(data stored in SCRATCH zone)

EMBL: CP000271

ID   CP000271; SV 1; circular; genomic DNA; STD; PRO; 3363523 BP.
XX
AC   CP000271; AAAJ03000000-AAAJ03000058;
XX
PR   Project:PRJNA254;
XX
DT   03-JUL-2006 (Rel. 88, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 11)
XX
DE   Paraburkholderia xenovorans LB400 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Paraburkholderia xenovorans LB400
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Paraburkholderia.
XX
RN   [1]
RP   1-3363523
RX   DOI; 10.1073/pnas.0606924103.
RX   PUBMED; 17030797.
RA   Chain P.S., Denef V.J., Konstantinidis K.T., Vergez L.M., Agullo L.,
RA   Reyes V.L., Hauser L., Cordova M., Gomez L., Gonzalez M., Land M., Lao V.,
RA   Larimer F., LiPuma J.J., Mahenthiralingam E., Malfatti S.A., Marx C.J.,
RA   Parnell J.J., Ramette A., Richardson P., Seeger M., Smith D., Spilker T.,
RA   Sul W.J., Tsoi T.V., Ulrich L.E., Zhulin I.B., Tiedje J.M.;
RT   "Burkholderia xenovorans LB400 harbors a multi-replicon, 9.73-Mbp genome
RT   shaped for versatility";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(42):15280-15287(2006).
XX
RN   [2]
RP   1-3363523
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Lykidis A., Richardson P.;
RT   "Complete sequence of Chromosome 2 of Burkholderia xenovorans LB400";
RL   Unpublished.
XX
RN   [3]
RP   1-3363523
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (13-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f695f4da3a9c79eb69bc167094efc30c.
DR   BioSample; SAMN02598451.
DR   EnsemblGenomes-Gn; Bxe_BR0001.
DR   EnsemblGenomes-Gn; Bxe_BR0002.
DR   EnsemblGenomes-Gn; Bxe_BR0003.
DR   EnsemblGenomes-Gn; Bxe_BR0004.
DR   EnsemblGenomes-Gn; Bxe_BR0005.
DR   EnsemblGenomes-Gn; Bxe_BR0006.
DR   EnsemblGenomes-Gn; Bxe_BR0007.
DR   EnsemblGenomes-Gn; Bxe_BR0008.
DR   EnsemblGenomes-Gn; Bxe_BR0009.
DR   EnsemblGenomes-Gn; Bxe_BR0010.
DR   EnsemblGenomes-Gn; Bxe_BR0011.
DR   EnsemblGenomes-Gn; Bxe_BR0012.
DR   EnsemblGenomes-Gn; Bxe_BR0013.
DR   EnsemblGenomes-Gn; Bxe_BR0014.
DR   EnsemblGenomes-Gn; Bxe_BR0015.
DR   EnsemblGenomes-Gn; Bxe_BR0016.
DR   EnsemblGenomes-Gn; Bxe_BR0086.
DR   EnsemblGenomes-Gn; EBG00001040210.
DR   EnsemblGenomes-Gn; EBG00001040211.
DR   EnsemblGenomes-Gn; EBG00001040212.
DR   EnsemblGenomes-Gn; EBG00001040213.
DR   EnsemblGenomes-Gn; EBG00001040214.
DR   EnsemblGenomes-Gn; EBG00001040215.
DR   EnsemblGenomes-Gn; EBG00001040216.
DR   EnsemblGenomes-Gn; EBG00001040217.
DR   EnsemblGenomes-Gn; EBG00001040218.
DR   EnsemblGenomes-Gn; EBG00001040219.
DR   EnsemblGenomes-Gn; EBG00001040220.
DR   EnsemblGenomes-Gn; EBG00001040221.
DR   EnsemblGenomes-Gn; EBG00001040222.
DR   EnsemblGenomes-Gn; EBG00001040223.
DR   EnsemblGenomes-Gn; EBG00001040224.
DR   EnsemblGenomes-Gn; EBG00001040225.
DR   EnsemblGenomes-Gn; EBG00001040226.
DR   EnsemblGenomes-Gn; EBG00001040227.
DR   EnsemblGenomes-Gn; EBG00001040228.
DR   EnsemblGenomes-Gn; EBG00001040229.
DR   EnsemblGenomes-Gn; EBG00001040230.
DR   EnsemblGenomes-Gn; EBG00001040231.
DR   EnsemblGenomes-Gn; EBG00001040232.
DR   EnsemblGenomes-Gn; EBG00001040233.
DR   EnsemblGenomes-Gn; EBG00001040234.
DR   EnsemblGenomes-Gn; EBG00001040235.
DR   EnsemblGenomes-Gn; EBG00001040236.
DR   EnsemblGenomes-Gn; EBG00001040237.
DR   EnsemblGenomes-Tr; Bxe_BR0001-1.
DR   EnsemblGenomes-Tr; Bxe_BR0002-1.
DR   EnsemblGenomes-Tr; Bxe_BR0003-1.
DR   EnsemblGenomes-Tr; Bxe_BR0004-1.
DR   EnsemblGenomes-Tr; Bxe_BR0005-1.
DR   EnsemblGenomes-Tr; Bxe_BR0006-1.
DR   EnsemblGenomes-Tr; Bxe_BR0007-1.
DR   EnsemblGenomes-Tr; Bxe_BR0008-1.
DR   EnsemblGenomes-Tr; Bxe_BR0009-1.
DR   EnsemblGenomes-Tr; Bxe_BR0010-1.
DR   EnsemblGenomes-Tr; Bxe_BR0011-1.
DR   EnsemblGenomes-Tr; Bxe_BR0012-1.
DR   EnsemblGenomes-Tr; Bxe_BR0013-1.
DR   EnsemblGenomes-Tr; Bxe_BR0014-1.
DR   EnsemblGenomes-Tr; Bxe_BR0015-1.
DR   EnsemblGenomes-Tr; Bxe_BR0016-1.
DR   EnsemblGenomes-Tr; Bxe_BR0086-1.
DR   EnsemblGenomes-Tr; EBT00001641656.
DR   EnsemblGenomes-Tr; EBT00001641657.
DR   EnsemblGenomes-Tr; EBT00001641658.
DR   EnsemblGenomes-Tr; EBT00001641659.
DR   EnsemblGenomes-Tr; EBT00001641660.
DR   EnsemblGenomes-Tr; EBT00001641661.
DR   EnsemblGenomes-Tr; EBT00001641662.
DR   EnsemblGenomes-Tr; EBT00001641663.
DR   EnsemblGenomes-Tr; EBT00001641664.
DR   EnsemblGenomes-Tr; EBT00001641665.
DR   EnsemblGenomes-Tr; EBT00001641666.
DR   EnsemblGenomes-Tr; EBT00001641667.
DR   EnsemblGenomes-Tr; EBT00001641668.
DR   EnsemblGenomes-Tr; EBT00001641669.
DR   EnsemblGenomes-Tr; EBT00001641670.
DR   EnsemblGenomes-Tr; EBT00001641671.
DR   EnsemblGenomes-Tr; EBT00001641672.
DR   EnsemblGenomes-Tr; EBT00001641673.
DR   EnsemblGenomes-Tr; EBT00001641674.
DR   EnsemblGenomes-Tr; EBT00001641675.
DR   EnsemblGenomes-Tr; EBT00001641676.
DR   EnsemblGenomes-Tr; EBT00001641677.
DR   EnsemblGenomes-Tr; EBT00001641678.
DR   EnsemblGenomes-Tr; EBT00001641679.
DR   EnsemblGenomes-Tr; EBT00001641680.
DR   EnsemblGenomes-Tr; EBT00001641681.
DR   EnsemblGenomes-Tr; EBT00001641682.
DR   EnsemblGenomes-Tr; EBT00001641683.
DR   EuropePMC; PMC1847439; 17362501.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2765135; 19700546.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000271.
DR   SILVA-SSU; CP000271.
DR   StrainInfo; 374301; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351477
CC   Source DNA and bacteria available from Jim Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Contacts: Jim Tiedje (tiedjej@pilot.msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3363523
FT                   /organism="Paraburkholderia xenovorans LB400"
FT                   /chromosome="2"
FT                   /strain="LB400"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266265"
FT                   /type_material="type strain of Paraburkholderia xenovorans"
FT   gene            446..1108
FT                   /locus_tag="Bxe_B3028"
FT   CDS_pept        446..1108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3028"
FT                   /product="plasmid segregation oscillating ATPase ParF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32969"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SH0"
FT                   /protein_id="ABE32969.1"
FT                   /translation="MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVVDADGQNT
FT                   LIHWASASSDGDTGIPFPVVNLSEAGSQIHREIKKFVADYDIIVVDCPPSITEKVSGVV
FT                   LLAASVAVIPTSSSPADYWSSIGLVKLVQQAQLMNEDLRAVFLLNKTEEKRMLTRELKR
FT                   ALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGAKLAAIEVRACANEIAALLP"
FT   gene            1134..2192
FT                   /locus_tag="Bxe_B3027"
FT   CDS_pept        1134..2192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3027"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32970"
FT                   /db_xref="GOA:Q13SG9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG9"
FT                   /protein_id="ABE32970.1"
FT                   /translation="MKPSQFAKGFQARPDSTSSEKRTALDRLNAIDGIVKNDARHSEAA
FT                   GRVIAPGTPSQSLTEVDAVDAANESAAYRTWRLEHGYRPGQVIELALKTIKPSPFNPRH
FT                   FYLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKAIV
FT                   VDLPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDRHFQSQKELAEHLGLDESTVA
FT                   VALSISKLPEVVMHEMVARPDRFGSNMAYQVGRYHTARGADATLRLINKILSDDLSTRQ
FT                   VADIVKGRASAQESTKPAGRQRYAQRLEIKLDGVSVGDLKSYGDDRIELRLKGLTREKR
FT                   DDILRQIEKMLK"
FT   gene            complement(2251..3633)
FT                   /locus_tag="Bxe_B3026"
FT   CDS_pept        complement(2251..3633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3026"
FT                   /product="Putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32971"
FT                   /db_xref="GOA:Q13SG8"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG8"
FT                   /protein_id="ABE32971.1"
FT                   /translation="MLSPNPSSTRRMATKRAKKTDVVSPSSAELRKAVEAIAIQPKSGK
FT                   ITLLTRKLFNVLLAVAQQADESGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQV
FT                   EWSTGTSSQKPGRKWGISTLIADAEILEDPTTRRVWVEFSFAPKIKKKLLDPVQYARLS
FT                   LQFQSQLRSSAGLALYEICVRYLTNPSHLTMRETWEWWRPILSGTPDTEAGDEAKREYK
FT                   YFKRDYLRPAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDS
FT                   TLVDRMVKIGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTSLPPVRSAPALFKDALK
FT                   KGYAPPVEALPSSGGGKAAVAAPADDLKARLLGEYSAYRRKEARELYDEQGESEREIAR
FT                   QSFEEDELPGLGTHMRDDWRRRGLDSKIVETAFFDWLARKTWGEPTDGDLLAFTLSQSR
FT                   AA"
FT   gene            5826..6899
FT                   /locus_tag="Bxe_B3025"
FT   CDS_pept        5826..6899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32972"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG7"
FT                   /protein_id="ABE32972.1"
FT                   /translation="MATVRDLTQTGSASDIPKDIDHFWERIRNVSRVKVGTGAIPKALE
FT                   ERAGELLGALFEEAVTHARATLDDEREEMRTQIAAADQRARDAEIRQQAAEDAIKRGEL
FT                   RAEAGWERVRALEAQLSSATTHGNTHQEGLQATVRRLDQENESLRQRLDTEFATNAALR
FT                   DRIDALHVELRQSTEHYAQQIKDAIAEAERRVKPMLVELDSLRSMAATYQSGLRDASRK
FT                   EFEFIQQIAAAKARGDRLDAQLREQSDEVDALTKEVAVLRSQQGVDPAIATLLCSLVEA
FT                   GRLTEDELKAIGTAVDGHVALPLRCPKCEEGEPELSQVDHRFELQCPECDHSSGLGESR
FT                   LEAVRRFQSSGPVAASA"
FT   gene            complement(6971..8053)
FT                   /locus_tag="Bxe_B3024"
FT   CDS_pept        complement(6971..8053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3024"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32973"
FT                   /db_xref="GOA:Q13SG6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG6"
FT                   /protein_id="ABE32973.1"
FT                   /translation="MSPPHLTDPVPRPAPSTDLFDQQREDWRRDPQIAFDAWLARQHFR
FT                   RSSAEVYQAQWGLFLDWLGMRQKSLATVDARAIAEFVAGLDVRKTQRMRYLRLIERVLD
FT                   HVREIESASTNPARFIAQDGEAAWRNARDNEPTGFLSHAERTALTAHLFSPLLNLSAAR
FT                   RWRERRDRALIAVFLGGGLKTGEAAALTVSCVTAGSPWVTIEAANPMLTRRTRLAPFAA
FT                   AILDAWLAERRLAELAGNLVFPASPSGRPMHKATMLRAVDALIDGAGIAASRTSRASPQ
FT                   TLRNTFAADLFESGVEAELVGQWLGFVQAVSANRLYRAWQNWMDQQEAPAADVPDPAAP
FT                   LLAAPRRDGRLTRKRGASES"
FT   gene            complement(8112..8507)
FT                   /locus_tag="Bxe_B3023"
FT   CDS_pept        complement(8112..8507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3023"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32974"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG5"
FT                   /protein_id="ABE32974.1"
FT                   /translation="MNDLITDSTDHALAALRYQTAARDLERIVRNIAARYIVQEVPLTW
FT                   RLLHAIEAEALADLGFASRHDALMLGLFQRPSGLPYPETDEAVDFGTSTALPAVFAFAV
FT                   SAYEEAARRAAQASQNTALRHARAWGD"
FT   gene            complement(8613..9239)
FT                   /locus_tag="Bxe_B3022"
FT   CDS_pept        complement(8613..9239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3022"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32975"
FT                   /db_xref="GOA:Q13SG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG4"
FT                   /protein_id="ABE32975.1"
FT                   /translation="MASSGIRRAAADAALTSGATSVPAVAAPPRVGEQIQRLRAERRMT
FT                   LDDLSRAAGVSKSMLSEIERDKANPTIAVAWRLTNALGVSLDSLFAPQKTPEAIAVSGP
FT                   HEIPTLSGRDARYQLRVWGPIELAGKFEWYELTLQPGGVLASNAHEPGTREHLTVLQGS
FT                   IEIEAASTTKRLKTADTARYVADEPHAIRNAGKGEAKALLVVIHG"
FT   gene            9401..10600
FT                   /locus_tag="Bxe_B3021"
FT   CDS_pept        9401..10600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3021"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32976"
FT                   /db_xref="GOA:Q13SG3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG3"
FT                   /protein_id="ABE32976.1"
FT                   /translation="MRDLYLAHLRDTLEQIRADGFYKNERVIASPQSADIRLADGAAVL
FT                   NFCANNYLGLADDARLIDAAKQGLDSDGFGMASVRFICGTQTVHKELEQALAAFLQTDD
FT                   CILYSSCFDANGGLFETLLDENDAIISDELNHASIIDGVRLSKAKRSRYKNNDLADLEA
FT                   RLIEAQAAGARFKLIATDGVFSMDGIIADLAGICDLADRYGALVMVDDSHAVGFVGEHG
FT                   RGTPEHCGVLSRVDIITGTLGKALGGASGGYVAARKEIVELLRQRSRPYLFSNTLTPSI
FT                   AAASLKVLELLASEEGAQLRARVRENGAHFRSKMSALGFTLVPGEHPIIPVMLGDAQLA
FT                   SKMADALLKEGVYVIGFSFPVVPKGRARIRTQMSAAHTPGQIDRAVDAFARVGRELGVI
FT                   "
FT   gene            10614..11645
FT                   /locus_tag="Bxe_B3020"
FT   CDS_pept        10614..11645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3020"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32977"
FT                   /db_xref="GOA:Q13SG2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13SG2"
FT                   /protein_id="ABE32977.1"
FT                   /translation="MKALAKLERAPGLTLTDVKKPEVGHNDVMIRITRTAICGTDIHIW
FT                   KWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRR
FT                   HLCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLV
FT                   GEDVLITGAGPIGIMAVAIAKHVGARNVVITDVNDYRLELARKMGATRAVNVSRESLRD
FT                   VMADLHMAEGFDVGLEMSGVPSAFTGMLEAMNHGGKIALLGIPPAQTAIDWTQVIFKGL
FT                   EIKGIYGREMFETWYKMVAMLQSGLDLSPILTHHFKVDDYREAFATMLSGESGKVILDW
FT                   TAA"
FT   gene            complement(11713..12363)
FT                   /locus_tag="Bxe_B3019"
FT   CDS_pept        complement(11713..12363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3019"
FT                   /product="putative YceI like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32978"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG1"
FT                   /protein_id="ABE32978.1"
FT                   /translation="MSTLTLRATFVRAFLSAMLLTAAACTPLQVLTHSVSQNEARVPPG
FT                   RYEIDPDHCSITFDIDHFKYSRFTARFDRKKGELDWNEGGLDRSTTSVTIDAASIDTNV
FT                   PLLDKMVKSGSMLDVERYPEIRFVSTRFERTGESRGTLTGDLTIHGVTQPVTLDVTFNG
FT                   FAPDPLTKKDTLGFSAEGRFSRARFGLATWYPAVGDDIHVRIQAEFVKTPAGG"
FT   gene            12472..13137
FT                   /locus_tag="Bxe_B3018"
FT   CDS_pept        12472..13137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3018"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32979"
FT                   /db_xref="GOA:Q13SG0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG0"
FT                   /protein_id="ABE32979.1"
FT                   /translation="MATETHIESVPPGSARERLLDAAEALIYAGGIHATGVDAIVKQSG
FT                   TARKSFYTHFESKDALVAAALDRRDERWMNWFIAGTQRHGKTARKRLLGMFEVLREWFA
FT                   SKDFHGCAFLNASGEIASADDPIRIVARKHKERLLAFVRTECDGLAAESGMDARRAARL
FT                   SRQWLILLDGAIAVALVSGEPDAALDAQAAAQVLLDAECACERGTPPSKRPPSRRTAT"
FT   gene            13151..13630
FT                   /locus_tag="Bxe_B3017"
FT   CDS_pept        13151..13630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32980"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF9"
FT                   /protein_id="ABE32980.1"
FT                   /translation="MTDPIETRPPLPPFTRETAIQKVRAAEDGWNTRDPERVSLAYTKD
FT                   SVWRNRAEFTNGRAEIVGLLRRKWAKELDYRLIKELWAFTDNRIAVRFAYEWHDDSNNW
FT                   FRSYGNENWEFDEHGLMARRHASINDMPIREADRLYHWPLGRRPDDHPGLSDLGL"
FT   gene            13842..14360
FT                   /locus_tag="Bxe_B3016"
FT   CDS_pept        13842..14360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32981"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF8"
FT                   /protein_id="ABE32981.1"
FT                   /translation="MHFRQINKNIRRAALALVASLAAASAAHAGNWCEGGVWVDAMLGS
FT                   YHINPDPDTHFEQFNPGLGVECWLNNQWALTAGGFRNSLRRPSYYGGGVWAPEFAHWGI
FT                   VRIAAIGGIISGYNYGNWGLGRNHTIGPVVAPIVMVEYKRVGANFIVIPPