYGG
FT                   GCFVVRLP"
FT   gene            495521..496459
FT                   /locus_tag="Rfer_0479"
FT   CDS_pept        495521..496459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0479"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68231"
FT                   /db_xref="GOA:Q221S2"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S2"
FT                   /protein_id="ABD68231.1"
FT                   /translation="MSWQTVTPQPCLLGESPFWHPHEQRLYWVDIAGRKILRTQPGLSP
FT                   VEAWAMPSEPGCIAPAAGGGLVIALRHGVFRAREWGGPLQHIATLDYDPQHLRANDGKC
FT                   DALGRFWIGTLDETRVARNAALYCLDCRAGIPPQIERQLDQTVLPATTANGLAWSPDDR
FT                   TLYWADTPSHAIQAWDYDLARNCLTGQRTFAQFAPKPPGWQSDGAANNGGYQGRPDGAA
FT                   VDVLGNYWVAMYEGRRVCQLAPDGSLLAEFAVPAQCPTMPCFGGEDLQTLFVTSARHGR
FT                   GAAELTRFPESGCVFAMRVSVPGLPVNFFVD"
FT   gene            496510..497682
FT                   /locus_tag="Rfer_0480"
FT   CDS_pept        496510..497682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0480"
FT                   /product="FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68232"
FT                   /db_xref="GOA:Q221S1"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S1"
FT                   /protein_id="ABD68232.1"
FT                   /translation="MDPLHQITERIRAAAAHRTPLRIRAGGSKDFYGQSLQGEVLDLTG
FT                   LSGIISYEPSELVVTVRAGTPLSELEAVLAEKGQCLAFEPPHFALPGVGPSGATVGGMV
FT                   AAGLSGPARASVGGVRDYVLGVKLLNGRAELLTFGGQVIKNVAGYDVSRLMVGALGTLG
FT                   VLTEMSLKVLPLAPFEATLMAAGIAQQAALDLLQRWGGQPLPLNASCWVRDDSVSPARD
FT                   TLFVRLRGASAAVAAACPRLLADLQAAGGDCARLDNAQAGPDWAACRDQTLPFFQPPAP
FT                   DLGLWRLSLPPTAPALALPYAPLIEWHGGLRWLWAPLTAQAQLRQAATDAGGNAMLFRA
FT                   PDADKTGATARFHPLTPVLAQIHQRLKAEFDPAGIFNRGRMYPDANSTRP"
FT   gene            497660..498928
FT                   /locus_tag="Rfer_0481"
FT   CDS_pept        497660..498928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0481"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68233"
FT                   /db_xref="GOA:Q221S0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q221S0"
FT                   /protein_id="ABD68233.1"
FT                   /translation="MQTQLAPEYQATADGLAAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLMKQVLEGATPTRKTQLHLDRCLTCRSCESTCPSGVQYGHLLDIGRKLVDA
FT                   KVPRPAGERALRWVLKEGLPSPLFAPAMALGQMVRPLLPAALQAKVPAKQSAGAWPTRG
FT                   HARQVLLLAGCVQPAMAPNINHATARVFDAAGVQCVIAPKAGCCGAVKFHLNDQDGGMM
FT                   EMRANIDAWWPYLQGHNGHAGVEAILMNASGCGVTVKEYGHILRDDPVYAEKAARISAL
FT                   TQDVSEWLPELSEKLRSRVSPQVSKQAGAMVFHPPCSLQHGQQLRGGVERYLGELGFNI
FT                   KVTGFEAHLCCGSAGTYSVLNPDLSHQLLARKLGHLNTTFGAAPPDVIVSANIGCITHL
FT                   QSGTDTPVRHWIEVLDEALQESP"
FT   gene            499016..500074
FT                   /locus_tag="Rfer_0482"
FT   CDS_pept        499016..500074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0482"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68234"
FT                   /db_xref="GOA:Q221R9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R9"
FT                   /protein_id="ABD68234.1"
FT                   /translation="MTFPSAFENLNVLSQHTLLSPAQLHDDVPASVRATQTVTTARQAV
FT                   ASILSGRDPRLLVVVGPCSIHDIAAAKDYAQRLKALADELADQLFIVMRVYFEKPRTTV
FT                   GWKGLINDPHMDDSFDIEEGLHIARRLLVELNDMGLPCGTEALDPITPQYLGDLIAWSA
FT                   IGARTTESQTHREMASGLSSPVGFKNGTDGDLDVALNGMLSAAQPHAFLGINGDGQVAL
FT                   TQTRGNAFGHLILRGGAVPNYDSVAVAQAEAALRAAKLPVNIVVDCSHANSRKNHALQT
FT                   LVLKDVVGQILDGNRSIKGVMLESNLFEGNQKLARPQDLRYGVSITDACLGWDSTAASL
FT                   REAAERLRTMPR"
FT   gene            500120..501019
FT                   /locus_tag="Rfer_0483"
FT   CDS_pept        500120..501019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0483"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68235"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R8"
FT                   /protein_id="ABD68235.1"
FT                   /translation="MHALVRCRRPLLIALLGLALALPVLAQNSTPDARAIDLRQQAIAY
FT                   ENGEGVPRNPALAISLYCQAAALGDAQAHYSLGWIYANGRGVPRDDAMAAYFFQAAAAQ
FT                   GLEAAQRMLKIVGEPTPDVPECLRPPAPPPASATDLVPEPGVDYQAIAPRKIFELVMKM
FT                   APQYQVQPQLALAIIAAESNFDSQALSPMNAQGLMQLIPETSQRFQVRNPFDAAQNIRG
FT                   GLAYLRWLLAYFEGDIVLVAAAYNAGEGKVERYRGVPPYQETRAYVQRIVRAVGTLAHP
FT                   FDARVTPPSPALALIRLN"
FT   sig_peptide     500120..500200
FT                   /locus_tag="Rfer_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            complement(501026..501511)
FT                   /locus_tag="Rfer_0484"
FT   CDS_pept        complement(501026..501511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0484"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68236"
FT                   /db_xref="GOA:Q221R7"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R7"
FT                   /protein_id="ABD68236.1"
FT                   /translation="MSPVYDFEALQINGQPVSLSQFKGRVMLIVNTASACGFTPQFAGL
FT                   EELHETYGNKGLVVLGFPCNQFGAQDAGSNNEIAEFCQLNYGVSFPMMAKIDVNGAQAH
FT                   PLYQWLTQEAPGLLGSKAIKWNFTKFLVGKDGQVLKRYAPTATPASLAKDIETALAA"
FT   gene            complement(501619..502176)
FT                   /locus_tag="Rfer_0485"
FT   CDS_pept        complement(501619..502176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68237"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R6"
FT                   /protein_id="ABD68237.1"
FT                   /translation="MPVAASRGLKAWIWPRPPESTIWFAEFVVLGRLFFNVGSSTAGGS
FT                   RMSADSAAVTRIVEAFAECWNRHDMNAFAELFAPDAEFVNVVGLWWKGRAEIKAAHEFT
FT                   HQTLFKNSRLTLVELSTRFPTPQIAIARCRWRLVGHVTPQGIPLPERQGVLLNVLRQQD
FT                   GKWFIIDSQNTDIIEGVASRPQ"
FT   gene            complement(502253..503191)
FT                   /locus_tag="Rfer_0486"
FT   CDS_pept        complement(502253..503191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0486"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68238"
FT                   /db_xref="GOA:Q221R5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R5"
FT                   /protein_id="ABD68238.1"
FT                   /translation="MHATTNSRFEAIEAICRRPPLSKTALAAAALTLNAFVWGVSWWPF
FT                   RSLQSLGLHPLWTTALIYTFGLLCLALVQPRAWRGFLRHPELWWLLLAAGLTNVGFNWA
FT                   VTVGDVVRVVLLFYLMPAWVVLLAWPLLGEKPSTGSLVRLALALAGVVIVLKTPASPWP
FT                   VPESLADWLALMAGFCFALTNILLRRLNHTPGESRMLAMFVGGALLAGAAAVLGVGLDV
FT                   VTPLPAPKLAWVAWALLISLAFLAGNLALQYGAAHLSASATSLIMLSEVIFASGSSVLL
FT                   GAGTLSARTLIGGALILLASLLSVLSFRQPS"
FT   gene            complement(503163..504446)
FT                   /locus_tag="Rfer_0487"
FT   CDS_pept        complement(503163..504446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0487"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68239"
FT                   /db_xref="GOA:Q221R4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R4"
FT                   /protein_id="ABD68239.1"
FT                   /translation="MKRGFFTIMSAQFFSSLADNALFVTAVQLLRSSHAPEWQQAALVP
FT                   MFALFYVVLAPFVGAFADSMPKGKVMLLSNFIKVLGCLFMLFGSHPLLAYAIVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASIILGVLLGGQLVGPVIAPWLLAFDFPL
FT                   VDTGVNNAPEAAICVLIFVYLLAAWFNTHIPLTGVEMRPMSRRVTSLLPDFWACNVRLW
FT                   RDKLGQISLAATTLIWGVAGNLRFIVLAWAAAALGYSVTQASALQGVVAIGMAAGAVVA
FT                   SMRMRLEDGPRVITLGIVMGILIILLIFITNVWVAAPFLILLGALGGFLVVPMNALLQH
FT                   RGHNLMGSGRSIAVQNFNEQACILGLGAAYSLSTGLGLPTFTAITGFGLVIAGFMWLIR
FT                   RWHARNCVVHQVEIEHLLSIARNDKFEV"
FT   sig_peptide     complement(504390..504446)
FT                   /locus_tag="Rfer_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.913 at
FT                   residue 19"
FT   gene            504569..505693
FT                   /locus_tag="Rfer_0488"
FT   CDS_pept        504569..505693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0488"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68240"
FT                   /db_xref="GOA:Q221R3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221R3"
FT                   /protein_id="ABD68240.1"
FT                   /translation="MPRPIQATIHTAALRHNLARARLAAPDAKVWAIVKANAYGHGIER
FT                   VFEGLRAADGFALLDLDEAQRVRALGWRGPILLLEGVFELRDLELCSRLDLWHTVHCDE
FT                   QIDMLASHKTKVAQRVFLKMNSGMNRLGFTPQRYRAAWTRLNALPQVDEISLITHFSDA
FT                   DGARGITEQMAVFAEVTRDLPGERTLSNSAATLLHTPARQPGDGFVASDWVRPGIAIYG
FT                   SAPDFPQHSATDWGLQPSMTLTAKIIATQTVDTGASVGYGSTFVADKPIQVGVVACGYA
FT                   DGYPRLCPTGTPVLVNGIRTRTVGRVSMDMLAVDLSAVTAAGGQVGIGSEVTLWGRAAN
FT                   GLVLGIDEVAQPAGTVGYELMCALAPRVPVLVAD"
FT   gene            505693..506901
FT                   /locus_tag="Rfer_0489"
FT   CDS_pept        505693..506901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0489"
FT                   /product="HD-GYP domain-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68241"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R2"
FT                   /protein_id="ABD68241.1"
FT                   /translation="MDYVMLPVARLKLGNTLPIDVWAPDGRLLLRRGQAILSEQQREML
FT                   HAHQACMTASDARAWQKSYERLINTLLQRGADLDAIMRAELPSELVETDYLSGAQVLGG
FT                   WLDLQEILRGLLYQGEAAINPLPRLAGTESRALELLRADPDECLFILFQALADISLGYC
FT                   ATHALLSAVVCALTAEKLDMAAAAGGSLFRAALVMNIGMAREQDKLAMQSSLPTEAQRV
FT                   LVREHPCKSVELLRLMGVSDEDQLDIVRWHHEVNESHGLAHNVMARRLLRLADGFVAKM
FT                   AARKTRLAMSPLGAAKSVFLGATPDTASIGSAMATALGFYPPGTYVQLFNGEKAVVVAR
FT                   GLRANQPQVVSIVNAGGMPVSKYLYRETSNPRFAIRTPINAERIKVKVSLEKVQKARKE
FT                   HTD"
FT   gene            506981..507961
FT                   /locus_tag="Rfer_0490"
FT   CDS_pept        506981..507961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0490"
FT                   /product="heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68242"
FT                   /db_xref="GOA:Q221R1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R1"
FT                   /protein_id="ABD68242.1"
FT                   /translation="MAGRMQVEFKDYYQIMGLQRSATQDEIKRAHRTLARKYHPDVSKE
FT                   PNAEARFKEIGEAYEVLKDPEKRAAYDQLGANWKGGQEFRPPPDWNAGFETGGAGFGAG
FT                   EAGDYSDFFESLFSRGFGAQRGGRRGGAAFHAPGQDRHAKIQIDLEDAYQGAKRRVTLQ
FT                   VPTLDAQGHVATREHTIEFSIPKGVRAGQQIRLAGQGDPGMGQGAPGDLYLEIEFRAHA
FT                   HYRIDKHDVYLDLPVAPWEAALGAQIEVPTPSGFVELKIPAGSVEGRKLRLKGRGIPAR
FT                   TPGDFYFVLKIALPPADSEAAQAFYRSMATQFKSFKPRARLGAAA"
FT   gene            507958..508314
FT                   /locus_tag="Rfer_0491"
FT   CDS_pept        507958..508314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68243"
FT                   /db_xref="UniProtKB/TrEMBL:Q221R0"
FT                   /protein_id="ABD68243.1"
FT                   /translation="MSTTPKRVATRAATAEPATELTLLDISRTCAVQTDFILELIEEGV
FT                   LAPLAGSAPGSWRFTTVQTRQVTVAARLQRDLGVNPAGAALALQLLDELETLRAQLAAS
FT                   ASDDDSGPSSTRSD"
FT   gene            complement(508306..510879)
FT                   /locus_tag="Rfer_0492"
FT   CDS_pept        complement(508306..510879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0492"
FT                   /product="ATPase, E1-E2 type"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68244"
FT                   /db_xref="GOA:Q221Q9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q9"
FT                   /protein_id="ABD68244.1"
FT                   /translation="MVLPASDAGLTTAQAAQRLAEDGPNALPGDQRRTLLGIARETLRE
FT                   PMFLLLLAASLLYLLLGDLQEGLILLGLVLVVLALTLYQEGKTERALESLRDLSSPRAL
FT                   VLRDGQPLRIAGSDVVLGDILILAEGDRIPADAVLLSGTEVQVDESLLTGEPVPVSKVA
FT                   DVMAVQAAAPRPGGDGQAYLFSGTLLVKGHGSARVTATGARSEIGRIGTALVSLSSEPS
FT                   PLKKQTASLVKVLALIALAASLFLVATFGLLRGDWLAALLAGIALAMALLPQEFTVVLT
FT                   VIPALGAWRLSKQDVLTRRIAAIETLGATSVLCVDKTGTLTENRMTVAELYVQGHKLLI
FT                   DYAVTSELPESFHTLVEFSILASVAAPFDPMEKAFHRLGQHFLQDTEHLHHDWTLMQQY
FT                   GLTPELRAMSHVWKARQDQQHVVAAKGAPEAIVDLCHLDGAAQARIAAAVDAMAAKGLR
FT                   VLGVAQARFEGEHWPAIEHDFEFEFIGLLGLADPLRGEIPDAVAECRSAGIRVVMITGD
FT                   YPATASAIARQAQLQSTLDTAAADPLLTGDAMAAMSDAELQARMQSVSICARIAPEQKL
FT                   RIVQALKANGEVVAMTGDGVNDAPALKAAHVGVAMGGRGTDVAREAASLVLLDDNFASI
FT                   VRAVRLGRRIFDNLRKSMSYILAVHVPIAGMALLPVLLGWPTMLFPLHIAFLELVIDPA
FT                   CSMVFENEPSESDVMRRPPRNVNTPLFGGLTLLLALLQGLGALAVAMGAAMWGADQLPE
FT                   GGARAFAFATLVCTNLALIFSNRSRAGSLWASLWVPNRTLWIVASAALALMALALYLPW
FT                   LARLFVFEPLPLLYLGAALGLGLASMFWFEAVKLGQRQTAKAASI"
FT   gene            complement(510849..513335)
FT                   /locus_tag="Rfer_0493"
FT   CDS_pept        complement(510849..513335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0493"
FT                   /product="Magnesium-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68245"
FT                   /db_xref="GOA:Q221Q8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q8"
FT                   /protein_id="ABD68245.1"
FT                   /translation="MNGLTSLVAAARLRQYGPNRLQPARQRALLLQFLAHFKNPLVLVL
FT                   LAASGLSALTGDVTGALIIGVIVLMSVTLDFVQSYRAGRAAEQLALQVAITATVLRDGQ
FT                   RRELPVTELVPGDVVLLSAGNLVPADARLLEADDFFVNQAQLTGEPYPVEKRASLPDQA
FT                   DAEQASSQAWALDAADAVFMGSSVVSGSASVLIGRTGSTSALGQIAVSLADKAPPTAFE
FT                   IGTRHFGMLIMRLTFLLVLFTLLVNVALHRPLLESFLFAVALAVGLTPELLPMVVSVTL
FT                   TRGALRMAALKVIVKRPSAIQDMGAMDVLCTDKTGTLTEAKIRLERHVDAGGQDDPHVL
FT                   ELAYLNSYFESGLKSPLDDAILAHGEIDVSAWTKIDEVPFDFERRRVSVLVQRAGARRL
FT                   VVKGAPEDIVRLCTHYQDSADATVALDAAARVRITQLFDSLSEEGFRVLGIASRDVPGD
FT                   HPHAMVSDESELVFAGFAAFLDPPKASAGEALKALAASGVAVKIVTGDNERVTRHVCTQ
FT                   LGVAIEGVLTGTELAALNDDALRARVEGANLFCRVNPAQKNRILLALKGRGHVVGYLGD
FT                   GINDAPSLHTADVGISVEGAVDVAKQAAAMILLERDLMVLHQGILEGRRTFGNVMKYIM
FT                   MATSSNFGNMFSMAAATLFLPFLPMLPMQILLNNLMYDVSEITLPMDNVDEENLAQPKR
FT                   WDMTFIRNFMLTIGPISSLFDFLTFYLLLSLFNAHESLFRTGWFVESIATQVLVIFVIR
FT                   TRRNPLRSHPNRWLVLTSLGVVVTAMLLPFTPLAPYLGFTPLPLSYFGLLGALVVAYLL
FT                   MVEGGKQWFYRRATRA"
FT   gene            513638..513970
FT                   /locus_tag="Rfer_0494"
FT   CDS_pept        513638..513970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0494"
FT                   /product="protein of unknown function DUF1508"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68246"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q7"
FT                   /protein_id="ABD68246.1"
FT                   /translation="MAGWYELSKSSDGQFRFVLKDGTGDTLLTSELYKARSSAEQGVAS
FT                   VQANSLLDERYERKTASNGKAFFNLKAANHQVIGTSQMYATEAAREADIARVKAEGASK
FT                   TVKEKT"
FT   gene            complement(513880..514590)
FT                   /locus_tag="Rfer_0495"
FT   CDS_pept        complement(513880..514590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0495"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68247"
FT                   /db_xref="GOA:Q221Q6"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q6"
FT                   /protein_id="ABD68247.1"
FT                   /translation="MKTPVNIFKQALQNQQAQIGLWLGLADPYCAEILAGTGYDWLVID
FT                   GEHAPNDLRSVLGQLQAIASATSALAGPGSHPVVRVSVGETALIKQYLDLGVQTILVPM
FT                   VDTAAQAARHPGRQRRPGPPMVDCRGLVRGGGRRDHAAVGGSDSAAGEVQAVGGSRRCE
FT                   QWLLNIAIKIAATWAYSTRARARYGSLTFSKVCSQGASADRQKAQVFSLTVLDAPSALT
FT                   RAMSASRAASVAYI"
FT   gene            514998..515954
FT                   /locus_tag="Rfer_0496"
FT   CDS_pept        514998..515954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0496"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68248"
FT                   /db_xref="GOA:Q221Q5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q5"
FT                   /protein_id="ABD68248.1"
FT                   /translation="MKFTELADDPEDTDHSPAERIAAASRSTWVSVVVNLVLTITQIAI
FT                   GVVAKSQGLIADGIHSLSDLVADFVVLFASHHSKKDADADHPYGHQRFETAASLVLGTL
FT                   LLAVGLGMLWSAARKLEAPETVQTVHIMALWVAGGALIAKELLFRYMLSVAKRVKSSML
FT                   VANAWHARSDAASSLVVGIGIVGNLAGYPILDPIAALIVGFMVTKMGWGFSWDALHDLM
FT                   DRAVDEQEVQAIRLTLIETPGVSGVHDVRTRKMGDMIVVDAHIEVDAAISVEAGHDIAV
FT                   EARQRVLQRHRVLNLMTHVDPWRRPDLDHPTPAAAPR"
FT   gene            516157..517329
FT                   /locus_tag="Rfer_0497"
FT   CDS_pept        516157..517329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0497"
FT                   /product="oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68249"
FT                   /db_xref="GOA:Q221Q4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q4"
FT                   /protein_id="ABD68249.1"
FT                   /translation="MVWRRRGVAAKTPVAESVETRPVSSGAWPGWREFRVLRREFEDDT
FT                   HTQCSFYLVPVDGAALPPFRPGQFLTFTLQVADAGEPGGQRTITRCYSLSDRPEPTCYR
FT                   ITIKRIPTPDDRPLVPPGASSSHFHDRIRAGDVLQVKAPSGHFFIDPDPQVPAVLIAGG
FT                   IGVTPMMSMLRWCLAEQPGRTLHLYYGVRQGGEHAFKLQLEQLANSHPNFHLSVVYSRP
FT                   GPNDAPERDYQQAGHVDIDLLRRTLPHGRHQFYVCGPAAMMESLVPALARWGVPQPDIH
FT                   FEAFGPASVRLPGATPQAQAAGLAAPLAIHFRRSGRTLTWDGKDDTLLDFAERHDVAVA
FT                   SGCRSGGCGTCETKLISGRVRYANPPEHDVAPRHCLLCVGRPESALEIEA"
FT   gene            517335..517913
FT                   /locus_tag="Rfer_0498"
FT   CDS_pept        517335..517913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68250"
FT                   /db_xref="GOA:Q221Q3"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q3"
FT                   /protein_id="ABD68250.1"
FT                   /translation="MKARLIRREVLPFLLSLGTLALATVLIDALLHLANIAWIGRYLGI
FT                   PGTLLILGSFGYSLRKRRLIQAGRPLQLLRWHERMAWLGSLLVLVHAGIHFNSILAWLA
FT                   VVAMLINVASGLTGKFLLDRSRRRLEEARQRMRQHGLAADELDEHLYWDSLTFDAVKQW
FT                   RSVHFPITLAFAVLALAHIMAVFLFWGWR"
FT   sig_peptide     517335..517406
FT                   /locus_tag="Rfer_0498"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.856 at
FT                   residue 24"
FT   gene            517910..518647
FT                   /locus_tag="Rfer_0499"
FT   CDS_pept        517910..518647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68251"
FT                   /db_xref="GOA:Q221Q2"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q2"
FT                   /protein_id="ABD68251.1"
FT                   /translation="MKRGWLMALIAANLLVLVVLIFIYPHLMVSPGPVVAAHAEIATDC
FT                   FACHAPWRGASAARCVSCHVLPDIGLRTSKGVAIVQHTRKTSFHQALIEQDCMACHSDH
FT                   AAPKLTQRSRKPFSHLLLKTAVREQCQGCHQAPTDKLHGQITGNCNQCHSQQAWKPATF
FT                   EHDKLFLLDRDHAASCETCHSNNDYRRYTCYGCHEHSLDKIRSEHREEGIQNFENCVEC
FT                   HRSAKGEPENKGSGKRKDKEDDD"
FT   sig_peptide     517910..518020
FT                   /locus_tag="Rfer_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.937) with cleavage site probability 0.532 at
FT                   residue 37"
FT   gene            518783..520147
FT                   /locus_tag="Rfer_0500"
FT   CDS_pept        518783..520147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0500"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68252"
FT                   /db_xref="GOA:Q221Q1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q1"
FT                   /protein_id="ABD68252.1"
FT                   /translation="MAKEKTVYVCSDCGGTSPKWQGKCPSCNAWNTLIESVPESLSPTK
FT                   NRFASLAKTAEIAILGDIDAVDMARTPTGHEELDRVLGGGMVEGGVVLIGGDPGIGKST
FT                   LLLQALDSLQCSGQNTLYVTGEESGAQVALRSRRLGLGHSQVRVLAEIQLEKILSVLAA
FT                   TQPDIAVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRAAKASGVCIVLVGHVTKEGAL
FT                   AGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTEKGLKGVSNPSAI
FT                   FLSQHAEPVPGSCVMVTLEGTRPMLVEIQALVDSGGPSPRRLSVGLDKDRLAMLLAVLH
FT                   RHAGVACMDQDVFVNAVGGVRISEPAADLAVLLAITSSLRGKPLPKGFFAFGEVGLAGE
FT                   VRPAPRGQERLKEAAKLGFSVALVPKANAPKKPIEGLTIHAVERVEQAMEVVRGL"
FT   gene            complement(520194..520820)
FT                   /locus_tag="Rfer_0501"
FT   CDS_pept        complement(520194..520820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0501"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68253"
FT                   /db_xref="GOA:Q221Q0"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q221Q0"
FT                   /protein_id="ABD68253.1"
FT                   /translation="MKKTVWTMTCGLIFSSLAATALAQTPMLPKAQYTADSRQAQERYA
FT                   ADKKLCNDEASSTARLQCRRDAKSEYDKAIAAARAQLAAQTPAATSHQNATAACPDCAR
FT                   VIAVNVSDKKGEGSAVGLIAGGVTGAILGHQVGGGLGKDLATVAGAAGGAYAGKKIEEK
FT                   VKTHKVWTVHVQYQDGRKHSFSFEQDPGFKTGDAVRNSGNSIVRQ"
FT   sig_peptide     complement(520749..520820)
FT                   /locus_tag="Rfer_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 24"
FT   gene            520969..521682
FT                   /locus_tag="Rfer_0502"
FT   CDS_pept        520969..521682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0502"
FT                   /product="cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68254"
FT                   /db_xref="GOA:Q221P9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P9"
FT                   /protein_id="ABD68254.1"
FT                   /translation="MQIFDTAKEKSQILVWDAPVRVFHWLLALSFAGAYVSAESDRWLA
FT                   LHVTLGYTMAGLVAFRILWGLLGTRYARFGSFVRGPLTLVRYGRAMLAGRPEHHVGHNP
FT                   AGAVAIVLLLSLSMAIVATGWLFYNVPGARWLKEVHEGAAGFMLAVVALHIGGAVLTSL
FT                   MHRENLVRAMINGKKEGAPNQGIRRAWRPLALLMVAAVLGFWYLQWQSPATPGLSGKGL
FT                   ASQDAKYRSHTHDDD"
FT   gene            521756..522439
FT                   /locus_tag="Rfer_0503"
FT   CDS_pept        521756..522439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0503"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68255"
FT                   /db_xref="GOA:Q221P8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P8"
FT                   /protein_id="ABD68255.1"
FT                   /translation="MRILLAEDDSMLGDGLRAGLRQLGFQVDWVRDGLAAERELACGDY
FT                   AAAVLDLGLPLKDGIDVLQAVRASKITTPVLVLTARDAVPDRIRGLDLGADDYVVKPVD
FT                   LHELGARLRSLVRRAHGQMQDVLRCGAVLLEPSARRVSLNDEPVALSTREFDLLHVLML
FT                   NADRVLSREQLEQQLYSWGYEVESNAIEVHIHHLRRKLQPDLIQTVRGIGYTVQRGSAP
FT                   ASAST"
FT   gene            522436..523788
FT                   /locus_tag="Rfer_0504"
FT   CDS_pept        522436..523788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0504"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68256"
FT                   /db_xref="GOA:Q221P7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P7"
FT                   /protein_id="ABD68256.1"
FT                   /translation="MRTARRLKSLQARLLAPLLGLLTVVWLGAAVMIWFDASHELDELL
FT                   DGHLAQAAALLIMQQAHAHEADSVEDAPSLHKYAPKVVFQVFHEGRLVLSSANAGTAPI
FT                   AGNAQGFSTVRLADDAQWRVFATRGAEHDVQVYVGEQTESRDSILLAVLQGVLLPLVIA
FT                   LPLLALVGWWAVRQGLAPLRHLSRVLAQRRPQAMEPLLVPDLSTEMVPVVQALNGLFER
FT                   IEQMLVSERRFTADAAHELRTPIAAIRAQAQVALGAGHDAAQRDHALQFTLAGCDRATH
FT                   LVEQLLTLARLEAAPASAADAVARVDLSALARRVAADLAPTALARGQTLQLEAPTACQV
FT                   AGDEALIGVLVRNLVDNALRYSPNQAQVWVSVAMESGQAVLRVQDSGAGMTEPEIARLG
FT                   ERFYRVLGSDQPGSGLGWSIVKRIATVFGAQVQVSRSERLGGLAVTVRWRR"
FT   sig_peptide     522436..522525
FT                   /locus_tag="Rfer_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.890) with cleavage site probability 0.298 at
FT                   residue 30"
FT   gene            523871..525274
FT                   /locus_tag="Rfer_0505"
FT   CDS_pept        523871..525274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0505"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68257"
FT                   /db_xref="GOA:Q221P6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P6"
FT                   /protein_id="ABD68257.1"
FT                   /translation="MSKLSLLDLGFFIAETQASPKHVAGLLICRRPPKSTLAFAKNLYR
FT                   ELLTFTDVKAPFNRVIKFSLKAMPHWQYSKAVDLKQHIFYHKLAGGCNDRQALYDFVSK
FT                   LHQPMLDRSRPLWEVHVIDGLEIDRKKGYFALYQKMHHACADGVTMSRWTSESMAQTPD
FT                   DLELTPVWTRKHGGHGDRHKQAMQDLMHSLWKDVGGTTLRFLGIARLATMLLLESVKLT
FT                   KNAIALPFVSTAKTPLTGQVTAGRQFTTAGVSLARVNQVRERTRSTINHVALTCLDGAL
FT                   RRYLKDQGVELQRPITIQMPVNLRKEGEKTAGNKIGIIQVELSAPTDDPYVRLRNIGFS
FT                   LRSVRTMIDSVAPEAIESYTIITGLVAQIAELLQLSNTLPPMGNTLVSNVPGPKEYLYI
FT                   KGAKMEEMHPISTLPPSNLLNITLFSYAGELFFGLIATDELPNLQRLGDYVQEAFTELE
FT                   SSVRDARAA"
FT   gene            525352..526302
FT                   /locus_tag="Rfer_0506"
FT   CDS_pept        525352..526302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0506"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase / branched
FT                   chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68258"
FT                   /db_xref="GOA:Q221P5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P5"
FT                   /protein_id="ABD68258.1"
FT                   /translation="MSPVTPSMSDRDGKIWMDGQMVDWRDAKIHVLTHTLHYGCGVFEG
FT                   VRAYNAVGGTAIFRLEDHTERLFNSAKILRMKIPFSMDEVLAAQKAVVRENKLEGGYIR
FT                   PLSWIGDEKLGVSPKGNTIHLMVAAWPWGAYLGEEGMKRGIRVKTSSFTRHHVNITMTQ
FT                   AKAVSNYSNSILANLEVTDEGYDEALLLDCSGFVSEGPGENIFVVKDGVVYTPDLSSGA
FT                   LNGITRNTIFHIAKDLGLELIQKRITRDEVYICDEAFFTGTAAEVTPIRELDRIELGKG
FT                   DYVGSRGPITEKIQSAYFDIVNGRNPKYAHWLSKV"
FT   gene            526315..526518
FT                   /locus_tag="Rfer_0507"
FT   CDS_pept        526315..526518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68259"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P4"
FT                   /protein_id="ABD68259.1"
FT                   /translation="MNKSTVELLAADLNHQGGVFCPNPKADMKLWDSHPKVYLDVAHSG
FT                   EAKCPYCGTVYKLKAGEHFAGH"
FT   gene            526589..527542
FT                   /locus_tag="Rfer_0508"
FT   CDS_pept        526589..527542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0508"
FT                   /product="Lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68260"
FT                   /db_xref="GOA:Q221P3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P3"
FT                   /protein_id="ABD68260.1"
FT                   /translation="MTEPLMRRLQARGERLTVGALPWVAPVYRLMPQVAEVIELPFAHG
FT                   GLQLKARRSLARQLSGRFDVAYVCPNSLKSALLPLLAGIPKRVGYLGEARVGLLTHRLK
FT                   NPPKAQRPPMVAFYSALSGAADSGNDRPQLQLNPVEVDIALAALGLQRGAYDVFAPGAE
FT                   YGPAKRWPTRHFAELARRLELPVVLLGSAKERDLCREIADLVNADQPGKCRNLAGETSL
FT                   AQAFSVIGAAKCLVSNDSGLMHVGAALGVRQVALFGSSSPLHTPPLNDRAAVLWLKNDA
FT                   SYQPPLDCAPCFERECPLGHTRCLVDITADRVLLNM"
FT   gene            complement(527805..529088)
FT                   /locus_tag="Rfer_0509"
FT   CDS_pept        complement(527805..529088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0509"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68261"
FT                   /db_xref="GOA:Q221P2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P2"
FT                   /protein_id="ABD68261.1"
FT                   /translation="MFFKKLYVRIWLAVVLAVAVLTLLVGWAWRLTAEPPLRNVVIRDH
FT                   VGRIIGNGHSRMRRPPDVGFGENSDRAPDAQDRWLGPYSQYGNDPEFVVVMNDGQMVHL
FT                   QFPRPPQSPWSRPPFGFFWTLSLVGIAVALATYPIIRKLTRRLELLQNGVEKWGEGDLS
FT                   IRVPEAGADEVTFLAARFNHAAERIETLVKSHESLLASQKSLLANASHELRSPLTRIRM
FT                   GLELMGSSASPAFKNEISRNISELDQLIEEILLASRLDAREADMGTIESVDLIGLAAEE
FT                   CARVNAELDVQLASDSSATPTEPAGPSDLPVQGVTKLLRRAMRNLLENARRHAAGEITV
FT                   TLRKTDRQAVISVCDRGPGVPPELRERIFEPFYRLPGATERDGGVGLGLALVKSIALRH
FT                   GGTVSCENRPDGGACFVVRLPLSPVDKV"
FT   sig_peptide     complement(528987..529088)
FT                   /locus_tag="Rfer_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.724 at
FT                   residue 34"
FT   gene            complement(529091..529795)
FT                   /locus_tag="Rfer_0510"
FT   CDS_pept        complement(529091..529795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0510"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68262"
FT                   /db_xref="GOA:Q221P1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P1"
FT                   /protein_id="ABD68262.1"
FT                   /translation="MTQHLLMIEDDTRLAQMVSEYLAQSGFVVGHAGDGQTGLTDLQSD
FT                   PPDLVILDLMLPDMDGLEVCRRIRSLPGALAQIPVLMLTAKGDPMDRIIGLEIGADDYL
FT                   PKPFEPRELLARIRAVLRRHVEGAHPVQTQLRFGTLEIDRDARSVSVAGQLCDLTSYQF
FT                   DLLVALAERAGRVLTRDQIMEAVRGRELDAFDRSIDVHMGRIRAAIELDAKDPKRILTV
FT                   RGVGYVFARQQD"
FT   gene            complement(529864..532311)
FT                   /locus_tag="Rfer_0511"
FT   CDS_pept        complement(529864..532311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0511"
FT                   /product="Glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68263"
FT                   /db_xref="GOA:Q221P0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q221P0"
FT                   /protein_id="ABD68263.1"
FT                   /translation="MPATAIFQFDKPTNSVEALRRSISNRLVYQVGKDLHSATQRDWLF
FT                   AVFHAVRDRIMDGWRESLTQAEDQDAKRVYYLSLEFLTGRALTNAMLATDIYEPVKQAC
FT                   ALLGADFDALIDLEPDAGLGNGGLGRLAACFLDSMATLGLPGMGYGIRYEFGMFAQRIE
FT                   HGQQVEEPDYWLVNGYPWEFMRPELSYTIRYGGRLVPQNGQSLWLDTEDVIATAYDSGV
FT                   PGHQMRSVVTMRLWSARASGGVNLDAFNRGDYIQAVEAKNQSENVSRVLYPDDRTEHGH
FT                   ELRLRQEYFFVSASLQDILRRHLKNHSGFEQLADKVAIHLNDTHPALAVPELMRLLMDE
FT                   HQLDWEAAWGLCTRIFSYTNHTLMEEALETWPVELLGRVLPRHMGLIFDINARFLAEVH
FT                   TRFPDDHALLRRISLIEERGVRRVRMAHLSVLSSHKVNGVSALHSQLMVDTIFSDFVRM
FT                   YPERFCNKTNGITPRRWLSLANPSLSTLIDSRIGPDWRQDLDQLAQLRDLADEPEFQNA
FT                   FRLAKQQNKRRLTDLMARCPGVIVDPHSLFDVQVKRMHEYKRQLLNVLHVITRYHRILA
FT                   QPHANWVPRTVIFAGKAASAYYMAKLVIRLINDVARVINNDPLIGSLLRVVFIPNYRVS
FT                   LAEIIIPAANLSEQISTAGTEASGTGNMKFALNGALTIGTWDGANIEIAEKVGPDNIFV
FT                   FGNRAEKVAELRGYGYLPRSYYEGNFDLKFAIDRLAQGGFSPEEPGRYRDVVNVLLESD
FT                   YYQLLADYGDYCACQDKVDDLYRRPGAWTRSAILNVAGMGPFSSDRTIREYATDIWGVA
FT                   PLR"
FT   gene            complement(532343..533827)
FT                   /locus_tag="Rfer_0512"
FT   CDS_pept        complement(532343..533827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0512"
FT                   /product="Glycogen/starch synthases, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68264"
FT                   /db_xref="GOA:Q221N9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221N9"
FT                   /protein_id="ABD68264.1"
FT                   /translation="MKVLYVCTELFPFLKTGGLADVSAGLAPALQAVGCEVRLLLPAFP
FT                   AIANQALSTRPIASLPAGPMPWGPAPVLPPASLTLATLPGLELPVYLVQAPALYDRPGN
FT                   PYLGPDGKDWSDNAIRFAALGWAGATLGQGLDPHWRPDVIHCHDWHSGLTPTYVRAFAA
FT                   AKQATPATVFTIHNLAYQGLFAAAEVTRLGLPKSWFDIDGFEFFGKVSFMKAALRYADR
FT                   ITTVSPTYAREISSEAQGCGLDGLLRERANSLSGILNGVDDLIWNPATDALLPAPYDEH
FT                   KLQGKTLAKRALQTKFGLEPRANALVFGAVSRLTEQKGLHLLPQVLADMVQRGGQLALL
FT                   GQGDVALERAFVDAAIRYPGQVGVRIGYDEVTAHAVIAGADVILVPSEFEPCGLTQLYG
FT                   LRYGTLPLVRRVGGLADTVVDCTLENLDEGSATGFVFDELSPAGLLSAVRRAFVLFRRP
FT                   DEWLAVQQRGMGLRFDWLASAQHYLAMYQTLRPGAK"
FT   gene            complement(533824..535095)
FT                   /locus_tag="Rfer_0513"
FT   CDS_pept        complement(533824..535095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0513"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68265"
FT                   /db_xref="GOA:Q221N8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221N8"
FT                   /protein_id="ABD68265.1"
FT                   /translation="MKDGAHHRPVRRTISLVLAGGRGSRLQDLTENCAKPAVHFGGKFR
FT                   IIDFVLSNCVNSGLHRIGVLTQYKSHSLLRHLQHGWSFLRNEVNEFIDLLPAQQRVDEA
FT                   SWYRGTADAVYQNIDILREHDPKYILVLAGDHVYKMNYASLIEDHVALGAPCTVACIEV
FT                   PLAEASAFGVMTVDAMRHITRFDEKPAHPQPMLDQPEQALVSMGVYVFDADYLFAALQT
FT                   DIEDAASHHDFGKDLIPAIVSRGEAMAHPFDLSCVKSSPESPSYWRDVGTVDAYWAANI
FT                   DLTATIPQLDLYDKDWPIWTYQPTSPPAKFVFDDEGRRGMAVDSLVSGGCIVSGALVRR
FT                   SVLFTGVHLHSYSSVEESVLLPEADVGRHCRLRKVVVDEGCRIPAGMTIGFDAEDDARR
FT                   FHVSADGVVLVTVAMLEALRVSQA"
FT   gene            complement(535130..536668)
FT                   /locus_tag="Rfer_0514"
FT   CDS_pept        complement(535130..536668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0514"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68266"
FT                   /db_xref="GOA:Q221N7"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N7"
FT                   /protein_id="ABD68266.1"
FT                   /translation="MSPAQAATAAIFSQRCSGVLLHLTSLPGPHGSGDLGAEAYHFVDW
FT                   LVSAGQRLWQILPLSPVGPGNSPYHSPSTFAGNPLLVDLDELVKNGWLSAQEPPVFEVG
FT                   RCDFERVAPYRLQRLREAWQGFLEHTQASDWTEFERFRLQQAHWLEGYAFFMALETHHG
FT                   KPWTQWPTGLAQADLAALAAVGESMADELGFFSFIQWRFMVQWQRLRDYAHARGIAIVG
FT                   DAPIFVAHHSADVWLNTDLFLLDPLGEATVVAGVPPDYFSVTGQRWGNPLYRWDVMAEQ
FT                   GFAWWKDRLSHLLELVDVIRLDHFRGFESYWEIPATEPTAVAGCWRQGPGQALFDALAQ
FT                   ARLQQGASGLLPIIAEDLGIITQAVTDLRQNCGFPGMRVMQFAFGDTPANPYLPHNFDV
FT                   QTVAYTGTHDNDTTLGWWQTAGAGQRHVARAYLGPLADFEIHWAMMQSLSQSKANTVIF
FT                   PLQDVLGLDGLHRMNTPGVAQGCWQWRFAWRQVGDTPARRLKDMAHAHGRNLLR"
FT   gene            complement(536665..538884)
FT                   /locus_tag="Rfer_0515"
FT   CDS_pept        complement(536665..538884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0515"
FT                   /product="Glycogen debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68267"
FT                   /db_xref="GOA:Q221N6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N6"
FT                   /protein_id="ABD68267.1"
FT                   /translation="MLTSDADALANRPGLPCKTGQSWPLGATCMTLDGQSGINFAVYSR
FT                   HAEAIELCLFDEHGAQETARIRLPAHSDGVWHGFVRGLKAGQLYGLRAHGPYQPAHGQR
FT                   FNPAKLLLDPFARALKGSTQHLSLERDYLGQAAADATVLNAAPDPHDNAPRMPKAQVLD
FT                   LAAELQGGAAITRKPGVPLARTVLYEAHVKGLTQRHPDVPVALRGTYAGLASPPMLAHY
FT                   RHLGITTLCLLPVQLFVTEAHLLQKGLRNYWGYNTLAYFVPEPAYASGQFTDDRTEFRH
FT                   MVDQLHQHGLEVVLDVVFNHSAESDTFGPTLSWRGLDNASWYALDTAGQYLNFSGCGNS
FT                   FNLAQPCAVQLVMDSLRWWVQAFGVDGFRFDLATALGRDPILHHDFHPMSGLLTALAQD
FT                   PVLAGIKLIAEPWDLGPNGYQLGRFPARWHEWNDRFRDTSRAFWLGHHSTRGGLARRLT
FT                   GSSDYFDHDGRSPLACINLLSAHDGMTLADLTSYRHKHNLANGEGNRDGQHHNLSANAG
FT                   VEGPTDDVTVQSVRAQWRRALLATLFCSQGLPQLLAGDELGHSQQGNNNAYCQDNETSW
FT                   LDWPGADPELTNFVGGLVHLRQTHAALRHARWFTGRATAGAGVTAADIAWRRPDGAAMA
FT                   APDWDDAQSRSFAGLIEVTDTAEASDAMPLRWLLLVHAGDEPQIFALPPGRWHTVLDSA
FT                   ASWVLPDAQWNSAPACTQAITAAPRTMLGLVQHVTNPVLPLEAQA"
FT   gene            complement(538923..540248)
FT                   /locus_tag="Rfer_0516"
FT   CDS_pept        complement(538923..540248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0516"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68268"
FT                   /db_xref="GOA:Q221N5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N5"
FT                   /protein_id="ABD68268.1"
FT                   /translation="MTSSASNTPQIKPAWIDTFKVYLEPPTLRMLLLGFSAGLPLLLVL
FT                   GTLSFWLREAGLDRTTIGYLSWVGLAYAFKWVWAPLVDRMPIPLLTRWMGRRRSWLLLA
FT                   QLAVMAGLVAMSFNDPRVALQPVVWGALAVAFGSATQDIALDAFRIESANINRQAALAA
FT                   AYQTGYRLAMIWAGAGVLWVAARAEVAGVAGYQHGAWQTAYLVMAASMLLGVLTVLLSP
FT                   EPLRRAMPSAKNAREWLRGALIEPFADFLHRYGKQALLILALIAIYRISDVVMGIMANP
FT                   FYVDMGYTKDEVAAVTKIFGVIMTLVGAFVGGVLSMRFGVMRVLMLGAVLSAATNLLFA
FT                   ALSTRGHDLTALIFVISADNLASGIASAAFIAYLSSLTNINYSATQYALFSSMMLLAPK
FT                   FLAGYSGRYVDAFGYQNFFIGTSLLGLPVLLLVWLASRARQA"
FT   gene            540292..541137
FT                   /locus_tag="Rfer_0517"
FT   CDS_pept        540292..541137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0517"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68269"
FT                   /db_xref="GOA:Q221N4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N4"
FT                   /protein_id="ABD68269.1"
FT                   /translation="MNTPYHCPLCLTRRLALQGMALTLVLPGATWPIALAREGVDVGGN
FT                   SVFSNLVPAETVERSAGQQYAQLLQQAAAQHALGSKDHPQVRRLRAIANKIIPFASTWN
FT                   PRASNWRWEVSLIGSKQINAFCMPGGKIAFYSGILEQLKLTDAEIATVMGHEMAHALRE
FT                   HARARLGKNAATGIGASLLGQVLGLGNLGQTVTNYGAQLLTLQFSRSDESDADLVGMEL
FT                   AARAGFDPRAGVTLWQKMAAASRGAPPQWLSTHPSGSTRISDIERNLPKVTPLYERAKQ
FT                   "
FT   gene            541203..542825
FT                   /locus_tag="Rfer_0518"
FT   CDS_pept        541203..542825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0518"
FT                   /product="phenylpyruvate decarboxylase"
FT                   /EC_number="4.1.1.43"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68270"
FT                   /db_xref="GOA:Q221N3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR017765"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N3"
FT                   /protein_id="ABD68270.1"
FT                   /translation="MNLTESLLHALKAHGARQIFGIPGDFALPYFRIIEKSAILPLYTL
FT                   SHEPGVGFAADACGRISGGLGVAAVTYGAGAFNMVNAVASAYAEKSPLVVLSGGPGKGE
FT                   SQSGLLLHHQAKTLDSQFQIYKEITCDQVRLDDAERAPADIARALANCLRHSQPVYIEI
FT                   PRDMVAEPCLPVTAQAALAVDPDALDACVTDILQRLAQASAPVLMAGVEVRRFGLEAKV
FT                   AELSSRLALPVVTSFMGVGLLAQTEAPLVGTYLGVAGLPEVTQLVENSDGLFLLGVIVS
FT                   DTNFAVSEKKIDLRKTIRALAGQVTMGYHTYSHIPLAALVDHLLLRVPATDKKFSVKHQ
FT                   SYPHGLVADAASITPTDIATAVNDLMARHGKLPIASDMGDCLFTALDIEHTALIAPGYY
FT                   ATMGFGVPAGLGLQAATGERPLILVGDGAFQMTGWELGNCRRYGWDPIVLLFNNASWEM
FT                   LRTFQPESGFNDLDHWGFAEMAAGMGGDGVRVNTRAELKAALDKAIATRGRFQLIDITI
FT                   PRGVLSETLSRFVAGVKRLSTPQ"
FT   gene            complement(542970..544172)
FT                   /locus_tag="Rfer_0519"
FT   CDS_pept        complement(542970..544172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0519"
FT                   /product="Rh-like protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68271"
FT                   /db_xref="GOA:Q221N2"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N2"
FT                   /protein_id="ABD68271.1"
FT                   /translation="MEALKQGADTLFILLGAVMVLAMHAGFAFLELGTVRRKNQVNALV
FT                   KILVDFSVSTIAYFLVGYGVAYGTHFFVGAEQLAAKNGFELVRFFFLLTFAAAIPAIIS
FT                   GGIAERARFWPQLIATAVIVGFVYPFFEGIAWNQHFGVQGWIKSLTGAEFHDFAGSVVV
FT                   HAVGGWVALPAVILLGARANRYRKDGGISAHPPSSIPFLALGAWVLTVGWFGFNVMSAQ
FT                   TLDKISGLVAVNSLMAMVGGTLAALVAGKNDPGFVHNGPLAGLVAVCAGSDLMHPLGAL
FT                   VVGVVAGALFVRMFTLTQNRWKIDDVLGVWPLHGLCGTWGGIAAGIFGSQALGGLGGVN
FT                   LGAQLIGTAMGVAWAVAGGLLVYGGLKAVMGLRLSQEEEYNGADLSIHMISATAEREVN
FT                   W"
FT   gene            544383..544946
FT                   /locus_tag="Rfer_0520"
FT   CDS_pept        544383..544946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0520"
FT                   /product="protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68272"
FT                   /db_xref="GOA:Q221N1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N1"
FT                   /protein_id="ABD68272.1"
FT                   /translation="MDAFLVSTGIVALAEMGDKTQLLALLLAVRFRRPWPIVLGIFVAT
FT                   LANHALAGAVGAWVTTVLGPDVLRWVLGGSFIAMAVWMLIPDKMDDDETGAAPRFGVFG
FT                   TTVIAFFLAEMGDKTQVATVMLAAQYHAYFSVIAGTTLGMMLANAPVVWLGERMTRLLP
FT                   LRAVHIVSALIFLGLGLAALLGWI"
FT   gene            complement(545013..545180)
FT                   /locus_tag="Rfer_0521"
FT   CDS_pept        complement(545013..545180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68273"
FT                   /db_xref="UniProtKB/TrEMBL:Q221N0"
FT                   /protein_id="ABD68273.1"
FT                   /translation="MAKEFRTEAERKASPRPVAPKGVCYTAGHGQMRSLERGTATNNKK
FT                   NPGKRCKKGG"
FT   gene            complement(545258..545611)
FT                   /locus_tag="Rfer_0522"
FT   CDS_pept        complement(545258..545611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68274"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M9"
FT                   /protein_id="ABD68274.1"
FT                   /translation="MCRINSQKASVKKTFKLDIEGKNRDRVLEATKHEIRKYVKRQRRV
FT                   PLPEGVDYWDFDCKFGSNEANAAVVHFATITSLIDALAKDGGAEFYLELLAKPGHRAAR
FT                   AAGAEPSDQADRD"
FT   gene            complement(545691..547379)
FT                   /locus_tag="Rfer_0523"
FT   CDS_pept        complement(545691..547379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0523"
FT                   /product="acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68275"
FT                   /db_xref="GOA:Q221M8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M8"
FT                   /protein_id="ABD68275.1"
FT                   /translation="MNSRMNPAPNSLYLADTHELSNLSTELCDYNMYTQDAALREAVQR
FT                   EGGQWAEGELSEFGQMTGSADYLELGNLANKFQPEFDTHDRFGNRIDLVKFHPSYHQLM
FT                   KTSIEHGLHASPWTAPRAGAHVARAAKSFLHGQVEAGHGCPITMTFAAVPALRLQSDLA
FT                   SVWEPKVTARVYDPRNVPVEQKQGVTIGMAMTEKQGGSDVRTNSTRAYPVGTGGPGQAY
FT                   ELVGHKYFVSAPMCDAFLVLAQAPGGLSCFLLPRWRPDGSKNPMQVLRLKKKMGNASNA
FT                   SSETELRGALAWMVGEEGRGVRNIIEMVSMTRFDCMIGSSAGMRMAASQALHHCSVRSA
FT                   FGQVLNQQPLMQNVLADLALESEAATTLTMRMARAMDNRFEEQEDLLVRLVTAVGKYWI
FT                   CKRTPNHAYEAMECIGGSGVMEDSMMPRLYREAPVNTIWEGSGNVQCLDVLRALSKTPA
FT                   VVDAFFAEVNQARGAQALLDRHIAALATDLKDLADFEYRARDVVDRMALALQASLLVRH
FT                   APAFVSDAFCESRLGQVGQHNYGTLPRGVDAGAIIARATPRIARA"
FT   gene            complement(547372..548217)
FT                   /locus_tag="Rfer_0524"
FT   CDS_pept        complement(547372..548217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68276"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M7"
FT                   /protein_id="ABD68276.1"
FT                   /translation="MKVNPKNLVLDLMLATGDKPMAARDAILAGALFNISENSLRVTLA
FT                   RLSAAGLIEAAERGAYRLGPAATDLAGEVATWRTMESRLRAWQGSHIVVHCGALGRSDR
FT                   AAPQRRERALQMMGLRLLERGLYIRPDNIESDLDEVRQRLFKLGLDHNAAVFRASGLDP
FT                   AREAVVHQLWNGQALTRTYRQLRAELEAWLARANQLPLDAAARESFLLGGKAIHQLVFD
FT                   PLLPEPFVDTRERHAFIQAVHHFDEAGRAIWNRFFASVADTPPALHLTPQPAELETINE
FT                   "
FT   gene            complement(548359..549561)
FT                   /locus_tag="Rfer_0525"
FT   CDS_pept        complement(548359..549561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0525"
FT                   /product="phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68277"
FT                   /db_xref="GOA:Q221M6"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M6"
FT                   /protein_id="ABD68277.1"
FT                   /translation="MTHVVPPSKPIMNPLCTTILIATCAVTTGARGQNNINVSAGPAAW
FT                   QTCANLTGDSEARLICFDRWAAQQAGAAASRAPSPGASALAQTPATPALAPVAPAPVTI
FT                   TMEAPAAHNCKNKLFSELSRFWELEAGSDCGTFGIRGFHPISLSWIGSDSVNTQPSSPA
FT                   PDHTAAEALGYGNNEVRIQLSVRTKIAQGLLTGQQELKRDSLWFGYSQQSNWQIFSGDL
FT                   SRPFRTTDHEPELTYIYPTDVPLPLGWRLRYSGLSLVHQSNGQPLPLSRSWNRNVLMAG
FT                   MEKGNQFRVDAKLWKRVNENLANDDNPDISNKIGRAEVAAFWTPNQDNTLGVTLRHSLR
FT                   ADANGSVRLEWLRQLTSSGLPGSQDALRFHTQLFSGYGDSLVDYNRRRTVLSIGLSLVD
FT                   W"
FT   sig_peptide     complement(549463..549561)
FT                   /locus_tag="Rfer_0525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.784) with cleavage site probability 0.721 at
FT                   residue 33"
FT   gene            complement(549590..551239)
FT                   /pseudo
FT                   /locus_tag="Rfer_0526"
FT   gene            551325..552383
FT                   /locus_tag="Rfer_0527"
FT   CDS_pept        551325..552383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0527"
FT                   /product="porin, Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68278"
FT                   /db_xref="GOA:Q221M5"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M5"
FT                   /protein_id="ABD68278.1"
FT                   /translation="MVHCQLRAVLAASGASFAQSSVTLYGIADVYLGNTKLTGHDGVST
FT                   TTNSLGSGGVSTDRWGFKGSEDLGGGLKANFLLEQGFNIDTGAAKGTGNNAAGLPVAGA
FT                   QGFARQSYVGFSGGFGEVKLGKMWTAFDDVNGATDAVFDSALSPMYYVFTSTNYNANPG
FT                   NSVYYTTPTFSGFSGTVSYGLGENKTAAQNAGSNAAFNVQYTGGPVYVALGYQSEKDNG
FT                   NVSSRDFTRVNASYDLGVVKLMGNLGRTKANDKSTNEWQLGVDYPVGSALTLSASYAAS
FT                   KGGVLTTFAPTAAGTADVKRTGFGIGASYSLSKRTSLYGGYMAAKEEANANFVGTADAE
FT                   TKLFAVGLRHAF"
FT   sig_peptide     551325..551381
FT                   /locus_tag="Rfer_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.932) with cleavage site probability 0.648 at
FT                   residue 19"
FT   gene            552646..553662
FT                   /locus_tag="Rfer_0528"
FT   CDS_pept        552646..553662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0528"
FT                   /product="porin, Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68279"
FT                   /db_xref="GOA:Q221M4"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M4"
FT                   /protein_id="ABD68279.1"
FT                   /translation="MKKSLIALAVLAASGAAMAQSSVTLYGVADVGFAHEDNGSTSVNR
FT                   MDSGNLNGSRWGLKGSEDLGGGLKAIFTLEAGFSLDTGAQADAASFFNRQSFVGVSSNF
FT                   GTVKLGRQMNPVYATASTWDSFGDALAGDSSHLFSYNGSRTNNMISYNYSANGFYGELQ
FT                   YGLGEVAGNNSITGDNSAGRSAAMFVGYMRGPFDVVLTHQNIHNSGPYTTATKMTLLGG
FT                   NYDFGVVKLFAAYAVEKTLGVGAKDQKDAHLGLTAPVGTAGTVELSYLRKKDDLVSNAN
FT                   AHQVAVGYVHTLSKRTALYTSYAQMSNESAAAYSAGKLVVPAGNSDKVFDIGVRHSF"
FT   sig_peptide     552646..552705
FT                   /locus_tag="Rfer_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(553812..554819)
FT                   /locus_tag="Rfer_0529"
FT   CDS_pept        complement(553812..554819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0529"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68280"
FT                   /db_xref="GOA:Q221M3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M3"
FT                   /protein_id="ABD68280.1"
FT                   /translation="MGEFELIERYFKRPERHAARVALGIGDDCALLQPAPGTQLAISCD
FT                   MLVEGRHFVSTLDPFKLGHKALAVNLSDLAACGARPLAFSLALALPRADESWLAPFAQG
FT                   LLALADAHSCELIGGDTTQGPLNICITVFGEVPVMAGRSQALLRSGAQAGDDLYISGNL
FT                   GDARLALEVFRGTVSVPEAVFTAARVRLETPTPRVALGLALRGVANAAIDVSDGLLGDL
FT                   GHILQQSGVGATVDADVATSLIAAHAYYTGATGQFDTNIAPEQWRRWALSGGDDYELLF
FT                   TAPVARREAVAAAAAASLTPVTRIGQIEAERGLRLMDAQRQPVPDRYASFDHFA"
FT   gene            complement(554822..556876)
FT                   /locus_tag="Rfer_0530"
FT   CDS_pept        complement(554822..556876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0530"
FT                   /product="putative site-specific recombinase transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68281"
FT                   /db_xref="GOA:Q221M2"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M2"
FT                   /protein_id="ABD68281.1"
FT                   /translation="MTQKLDLAELLDALDPQAHLAHRHLWLIDLLRWVRGGRDSVPHAV
FT                   ARMTLLLDTLQQRPDARAKLQAWWRVLLSTVDATALLADYGFSSRSAFASELAERLRLK
FT                   WLPGTPETVDASALFSLVLCDAFDAQWISALDDATLMRLSELLQLSCLDAGNDNCAWVP
FT                   QVKQGSVSPWQATLLEALTFCTSQIRATGFSPELRLRMSAPALETAPFHALDGDIMALQ
FT                   VAFLASPHVNSAERQDALQRYLSRLEACRQAAASVYTHLDANGISVNLVFQLRQLRERV
FT                   LRVRALLDCLLAANPQASTARLLAHLVLVGQARRSLRALIASNSSMLAAKVAERSSETG
FT                   EHYITRTRAEYGAMLRDAAGGGAVMSLTTLFKFMVLSLGLSAFWSGFYAGLNYALSFVL
FT                   IQLLHWTVATKQPAMTAPAMAAKLKDLDEPGAIDLFVDEVTHLVRSQVAAVVGNLALVA
FT                   PCVVLISAALWFTLGKPMIDVKEAEHVLHTLHVFGPTALFAALTGVLLFASSIIAGWVE
FT                   NWFVLHRLDSALRYNPKITAALGIARAGRWAQFMRDNISGLAANVSLGLMLGLVPAFAA
FT                   FFGLGLEVRHVTLSTGQLAAAAASLGLAVLQQSAFWWCVVGIVVTAVLNVGVSFYFAFR
FT                   LALRAHNIGGIDRSRIRTAIRARWRHAPLSFFLPAKETIPTPPANDKVD"
FT   gene            complement(556888..557280)
FT                   /locus_tag="Rfer_0531"
FT   CDS_pept        complement(556888..557280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0531"
FT                   /product="ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68282"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M1"
FT                   /protein_id="ABD68282.1"
FT                   /translation="MSQYQFRVEVESRYLADQSAPQQDLYVFAYTITIINVGQVSAQLI
FT                   SRTWNVNDANGHTERVKGLGVVGQQPLLKPGEAFEYTSGTRLRTPTGTMHGSFFCVAED
FT                   GEKFDVDVPMFVLDGLSPSGGARTLH"
FT   gene            557358..558074
FT                   /locus_tag="Rfer_0532"
FT   CDS_pept        557358..558074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0532"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68283"
FT                   /db_xref="GOA:Q221M0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q221M0"
FT                   /protein_id="ABD68283.1"
FT                   /translation="MNSKATIYTSPMTYRIAPSILSADFARLGEELSHVIAAGCDWIHF
FT                   DVMDNHYVPNLTFGPMICGALKPHAKTAGGVAVPIDVHLMVQPVDALASAFADAGADLI
FT                   SFHPDASGHVHRSIQAIKAKGCKAGLVFNPAEPLDVLDWVIDDIDLILIMSVNPGFGGQ
FT                   SFIDSALRKIEDVRRRITACGKDIRLEVDGGVKVDNIRRVADAGADTFVAGSAIFGQPD
FT                   YKSVVDAMRLALGTAA"
FT   gene            complement(558088..558591)
FT                   /locus_tag="Rfer_0533"
FT   CDS_pept        complement(558088..558591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68284"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L9"
FT                   /protein_id="ABD68284.1"
FT                   /translation="MKTALLSLWWLRIATFLLAALAAASATYWVLKWQATVPASLTAAV
FT                   VYTAPPAADPQVVARLLGGGQTSVSAKLVDSAASHFKLSGVLANRASDSYALISVDGKP
FT                   AKPYRVGAHVNDELVLHSVAPRSASLAISLDAPVSVTLELPKLTQAQTQAPTRPAPAKA
FT                   PTEE"
FT   sig_peptide     complement(558514..558591)
FT                   /locus_tag="Rfer_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.383 at
FT                   residue 26"
FT   gene            558642..559085
FT                   /locus_tag="Rfer_0534"
FT   CDS_pept        558642..559085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0534"
FT                   /product="General secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68285"
FT                   /db_xref="GOA:Q221L8"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L8"
FT                   /protein_id="ABD68285.1"
FT                   /translation="MKSISQSMRRRLQAGFTLIELMVVLLIIGVLAALIVPNVLDRADD
FT                   ARVTAAKTDVNNLMQALKLYRLDNQRYPTAEQGLQALLTKPTTAPVPPNWKSYLDLLPN
FT                   DPWGKPYVYLNPGIKGEVDVMSLGADGQAGGEGKNADIGSWQP"
FT   gene            559132..559599
FT                   /locus_tag="Rfer_0535"
FT   CDS_pept        559132..559599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0535"
FT                   /product="General secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68286"
FT                   /db_xref="GOA:Q221L7"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L7"
FT                   /protein_id="ABD68286.1"
FT                   /translation="MTKTSTNRGFTLLELLVVVAVIAMASAGVGFAMRDTSQVQLERDA
FT                   ERLAALLESARARSRVSGVPVRWRATPTGFRFEGLAPSAQPDSDLPEQWLDPDTRVADG
FT                   PATAPALTLLLGPDPIIEPQQVELTSRTQPGKSVRLATDGVRPFAVLAGVP"
FT   sig_peptide     559132..559230
FT                   /locus_tag="Rfer_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.801 at
FT                   residue 33"
FT   gene            559596..559976
FT                   /locus_tag="Rfer_0536"
FT   CDS_pept        559596..559976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0536"
FT                   /product="General secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68287"
FT                   /db_xref="GOA:Q221L6"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L6"
FT                   /protein_id="ABD68287.1"
FT                   /translation="MNSARQPQRHGARGFTLVEVLVALGIVAIALLAGLQATAALTRNA
FT                   QRQSDVLLAQTCAENELVKVRLARQLPDVGDSSIACEQAGEVFTVALAVRPTPNFNFRR
FT                   VDAQVFKGDDAVLRLSTVAGRY"
FT   sig_peptide     559596..559715
FT                   /locus_tag="Rfer_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.838) with cleavage site probability 0.801 at
FT                   residue 40"
FT   gene            559976..560656
FT                   /locus_tag="Rfer_0537"
FT   CDS_pept        559976..560656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0537"
FT                   /product="methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68288"
FT                   /db_xref="GOA:Q221L5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L5"
FT                   /protein_id="ABD68288.1"
FT                   /translation="MTHPGLPRLRVKGFTLIELLVAISLMALMAALSWRGLDGMTRAQT
FT                   QMRRHSDDVLTLQAGLAQWGADLDALATQPNTPSLDWDGRALRLLRASTAMPGEGLRVV
FT                   AWSRRTIDGAGQWLRWQSPPLTTRAQLQLAWQQAALWGQNPSDEARTREVRVAALDQWQ
FT                   IFYFRDNAWSNPLSSAGASGAAQAATAALIPDGVRLELTLSAGQAISGRVTRDWVRPTL
FT                   GSGK"
FT   gene            560653..561630
FT                   /locus_tag="Rfer_0538"
FT   CDS_pept        560653..561630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0538"
FT                   /product="General secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68289"
FT                   /db_xref="GOA:Q221L4"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L4"
FT                   /protein_id="ABD68289.1"
FT                   /translation="MKSQRGAAILTAMLTVVLVASLASATLWQQWRGVEVEAAERSRMQ
FT                   SAWILSGALDWARLILREDGRKGGADHLAEPWAVPLEQARLSSFLAADRSDTQAADAAQ
FT                   EAFLSGQITDLQSRLNVANLVQNGAIDVDSERAFTRLFEVLDLPETELVLLLDKLRLAQ
FT                   GAPAGAAVAAAPLDAPDAASITLWPQTIDQLAWFGLSAHSIAVLRPFITILPVRTPVNL
FT                   NTAAAEVIYACVEGFDLADAHRLVRERNAIHLATLSDASKISGKTSVQFNAALHSVSSR
FT                   FFEVRGDLRIDQATVQEVSVVQRDGLEVKTLSRQRVASSSPTLQ"
FT   sig_peptide     560653..560730
FT                   /locus_tag="Rfer_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.637 at
FT                   residue 26"
FT   gene            561627..562886
FT                   /locus_tag="Rfer_0539"
FT   CDS_pept        561627..562886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68290"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L3"
FT                   /protein_id="ABD68290.1"
FT                   /translation="MTADTHQPAPMTTLIVTLPAEPLDAAALYDYVLTRDGSTVAEQSR
FT                   APLALLPLVGKADCEVVALVSAQRLSWHQVQLPKGTLGRRLFQDGGALRVRAVLDGLLE
FT                   DRLLDDTEQLHFALEPQPPTDAPVWVAVCERAWLRAALQVLEQSGRAVSRIVPEFTPQA
FT                   LTNTLYVTGEADAAYLVGAAEGSVAVLPLSREAMALLAGSEEKNVVAEPAVVASAEALF
FT                   QRPVTLQQSALRQLQAAQSAWDLAQFDLVTSQSARTWKRWAGAARGLLSAPRWRAARLA
FT                   VLALLIINLAGLNAWAWKEKSLLNSQRQAIQAVLTTTFPQVRVVVDAPTQMAREVATLQ
FT                   QASGAPSGRDLESMLGAFGAVAPVNAVPEAIEYVAGEARLKGLKLTAEQLTAIASQLKP
FT                   QGYAVNVEADNVVIKQVAAL"
FT   gene            562883..563380
FT                   /locus_tag="Rfer_0540"
FT   CDS_pept        562883..563380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68291"
FT                   /db_xref="GOA:Q221L2"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L2"
FT                   /protein_id="ABD68291.1"
FT                   /translation="MKLLSELQARWRLLARREQRLLLAALALVLLTLLWSLALAPALAT
FT                   LKAAQQQRLVLDAQWQQMQRLQAQAKVLQAQPPLSFADARRLLEASIKPLGATAQLVVA
FT                   GERVTLSFKGISADALAQWLAQVRLTARAVPSEARLVRGAAVVGGAPGGWNGTLVLSLS
FT                   AR"
FT   sig_peptide     562883..563017
FT                   /locus_tag="Rfer_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.627 at
FT                   residue 45"
FT   gene            563435..564277
FT                   /locus_tag="Rfer_0541"
FT   CDS_pept        563435..564277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0541"
FT                   /product="putative general secretory pathway N
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68292"
FT                   /db_xref="GOA:Q221L1"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L1"
FT                   /protein_id="ABD68292.1"
FT                   /translation="MFRRPTILRTPARSRPRTSAPSALPLTAPWSWAWSGALLGLAVAL
FT                   LLNAPARWLTVAVQQGLQERVLLSDARGTVWNGSARLTLTGGAGSIDAATLPGRLTWQL
FT                   RPNWLGLAAELSADCCMQQPWRLSLQPRWGGARLALADSQSQWPAQWLTGLGTPWNTVQ
FT                   PEGLLSLSTHGLAAEWAAGRLLLSGRAQLDALHMSSRLSTLKPMGSYRVTLSGGATSTL
FT                   GLSTLEGALQLSGTGQWVGARLRFDGIASATPERLDALSNLLNIIGRRDGARAIIKVG"
FT   sig_peptide     563435..563536
FT                   /locus_tag="Rfer_0541"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.548 at
FT                   residue 34"
FT   gene            564284..566392
FT                   /locus_tag="Rfer_0542"
FT   CDS_pept        564284..566392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0542"
FT                   /product="type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68293"
FT                   /db_xref="GOA:Q221L0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q221L0"
FT                   /protein_id="ABD68293.1"
FT                   /translation="MKLRAPIKPKNAIYSIAVCAILTGVTALFPINLLAQASAVSKPGE
FT                   AVTLNFSNADIEAVARTMATITGTNVVVDPRVKGTLTLVTDKPVSRRAAMNQFQAALRL
FT                   QGFTMVESAGLYKVVPEADAKLQSGAVTVSDEAIGGALGNQITTQIFKLNFESANNLVA
FT                   VLRPLISPNNTINVNPGTNSLVITDYADNLRRMARIIAAVDVSNATDVEILPLKHAIAT
FT                   DLAPLVLRLVESSAAGTAPGQADTSFKTILVAEPRSNALILRAANPARVALVKSLVDKL
FT                   DQPAAPGLNGEAGNIHVVYLKNADATKLAATLRAAMTGQAPAAAAPGVAAAATVAVVAA
FT                   TQSTTGGQIQADVATNSLIITAPEPQYRQLRAVIDRLDGRRAQVLVESLIVEVNADRAA
FT                   EFGIQWQGPLGKAGDGVIGLLGTNFGAAGKNIINLATGAGAVAPGAGLNFGAVQRTNGV
FT                   YVLGFLANFLETSGSGNVLSTPNLLTLDNEEAKIVIGENVPFVTGSYTSNNTSGASVNP
FT                   FTTVERKDVGLTLKVKPQINEDGTVKMVIYQETSAVKAGTEKDANGPTTSKRTIESTVL
FT                   VDDGSIVVLGGLLQDKYSGNQDKVPGLGDVPLFGNLFKSEARTRNKTNLMVFLRPVVVR
FT                   DAHASDQLSMDRYDLMRSGMNAAQPVASQLVPINEAPQLPALPGSQPAVQRLQPPEPLG
FT                   ATPAKPQL"
FT   sig_peptide     564284..564391
FT                   /locus_tag="Rfer_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.735 at
FT                   residue 36"
FT   gene            566410..567798
FT                   /locus_tag="Rfer_0543"
FT   CDS_pept        566410..567798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0543"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68294"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K9"
FT                   /protein_id="ABD68294.1"
FT                   /translation="MRYPLPYAFARTHQLLLEDEAGDLTLCVHPDSGGSAVSEVMRKFP
FT                   VRHLQSLGAQALIQRISAAYAQGESSAAAVVSEVESDADLTRMMQDLPAIEDLLETSDD
FT                   APIIRMLNALLTQAARDGASDIHIEPYERHSSVRFRVDGTLREVVQPNRALHAALISRL
FT                   KIMAELDIAERRLPQDGRISLRIGTRAVDVRVSTLPSAHGERAVLRLLDKSEGRLSLEA
FT                   LGMQGEVLKRFEHLVTQPHGIVLVTGPTGSGKTTTLYAALSRLDASRSNIMTVEDPIEY
FT                   ELAGVGQTQVNAKIELTFAKALRAILRQDPDIIMIGEIRDFETAQIAIQASLTGHLVLA
FT                   TLHTNDATSAVTRLTDMGVEPFLLSSSLLGVLAQRLLRKLCLTCHGAGCSACGQTGYAG
FT                   RSGVFELLVTDDAIRAQIHGRAAEADIRAAALASGMTLMRDDGERLVRLGLTSREELVR
FT                   VTRD"
FT   gene            567813..569048
FT                   /locus_tag="Rfer_0544"
FT   CDS_pept        567813..569048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0544"
FT                   /product="General secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68295"
FT                   /db_xref="GOA:Q221K8"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K8"
FT                   /protein_id="ABD68295.1"
FT                   /translation="MPVYSFEALTADGETRKGVIEADSAKGARSLLRGQAMVPIKVESV
FT                   GAQAAGQDGAGGAGAGRSLRRRVFSATGLAIWTRQLAGLVSSGLPLERALTSLSDEAER
FT                   DNEHHLVALLRAEVNGGATFAKALSQHPREFTPIFIAVIGAGEQSGNLGLVLERLADDL
FT                   EEQQALKAKLIGAALYPAIVSLVAVVIVLFLVTYVVPQVAHVFAGSKRALPLLTVIMIG
FT                   TSAFVRSYGWLMLVAIIFGVIGARLALANALFREKFDAAWLNLPILGKLSRSYNTARFA
FT                   STLAMLAAAGVPILKALQAAAETLSNRAMRTDALDALVLVREGAPLASALAQKKRFPGL
FT                   LAMFARLGEQTGQLPTMLQRAAKQLSVEVQRRAMQLATILEPLLIVVMGVVVMLIVLAV
FT                   LMPIIQLNQLVK"
FT   gene            complement(569083..570768)
FT                   /locus_tag="Rfer_0545"
FT   CDS_pept        complement(569083..570768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0545"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68296"
FT                   /db_xref="GOA:Q221K7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K7"
FT                   /protein_id="ABD68296.1"
FT                   /translation="MEKIWLKSYPPGVPHDVNPEQYQSLTQLLEESFRKNASSRFAVCM
FT                   ESWMTYGQLDQLSSALGAWLHSLGLAPDARVAIMLPNIPQFPVTMAGVLRGGYTCVNVN
FT                   PLYTARELQHQLNDSGASVIVVLENFVATLAEVIDQTPIQHVVVASMGDLLGFWYGQWI
FT                   TFAVRHLAKMVPPYKLTLTEGRTATSFKQAIAKGAALPFRSAPSTLDSIAFLQYTGGTT
FT                   GLSKGAVLTHRNIVAAVLQAEAWFNPALSRIGDVRHVNSIAALPLYHIFALTLSLLAIR
FT                   WGAQLTLIPNPRDFGGFIETLKKRPFHLLPGVNTLFNALLAQPQFKTVDFSSLCATQAG
FT                   GMAASEGTAQRWLETTGCPMVEGWGMSETCAIGTNNPVLAREFSGTIGLPLPGIDIAIK
FT                   DDEGQSLAQGSPGEICIRGPNVMTGYYRQPEENRRAFTTDGFLRTGDVGIMDERGYTKI
FT                   VDRKKDMILVSGFNVFPSELENVISLCDGVLECAVIGVPDEKQGEAIKVFVVRDNPLLA
FT                   EDDVARYCQQNLTGYKHPKYIEFRDELPKSNVGKILRRELRVGK"
FT   gene            complement(570815..571606)
FT                   /locus_tag="Rfer_0546"
FT   CDS_pept        complement(570815..571606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68297"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K6"
FT                   /protein_id="ABD68297.1"
FT                   /translation="MQKRTISRAWHLGRLRVYMEATNIIRDAVSRVTALRQSATDKPEL
FT                   AQAISEVKRLQARRFAGTYVDLLRTEQYQPAALFFLEELYSEKDYTLRDAQFARIASGL
FT                   ERLFPQQVVQTAVSMARLHHLTEELDLAMALCWLNHGELGEVARYVAAWRSVGRRADRD
FT                   IQLATVLEVGQELDRLTRTPGLRMMLKMMRGPARMMGLSALQQFLESGFDTFAAMGRKG
FT                   EGASYFLDTVRQREAGLIERLFQASAVACETEITRILGQAL"
FT   gene            571621..572127
FT                   /locus_tag="Rfer_0547"
FT   CDS_pept        571621..572127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68298"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K5"
FT                   /protein_id="ABD68298.1"
FT                   /translation="MQRRTWLKLGAVSATVLILAGGATALLQPGLRQGRLTPGAQDVFT
FT                   SVARAILDSTLPTEPAQAQAALTGLVPRIDALVQALPPHAQAELSQLLGLLGTGLGRRT
FT                   LAGLAPDWRSASVAEVQQALQSMRSSRLGLRLQSYQALHDIVGAAYFSDASTWPTLGYP
FT                   GPLTI"
FT   sig_peptide     571621..571698
FT                   /locus_tag="Rfer_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.779 at
FT                   residue 26"
FT   gene            572159..573778
FT                   /locus_tag="Rfer_0548"
FT   CDS_pept        572159..573778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0548"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68299"
FT                   /db_xref="GOA:Q221K4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K4"
FT                   /protein_id="ABD68299.1"
FT                   /translation="MSSLQDPIRDGLKRGWKVLGGAHGARPEKMVCDVAIIGSGAGAGI
FT                   SAELLARAGLRVVIIEEGPLKSSSDFNQKEAEAYPALYQESAGRKTSDKGVTILQGRCV
FT                   GGSTTVNWTSSFRTPLDTLSYWQQKFALPDYTNDALAPYFQQAETRLNMGPWLVAPNEN
FT                   NDLLRRGAARLGIPAAAIARNVKGCWNLGSCGMGCPTNAKQSMLVTTIPAALDLGATLL
FT                   VETRAEQFELVNGRLRSVRCIAVKPNGAPVESGVNATTIVAKHFVLAAGAINSAALLLR
FT                   SNAPDPHGRLGRRTFLHPVVMSAAIMSQKVQAWAGAPQTIYTDHFLGTQPIDGPIGFKL
FT                   EAPPLHPVIFASTVFGCGQEQAAMLAQFPHTHVLLALLRDGFHEEAAGGQVKLRGDGSP
FT                   ELDYPLTDFVMAGARRALLAMMEIQFAAGARQVLPMHESARPCNNWTEGRQAVAALSMQ
FT                   PLLTKVVSAHVMGGCGLAGTEALGVTRPDGVHWQLDNLSIHDGSIFPTSIGANPQLSIY
FT                   GIVNRLAQGLVKRLTGQDLSLA"
FT   gene            complement(573900..574217)
FT                   /locus_tag="Rfer_0549"
FT   CDS_pept        complement(573900..574217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0549"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /note="FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68300"
FT                   /db_xref="GOA:Q221K3"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K3"
FT                   /protein_id="ABD68300.1"
FT                   /translation="MELRLSPTTMPTTVRPTLAPRLSSSQVTGGADGGFSGALKSALSS
FT                   VSAAQNDATRLQREVQMENPNVSLEETMVAIQKAQIGFQATLHVRNRMVQAYTDIMNMQ
FT                   V"
FT   gene            574319..576085
FT                   /locus_tag="Rfer_0550"
FT   CDS_pept        574319..576085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0550"
FT                   /product="flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68301"
FT                   /db_xref="GOA:Q221K2"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K2"
FT                   /protein_id="ABD68301.1"
FT                   /translation="MFSQPGRIIVSIGGAKLPHTDLETLGNPMSAAPAIAINPTLSQRF
FT                   SGLDQGQRLRMGLGLVVFVAIGIIGLMMGRQAEWRVLYANLADKDGGAIVAQLTTMNVP
FT                   YKYADGGGAILVPADKVYDTRLRLASQGLPKGAVAGFETMDANRFGMTQFQERLAFQRG
FT                   LEGELTRSIQALSSVQSARVHLALPNQNGFFREQQKPSASVLVSLNAGRTLDRAQLAGI
FT                   VHLVSSSVPEMNASAVSVLDDSGKLLSTPPEGADGAGGGDAQQLQYVQQLEQLYSRRIL
FT                   DILEPVVGRGNARAQVTAELDFSQTESTSESHKPNQTPDSSAIRSQQVSESSNGSGISG
FT                   PPSGVPGATSNKPPGPSSAPINGAPQTLTAAGAGASAGAGGRRESIINYEVDKTVKVVR
FT                   GGTGIVKRISAAVVVNHQSVTDAKGKTTTTPLSAQQIEQMTALVRETVGFNKERGDSVN
FT                   LMNAPFTTERVVPVDLPFWKQSEIQDLARSLAWPLGTLLFGALVLLGVIRPALKTLAQS
FT                   QPRISASSHQLNAIESEAPERAQLAAPARSSELAGPTSGELALDDARKLTRDNPAAVAN
FT                   IVKTWINGEAPA"
FT   gene            576109..577107
FT                   /locus_tag="Rfer_0551"
FT   CDS_pept        576109..577107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0551"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68302"
FT                   /db_xref="GOA:Q221K1"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K1"
FT                   /protein_id="ABD68302.1"
FT                   /translation="MNQTDGLQDAAILMMSLGEAEASEVFKHLSPKEVQKLGEAIAKTK
FT                   AITRERVDEVVDRFTGVAAAQSLLVSNSGDYVRSVLKRALGDDKAALLIDRILQGGDVS
FT                   GIESLKWMDPSSVAELLRNEHPQIVAAILVHLDFDQAADVLKFFAERQRNEVMLRVATM
FT                   EGIQPSALKDLNEVLFQVLAGGDKVRKSSLGGVKTAAEMINLMGTAIEGTVIESIRNHD
FT                   PDLAQKIMDKMFVFDDVMKLDDKAIQTVLKEVSSDVLIVALKGAQPELKEKFLANMSTR
FT                   AAEALREDLESRGPMRLSEVEAQQKEILKTVRRLADEGTIVIGGGADDLMV"
FT   gene            577110..577793
FT                   /locus_tag="Rfer_0552"
FT   CDS_pept        577110..577793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0552"
FT                   /product="flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68303"
FT                   /db_xref="GOA:Q221K0"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q221K0"
FT                   /protein_id="ABD68303.1"
FT                   /translation="MRNYSRFIPGEEIDAVEQWNFAAVDTASLLLAAQVKVRDEAAEES
FT                   KQEACRQAGYAEGFAQGRAQATMEAQRQMADFIAHQGSDAARQFAQLFATVQAQLAEAE
FT                   QVMAQGTLELACELARQVLRRELSVDPKAVQPVIREALGLLAADTKSAVVRLHPLDLNV
FT                   LEEVVRTEFSSLSLTLLADPTLTRGGCLIESAGTVVDGTLEKRWMRAVASLGLDSSWEE
FT                   PADEQ"
FT   gene            577783..579198
FT                   /locus_tag="Rfer_0553"
FT   CDS_pept        577783..579198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0553"
FT                   /product="ATPase FliI/YscN"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68304"
FT                   /db_xref="GOA:Q221J9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J9"
FT                   /protein_id="ABD68304.1"
FT                   /translation="MNSDASVKWQLFMDSARKRVSTGSTLALRGTLTRLTGLVLEASGI
FT                   RVPVGSQCLVTMKAQTPVLAEVVGFSNDRAFLMPAGDVHGLSSGASVEPAAAYVAVPRL
FT                   GERRQTERISGYATLRLPLGDGLLGRVVDAQGAPMDRRGPIEDVTAVPLDRQPINAMDR
FT                   APVRETLDTGVRAINALLTIGRGQRIGLFAGSGVGKSVLLGMMARYTKADVIVVGLIGE
FT                   RGREVKEFIEDILGDDGRARSVVVAAPGDAPPLLRMQGAAYATAIAESFRDKGKHVLLL
FT                   MDSLTRYAMAQREIALAIGEPPATKGYPPSCFAKLPQLVERSGNGLHGVGSITAFYTVL
FT                   SEGDDQQDPIADAARAILDGHIVLSRALAESGHFPAIDIEQSASRVMHNVVPQQHFEMA
FT                   RRFRAINSRYEKGRDLVQIGAYVGGSDPALDEAIQLHDDMARFLQQDMLEASTLDASVC
FT                   AMAKALDHEEAVA"
FT   gene            579195..579662
FT                   /locus_tag="Rfer_0554"
FT   CDS_pept        579195..579662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0554"
FT                   /product="Flagellar export FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68305"
FT                   /db_xref="GOA:Q221J8"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J8"
FT                   /protein_id="ABD68305.1"
FT                   /translation="MSAVKSFLLAIDLSTRKRDEAAQDLMRVQSAHVFAQDQMNQLEVY
FT                   AAETASRWTACAQVGTTPELMRHHYQFLDRLQHAIGLQQGVLANESRKVAQAKRLVLEA
FT                   EFRLVSLKQVLKKKQAGLALVQTRREQKQMDEFAALQTRRTSAGHFSGNQL"
FT   gene            579659..580843
FT                   /locus_tag="Rfer_0555"
FT   CDS_pept        579659..580843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0555"
FT                   /product="flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68306"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J7"
FT                   /protein_id="ABD68306.1"
FT                   /translation="MSVESSSTASSPKILGAVESSSAKDKGKVKSGEKPDDVPGGFLAL
FT                   ITALDSDTDVSAEVSVATTAPDADPALLLAQAGATGAVRAVGAGGATGTVGVGAVGAKA
FT                   GVANEPLAQTTLPTSGRASSAASLLNLEPGNPKQAVDAMLEQAAQTSPAWSTKGKGAGF
FT                   QSAVSATVADARAVQQAGRADSAASEPALSGTLLSGEGALLSSEIGDALLKPVQRSANK
FT                   FSGLSANAGMEGAWGHQALLAGNRVNTSVALASPSMQSLGPAVADTVSYWVTQGVQNAE
FT                   LKLDGLGGESVEVKISLKGDQAHIGFRTDQPEIRQMLEGALAHLRDALKSEGLVLSGVS
FT                   VGASGQDGSGAQEQRNPPGIRQAGQANLITTEQLPTPGQQRVNLTVGRALDLFV"
FT   gene            580958..581557
FT                   /locus_tag="Rfer_0556"
FT   CDS_pept        580958..581557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0556"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68307"
FT                   /db_xref="GOA:Q221J6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J6"
FT                   /protein_id="ABD68307.1"
FT                   /translation="MATKPDAAKPDAVKLDADEPGKKPVWRKKMLIIVIAGVMVLVSAG
FT                   GGAFFFISKKRAAAAVEGTGGASAVAVEAAPKGPPVYLPLDNMVVNLADPGGEKVAQVG
FT                   ITLQVVDAHASESVKAYLPSIRSGVLMLISQRTAAELLTQEGKQKLAKDIWRETLIPFG
FT                   GGEAGAAPAGVKKKAAKAAQAELPVVGVLFSSFIVQ"
FT   gene            581579..582568
FT                   /locus_tag="Rfer_0557"
FT   CDS_pept        581579..582568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0557"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68308"
FT                   /db_xref="GOA:Q221J5"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J5"
FT                   /protein_id="ABD68308.1"
FT                   /translation="MSESFLSQEEVDALLEGVTGESQKLVEEVHEKGEVRSYNISSQER
FT                   IVRGRMPTMEIVNERFARNLRVGLFNFIRRSPEISVGPVTVQRYSAFLRELAVPTNFNI
FT                   VAIRPLRGSGMIVCEPSLVFGVIDTLYGGIGKFQARIEGRDFSATEQRVINRLVDVITE
FT                   EYKKAWKGVYPLELEYQRSEMQPQFANIATPSEIVISTSFQLEIGEIAGSIHFCMPYAT
FT                   LEPIRDILYSSTQGDSIEVDKRWVNVLTQEIQAAEITLVAELARADATVEQLLAMKTGD
FT                   FIELDRPSRIEVTVEGVPVFECQYGTHNAKYAIRIDKSLRGNDLNWKG"
FT   gene            582573..582992
FT                   /locus_tag="Rfer_0558"
FT   CDS_pept        582573..582992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0558"
FT                   /product="Flagellar motor switch FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68309"
FT                   /db_xref="GOA:Q221J4"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J4"
FT                   /protein_id="ABD68309.1"
FT                   /translation="MAIDEKPAEDDGMADWAEALLEQKSSEPTAEPGGVLAGDTSHSFS
FT                   SSDAPISDINRVLDIPVQLSVELGRTKVPIKHILQLGQGSVVELDALAGEPMDVLVNGY
FT                   LIAQGEVVVVNDKFGIRLTDVVTPSERLRRVSKGG"
FT   gene            582992..583315
FT                   /locus_tag="Rfer_0559"
FT   CDS_pept        582992..583315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68310"
FT                   /db_xref="GOA:Q221J3"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J3"
FT                   /protein_id="ABD68310.1"
FT                   /translation="MQPMTQALLSVGLFVLLLALVPIGLKWLQARSAAGAGGVLVASRV
FT                   ISAVAVGPHQRVVTVEVGPEGARVWLTLGVTAQAITCLHSAALDPHGQASLAQATQTPP
FT                   AQL"
FT   gene            583326..584108
FT                   /locus_tag="Rfer_0560"
FT   CDS_pept        583326..584108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0560"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68311"
FT                   /db_xref="GOA:Q221J2"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J2"
FT                   /protein_id="ABD68311.1"
FT                   /translation="MVSDQFVYSALGKGPLSKVAVVLLAILTQSAALAQSAGQLPLLMG
FT                   SGPSGVSFSVPIQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLMRQALGTQSAPPNQVI
FT                   VGLSLFLTFLVMGPTLDKVYSEAYLPYTNSGMPFEQALAKAEDPLRQFMSKQTRQSDLA
FT                   LFAKLAKLEPGATAQTVPMRVLVPAFVTSELKSAFQIGFMIFIPFLVIDIVVASVLMSL
FT                   GMMMLSPVLVALPFKLMLFVLADGWNLLIGSLAASFVT"
FT   sig_peptide     583326..583430
FT                   /locus_tag="Rfer_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.911) with cleavage site probability 0.877 at
FT                   residue 35"
FT   gene            584130..584387
FT                   /locus_tag="Rfer_0561"
FT   CDS_pept        584130..584387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0561"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68312"
FT                   /db_xref="GOA:Q221J1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J1"
FT                   /protein_id="ABD68312.1"
FT                   /translation="MVLTMGQEALIMLLMVSAPVLGVVLVVGLLVSLFQAVTQINEATL
FT                   AFVPKLVAAMAVFALAGPWMLSILVDYIRRTFEAIPSAVM"
FT   gene            584449..585171
FT                   /locus_tag="Rfer_0562"
FT   CDS_pept        584449..585171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0562"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68313"
FT                   /db_xref="GOA:Q221J0"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:Q221J0"
FT                   /protein_id="ABD68313.1"
FT                   /translation="MIWPFLRVLAVFTAAPLFSSKAFPLRARIGLAFFIAFAAQPSLQG
FT                   QPIISISGPEAMGAVAQQVGIGLAIGFTVRLVFAAVELAGEVVGFQMGLGFASFFNPAL
FT                   NTQSSAVARFFGQMATFLFVVMNGHLMVLMAVIKSFDKFPVNQNFLEAIGQMKIYDFGT
FT                   DLFASGLWIALPMVGMLLFANLALGIVSRVAPQMNIFAIGFPVTLTVGMVGIAATLPML
FT                   DQPFMTLMERAIDIFAGK"
FT   sig_peptide     584449..584517
FT                   /locus_tag="Rfer_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.829) with cleavage site probability 0.624 at
FT                   residue 23"
FT   gene            complement(585217..585846)
FT                   /locus_tag="Rfer_0563"
FT   CDS_pept        complement(585217..585846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0563"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68314"
FT                   /db_xref="GOA:Q221I9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I9"
FT                   /protein_id="ABD68314.1"
FT                   /translation="MIHVILCDDHAMTRRGIRDTLAEAVDIQVTAEAGSYAEVREAMRN
FT                   ATCDVLVLDLNLPGRGGMEVLSSLKEAHSPIKVLIVSMFPEDQYAIRCLRAGAQGYLNK
FT                   AGDPADLISAVRTVAQGGKYVTPAVAHMLVESLSIPENQTLHAALSERELQTLLKIASG
FT                   KRLADIAEELMLSPKTVSVYRARVLEKLKLSNNAELTVYAIRNELV"
FT   gene            complement(585881..587032)
FT                   /locus_tag="Rfer_0564"
FT   CDS_pept        complement(585881..587032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0564"
FT                   /product="putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68315"
FT                   /db_xref="GOA:Q221I8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I8"
FT                   /protein_id="ABD68315.1"
FT                   /translation="MRPHCCTDAGHLHLRASPTMIPFTMAQTHPHPRPLRILHLEDSAL
FT                   DHELVKRALLKSHQPCELERVETLNEFGRRVKEFEFDVILADYRLPGFTALDAWHILQQ
FT                   QTRQPPFVLLSGAIGEPAAVAAIKTGISDYLAKDDLGRLAQVIRRALEVHDIRRAKEMA
FT                   DSELARSEKRLADFAEHLQMTIEQERAAIAREIHDDIGGALAAVRFDLSWIGRHTADPV
FT                   TQQHITAATEMLQQAIGASQRIMMNLRPAILDQGLVAAVQWLAGGFAKRTGIKTTVHAA
FT                   PEAGTLSKAVQLVAYRTAQEALTNIAKHADCSQVTIDLSDAENVLTLEIKDNGKGISPI
FT                   ELSKPQAFGVRGLHERAKTVGGWLDVSTHLGSGTSIILSVPLA"
FT   gene            587149..587625
FT                   /locus_tag="Rfer_0565"
FT   CDS_pept        587149..587625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68316"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I7"
FT                   /protein_id="ABD68316.1"
FT                   /translation="MRCLVKRLDTRMQANQTSYSVPAVQLPVMLVAEVQDSLLVVVHDL
FT                   NRLDGLLVHTMENLMERFTCASANLADPMLVDSAALDAVRSALRAAVTELQFQDIASQL
FT                   IVHTSKILQGCAYRLASESMGLEDGEAVPFVEEVPERPNPVTQDAMDAGSIELF"
FT   gene            587668..588030
FT                   /locus_tag="Rfer_0566"
FT   CDS_pept        587668..588030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0566"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68317"
FT                   /db_xref="GOA:Q221I6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I6"
FT                   /protein_id="ABD68317.1"
FT                   /translation="MSLILAVDDSPSMRKMVSFTLTGAGYQVVEAVDGVDAYEKAQAQS
FT                   FDLVLTDQNMPRLDGLGLTRKLRDHPQFKTVPILVLTTESSDLMKQAGRAAGATGWLVK
FT                   PFDPARLLEVIKKVIK"
FT   gene            588078..590267
FT                   /locus_tag="Rfer_0567"
FT   CDS_pept        588078..590267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0567"
FT                   /product="CheA signal transduction histidine kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68318"
FT                   /db_xref="GOA:Q221I5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I5"
FT                   /protein_id="ABD68318.1"
FT                   /translation="MAEAHQESSSTAADFDLSQFYQIFFEEAAENLDLMEQMLLSLNLE
FT                   TADDEELNGIFRCAHSVKGGAATFGFSDVAELTHQMESLLDRLRRHELQPNSAMVDVLL
FT                   ESADASRGLLARHQAGGEGDAPPTADLVRRIKALVAGEVAQALPSVAPPQPLPTPVVAP
FT                   AIVAVQSKAVLAPTPQPSNTTRSLEIRIGPLDHPAQADAIKELFRDIEGLGDITVVACN
FT                   QADTRVFAVETSSTDADLLDLFAFHVSREQVSIKEVDNVAVMPETGLGFFDGAAGSHET
FT                   SLYDDPPPGAPLAPAPGFGFFDGAPGAPVPVAAATGVAGGLSGSTASARGGGKATSPVV
FT                   QPEAATIRVAISKVDQLINLVGELVITQAMLAQNSRALDPALYQQLLTGLTDLDRNTRD
FT                   LQESVMSIRMIPMSIVFSRFPRMLRDLAGKLGKKVDFVTQGEATELDKGLVEKITDPLT
FT                   HLVRNSCDHGIEMPADRIRAGKSETGTITLSAAHQGGSIVIEVRDDGHGMSREKILTKA
FT                   RERGMDVSDQMPDSEVWMLIFAPGFSTAEVVTDVSGRGVGMDVVKRNIAALNGTVEIDS
FT                   VEGYGMKVSIRLPLTLAIMDGMSVGVGDEVYILPLSSVVESFQVKSDAVSTVGQGAQLV
FT                   KVRDEYMPVIELEKVFQVPRFDFDKSSDIMVVIEADGSRVALLVDELLGQQQVVVKNLE
FT                   SNYRKVPNISGATILGDGKVALILDTGALVRRSRH"
FT   gene            590292..590780
FT                   /locus_tag="Rfer_0568"
FT   CDS_pept        590292..590780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0568"
FT                   /product="CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68319"
FT                   /db_xref="GOA:Q221I4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I4"
FT                   /protein_id="ABD68319.1"
FT                   /translation="MGAMERIGEMTSAGAREYLTFRLDQEEYGIDILKVQEIRGYEPPT
FT                   RIANAPNFIKGVVNLRGTIVPIVDMRLKFNCSKAEYDSFTVVIILNLHSRIVGIVVDSV
FT                   SDVMELPPESLKAAPDVDSVIDGDAVLGLGSLGDRMLILLDIEKLMSGVDMALAPDVV"
FT   gene            590817..591713
FT                   /locus_tag="Rfer_0569"
FT   CDS_pept        590817..591713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0569"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68320"
FT                   /db_xref="GOA:Q221I3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I3"
FT                   /protein_id="ABD68320.1"
FT                   /translation="MALVRTDVRPNAAVRMPVGGVSDAGGADMQGREFAWTDADFDRVQ
FT                   ALIYQRAGISLHDGKHAMVYSRLSRRLRDTGYQSFKDYLGWLETHDGPEWQEFVNALTT
FT                   NLTSFFREQHHFEIFASHLKSRPAGTAWRVWCNAASTGEEPYSIIMTALEALGPQANLT
FT                   LTASDIDSKVLASAAQGVYRLEGLKGVNEERIQRFFLRGKGGNAGMARVKPELQRMIEF
FT                   ISVNLIRDDWPFRQPFDVVFCRNVMIYFDAPTQRKVLERIHRVMVPGGLLFVGHAENFS
FT                   ESRDLFVLKGKTVYERR"
FT   gene            591776..592480
FT                   /locus_tag="Rfer_0570"
FT   CDS_pept        591776..592480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0570"
FT                   /product="CheD, stimulates methylation of MCP proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68321"
FT                   /db_xref="GOA:Q221I2"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221I2"
FT                   /protein_id="ABD68321.1"
FT                   /translation="MNMFASGTAALPLRASGVVVAPTVLAGGALSRVDQLKAQIRNPGE
FT                   ASFFYRDHHFQYDAVKVLPGEYFVSAEDLVIMTVLGSCISACIWDGRVRAGGMNHFMLP
FT                   DGDSVDGFGRYGSYAMELLINELLKKGARRESMQAKVFGGAAVMAGFTTMNVGERNTKF
FT                   VLDYLATERIPVVSQDVLDIHPRKVCFFPVTGKVLVKRLAHSHPETLAVEERKGNAATV
FT                   AKATSGGSVDLF"
FT   sig_peptide     591776..591856
FT                   /locus_tag="Rfer_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.756 at
FT                   residue 27"
FT   gene            592458..593579
FT                   /locus_tag="Rfer_0571"
FT   CDS_pept        592458..593579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0571"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68322"
FT                   /db_xref="GOA:Q221I1"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221I1"
FT                   /protein_id="ABD68322.1"
FT                   /translation="MARWICFEDIELKKIRVVVVDDSALVRSLLAEIINRQKDMECVGT
FT                   ANDPLIAREMIRELNPDVLTLDIEMPRMDGIDFLGRLMRLRPMPVVMVSTLTERGAEIT
FT                   MKALELGAIDFVAKPRIGVASGLTELSDQIVEKVRIAATAHVRRAPAVPAAATPAVGGA
FT                   VGGHAPVASIGRVSTEKLICIGASTGGTEAIKEILTRLPADSPGIVITQHMPPGFTTSF
FT                   AARLNSLCQIAVQEAVNGERILPGHAYIAPGGKQFRVSRSGANYVALVEDGELVNRHKP
FT                   SVEVLFKSVASVVGRNAYGVMLTGMGNDGAKAMREMKDAGSYNFVQDEASCIVFGMPRE
FT                   AILHGAADEVLPLTAIAPALIAKLSSATDRYRV"
FT   gene            complement(593580..595175)
FT                   /locus_tag="Rfer_0572"
FT   CDS_pept        complement(593580..595175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0572"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68323"
FT                   /db_xref="GOA:Q221I0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q221I0"
FT                   /protein_id="ABD68323.1"
FT                   /translation="MFDYIIVGGGSAGCVLAARLSENPEITVALLEAGPVDSSVLIHCP
FT                   AGLALMAQTGQANWKVASVAQPGLNGRQGYSPLGKVLGGSSSINAMIYIRGQRQDYDLW
FT                   AAEGNAGWAYDDVLPYFKRAEHNERGGDAFHGSDGPLNVMDLRCPNRYSPAFVQAGQQA
FT                   GYAHNTDFNAATQEGVGMYQVTHKNGERFSAAKAYLTPNLARPNLQVFTGAHTTRILLE
FT                   HKRAVGVEFQHEGQVKQLKASREVLLCAGALHSPQILMLSGIGEHAHLVGMGIATQHNL
FT                   PGVGQHLHDHVDVVLVVNAPGAKDLFGISLTGMRHLIKGIVDWRQHRSGILTTNFAEAG
FT                   GFIKSQPIEATPDLQLHFVIGKLINHGRTVVFGHGFSCHVCLLRPRSRGSVKLASKDPL
FT                   ATPLIDPNFLGDRDDMDRMVRGFKLARRILAQPALAALGGRELEASIHAQSDAQIEQFI
FT                   RDHADTIYHPVGSCRMGNGPLDVVDAQLRVRGLEGLRVVDASIMPSVVSGNTNAPVIMI
FT                   AEKAADMIKAAQVL"
FT   gene            595347..595802
FT                   /locus_tag="Rfer_0573"
FT   CDS_pept        595347..595802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0573"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68324"
FT                   /db_xref="GOA:Q221H9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H9"
FT                   /protein_id="ABD68324.1"
FT                   /translation="MLSQNSNPQRDPELLLDNQLCFALYSTSLAMTKIYQPLLAALGLT
FT                   YPQYLVMLVLWEQDDVSVSALGERLFLDSGTLTPLLKRMEAAGFLRRTRSSLDERRVQI
FT                   ALTDSGRELKAQAAKVPACVVSAAHCPVAELMALTKKVQALRRQLTA"
FT   gene            595878..596306
FT                   /locus_tag="Rfer_0574"
FT   CDS_pept        595878..596306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0574"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68325"
FT                   /db_xref="GOA:Q221H8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H8"
FT                   /protein_id="ABD68325.1"
FT                   /translation="MVTKVEKVVYQAHATSTGGRDGSTRTSDGLLDIKLAVPKEMGGAG
FT                   GGVNPEQLFAAGYSACFIGAMKFVAGTQKLAMPANASIDATVGIGQIPAGFGIEVQMVV
FT                   HLPGMDRAVAQALIDKAHQVCPYSNATRGNIEVTLTLA"
FT   gene            596416..597543
FT                   /locus_tag="Rfer_0575"
FT   CDS_pept        596416..597543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68326"
FT                   /db_xref="InterPro:IPR021276"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H7"
FT                   /protein_id="ABD68326.1"
FT                   /translation="MTTLDFLVRKDQLAKTELRGAPELPLSDGEVRVRIDKFALTSNNI
FT                   TYAAFGEAMNYWSFFPVVASQDPGWGRIPVWGFSTVVQSLHPAVAVGERFYGYYPMSSS
FT                   VVLQPTRLSSAGFADGAAHRAALHPVYNQYSRCSVDPFYTGDSEDTQALLRPLFMTSWL
FT                   IDDFLADNDFFGALGAHGQRGVMLLSSASSKTAYGTAFQLAQRPGLDVVGLTSAANVGF
FT                   CDSLGCYQRVLSYEQLDQIEAATPCVYIDFAGNADLRRVIHTRFKNLRYSSSIGGTHVE
FT                   QLGGAKDLPGPRATLFFAPAQIKKRNTDWGADQLGRRLLQAWQAFVAKVTDPAEPWLVV
FT                   ERHQGPVAVEAAYRQVLAGRGDPRRAHMLSLNPHA"
FT   gene            597627..598682
FT                   /locus_tag="Rfer_0576"
FT   CDS_pept        597627..598682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0576"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68327"
FT                   /db_xref="GOA:Q221H6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H6"
FT                   /protein_id="ABD68327.1"
FT                   /translation="MFAPSPSSVVPHAYQALTPDVVMDALASVGLYGDGRLLALSSYEN
FT                   RVYQLHLEDGSVVVAKFYRPGRWSEAQILEEHAFSAELMEAEIPVVGPLQLNGNTLHHF
FT                   GGFAFSVAPSRGGRPPELDDPEVLEWIGRFLARIHTVGAAKPFASRPALDLQSFGIDSR
FT                   EWLLGHDQVPLDVQSAWAKASQDAINVIATHDCLTGATSQNDPYFEPIRQLRLHGDCHP
FT                   GNILWTPLDLPTSAGPGPHFVDLDDARSGPAVQDLWMLLSGDRQQRTRQLGCLVDGYEQ
FT                   FREFDRRELALIEPLRTLRLIHYSAWLARRWSDPTFPINFPWFGSSDYWQGQVQMLQEQ
FT                   LEAMEEAPLTV"
FT   gene            complement(598582..600012)
FT                   /locus_tag="Rfer_0577"
FT   CDS_pept        complement(598582..600012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0577"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68328"
FT                   /db_xref="GOA:Q221H5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H5"
FT                   /protein_id="ABD68328.1"
FT                   /translation="MFWRFFSFIACQLLGGLVGWYATSSSHAPTSELVSTLAGVVLGGV
FT                   VWFLLDTSRGARLLRWLRVGDASEVAMRSGLWGEVSDRARRLIRAREQMTLESQRRLQD
FT                   FLSALQASPNGVLLLDAQGQIEWLNQTAASHFGLDAQRDLLQHLGNLVRDPAFASYFAS
FT                   RDYRHELIMPGRESTPARPVRLSVHLHPYGEGRLLLLSSDITAVEQAEAMRRDFVANVS
FT                   HEIRTPLTVLAGFVETLQTLPLNDEERARYLALMAQQAGRMQTLVNDLLVLSRLEGSPL
FT                   PSDSEGIAVPALMHQLEQDGRALSAVMNPASEPLQHLTFDSSLAGDIMGAPNELLSALG
FT                   NLVSNAIRYTPSGGQIQVRARLLADDRAEFSVSDTGPGIAPEHIPRLTERFYRVDRSRS
FT                   RDTGGTGLGLAIVKHVAQRHGAELKIDSTPGKGSVFKIIFPASRVRLSKALPPSLPTAP
FT                   AASAPGPASSRWSQTTGS"
FT   gene            complement(600058..600780)
FT                   /locus_tag="Rfer_0578"
FT   CDS_pept        complement(600058..600780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0578"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68329"
FT                   /db_xref="GOA:Q221H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H4"
FT                   /protein_id="ABD68329.1"
FT                   /translation="MRQQPGVLIVEDEPAIAELIAVNLRHNGFRPTWAMDSASAQRELD
FT                   AVLPDVILLDWMLPGESGLALAKRWRAHPRTKAIPIIMLTARGDETDRVAGLDAGADDY
FT                   IAKPFSTKELLARMRAVLRRRAPEQVGGVVSVGALSLDTATYRVTFAGQPLKLGPTEFK
FT                   LLQYLMSHAERVHSRGQLLDKVWGDHVFIEERTVDVHVKRLREALGAQAGQMVETVRGA
FT                   GYRLTAQSIQAAPVQASA"
FT   gene            complement(600777..601478)
FT                   /locus_tag="Rfer_0579"
FT   CDS_pept        complement(600777..601478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0579"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68330"
FT                   /db_xref="GOA:Q221H3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H3"
FT                   /protein_id="ABD68330.1"
FT                   /translation="MPEKHLSTQFDSELSAVSTRVMEMGGLVESQIHQAIFALSQFSVE
FT                   VANQVSATEPRVNTMEVDIDRELSSIIARRQPTARDLRLLIAISKTTANLERVGDEAAK
FT                   IARMVRSIIESGGPRSLPANELRVAGDMASGLLRKALDAFARLDTTAAVAILKEDDLID
FT                   DEFNGFVRKLITYMMEDPRMISPSLDLLFLAKALERIGDHAKNIAEFIIYVVKGADVRH
FT                   TSMEQIESVLK"
FT   gene            complement(601488..602267)
FT                   /locus_tag="Rfer_0580"
FT   CDS_pept        complement(601488..602267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0580"
FT                   /product="Phosphate transport system permease protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68331"
FT                   /db_xref="GOA:Q221H2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221H2"
FT                   /protein_id="ABD68331.1"
FT                   /translation="MNTAVVTNAAPKIAVKNLNFFYGKFHALRDISLEIPEHKVTAFIG
FT                   PSGCGKSTLLRVFNRMFELYPEQRAEGEILLDGENLLTSKKDVALLRAKVGMVFQKPTP
FT                   FPMSIFDNIAFGVKLFESLNTTDLEERVEWALRKAALWGEVKDKLTQSGSSLSGGQQQR
FT                   LCIARGIAIKPEVLLLDEPCSALDPISTGKIEELITELKSDYTVVIVTHNMQQAARCSD
FT                   YTAYMYLGDLMEFGATEQIFFKPTRKETEDYITGRFG"
FT   gene            complement(602280..603164)
FT                   /locus_tag="Rfer_0581"
FT   CDS_pept        complement(602280..603164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0581"
FT                   /product="Phosphate transport system permease protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68332"
FT                   /db_xref="GOA:Q221H1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H1"
FT                   /protein_id="ABD68332.1"
FT                   /translation="MSTSELLLQAQALEQTRLARYAQRKLVNRVALTLSLLAMAFGLFW
FT                   LAWILFETIRLGVSGLNLATLTQMTPPPNDVGGLANAIYGSFLMVLLATFVGTPIGIMA
FT                   GIYLAEFEPKGWLASTTRFVNDILLSAPSIVIGLFVYAVVVTRFKSFSGYAGVLALALI
FT                   VIPVVIRTTENMLQLVPAGLREAAYALGAPKWKVIISITLRASSAGVLTGILLAVARIA
FT                   GETAPLLFTALSNQFWTSSLSGPMASLPVTIFKFAMSPYENWQKLAWAGVFIITMAVLG
FT                   LNILARVLTRSKT"
FT   gene            complement(603161..604192)
FT                   /locus_tag="Rfer_0582"
FT   CDS_pept        complement(603161..604192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0582"
FT                   /product="Phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68333"
FT                   /db_xref="GOA:Q221H0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q221H0"
FT                   /protein_id="ABD68333.1"
FT                   /translation="MSSTLPASEISLHQFEPTAGRVMSLPPAPKMARSGPMADRIFGWL
FT                   AKAAALFTLGMLIAILVSLTISAWPAIDRYGLDFLTSTTWDPVKEEFGGLVMIYGTLMT
FT                   SFIALLIAVPVSFGIALFLTELAPAWLKRPLGTAIELLAAIPSIVYGMWGLLVFSPVLA
FT                   TYVQQPLQAMFSGVPYMGAFFSGPPVGIGILSAGIILAIMIIPFIAAVMRDVFEITPTL
FT                   LKESAYGLGATTWEVVSTVVLPYTKAGVIGGIMLGLGRAIGETMAVTFVIGNFNQLDSL
FT                   SLFQAANSITSALANEFAEAGEGLHQASLMYLGLVLFFITFVVLSLSKILLAQLKKNEG
FT                   ART"
FT   gene            complement(604235..605278)
FT                   /locus_tag="Rfer_0583"
FT   CDS_pept        complement(604235..605278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0583"
FT                   /product="Periplasmic phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68334"
FT                   /db_xref="GOA:Q221G9"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G9"
FT                   /protein_id="ABD68334.1"
FT                   /translation="MKTSFKIALLSVASLASLSYATVAGAQEITGAGASFPAPLYAKWA
FT                   ADYNKATGVKINYQSVGSGAGIKQIDAKTVDFGASDMPLSDEVLAQKGQIQFPTVMGGV
FT                   VPVINVKGINPGQLKLNGQVLGDIYLGKISKWNDAAIKALNPTLALPDAAIAQVRRADG
FT                   SGTTFIFTNYLSKVNAEWKSKVGEGTAVNWPVGAGGKGNEGVSAFVGRLPNSIGYVEYS
FT                   YAKQNKMTYTLMQNAGGNFVAPDDATFKAAAAGADWAKSFYQILTNQPGKDAWPISGAT
FT                   FILMHKLQDKPANATETLKFFAWAYKNGDKQALDLDYVPMPKSVVGNIEKAWGEIKDAS
FT                   GKAVAFK"
FT   sig_peptide     complement(605198..605278)
FT                   /locus_tag="Rfer_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.965 at
FT                   residue 27"
FT   gene            complement(605575..606567)
FT                   /locus_tag="Rfer_0584"
FT   CDS_pept        complement(605575..606567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0584"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68335"
FT                   /db_xref="GOA:Q221G8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G8"
FT                   /protein_id="ABD68335.1"
FT                   /translation="MAPASSCHTDSMAFDAPIVGNTHQIRTIEAFDADEHAHNLTDWEQ
FT                   SYDQITRGHFHGALAELHLPQMQVFRERTSQAVRQSCCVWPDAFWFGLPEQSDQTRING
FT                   RLAGEHAIMVRPGACEFELVTPPDYAIYGIVIRREALWQAAELSGCRIDWAQLTGTEVM
FT                   HVDSSSRASLLQTLSGLLQDGGGCTDRDLRQQVLVNALLALLDTRAVDSAVSGSFQRRQ
FT                   RIVAKARDLVLAHHDQAITVPRLCEQLFVSRRTLQYCFEDVLGMSPMQYLRLIRLNGAR
FT                   RHLRQASSKSLTVQDVAADWGFWHFSQFSSDYRKLFGQSPSESLRQRSH"
FT   gene            606772..608175
FT                   /locus_tag="Rfer_0585"
FT   CDS_pept        606772..608175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0585"
FT                   /product="amino acid permease-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68336"
FT                   /db_xref="GOA:Q221G7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G7"
FT                   /protein_id="ABD68336.1"
FT                   /translation="MNPLDPSHHSGTHVLKPVLSTLQLWGIAVGLVISGEYFGWSFGWA
FT                   SAGTLGFTITSIFIAAMYATFIFSFTELTTSIPHAGGPFAYSKRAFGPVGGYLAGAATL
FT                   IEFVFAPPAIALAIGAYLNVQFPALDPKLAALGAYLVFMTLNIVGVQIAATFELAVTVL
FT                   AIFELLVFMGVVSPGFSMAHFTKGGWSGEDSFSLAAIPGMFAAIPFAIWFFLAIEGVAM
FT                   AAEEAKDPRRSIPVAYITGILTLVVLAIGVMVFAGGAGDWTKLSNINDPLPQAMKMIVG
FT                   ENSGWLHMLVWLGLFGLVASFHGIILGYSRQIYALSREGYLPPFFAKLHPRFKTPHRAI
FT                   LAGGAIGIAAIYSDELIKIGGQTLTANIVTMSVFGAILMYIISMLSLFQLRRAEPLMVR
FT                   PFRAPFYPLFPAFALLGAGVCMATMIYYNALIFGIFLGFLAMGYGYFLMTSHHRTHALA
FT                   MNNMAADLT"
FT   gene            608186..609583
FT                   /locus_tag="Rfer_0586"
FT   CDS_pept        608186..609583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0586"
FT                   /product="Ethanolamine ammonia-lyase heavy chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68337"
FT                   /db_xref="GOA:Q221G6"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G6"
FT                   /protein_id="ABD68337.1"
FT                   /translation="MQTHQYTHSVGATTYSFRDLKDLMAKATPERSGDLLAGVAAHSAQ
FT                   ERVVAQMALAEVPLKTFLTEVLVPYEDDEITRLIIDSHDATAFAPVSHLTVGDFRNWLL
FT                   GDEVDSAVLTALAPGITPEMAAAVSKIMRNQDLILVAKKCRVVTKFRNTIGLPGRMATR
FT                   LQPNHPTDDATGIAASLLDGLLYGSGDAVIGINPATDNVPQVIKLVTMMSDIIQQYEIP
FT                   TQSCVLTHVTNTIEAINRGAPVDLVFQSIGGTEATNRSFGVSLDLLGQARSAALSLKRG
FT                   TVGDNVMYFETGQGSALSANAHHGVDQQTCEARAYAVARHFKPLLVNTVVGFIGPEYLF
FT                   DGKQIIRAGLEDHFCAKLLGLPMGCDVCYTNHAEADQNDMDVLLTLLGVAGCSFVMGIP
FT                   GSDDIMLNYQTTSFHDALYVRRVLGLKPAPEFEAWLQKMQIFSRDAQFRLNPALPPAFQ
FT                   RALLRLA"
FT   gene            609590..610453
FT                   /locus_tag="Rfer_0587"
FT   CDS_pept        609590..610453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0587"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68338"
FT                   /db_xref="GOA:Q221G5"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G5"
FT                   /protein_id="ABD68338.1"
FT                   /translation="MDDPTSPVIANPWAALRQFTDARIALGRAGVSLPTAAHLDFQLAH
FT                   AKARDAVHLALDAPQLAQSLNAARGDQQAPCLLLHSAAADRPTYLQRPDLGRRLDAASS
FT                   AAVDALEPAQAPSPRPYDLAFVVVDGLSALAIEQNAAPFLRILQARIAPEHWSVAPICI
FT                   VKQGRVAIGDEVAERLGAKAVVVLIGERPGLSAADSMGLYLTWMPRVGLLDASRNCISN
FT                   VRPAGLGFDEAAYKLHYLLSQARQRQLSGVELKDETGGGPDRVTANQTNFLLDHAHTPN
FT                   EAAPPS"
FT   gene            610522..611733
FT                   /locus_tag="Rfer_0588"
FT   CDS_pept        610522..611733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0588"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68339"
FT                   /db_xref="GOA:Q221G4"
FT                   /db_xref="InterPro:IPR020916"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G4"
FT                   /protein_id="ABD68339.1"
FT                   /translation="MACGILPRSIQQQRHETNSTMNVTHNQGGPATRGILVRGRETGDA
FT                   SGARHAVLTLLDALDLAPHVRVEAGADALGPFVRLWLSDDRVQAWAPAHDTLQLCQTLA
FT                   LDTLNQPGDLMREIVLTLLMGPVAFEFPSLDELVSAVRIRRNIVQAARKTTLAFHTRAL
FT                   DRPLDCWTYDEDRGFTIRPGVSLIAALTKATQPEVSGSLYSFSCYRATEYVILLGIAQE
FT                   LQQSNPALLQQLQTMWTARPIASGEFHEVFLREQGSMEEPLPPRYFVPGDRTWFRNPDE
FT                   ASADASGFEGSWVMYLGGGLFCNFWKLDQPYTLTRKCVEIYHWRHGLYRDDNGDERIDE
FT                   VRIEPLIEASLNDPAERQRILAVMERYREPRGVYTEAGGCIDTTREFARWVRPGTADLV
FT                   LPAQ"
FT   gene            611730..612821
FT                   /locus_tag="Rfer_0589"
FT   CDS_pept        611730..612821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0589"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68340"
FT                   /db_xref="GOA:Q221G3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G3"
FT                   /protein_id="ABD68340.1"
FT                   /translation="MNSARPGRQTHVDALKLLASQLIVLHHFATYGPLAEALSEVAPAL
FT                   TNWFYDYARMAVQVFLVLGGYLAVRSLAPAGQLRPGAPWRAILQRYQRLILPFLAALVL
FT                   AVASAALARQWLSDDFIPGAPTWAQALAHAALLHGVLGHDSLSAGVWYVAIDFQLFALM
FT                   TLLLWLGRRPRWPQALLLGLMLASLFFFNRDEDWDNWALYFFGAYGMGAAAFWAGNARR
FT                   PGWLLGLLAGVGLLALVLDFRERITLALAVALLLGLLQWRHQTAASPLRLPASLSHAVA
FT                   LLGKTSYALFLVHFSVLMIGNALFAQLGLGASWLTWLFLLGCWACCLGLAVLFERWVEA
FT                   PLSRLGYRRNRGLSSASPHRAIL"
FT   gene            complement(612882..615512)
FT                   /locus_tag="Rfer_0590"
FT   CDS_pept        complement(612882..615512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0590"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68341"
FT                   /db_xref="GOA:Q221G2"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221G2"
FT                   /protein_id="ABD68341.1"
FT                   /translation="MNSTVAPASVADIRKIFLDFFASKGHTVVPSSPLVPGNDPTLMFT
FT                   NSGMVQFKDVFLGTDKRSYVRAASVQACLRAGGKHNDLENVGYTARHHTFFEMLGNWSF
FT                   GDYFKRDSLKWGWELLTKVYKLPADKLWATVYIDDDEAYNIWTQEIGLPPERVVRIGDN
FT                   KGAKYASDNFWMMADTGPCGPCSEIFYDHGPAIAGGPPGSPEQDGDRYIEIWNHVFMQY
FT                   DMQPDGSVKPLPAPCVDTGMGLERLAAILQHVHSNYEIDIFDALIKAAARETGCTDLGN
FT                   KSLRVIADHIRATAFLVSDGVLPSNEGRGYVQRRIIRRAIRHGYKLGQKAPFFYKLVPD
FT                   LVTLMGEAYPGLATQAERIAQVLQAEEERFFETLANGMQILDETLTGDAKVLPGDVAFK
FT                   LHDTFGFPLDLSADVCRERGVEVDEAGFHAAMEKQKAQGRAAGKFRMDRALEYSGDGND
FT                   FVGYERLTEVTKIVALYADSTPVSELKAGQAGVVVLAATPFYGESGGQVGDQGAIFSDG
FT                   AMFDVADTQKIKADVFGHHGVLKSGALKIGDVVTAHVNASLRAATQRNHSATHLMHKAL
FT                   REVLGAHVQQKGSLVNAERTRFDFAHNAPVTDEQIREVEARVNSEILSNAATQSRVMDI
FT                   DAAQETGAMMLFGEKYGESVRVLDIGASRELCGGTHVARTGDIGLFKVVAESGVASGVR
FT                   RIEAVTGQNALSYLQDLEDTVTQVAGTLKAPVVEINERVAGVLDHLKSLEKEIAALKGK
FT                   LASAQGDELVTQAVDVKGIKVLVAMLEGADTKTLRDTMDKLKDKLKSAVIVLAAVEGDK
FT                   VQIAAGVTSNSVGKVKAGELVNFVASQVGGKGGGKPDMAMAGGTEPAKLPAALASVMAW
FT                   VSAKL"
FT   gene            complement(615614..617008)
FT                   /locus_tag="Rfer_0591"
FT   CDS_pept        complement(615614..617008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0591"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68342"
FT                   /db_xref="GOA:Q221G1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G1"
FT                   /protein_id="ABD68342.1"
FT                   /translation="MFSLNPQSATPLVLQIVDGFRLAIQDGSLRPGSKAPSIRQFAHAH
FT                   GVSVFTVVDAYDRLVAQGYFTSRPHSGFFVRQRPVSNIEVPGHGPNFNFDSMWYLRRIF
FT                   ENRALRIKPGCGWLPGDWLFQDGVRRSLRSLATDDVDLGGYGEPKGYPPLRQLVRDLLA
FT                   EQEIAVSSEQVLLTQGSSQAMDLVARRLVRPGDAVLVDEPGYPNLLFSLRFLGARLIGV
FT                   PRTPVGYDLVTLERLVIKHQPKLFFTQPRLQSPTGSVAQLAHLHRVMQLADKYDFLVVE
FT                   NDIYADLDPEPRPSLASLDQLNRVIYISSFSKTISPNIRVGYLAANPDLLEDLAQLKMI
FT                   SGLTSSEFSERLAYGALMDGRWRKHVKNLRERLAKAHEGAASRLLKIGFEIFCEPKAGI
FT                   FLWAKHPAIADSAELAYKATEQDILLGPGHLFSPDLQPSPWLRFNVIFCDEPALFTFLE
FT                   QQCRAL"
FT   gene            617152..618450
FT                   /locus_tag="Rfer_0592"
FT   CDS_pept        617152..618450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0592"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68343"
FT                   /db_xref="GOA:Q221G0"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q221G0"
FT                   /protein_id="ABD68343.1"
FT                   /translation="MQRESNLKNASLMARRRAAVPRGVGQSHEVFIARGENAEIWDVEG
FT                   KRYIDFAGGIAVLNTGHCNPTVIAAVKAQLDLYTHTCFQVLAYEPYVELAERINALAPG
FT                   DFAKKTMFLSTGAEAVENAIKIARAYTKRTAIIAFTSGYHGRTLLTLGLTGKVAPYKTG
FT                   FGPFPAEIFHAQFPNALHGVSVDESIASIESIFKNDVEASRVAAIIVEPVQGEGGFNVA
FT                   PPEFLQRLRALCDQHGILLIADEIQTGAGRTGTWFAVEQSDVAPDMITLAKSMAGGFPI
FT                   SAVVGRADVMDAPAPGGLGGTYAGSPLSCAAALAVLEVFKQENLLDRSRQLGLRLTTSL
FT                   KKMAASHRCIADVRGLGAMVAIELCKGGDIHQPDADMAKRLAAEATQRGLILLTCGTYG
FT                   NVVRILVPLTASDAIVDEGLAIIDACLTAIQAV"
FT   gene            618556..619638
FT                   /locus_tag="Rfer_0593"
FT   CDS_pept        618556..619638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0593"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68344"
FT                   /db_xref="GOA:Q221F9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F9"
FT                   /protein_id="ABD68344.1"
FT                   /translation="MSSQELVKFAGVEKTYDGKTLVVRDLNLDIRAGEFLSLLGPSGSG
FT                   KTTTLMMLAGFESPTAGEIFLNGKPITRTPPHKRNFGMVFQNYALFPHMTIADNVAYPL
FT                   TVRNFSKAEREAKVLRALGMVQMDNLSARYPGQLSGGQQQRVALARALVFDPQLVLMDE
FT                   PLGALDKQLREHMQLELKALHRQLGLTFVYVTHDQSEALTMSDRVAVFSDGIIQQIDIV
FT                   TGLYETPANHFVAGFVGDNTVFDGTVAATRDGQCDLRLASGTVLSGLNVNAAATSSRVH
FT                   ACIRPERIEVHPAGASPGVNSLEAKVGDVIYFGDHLRLRCALPGQVDATVKIALSSPTV
FT                   PQSGQTVWLRLPPEHLRVYL"
FT   gene            619697..620728
FT                   /locus_tag="Rfer_0594"
FT   CDS_pept        619697..620728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0594"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68345"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F8"
FT                   /protein_id="ABD68345.1"
FT                   /translation="MKLKPIVAACALLACAASFAQTQITVVNFGGANGNAQKKAYFEPY
FT                   EKATGNKIVGVEYNGEQAKIKAMVEAKQVNWDVVEVESPDVTRGCDEGLFEKLDYSKIG
FT                   NKADFTPAAIHECGIGTFVWSTVMAYNADKLKTAPTTWADFWDVKKFPGKRAMRKGARY
FT                   NLEFALMADGVAVQDVYKVLATKDGAERAFKKLTELKPNIQWWEAGAQPPQFLVAGDVV
FT                   MTTAYNGRIDAAQREGKNLQITWTGGIYDLDYWVMPKGASNREATLKFIAMASSSKEQA
FT                   EYAKLISYGPTNVKALTMLDAKVLGKLPTAPANAKTALQFNVGFWADQGEALEKRFAAW
FT                   AAQ"
FT   sig_peptide     619697..619759
FT                   /locus_tag="Rfer_0594"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.887 at
FT                   residue 21"
FT   gene            620750..621991
FT                   /locus_tag="Rfer_0595"
FT   CDS_pept        620750..621991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0595"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68346"
FT                   /db_xref="GOA:Q221F7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F7"
FT                   /protein_id="ABD68346.1"
FT                   /translation="MAQSMTLDPGKLVGQLRRAERRKRAFAISLTLPLLLFLLFTFLVP
FT                   IGALLVRAVENPEVANTLGHTAKALSSWSRTAAPPAVAYAALIEDLSAIKEQSDAGALA
FT                   RRLNSEVSGARSLIMSTYRALPLAPGMTPEQVRTQLLALDARWGELSYWQAIAKNASRW
FT                   TPDYLLTSLDLKRDVQGHITQVDADSAAFANILVRTFKISAIVTLFCLLLGYPLAYWLS
FT                   ILSTRKANMLMILVLVPFWTSILVRVAAWIVLLQSNGLVNRSLMGLGLTDAPLPLLFNR
FT                   LGVIIAMVHILLPFMILPLYSVMKSVPPTYLRAAVSLGSHPLAAFFRVYVPQTWPGVGA
FT                   GGLLVFILSIGYYVTPALLGGAGDQMLSYYIAQYTNVNVNWGMACALGAVLLTATLVLY
FT                   ALYRRVVKSELSLG"
FT   sig_peptide     620750..620911
FT                   /locus_tag="Rfer_0595"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.774) with cleavage site probability 0.766 at
FT                   residue 54"
FT   gene            622066..622911
FT                   /locus_tag="Rfer_0596"
FT   CDS_pept        622066..622911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0596"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68347"
FT                   /db_xref="GOA:Q221F6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F6"
FT                   /protein_id="ABD68347.1"
FT                   /translation="MRALATLAAFARLPTFPAYATPADKVGWYALRVLCLGVLLFLLLP
FT                   ILVIMPLSFSSSSFLSYPMPGWSMQWYDNLFSSDEWGRATRNSFIVAPLATLLATVLGT
FT                   LAAVGLARVQFFGKGALMSLLIAPMVVPIVVVGVSTYLFFAKIGLADTYLGLILVHAAL
FT                   GAPFVLTTVLATLQNFNNNLVRASQSLGANQTQTFFRITLPIIAPGVISGALFAFATSF
FT                   DEVVVTLFIAGPTQVTLPRQMFTGIRENITPTIAAVATLLIIFTTTLMLGLEWLRGRRR
FT                   "
FT   sig_peptide     622066..622128
FT                   /locus_tag="Rfer_0596"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            622914..623861
FT                   /locus_tag="Rfer_0597"
FT   CDS_pept        622914..623861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0597"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68348"
FT                   /db_xref="GOA:Q221F5"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F5"
FT                   /protein_id="ABD68348.1"
FT                   /translation="MAPKNQPLSGNAMPRFGGIASMLRLPVSSSPEGLDAAFIGVPLDI
FT                   GTSHRPGARFGPRQIRAESALIRPYNMATGAAPFDTLQVADLGDVPINTYSLTKSLPII
FT                   TNFYRTVLEAGCTPLTLGGDHTIALPILRAMAAKHGPVALVHVDAHADVNEEMFGEPVA
FT                   HGTPFRRAVEEGLLDCHKVFQIGLRGSGYASDDFDWPRQQGFTLVMAHEVWYQSLAPLM
FT                   ANIRAHIGQTPCYLSFDIDGIDPAYAGGTGTPEIGGLTVPQALEIVRGCSGLNLIGCDL
FT                   VEVSPAYDVSGNTALLGANLLFEMLCVLPGVLRR"
FT   gene            623934..625412
FT                   /locus_tag="Rfer_0598"
FT   CDS_pept        623934..625412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0598"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68349"
FT                   /db_xref="GOA:Q221F4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F4"
FT                   /protein_id="ABD68349.1"
FT                   /translation="MSALLSPLSLLKDPTLLKTDALINGQWVSGSSRFAVTDPATGAHL
FT                   ADVANLGPAEAETAIAAANAAWPAWRNKTAKERSIILRKWYDLIMANQDDLGRIMTAEE
FT                   GKPLPEAKGEIAYGASFVEWFAEEAKRINGETLPQFDNNRRLLLLRQPIGVCAAITPWN
FT                   FPMAMITRKVSPALAAGCPVVIKPAELTPLSALAVAELALRAGIPAGVLNVITADADNS
FT                   IAVGKVFCASDVVRHISFTGSTEVGRILLAQSAPTVKKLSLELGGNAPFIVFDDADIDS
FT                   AVEGAFASKYRNAGQTCVCSNRFYVQEGVYDEFVQKFAAKVKTAKVGNGFEEGVNQGPL
FT                   IEEAALLKVERHVQDALLKGARLLTGGHRLPGQFFEPTVMADATADMLCAREETFGPFA
FT                   PVFKFKTEQDAIFAANNTEFGLASYFYSRDVGRIFRVSEALEYGMVGINVGILATEHVP
FT                   FGGVKQSGLGREGSHLGIDDYVEIKYLCIGDILK"
FT   gene            complement(625491..626156)
FT                   /locus_tag="Rfer_0599"
FT   CDS_pept        complement(625491..626156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0599"
FT                   /product="cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68350"
FT                   /db_xref="GOA:Q221F3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F3"
FT                   /protein_id="ABD68350.1"
FT                   /translation="MSHKVRVWDLPTRCFHWGLVVCFMGLITSAQIGGDAMAWHFRSGY
FT                   AVLSLLLFRIIWGLVGGRWSRFTSFIYAPAAILAYVKGRGLPEHTVGHNPLGSGSVFAM
FT                   LGFLLLQVMTGLVSDDEIANAGPLSQFVSNAVVSFATFYHAAIGRWVLIGLVVLHLSAI
FT                   FFYHLKKRQNLVLPMLLGDKETDSAVMSSRDDLGSRTWALALFLGCTALVAGMVKLAG"
FT   gene            626354..626806
FT                   /locus_tag="Rfer_0600"
FT   CDS_pept        626354..626806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0600"
FT                   /product="cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68351"
FT                   /db_xref="GOA:Q221F2"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F2"
FT                   /protein_id="ABD68351.1"
FT                   /translation="MKSSTLFVLAATVVAFSAPACAQFAKPEDAVKYRKNALFVMQQNF
FT                   GRLGAMATGKAPFDAKAAADSAAVAEFMSKLPWGAFGEGTDKGETRAKAEIWKEPAKFK
FT                   EYADKMQAEMTKLAAAAKTGSLDNIKTAVSATGGTCKTCHDAYRKD"
FT   sig_peptide     626354..626422
FT                   /locus_tag="Rfer_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.911 at
FT                   residue 23"
FT   gene            627074..627520
FT                   /locus_tag="Rfer_0601"
FT   CDS_pept        627074..627520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0601"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68352"
FT                   /db_xref="GOA:Q221F1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F1"
FT                   /protein_id="ABD68352.1"
FT                   /translation="MNNGILIIAHAPLASALRQCVLHVFPDAEAAVATFDVQPNTPPEE
FT                   TLAGARQALALLNVPQTLVLADVFGATPCNVAQRLVDGVNSKLVAGVNLPMLLRTVTYR
FT                   GETLDAMVARALAGGTQGVMPVATTAPQNQLRKKSDQSKHDHQQ"
FT   gene            627489..627758
FT                   /locus_tag="Rfer_0602"
FT   CDS_pept        627489..627758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0602"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68353"
FT                   /db_xref="GOA:Q221F0"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q221F0"
FT                   /protein_id="ABD68353.1"
FT                   /translation="MIKASTTISNKLGLHARASAKLTKLAGGYPCEVWIAKGERRVNAK
FT                   SIMGVMMLAAGNGSTVEIDASGEREQEALDALLALIADKFGEGE"
FT   gene            627755..629530
FT                   /locus_tag="Rfer_0603"
FT   CDS_pept        627755..629530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0603"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68354"
FT                   /db_xref="GOA:Q221E9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E9"
FT                   /protein_id="ABD68354.1"
FT                   /translation="MTFSIHGLAVARGIAIGRAVLVASSRVDVAHYFIAATEVDAEIER
FT                   VRSARDAVVNEIHRLQASISHMGPKEAPQELTALLDVHLMLLNDDELSNGVRHWIKDRL
FT                   YNAEWALTTQLEVIARQFDEMEDEYLRGRKADLEQITEKVLRAMKGVASPVVVAPSRTL
FT                   RKPSQQDLLLDDTVDVPLILVAHDLSPADMLQFKQSVFAGFVTDVGGKTSHTAIVARSL
FT                   DIPAVVGARLSSQLVRQDDWVIIDGDAGVLVVDPSPIVLAEYGFKQRQGELERGRLTRL
FT                   LHTPAVTMDGQKIELLANIEMPEDALGAVLAGAVGVGLFRSEFLFMGRNGRLPNEEEQY
FT                   LAYRRAVEGMQGLPVTIRTVDVGADKPLDESQQDNAHLNPALGLRAIRWSLADPAMFLT
FT                   QLRAILRAAAHGPVNLLIPMLVHAGEIRHTMAMIDRARVELDNRGIAYGPVKIGAMIEV
FT                   PAAALIVKVFLKYFDFLSIGTNDLIQYTLAIDRTDESVAHLYDPLHPAVLRLVAQTIAE
FT                   CRAQGKPVSLCGEMAGDVSLTRLLLGMGLRSFSMHPAQILAVKQEVLRADAGKLTAWAQ
FT                   QVMADDEPGLRMTRH"
FT   gene            complement(629533..630258)
FT                   /locus_tag="Rfer_0604"
FT   CDS_pept        complement(629533..630258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0604"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68355"
FT                   /db_xref="GOA:Q221E8"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E8"
FT                   /protein_id="ABD68355.1"
FT                   /translation="MPNFVELWVYLSSTPLFGLTATLVVYVLAQAVYVRLQQAPWANPV
FT                   LWTVLAIASVLLATGVSYPTYFAGAQFIHFLLGPAVVALAWPLWERRAALALHWRALLL
FT                   AAVAGGLAASGSALALGWAAGLPLDVVLSLAPKSVTAPVAMGIADKIGGIPALAAVFAV
FT                   ITGMVGALSGKYLFAALKIPTDPAGWMARGFSLGTAAHGIGAARALQVNADAGAYAGLA
FT                   LGLQVVLASLLIPLAFRLF"
FT   gene            complement(630242..630598)
FT                   /locus_tag="Rfer_0605"
FT   CDS_pept        complement(630242..630598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0605"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68356"
FT                   /db_xref="GOA:Q221E7"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E7"
FT                   /protein_id="ABD68356.1"
FT                   /translation="MTGLRGLAWLLALQSIGELLARGFSLPFPGPVIGMLLLLLALRAP
FT                   VVREPVAACASFLLSHLSLLFVPVGVGVMTHLGLISQYGVRMLIVIALSTWIGLAVTAL
FT                   TLRLFRKKSDAEFR"
FT   gene            complement(630611..632089)
FT                   /locus_tag="Rfer_0606"
FT   CDS_pept        complement(630611..632089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0606"
FT                   /product="FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68357"
FT                   /db_xref="GOA:Q221E6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E6"
FT                   /protein_id="ABD68357.1"
FT                   /translation="MPTAPQRAERQAQIVRGLEAVLPRHALLWNPEDTTPYECDGLTAY
FT                   RQRPLVVALPETEAQVQAVLRTCHTLGVPVVARGAGTGLSGGAMPHALGVTLSLARFNN
FT                   IVKIDPLSRTAVVQCGVRNLAISDAAAAHDLYYAPDPSSQIACTIGGNVAENSGGVHCL
FT                   KYGLTLHNIVKIKGFTMDGEAVEFGSDALDAPGYDLMSIVIGSEGMLAVTTEVTVKLIP
FT                   KPQLASCIMASFDDIRKAGDAVAAIIAAGIIPAGLEMMDKPMTAAVEDYVHAGYDLNAE
FT                   AILLCESDGTPQEVDEEIARMSAVLRTHGATALAVSRDEAERLKFWSGRKNAFPASGRI
FT                   SPDYMCMDSTIPRKRLADMLLAIQQMEKKYDLRCANVFHAGDGNLHPLILFDANQADQL
FT                   HRAELFGADILETSVAMGGTVTGEHGVGVEKLNSMCVQFSAEENEQMFGVKRAFDAKGL
FT                   LNPGKVIPTLQRCAEYGKMLVRGGQLKHPDLPRF"
FT   gene            632339..633238
FT                   /locus_tag="Rfer_0607"
FT   CDS_pept        632339..633238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0607"
FT                   /product="Phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68358"
FT                   /db_xref="GOA:Q221E5"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q221E5"
FT                   /protein_id="ABD68358.1"
FT                   /translation="MRWVQSRPFQPSVAPMFDRLAVLPQYLLPKQAITLLAGRVAGARG
FT                   GKWTTRLIEWFVKRYKVNMREAANPEVASYATFNDFFTRALQAGARPLARADLICPVDG
FT                   AISQFGAMAGQQIFQAKGHHYSSTALVGGDAALAAQFDDGHFATLYLSPRDYHRIHMPC
FT                   DGVLRRMIYVPGALFSVNPTTALGVPGLFARNERVVCVFESARGPFVLVLVGATIVGSM
FT                   ATVWHGVVNPPRSTAVREWRYDEQPVRLKQGEEMGRFLLGSTVVMLFPKGPLQFNPAWS
FT                   PGAAIRLGEAMARQPPLA"
FT   gene            633266..634057
FT                   /locus_tag="Rfer_0608"
FT   CDS_pept        633266..634057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0608"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68359"
FT                   /db_xref="GOA:Q221E4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E4"
FT                   /protein_id="ABD68359.1"
FT                   /translation="MNYEHVLVTSSGPITTLTLNRPEKRNALAMPVMRELTQALRAVAQ
FT                   SDALGVILAANGPVFSAGHNFGDMAGATLAQARELFGVCTEMMDAVQAMPQPVIARVHA
FT                   LATAAGCQLVASCDLAIAADTAGFAIPGGKGGLFCHTPLVAVARNIGRKRALEMALTGD
FT                   VIDAATAAQWGLINRAVPADQLDAATLDLITRATRGSALSKAMGKQGFYQQVGLPQAQA
FT                   YALACELMATAAMTPDAQEGIAAFLQKRQAHYTQRPSGTGA"
FT   gene            complement(634091..634939)
FT                   /locus_tag="Rfer_0609"
FT   CDS_pept        complement(634091..634939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0609"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68360"
FT                   /db_xref="GOA:Q221E3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E3"
FT                   /protein_id="ABD68360.1"
FT                   /translation="MNPVYILTLSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDQDTGL
FT                   FFMRVQFACAQLTHEDLTLQLKAFAQPFEMQWRLHARAQPIRTVIMVSKEGHCLNDLLF
FT                   RWKSGLLPIDIRAIISNHREFYQLAASYNVPFHHLPITAATKPQVEARQYEIIQTEAAE
FT                   LVVLARYMQVLSDDLCRKLSGSAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVT
FT                   ANLDEGPIIEQDVARVDHSKTVEDLTTLGRDTESQVLARAVKWHSEHRVLINGHKTVIF
FT                   K"
FT   gene            complement(634960..635904)
FT                   /locus_tag="Rfer_0610"
FT   CDS_pept        complement(634960..635904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0610"
FT                   /product="Uncharacterized iron-regulated protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68361"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E2"
FT                   /protein_id="ABD68361.1"
FT                   /translation="MPSWRKTRCWCTEATPRPLPIGLEPSVFGVAARPLAALVAVLALL
FT                   GCTTLSPSAAPNGLEPISQLQQLLPADAIFLGEQHDVPEHQQIHRAVVEALAGQQTLAV
FT                   LALEMASQGQSTEKLGSDASEDTVRAALHWNNEGWPWSAYGPAVMAAVHAGVPVVGANL
FT                   PSARVRAAMTESGLDALLSGPALQAQQEKVRVGHCNLLPESQIAPMTRVQIARDVAMAQ
FT                   TVARAALRGKIVLLLAGGGHVDRSLGVPLHLPPDLTVKTVLLQAGPAFEETESADNFDQ
FT                   IWPTGAAPVKDYCADFSQQRSAAAAASRSKKEP"
FT   gene            complement(635867..636178)
FT                   /locus_tag="Rfer_0611"
FT   CDS_pept        complement(635867..636178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68362"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E1"
FT                   /protein_id="ABD68362.1"
FT                   /translation="MHTLYDSDTYSVTHMLANAVATDATPDVSLDRTEPVRIVPTLARH
FT                   GFEIVDKRANKEVYLDGSWAELFQQHISAWQQNTPTQEEVEDTLEQYAELAQNPVLVH"
FT   gene            complement(636243..637316)
FT                   /locus_tag="Rfer_0612"
FT   CDS_pept        complement(636243..637316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68363"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q221E0"
FT                   /protein_id="ABD68363.1"
FT                   /translation="MAGVNSVFSFKVMAAITVAVLWAHLAALQASPMALRPSQAEPAPR
FT                   AFITRSIEPVAPQMAAPAGAHTAATVAPPPRQPAQPSAGRSAPPPASGRAPAATPMPPP
FT                   LEAVSRQAQDAAAQAPPDASADQLALAPGAPPPPRDSTLAAAADKLPGSVHLKYQVLAN
FT                   KFPYRLNADLLWQQTGDQYAARLEISAFGQARVQTSRGQITPQGLAPLRFSDKFRSEVA
FT                   AHFNRAQGKVTFSANTPDVALLAGAQDRLSVLVQLAAMFASAPQSYPRGSTITIQTIGP
FT                   RAADLWRFTVGEPEALALPGGPQATLKLLRNPREAFDQKVELWLAPALDYLPARIRITE
FT                   SNGDYVDQQWLVTEPQT"
FT   sig_peptide     complement(637224..637316)
FT                   /locus_tag="Rfer_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.862) with cleavage site probability 0.522 at
FT                   residue 31"
FT   gene            637332..638336
FT                   /locus_tag="Rfer_0613"
FT   CDS_pept        637332..638336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0613"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68364"
FT                   /db_xref="GOA:Q221D9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D9"
FT                   /protein_id="ABD68364.1"
FT                   /translation="MKLATYKDGSRDGQLVVVARDLSIAHYATGIAHQLQQVLDDWNFL
FT                   SPQLQDLYDALNRARDSSASAGLARHAFPFDPRQCMAPLPRAYQWVNGSVYRNPAALQG
FT                   PASTAGSPVLYQGASDDFLGPCDEVHCAREADGIDFEAGVAIITGDVRLGASPAQALDG
FT                   IRLLLLSNALSLRQLMQAELAQGLGPLQSRPATAFSPVAVTPDEVGTAWAQGRLDLTLQ
FT                   SSWNGRKVGLCEAGPEMRFHFGQLIAHLCKTRRLRAGCIVGAGAVSNTDASHGYSCIAD
FT                   KRALEIMQDGQPMTEFMKFGDTIRIEMKGRDGQSVFGAIEQEIVPLEKAAAPL"
FT   gene            complement(638361..638963)
FT                   /locus_tag="Rfer_0614"
FT   CDS_pept        complement(638361..638963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0614"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68365"
FT                   /db_xref="GOA:Q221D8"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D8"
FT                   /protein_id="ABD68365.1"
FT                   /translation="MNYTFASATILLILITDPIGNIPIFANALKHVAPERRPWVILREV
FT                   LIAFVLLLTFMFVGGGFLRVMNLSELSLQIGGGVILFLIALRMIFPPPKSDATEELHEP
FT                   LIVPLAIPAIAGPSALATVLLLVSQAPERRMEWIAALCVTMAVSAVVLVLAERIQRVAG
FT                   DRFVVALERLMGLVLVAVSIEMMLRGVKTFAGQLASA"
FT   gene            complement(638979..639353)
FT                   /locus_tag="Rfer_0615"
FT   CDS_pept        complement(638979..639353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0615"
FT                   /product="transcriptional regulators, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68366"
FT                   /db_xref="GOA:Q221D7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D7"
FT                   /protein_id="ABD68366.1"
FT                   /translation="MTQKLNTTFKEQLLAQRASLLAQLSDLRGGTVGRAEASAEHFGQK
FT                   EDSTAQESSARELEFALDARDSEELDRLDAALRRIEDGSYGLCVDCGVGIPAARLHAAP
FT                   DALRCIACQEKLEKAQARQA"
FT   gene            639465..639842
FT                   /locus_tag="Rfer_0616"
FT   CDS_pept        639465..639842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68367"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D6"
FT                   /protein_id="ABD68367.1"
FT                   /translation="MRPMSTLQLLRHARLLARLVLVWFVMSVAAAIASPLVKPQAMELI
FT                   CSGAGGMKLLQKTDDGSQPTASHTLDCPLCVGIGAPPPPLAHVAAKPMQALGYVLQGIP
FT                   AAHIAVLSAAPLPARGPPASL"
FT   sig_peptide     639465..639566
FT                   /locus_tag="Rfer_0616"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.452 at
FT                   residue 34"
FT   gene            639995..640510
FT                   /locus_tag="Rfer_0617"
FT   CDS_pept        639995..640510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0617"
FT                   /product="protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68368"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D5"
FT                   /protein_id="ABD68368.1"
FT                   /translation="MKFKTLMSSVALAAAAFAAHAAAIEVENAWVRATVKGQQATGAFM
FT                   TLTAKEGARLVGASTPAAGVSQVHEMTMDAGVMKMGEVKGGLDLPAGKAVALKSGGYHL
FT                   MLMDLKSALVAGTSLPLTLVFKDAKGVESKVELTVPVAAVAPAGMAHGKEAPMDHSMHG
FT                   NMPAKKAP"
FT   sig_peptide     639995..640060
FT                   /locus_tag="Rfer_0617"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            641074..641613
FT                   /locus_tag="Rfer_0618"
FT   CDS_pept        641074..641613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0618"
FT                   /product="protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68369"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D4"
FT                   /protein_id="ABD68369.1"
FT                   /translation="MPIFERRPVAVEKPRAVPRRLLSASLLLAALACTASVVQAHGVSQ
FT                   GDLQLDHPYAVPSAPGEPHGNAYLRGIKNSGAQADRLLSASSPLAARVELHRLKPDASG
FT                   LRGQQVEAIVLPPKTVTRLRHTGDYQLTLIGLKQALKDGERFDLTLNFEHAGSQTVKVW
FT                   VQTPRDAPSAQDPHQH"
FT   sig_peptide     641074..641196
FT                   /locus_tag="Rfer_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.959 at
FT                   residue 41"
FT   gene            641683..643986
FT                   /locus_tag="Rfer_0619"
FT   CDS_pept        641683..643986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0619"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68370"
FT                   /db_xref="GOA:Q221D3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D3"
FT                   /protein_id="ABD68370.1"
FT                   /translation="MSQFRLCQLTCAVALALPTLALLSGPALAADLAAFTLAPITVTGS
FT                   PSHISQPLGATAVDPASLAPKLSATSDTASLLQDVPGLSLYGAGGVSSLPAIHGLADDR
FT                   LRIKVDGMDLIASCPNHMNPALSYIDPTQVGLLKVYAGITPVSAGGDSIGGTIVAQTRA
FT                   PEFAAPGQAAITKGEVGTFYRSNNKARGANVSATYATEQFNISYSGATSRADNYTAGGD
FT                   FKNHDFTGRVGHTLGRDEVGSTAYDTRNHSVGLAFKSDNHLLEAKLGYQDMPFQLYPNQ
FT                   RMDMLGNTQNSVNLRYAGQFDWGALEARAYRENVDHVMDFGADKRYWYGAASGGGAALD
FT                   GTPCSPISATCAAGMPMVTEGKTTGLSVKADVALTPQDVLRVGAEAQQYRLKDWWPPSG
FT                   GGMFPGTFWNIQDGQRDRTAVFGEWEARKNTQWMTLLGARVEQVKMNAGNVVGYNPAGG
FT                   GFQGRDASAFNAQDRSKTDNNLDLTALARYSANTNYDIEFGFAHKVRSPNVYERYTWST
FT                   WQMAALMNNFVGDGNGYLGDVNLKPEKANTISATFDWHAADSRWGFKATPYYTQVSDYI
FT                   DAVQWNASTNLAATTLAANKFSVLKYANQSARLYGIDLSGHMPLAKRAWGDFGLKGLLN
FT                   YTHGTNQDTGDGLYNVMPLNAKLALTQKLKAWDNSFELLMVQAKDSVSGMRNEIKTPGY
FT                   GLVNLRGSYSWRQVRVDFGVENLFDRFYYLPNGGAYTGQGTTMSNPALPNYPQWGSAVP
FT                   GIGRSIYMGVNVKF"
FT   sig_peptide     641683..641772
FT                   /locus_tag="Rfer_0619"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            644055..645221
FT                   /locus_tag="Rfer_0620"
FT   CDS_pept        644055..645221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0620"
FT                   /product="Citrate utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68371"
FT                   /db_xref="GOA:Q221D2"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D2"
FT                   /protein_id="ABD68371.1"
FT                   /translation="MLPYTRAASFLVDAPALAGGKTNDESMLTAPETEVSRLLHICNDC
FT                   HYCDSFCAVFPSSSRRLQFAKADIHYLANLCHNCGACLHGCEVAPPHELAVNLPQAMAR
FT                   VRGQTYADYAWPPALGALYQRHGLVLSLALAGALTIFLLLALALNGTLLGSPQAGYSAV
FT                   FGHQMLVGLFAPVFLYAVLALGMGVRRFWHDVTPATSGQSVSAAAAGEAARDVLRLKYL
FT                   DGGHGDGCNNADGTATLARRRAHHLTFYGVLLCLAATLAASVYHYVLGWTAPYDLPQLP
FT                   KLLGVAGGLSLLLGTGSLFALNLQRHPLHGDAAQKPMDRGFIALLFCASASGLALWWVH
FT                   AGVALPALLTLHLGLVMALFATLPYGKFAHGIFRTAALLRHAVEKRQT"
FT   gene            645295..645999
FT                   /locus_tag="Rfer_0621"
FT   CDS_pept        645295..645999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68372"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D1"
FT                   /protein_id="ABD68372.1"
FT                   /translation="MSDAQNAGFGKFIPGFDFLQNLAKGATETVPQMPNLANWIAPTLN
FT                   VEELDKRIAELKAVHFWLDQNSKALGATVQALEVQKMTLATLKGMNFNIGDVANALKLK
FT                   AADSVYSGVQRVTEKAASTAQTISEVASDAEDVAKKVRKAAKPVTDMAAGLIDPMQLWT
FT                   SLTQQFGQIAASAMKDAGKATAMDATRNMAAGFAKEAVKATKKVASNAGAARAAAKKAP
FT                   KKAARKTVRRST"
FT   gene            646032..647315
FT                   /locus_tag="Rfer_0622"
FT   CDS_pept        646032..647315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68373"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q221D0"
FT                   /protein_id="ABD68373.1"
FT                   /translation="MKLFPYGHATHPQWQMAAELTLAQVRAQMALHGYASSPTLALLYI
FT                   TDHYALQAQEILDHLSAELPEITDWAGTVGVGIAANNAEYFDEPALALMLCELPTDQYR
FT                   VFSGVAPLGLGFEAHTALIHADASTPDLGELIEEMALRTDSGYLFGGLASSRSKTVQFA
FT                   VGGDGNISGQGAARGVFSGGLSGVAFGAGINLVSRVTQGCLPVARAHQVTKADKHVVLA
FT                   LDDEPALDVMLRDLHISLEQPQEALAVVRATLVGLARAQTARQGLAGSDAPAVRQTGHF
FT                   GNDVLVRHIIGLDPGQRGVAVAEPVEPGTQLVFCQRNAQAAKADLIRVCAEIREELEPE
FT                   ELPLEAVAALHASEAEAAPHPARGIAGAIYVSCAGRGGPHFGGPSAELQIIRRALGDVP
FT                   LVGFFAGGEIARNHLYGYTGVLTVFTGN"
FT   gene            647471..647755
FT                   /locus_tag="Rfer_0623"
FT   CDS_pept        647471..647755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0623"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68374"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C9"
FT                   /protein_id="ABD68374.1"
FT                   /translation="MNPSTSHPSSTWQLQDAKAQFSAVVRQAETSGPQLISVRGKPAVV
FT                   VLSNADYRRLQARSNKPGFTQLMRSSPLVGLDLAVDRSQDLTRQITLEK"
FT   gene            647757..648182
FT                   /locus_tag="Rfer_0624"
FT   CDS_pept        647757..648182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0624"
FT                   /product="PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68375"
FT                   /db_xref="GOA:Q221C8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C8"
FT                   /protein_id="ABD68375.1"
FT                   /translation="MAVLTGYLLDTNVISETVRAAPDPSVMRWLDSLEPEQLYVSVLSL
FT                   GEIRKGALAVADKRRRDKLLAWLHNKLPEWFENRVLPIDAAVCERWADLMVKAGTPTPA
FT                   IDSLLAATAAHAGLVVATRNVRDFVRLEVGVFNPWEF"
FT   gene            complement(648304..648801)
FT                   /locus_tag="Rfer_0625"
FT   CDS_pept        complement(648304..648801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68376"
FT                   /db_xref="GOA:Q221C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C7"
FT                   /protein_id="ABD68376.1"
FT                   /translation="MNLAIRLLKNLFSGLLALLILFEEWGWEPLQRALAWVGRLPGLRW
FT                   LEARIRALPPYAALALFLLPTAMLLPVKLLALWLIGQGKVWAGSLVILGAKLVGTAIVA
FT                   RLFALTQPALMQLAWFARLFTRWVSWKEALLAQVRASWPWRLGRVLKHRWKRRWRRFMP
FT                   RR"
FT   gene            complement(648806..650023)
FT                   /locus_tag="Rfer_0626"
FT   CDS_pept        complement(648806..650023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0626"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68377"
FT                   /db_xref="GOA:Q221C6"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C6"
FT                   /protein_id="ABD68377.1"
FT                   /translation="MLQFDLLQTDPSSHARRGRLTLNHGVVQTPIFMPVGTYGTVKGVT
FT                   PRSLEDMDAQIILGNTFHLWMRPGLDVMAQFGGLHQFEKWNKPILTDSGGFQVWSLGAM
FT                   RKITEDGVHFSSPVNGDKLFMSPEVSIQIQTTLNSDIAMQLDECTPYLSVEPKTKGQIT
FT                   TEDEARASMEMSLRWAQRSRAEFARLENPNALFGIVQGGMFEGLRQESLEQLVAMDFPG
FT                   YAVGGVSVGEPKDEMLRIMAHTPHRLPAHKPRYLMGVGTPEDLIEGVAQGVDMFDCVMP
FT                   TRNARNGTFFTRYGDLKIRNARHKMDQRPLDETCTCYACAGSATHANTPDTGAGRSWAQ
FT                   GGRGGFSRAYLHHLDRCGEMLGPMLSSIHNLHYYLNLMTEVRAALDAGTFGAFRQQFKA
FT                   NRARGV"
FT   gene            complement(650058..651320)
FT                   /locus_tag="Rfer_0627"
FT   CDS_pept        complement(650058..651320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0627"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68378"
FT                   /db_xref="GOA:Q221C5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C5"
FT                   /protein_id="ABD68378.1"
FT                   /translation="MNTFQKRTAIRIAAVSILLASLASPIAWYVARESAEESIVALAVE
FT                   ESGRLLHQFDAIDLSGPQATQHATLAANAISGGMFDIVEIYDAQGRKLAESVTPEGHAV
FT                   ESSLPHHGTPDYTTAFYNGHKPASGVWALRVFVPLRDSATDMSRPITGYFEGVRVMPTW
FT                   QQDQIFNNSLSAALMVGLASLLCGGALYPVVVHLSADNERKAQEVLDSHISMMEALGRA
FT                   IAKRDSDTGAHNYRVAWIAASIAEQMGLAGSDMQALIAGSFLHDVGKIGIPDAILLKPG
FT                   KLDDDEMRVMRTHVAQGEEIVNGMGWLEGANAVVAAHHEKWNGSGYPRQLSGEDIPLAA
FT                   RIFAVADVFDALCSKRPYKEPMGFDAAMVILEKDTASHFDPSVMAVFRPMARATFDRLA
FT                   GISENATRQLLEDRVRHHFEM"
FT   sig_peptide     complement(651249..651320)
FT                   /locus_tag="Rfer_0627"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.465 at
FT                   residue 24"
FT   gene            complement(651353..652435)
FT                   /locus_tag="Rfer_0628"
FT   CDS_pept        complement(651353..652435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0628"
FT                   /product="S-adenosylmethionine"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68379"
FT                   /db_xref="GOA:Q221C4"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C4"
FT                   /protein_id="ABD68379.1"
FT                   /translation="MPLTLADAARAFTLSDFDFHLPPELIAQHPAPERSGSRLLDSTSA
FT                   TPQDRVFRDLPSLLQPGDLLVFNDTRVINARLFGEKSTGGKLELLVERVLGGNQVAAHL
FT                   RVSKKPEVGASVALTGAPGTHENLRATLLGRWPDAQGALFRFVLTNDAGDDPFTLMARH
FT                   GHVPLPPYITHSDSAEDAARYQTVFAKNPGAVAAPTAALHFDDALLAALDARGVQRAFV
FT                   TLHVGAGTFQPVKTENLAEHQMHSEWYDVPTATQQAIADCRARGGRLIAVGTTTVRTLE
FT                   SWAKTGQTTGDTQIFITPGFEFQLVDLLVTNFHLPKSSLMMLVSAFAGYEPVMALYQHA
FT                   MAAQYRFFSYGDAMLLARQR"
FT   gene            652621..653016
FT                   /locus_tag="Rfer_0629"
FT   CDS_pept        652621..653016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0629"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68380"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C3"
FT                   /protein_id="ABD68380.1"
FT                   /translation="MTILVAYVPRPEGQAALDKGIEIAQRRNEKLVVVNASPGGKKEDA
FT                   SFADVQDFERVQQLLENTGLDAEVKQFVRGKNAVEEIEALIESLPASLLVIGMRKRSPV
FT                   GKLIMGSVAQELLLSVSCPVLAVKSAG"
FT   gene            653566..654984
FT                   /locus_tag="Rfer_0630"
FT   CDS_pept        653566..654984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0630"
FT                   /product="flagellin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68381"
FT                   /db_xref="GOA:Q221C2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C2"
FT                   /protein_id="ABD68381.1"
FT                   /translation="MPSVINTNISSLTAQRNLGMSQASLATAMQRLSSGLRINSAKDDA
FT                   AGLAISERMTTQIRGSNQAARNANDGISLAQTAEGDLAQIGNNLQRMRELAVQSANATN
FT                   SSSDRAALDGEVQALSAEIDRAAQNSSFNGTKLLDGSFTAQKFQVGANNTANDSITIAA
FT                   IASARTSVLGGYTTTKAGGVTTAALTAGALTLNGTSVGASAATSIPGQSASSAYSIAAA
FT                   INAVSGQSGVTATAQATAVTGAVQTAFTAITTGATLTVNGIQVGSIAAGGAAPAQGANV
FT                   AAAINLVSSQSGVTASAAADGKVTLTAADGRDIALGAGWVAADSGLTASATTVGTVTLD
FT                   STSSAGITIAGTAPASAGFTAGTTLATATKISSMNVLTAAAATAALGTIDGALETVSAS
FT                   RAALGAYQNRFTSVVTSLQTTSENLSASRSRIQDADFAAETANLSRAQILQQAGTAMVA
FT                   QANQLPQGVLSLLK"
FT   gene            655212..656627
FT                   /locus_tag="Rfer_0631"
FT   CDS_pept        655212..656627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0631"
FT                   /product="flagellin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68382"
FT                   /db_xref="GOA:Q221C1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C1"
FT                   /protein_id="ABD68382.1"
FT                   /translation="MSVINTNINSLTAQRNLGMSQASLATSMQRLSSGLRINSAKDDAA
FT                   GLAISERMTTQIRGSNQAARNANDGISLAQTAEGDLAQIGNNLQRMRELAVQSANATNS
FT                   SSDRAALDGEVQALSAEIDRVSQNSSFNGTKLLDGSFTAQKFQVGANNTANDSITVASI
FT                   GSARTSVLGGYTTTKAGGVTTAALTAGALTLNGTSVGASAATSIPGQSASSAYSIAAAI
FT                   NAVSGQSGVTATAQATAVTGAVQTAFTAITTGATLTVNGIQVGSIAAGGAAPAQGANVA
FT                   AAINLVSSQSGVTASAAADGKVTLTAADGRDIALGAGWVAADSGLTASATTVGTVTLDS
FT                   TSSAGITIAGTAPASAGFTAGTTLATATKISSMNVLTAAAATAALGTIDGALSTVSASR
FT                   ASLGAYQNRFTSVVTSLQTTSENLSASRSRIQDADFAAETANLSRAQVLQQAGTAMVAQ
FT                   ANQLPQGVLALLR"
FT   gene            656799..658286
FT                   /locus_tag="Rfer_0632"
FT   CDS_pept        656799..658286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0632"
FT                   /product="flagellar hook-associated 2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68383"
FT                   /db_xref="GOA:Q221C0"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q221C0"
FT                   /protein_id="ABD68383.1"
FT                   /translation="MATISSTGIGSGLDVNSIVSQLVALEKTPLKTLALKATNTQNQIS
FT                   AFGEIQSQFAALTDVASRISVASTWGARNASSSNTSAATITATGTANATSFSLDVDQLA
FT                   RSQSGSSAAVAPGTMPGAGTLTLQLGTWTAGGAAFTPGAAASVNVTVLATDTISDIASK
FT                   INGANAGVVATVFNDGTNERLLLQSKTTGAAAGFRMTVADADTTNNDNAGLSRLSFDPA
FT                   TVDPLTGLASGMATAGIPVQYAQDAKARINGLAVTSATNTLTDNIPGVTIKLVATTTTG
FT                   YGLPGEVKSPLTMAISEDVTPAVKNVSDFVTAYNKLNKSLTDLTKYDAATKTAGLFQGD
FT                   SSVVGLQNILRNMLGSASLGASSQRLSDVGLERQLDGSLVINTAKLSAAANNGTTLQQL
FT                   FTNDNKDPLTNGFALKFRDLGRGVASSGGSVKNKAEALQKNLDNNTKEQTKVNDRAALF
FT                   ETRLRKQYSALDAQMAQLNALNAYVTQQVATWNKSTA"
FT   gene            658333..658794
FT                   /locus_tag="Rfer_0633"
FT   CDS_pept        658333..658794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0633"
FT                   /product="flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68384"
FT                   /db_xref="GOA:Q221B9"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B9"
FT                   /protein_id="ABD68384.1"
FT                   /translation="MPINKVTNKMERSMFTSVSSRSASAYQRVSVETAVSQASPHQLVA
FT                   MLLDGLLKNVGAARAALKRGDIAAKGEKINKAVRIIDEALKPALNLAQGGDIAANLNGL
FT                   YGYCAIRLTEANLRNDDAALADVLRVIEPLADGWKQIGGQASSALSSSH"
FT   sig_peptide     658333..658410
FT                   /locus_tag="Rfer_0633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.749) with cleavage site probability 0.728 at
FT                   residue 26"
FT   gene            658808..659107
FT                   /locus_tag="Rfer_0634"
FT   CDS_pept        658808..659107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0634"
FT                   /product="flagellar protein FliT"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68385"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B8"
FT                   /protein_id="ABD68385.1"
FT                   /translation="MPLMLIDYYKAIEDSSLKMLNAAKAEDWDQVMRFEGACAVLIEQL
FT                   RARAHSEELLPAQRTEKTRIMQRILHNDAQIRYLAEPWLTHCEQNLDGQRQFLH"
FT   gene            659339..659412
FT                   /locus_tag="Rfer_R0003"
FT                   /note="tRNA-Gly1"
FT   tRNA            659339..659412
FT                   /locus_tag="Rfer_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(659452..660129)
FT                   /locus_tag="Rfer_0635"
FT   CDS_pept        complement(659452..660129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68386"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B7"
FT                   /protein_id="ABD68386.1"
FT                   /translation="MSLSSATLSAIQQAGSAAYAADTELKNAVKDYAARVNAAMSANPY
FT                   GLGNDALFENWKVVARLSQTMSGIEEELKKVYRVASELIADDQPSVRELPALAAPKRPV
FT                   AGQALGSQQDLTTTDVVVKRKKKTATPKTRKLKTQATSRPAKPTGTATSPVELSGNAAK
FT                   LLQHLKTLLDANKFTVINQTVVGQATGIPLGSMTAAIKKLTASGAIMTGPAGSFKLADF
FT                   HGA"
FT   sig_peptide     complement(660067..660129)
FT                   /locus_tag="Rfer_0635"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.985 at
FT                   residue 21"
FT   gene            complement(660175..660690)
FT                   /locus_tag="Rfer_0636"
FT   CDS_pept        complement(660175..660690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0636"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68387"
FT                   /db_xref="GOA:Q221B6"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B6"
FT                   /protein_id="ABD68387.1"
FT                   /translation="MLDSTQAQAPRGHGAWWRAATIACLLVIAIAIATGVSMFEQFKAQ
FT                   IHHLQTQLQSTAQIRFVAVLLDDSQAPAMLITLAPKEAALQIQRLNDVTEGRADSMQLW
FT                   ALAANGQPRSLGILTSTGKTLRLPVNDKALVDVSQLAISVENKDETTQRSQPSLPYLFK
FT                   GAVVQKAL"
FT   gene            660966..661388
FT                   /locus_tag="Rfer_0637"
FT   CDS_pept        660966..661388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0637"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68388"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B5"
FT                   /protein_id="ABD68388.1"
FT                   /translation="MFDQPIKSIMEQKKFLTAPPETTVSDAARLMADRNVGAVLVVADE
FT                   HLLGIFTERDAVFRVIAKGRDANTTQLTEVMTVDPKTLEPGKTYGHALLIMQENGFRHV
FT                   PVVENGRPVGIISSRNAMDPDLEEYVFEARRREHLR"
FT   gene            complement(661406..662707)
FT                   /locus_tag="Rfer_0638"
FT   CDS_pept        complement(661406..662707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68389"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B4"
FT                   /protein_id="ABD68389.1"
FT                   /translation="MKSPPSDDHKNPAHCVTMPKSPGAAASLAPASSVSLYDTRPFFEK
FT                   ALVFGVQNGIIDQQKLDAIGNDAPKGMVQIARYFGTEFLRPELEKAKDRIINLVSLYLE
FT                   NDSGGDLRLAAESLRDHSFLSRSKGGSDLLKALLAMPQNSHFGMNERAGFSDDKIPLLA
FT                   KWSLASLSDYQAELAKRSQVAQTMDAAIWLADALGMEADELEDASPDAEAVIRTALLTL
FT                   ACRRRTMPDWVGFEKMVLALRKKYGEAADVCSLFPIAMPAKLPIHFKTVLQKVQQSVAA
FT                   DLPKVLDAKVPVRKLFNQTPAFVGRYFWVEDGLSEVDDYDRSASLAWHKVTGGHSDDSS
FT                   LLTLFLCVATETAPKTLLTEKNAIALVRKIRKTGLKPGLASQYMALHAPAQHQSDYARL
FT                   WNDFLLDAQPTLQSDRDYGLQDALTLLRRECNVK"
FT   gene            complement(662688..663434)
FT                   /locus_tag="Rfer_0639"
FT   CDS_pept        complement(662688..663434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68390"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B3"
FT                   /protein_id="ABD68390.1"
FT                   /translation="MNHLALITKTQSLIAAGDIVGAESALVELADTEGDSALMLVLEQL
FT                   PPKDILAVIREYDNSRESVINLLVTPKQFAHAVVIEKQYKDLTRTHLRGMVNSIIFRDG
FT                   SDPLEFLTAMGDLEGGAEALADYFEEKWSRIEAFARTGTFDAVDDDGQMLSETALLGSA
FT                   YVPPRIEQDEVADQDWMELAWILRYRCPDLFIEMLLVLRAKARAFEAGLSEEEETPEDD
FT                   GKVETGDTDRGKATPAALESDEESAI"
FT   gene            complement(663563..664111)
FT                   /locus_tag="Rfer_0640"
FT   CDS_pept        complement(663563..664111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68391"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B2"
FT                   /protein_id="ABD68391.1"
FT                   /translation="MNISPFFRNLRSAYQAELEDLRSDSEGRDVMRQRLTQRRKELKFL
FT                   LQMMELSPEMVAVILHQGFTFKSPAMMEHLLSLAPDEFPDWDSLSDAIQPAPWAHDLIQ
FT                   VIRKEPVGDWFLTVAAGLEYMHHKPATAPAHIHEPEEDADEDLEADMNPLDAEEESDAR
FT                   SREEAGADWMVEQGFDRKD"
FT   gene            complement(664108..664416)
FT                   /locus_tag="Rfer_0641"
FT   CDS_pept        complement(664108..664416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0641"
FT                   /product="heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68392"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B1"
FT                   /protein_id="ABD68392.1"
FT                   /translation="MTDHYATLGLRSDATLAAIKKAFRQQASLHHPDRNAAASAPARFR
FT                   AVQEAYEVLSDAAKRQAYDDNRRRNLLDSPIDTAREIWHNYFDQLLRNVHDTKTPRP"
FT   gene            complement(664448..666337)
FT                   /locus_tag="Rfer_0642"
FT   CDS_pept        complement(664448..666337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0642"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68393"
FT                   /db_xref="GOA:Q221B0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q221B0"
FT                   /protein_id="ABD68393.1"
FT                   /translation="MALITFLNAQLAFGHVPLLDHTDFALETGERVGLIGRNGTGKTSF
FT                   LKILAGLEKADDGVLQLQQNLRLAYVAQEPQLDQDATVFVAASAGIAGVIALIDQYCEG
FT                   VGDLDALQSQIEAQGGWNWEQRVTETLHRLHLNENDIVGTLSGGTKKRVALAQALVAQP
FT                   DVLLLDEPTNHLDLDSIEWLEDLLIGFKGSVVAITHDRSFLDRVATRIIELDRGILRSY
FT                   EGNYARYQILKEEQLAQEAVISAKADRLLAQEEIWIRKGVEARRTRSESRIVRLENLRA
FT                   SRKAHREAVGKVKMDVASGGLSGKLVAELTQASLSFGDKVIIKDFSATILRGDKIGLLG
FT                   PNGAGKTTLLKLILGELVPDSGKIRQGTNLQVAYFDQMRNALDLDATLVDFISPGSEWI
FT                   EIGNQRKHVKSYLGDFLFSPARANSPVRSLSGGERNRLLLARLFARPANVLVLDEPTND
FT                   LDIETLELLEELLQNYAGTVFLVSHDRTFLDNVVTSTIAFEGDGLWREYEGGVQDWLLQ
FT                   SKRSKEIQNATISIAVNAQQTGARGQKNTKSSDNTKTVTAQKLSNKAQREVDTLQARID
FT                   VLEQEQAALRATLTDANLYAKDPARATELYARDAAIDAELLAALTRWEELSAI"
FT   gene            complement(666374..666829)
FT                   /locus_tag="Rfer_0643"
FT   CDS_pept        complement(666374..666829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0643"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68394"
FT                   /db_xref="GOA:Q221A9"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A9"
FT                   /protein_id="ABD68394.1"
FT                   /translation="MFFTTDLATISHGIQLAVAPVFLLTAVSGMIGAVAGRLARIIDRA
FT                   RLLEDRIEAAPADKPMAAEYTELARLRKRGALVNACIALLTFCAILIGLTIVVLFLGET
FT                   TELQIYRVATFCFLSGVLFFLAALLCFFCETLLATRILKFARPPKDV"
FT   gene            complement(666903..667754)
FT                   /locus_tag="Rfer_0644"
FT   CDS_pept        complement(666903..667754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0644"
FT                   /product="HAD-superfamily hydrolase subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68395"
FT                   /db_xref="GOA:Q221A8"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A8"
FT                   /protein_id="ABD68395.1"
FT                   /translation="MKALASWPQQDRRQLIGVFTDIDDTLTTDGAITPDALQALTRLKA
FT                   AGLHVIPITGRPIGWCEPFANGDPAHGIAPWPVDAIVAENGAVAFAFANLCQISLQPPW
FT                   NKGMQLSKLYQESDATRASHFTRLQQVATQVLHDVPGTSLSQDSPGRETDIAIDHSEFA
FT                   HLPPDQIARVVAIMRAAGMNASVSSIHINGWFGSHNKLEGARWIVRELFGRDLDAERDQ
FT                   WVYVGDSTNDQLMFQHFRHSVGVANILRFASELTHQPRYITRSERGAGFAEVARAILDA
FT                   RG"
FT   gene            complement(667781..669412)
FT                   /locus_tag="Rfer_0645"
FT   CDS_pept        complement(667781..669412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0645"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68396"
FT                   /db_xref="GOA:Q221A7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A7"
FT                   /protein_id="ABD68396.1"
FT                   /translation="MSYTAETRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQIAGSVKA
FT                   RKATRHATSDWMEIEKQRGISVASSVMQMVYRDHVINLLDTPGHKDFSEDTYRVLTAVD
FT                   SALMVIDAANGVESQTRRLIEVCRQRDTPIITFINKMDREVRDPLDILDEVERELGMPC
FT                   VPMTWPVGQGKTFGGIINLRTQVMTVFESGSERLPHDFDAMPLSDPAALKARFGSEWDT
FT                   ALESMELATGASPAFDREAFLAGKQTPVFFGSGVNNFGVMEVLDALVDLAPSPGPRTSS
FT                   FIVNKQPVIKQVQPEDDAFSGVVFKVQANMDANHRDRIAFVRIASGKYSPGMKLKVMRT
FT                   GKELRPTSVVTFMSQRREAVEEAYAGDIVGFTTHGGVQLGDTITDGSVNLLFTGLPFFA
FT                   PEMFMTVVLKNPLRTKQLQQGLAQLGEEGAIQVFRPEMGGNMLLGAIGQLQFEVVQHRL
FT                   KGEYDADIRLEASQYTGARWITADSPAELKEFVHAYPQRMARDAADTLAYLCTSPYDVR
FT                   LAQERFPKIHFHPLREHAGLALQSAA"
FT   gene            complement(669543..670313)
FT                   /locus_tag="Rfer_0646"
FT   CDS_pept        complement(669543..670313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0646"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68397"
FT                   /db_xref="GOA:Q221A6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A6"
FT                   /protein_id="ABD68397.1"
FT                   /translation="MDIRNKVAIVTGGASGIGRAIAQRFAADGARAVVVADLNFERAQA
FT                   VARDIKGLAVRCDVSQEADIQALVATTRQHYGQVDAYISNAGILGNMGGLDLDDALWNR
FT                   MWQIHSMAHVWAARAVVPEMVARGDGFFLVTASAAGLLTIVESAPYAVTKHAAVAFAEW
FT                   LRIAYGRKGVRVSCLCPQAVQTDMLTGDGGSASHDSIISPEQVANDVISTMLSDKFLVL
FT                   PHPEVAQYFRNKGQDYERWIGGMQKMYARHAEGG"
FT   sig_peptide     complement(670245..670313)
FT                   /locus_tag="Rfer_0646"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.499 at
FT                   residue 23"
FT   gene            complement(670651..671784)
FT                   /locus_tag="Rfer_0647"
FT   CDS_pept        complement(670651..671784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68398"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR017549"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A5"
FT                   /protein_id="ABD68398.1"
FT                   /translation="MKNPMSFWVRSVRALGFSAALSCISVAMAAPVYTVTNLVTDDQTA
FT                   HPAQITDPGLTNAWGLSYSPSSPFWVSSNGAGTATLYSVNPSTQLTAKTPLVVAIPGAG
FT                   NVTGQIFNGGTGFNADRFLFVSEDGTVSGWRGALGTTAEILVPASSANVYKGAAFGTAA
FT                   GNDYLYAANFRSGAIDVFKGSAAAPTLPGSFVDPNLPAGYAPFNVQNLGGTLFVTYAQQ
FT                   DASQQDEVAGAGLGLVNRFDLNGNLLGRVASAGSLNAPWGLAIAPGSFGSLAGALLVGN
FT                   FGDGRISAFDALSTAYLGQLLDASNQPITIDGLWALAPGNGVAGGSTQSLYFTAGPDGE
FT                   THGLFGVLTAVPEPSTYALMLAALAVLAGVKAGRRRI"
FT   sig_peptide     complement(671695..671784)
FT                   /locus_tag="Rfer_0647"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 30"
FT   gene            672166..673038
FT                   /locus_tag="Rfer_0648"
FT   CDS_pept        672166..673038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68399"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A4"
FT                   /protein_id="ABD68399.1"
FT                   /translation="MDSNWRFATRVCTVSALLGLVGCLTAFQVAATPFIFNTGNVDGKI
FT                   ATASRPADAGKSEIESADDFVITSSTTINSATFTGLLTSTGGLTPTVGDVRVEIYHVFP
FT                   KDSAIPPSGNVPTRVNSPSDVTFRDFDAVLGGLTFSTSVLSNSFTALNSVMTGINPAPN
FT                   QTNGGEGPVNGQEVTFSVTFTTPFDLPADHYYFVPQVQVTDGEFLWLSAARPIGATGTP
FT                   FSPDLQTWIRNENLAPDWLRVGTDIVGGDPAPTFNAAFSLNGRTIPEPGTLVLLLLGLA
FT                   GIVWRRFSQ"
FT   sig_peptide     672166..672261
FT                   /locus_tag="Rfer_0648"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.717 at
FT                   residue 32"
FT   gene            complement(673175..674092)
FT                   /locus_tag="Rfer_0649"
FT   CDS_pept        complement(673175..674092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0649"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68400"
FT                   /db_xref="GOA:Q221A3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A3"
FT                   /protein_id="ABD68400.1"
FT                   /translation="MSNAMQRRLALAHRHVRMRVFRLPAVWRGMLWVALSGLLFTLLNT
FT                   IVRNITLSLDPFQSQFLRYLFGVVAMLPLLWRQGLNAYRPVNLRGQFGRGAVHTAGLML
FT                   WFTALPHIGLADMTAIGFTGPIFIMIGAAWFLGEDMRADRWVAAMVGFAGVLVVVAPRL
FT                   TGQGGWYSLVMLASAPVFSASFLMTKTLTRYEKPGVIVLWQAISVTILSLPLGLMNWSS
FT                   PTAWQWLGFVTAGVLGSLGHYCLTRGFRVADISATQSLRFLDLIWASLMGWLVFSDVPN
FT                   QTTLLGALVILASTVWIARREHRR"
FT   gene            complement(674234..674992)
FT                   /locus_tag="Rfer_0650"
FT   CDS_pept        complement(674234..674992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0650"
FT                   /product="putative hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68401"
FT                   /db_xref="GOA:Q221A2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A2"
FT                   /protein_id="ABD68401.1"
FT                   /translation="MSIRPDTQTLITALTRARLSGQRLCAADWVGAVHSEADAYAVQDG
FT                   VATALGWAEGPLVRHWKSGGSTRSGPFSHAPLDPAAINPAGKTGLLLGVEAEVALRLGR
FT                   DVSPEAARAMKSETAGDWVDAMAVAVELVASRWTEGLAAPELLRMADHQSNAGLMLGIW
FT                   QPYAARDWSAQTCQVKVGSQTPVTCTGSHSLNDPAWLLPAWLQHLTRHGTTVAAGTVVT
FT                   TGSWVGCLPIQPDDRVSVDFAGLGHLTVGL"
FT   gene            complement(675239..675805)
FT                   /locus_tag="Rfer_0651"
FT   CDS_pept        complement(675239..675805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68402"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A1"
FT                   /protein_id="ABD68402.1"
FT                   /translation="MRRRLEKRPTILPSHSAVPLMNTLSRVLTGLLLTLLSSLVVAQDL
FT                   PTKFDPHRDAAKDVATAQSLAKATGRRVLVDVGGEWCAWCRMLDRLIASQPQIRALIDS
FT                   HYVWVKVNYSPENKNTAVLSRWPKIRGYPYLLVLDGAGKLLHAQGVQGLETETEKEADE
FT                   NYDPDRVMAFLNRYATATSVSAQHY"
FT   sig_peptide     complement(675677..675805)
FT                   /locus_tag="Rfer_0651"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 43"
FT   gene            676175..677635
FT                   /locus_tag="Rfer_0652"
FT   CDS_pept        676175..677635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0652"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68403"
FT                   /db_xref="GOA:Q221A0"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q221A0"
FT                   /protein_id="ABD68403.1"
FT                   /translation="MSAVLKPAVLKPNVDYVIADLSLAAWGRKELNIAQTEMPGLMAIR
FT                   EEFSKSQPLKGARITGSLHMTIQTAVLIETLQALGAQVRWASCNIFSTQDHAAAAIAAT
FT                   GTPVFAIKGESLADYWDYTHRIFEFGGKKGSALEGPNMILDDGGDATLLMHLGARAEKD
FT                   IKLLAKPGSEEEVCLFAAIKAKLKVDATWYSRRLKNIVGVTEETTTGVHRLNDMSAKGE
FT                   LMLRAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVALIAGYGDVGKGCAQA
FT                   MRALSAQVWVTEVDPINALQAAMEGFKVVTMEYAADKCDIFVTCTGNLNVITYKHMAAM
FT                   KDQTIVCNIGHFDNEIDVASLDKCKWEEIKPQVDHVIFPAKGKTPSKRIILLAKGRLVN
FT                   LGCGTGHPSFVMSSSFANQTIAQIELFTKPKQYKVGKVYVLPKHLDEKVARLHLGKVGA
FT                   MLSELTDEQAAYIGVSKAGPYKADSYRY"
FT   gene            677672..678493
FT                   /locus_tag="Rfer_0653"
FT   CDS_pept        677672..678493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0653"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68404"
FT                   /db_xref="GOA:Q220Z9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z9"
FT                   /protein_id="ABD68404.1"
FT                   /translation="MRADQLLVQRQLASTRSQAQRLIADGVQWLKGTEWKTVTKNGDEI
FT                   PLEAELKLLNDAEARYVSRGGLKLEAALKQVGLSVTGLACLDVGQSTGGFTDCLLQHGA
FT                   ASVVGVDVGSAQLHPSLREDPRVLCIEKVNARALVAADLIAAYEESTGAGGQFDVEEGD
FT                   ADLVEFAPEFDLIVADLSFISQTLVLPAVVPLLKCGGTLLTLVKPQFELQPGQVGKGGI
FT                   VKDAAMYWLVEQRLREACAALGLTVTAWFDSPIAGGDGNREFFIAAARLKL"
FT   gene            678504..679355
FT                   /locus_tag="Rfer_0654"
FT   CDS_pept        678504..679355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0654"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68405"
FT                   /db_xref="GOA:Q220Z8"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z8"
FT                   /protein_id="ABD68405.1"
FT                   /translation="MTATPQIPLSFEFFPPKTPEGVEKLRLVRQQLYALKPEFCSVTFG
FT                   AGGSTQEGTFSTVRDILTEGIGAASHISCIGATHAKVREQLAILKAMGVKRLVALRGDL
FT                   PSGFGVGGEFHYASDLVAFVRAETGDYFHIEVAAYPEVHPQARSPEADLQAFATKVKAG
FT                   ANSAITQYFYNADAYFRFVEEADALGLSLPIVPGIMPIASSTQLMRFSDACGAEIPRWI
FT                   RLRLQGFGDDAVSIKAFGLDVVTDLCEQLRAGGAPGLHFYSMNQSAATLEVCNRLGQGP
FT                   AD"
FT   gene            complement(679652..680014)
FT                   /locus_tag="Rfer_0655"
FT   CDS_pept        complement(679652..680014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68406"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z7"
FT                   /protein_id="ABD68406.1"
FT                   /translation="MGRILMGACQPACVGINDFCWIRKKRISKFRGNPMHTIFLIDPKH
FT                   LAVAHQFQFLAAHRQLNSKVHVRTQRWRSVNFKINASCADIAGQAMNITDFDWQRGLES
FT                   DCTSPMHQGWFFILDS"
FT   gene            680042..681049
FT                   /locus_tag="Rfer_0656"
FT   CDS_pept        680042..681049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0656"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68407"
FT                   /db_xref="GOA:Q220Z6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z6"
FT                   /protein_id="ABD68407.1"
FT                   /translation="MKILLTGAAGFIGMTTALRLLARGDEVLGLDNLNDYYDVTLKENR
FT                   LKRLSPHAGFRFVKMDVADRQGMAQLFADEKFDRVIHLAAQAGVRYSLQNPHAYIDSNI
FT                   VGFMNVLEACRHTQVQHLVYASSSSVYGGNTNMPFSEHDSVDHPVSLYAATKKANELMA
FT                   HTYSHLYGLPTTGLRFFTVYGPWGRPDMALFLFTKAILEGRPIDVFNYGQMQRDFTFVD
FT                   DIVEGVVRVLDRVACPNPVYDPARADPATSNAPYRVFNIGNNKPVPLLDFIACIEEALG
FT                   RKAEKNLLPLQDGDVPATYANTDALNDWVGFVPGTPIEQGIARFVAWYRDYYQV"
FT   sig_peptide     680042..680110
FT                   /locus_tag="Rfer_0656"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.561 at
FT                   residue 23"
FT   gene            complement(681084..681650)
FT                   /locus_tag="Rfer_0657"
FT   CDS_pept        complement(681084..681650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0657"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68408"
FT                   /db_xref="GOA:Q220Z5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z5"
FT                   /protein_id="ABD68408.1"
FT                   /translation="MIQRLKNFCFFRGSAPIKCASMTKLLMVCMGNTCRSPMAQAVIRK
FT                   LALETGLAQPFEVACAGTHAHHLGERLDPRAALTLTRHGYEMGRVRSRRITEQDFQSFD
FT                   LILAMDSSNLTELHRLCPAEQGHKLHLLLDFAEEISETEVPDPYYGNQEGFEQVLALCE
FT                   AGARGLIRRLLQKPSKIDAAVPPAG"
FT   gene            681878..682444
FT                   /locus_tag="Rfer_0658"
FT   CDS_pept        681878..682444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0658"
FT                   /product="polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68409"
FT                   /db_xref="GOA:Q220Z4"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR017477"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z4"
FT                   /protein_id="ABD68409.1"
FT                   /translation="MVAACASSSAYPPAPMGAATTDYNYVVGAGDTLNIIVWRNPELSM
FT                   SVPVRPDGKVSTPLVDELVAQGKTSVEIARDVEKALSKLVRDPVVTIIVTSFVGPYSEQ
FT                   IRVVGEAARPQALPYKQKMTVLDVMIAVGGLTDFADGNAASITRASEGDKRYSVRLKDL
FT                   VKRGDISANVEMKPGDVLIIPQGWF"
FT   gene            682528..684102
FT                   /locus_tag="Rfer_0659"
FT   CDS_pept        682528..684102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0659"
FT                   /product="lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68410"
FT                   /db_xref="GOA:Q220Z3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR014345"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z3"
FT                   /protein_id="ABD68410.1"
FT                   /translation="MDELISQLATAARGMWKHRWLGLLVAWAVTAIGLFVVLSVPDKYE
FT                   ATARIFVDTQSILKPLMSGLAVQPNVDQQVGMLSRTLISRPNVEKLVRMADLDLKTQSK
FT                   SEHEALIDRLMKTLEIKNVGRDNLYVLSYRDTSPDKAKRVVQSLVSIFVESSLGDSRKD
FT                   SKTARRFIDEQIQTYVTKLEEAEARLKQFRLRNIELQNADGKDMAGQIGAVSSQLSQAR
FT                   LDLREAENARDSAKRQLDAEKDQNANITSRSLLQESAMQSSTPEIDARIDAQKRQLDGL
FT                   LQRFTEQHPDVVGTRRLIQELESTKAKELQELRKTALANPAAASANSMAYQELHRLLAS
FT                   SEVQVAALRARVGEYETRYARARELMKTAPQIEAELAQLNRDYDINKKNYNDLVSRRES
FT                   AAMSGDLDSAAGMADFRLIDPPRASPQPVAPNRLLLMPLALLAGLGVGLVAAFAASQLR
FT                   AVFHDGRSLKETLGLPLLGVVTLVLDDGAVLREKLELKKFWAASGGLIGVFLTGMIIFS
FT                   VMSGRLG"
FT   gene            684110..685081
FT                   /locus_tag="Rfer_0660"
FT   CDS_pept        684110..685081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0660"
FT                   /product="Protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68411"
FT                   /db_xref="GOA:Q220Z2"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z2"
FT                   /protein_id="ABD68411.1"
FT                   /translation="MSSLIEQAAVRLEQLRQAGAEMPVVTPVAHASDENWKPVTETARV
FT                   AEAATAPGVHSGATSRRIEIDLEALAKAGIVSPNAPRSQIADQYRVVKRPLISNAMGKG
FT                   ASTVTSGNLIMVTSALPGEGKTFTAINLAMSMATELDYTVMLVDADVLRPSVMAVMGLD
FT                   EGAGLLDLVLDESKDLSSVLLKTNIDKLSLLPSGTPHPRATELLASDAMTRLLTDLATR
FT                   YADRIIIFDSPPLLLATEARVLASHMGQVVVVVQAEKTLKSDVVQALATIEACPVKLML
FT                   LNQAKTASKGGYGYGYGYGYGYGYGHGYEQARSGLSSLSTQP"
FT   gene            685081..686637
FT                   /locus_tag="Rfer_0661"
FT   CDS_pept        685081..686637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68412"
FT                   /db_xref="InterPro:IPR017467"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z1"
FT                   /protein_id="ABD68412.1"
FT                   /translation="MRSPLALRRLRFRVAGAPTAGLLMMASVGAYAQATVEDAGSRRLV
FT                   SVVPRISISEVLTNNVGLSSTNPQADQITQISPGILVNVAGARVHAYFDYSRNELFYAQ
FT                   DSSSQKSQNALNTFGTLEVIDNWAFLDFSGNISQQSISAFGAQSVDNTSINPNRTEVST
FT                   YRLSPYVRGLLGSVANYEARYSRTVTSSDAAIGRGVTTVDAVAKVGADRAFGNLGWSAD
FT                   ASQQTADYSAGRPTESERLNLGLSYAVTPQLSVSARAGRETNNYTSLDKQNYDTSGVGV
FT                   NWAPSERSKLSASLDHRPFGDAHSVSFEHRTARTAWRFSDSKDVSTTPGQTGLSSLGSV
FT                   YDLLFSQFASLEPDETKRAQLINAYLQTNGISPNTPVISSFLTSSVSLQRRQDLSFVLL
FT                   GVRDTVTFAVTRSENRRLDTVTTGVDDFTTAPLVHQRGFSFNYAHRLTPGYSLGVLASQ
FT                   QDTTGELSLQDSRLRLLSIQLTGKVGKNAAASVGVRRVVYSSFTAPYGETAITVSLNVQ
FT                   F"
FT   sig_peptide     685081..685179
FT                   /locus_tag="Rfer_0661"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.957 at
FT                   residue 33"
FT   gene            686641..687747
FT                   /locus_tag="Rfer_0662"
FT   CDS_pept        686641..687747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0662"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68413"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017466"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q220Z0"
FT                   /protein_id="ABD68413.1"
FT                   /translation="MYETYYGLNSKPFQLNPDPSFYFGSKQHRRAKAYLEYGVQRNEGF
FT                   IVITGEVGAGKTTIVRGLLASLDPDKVVAANLVTTQLDAEDTLRLVGAAFGVRVKDVSK
FT                   ADVLMALEAYLVNQTSQGRRCLLIVDEAQNLTAKAVEELRMLSNFQFGQQALLQTFLVG
FT                   QPEFRTILQSPTMQQLRQRVTATCHIGPMDKDETRGYVEHRLKCAGAKGRPSFDDFAFE
FT                   AIFKASGGIPRRINLTCDRLLLFGFLGNKDAFGVEDVNEVVNEINDESAVPVKPSASAG
FT                   STPDDAPVQSLSGFEAGDIDSTKLQAGSALAGALCSQIDGLSAEQYDGRLRRLELSMLR
FT                   IERINLEVLAMLQKMVMAARKPSQESHS"
FT   gene            687744..688940
FT                   /locus_tag="Rfer_0663"
FT   CDS_pept        687744..688940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rfer_0663"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Rfer_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABD68414"
FT                   /db_xref="GOA:Q220Y9"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro: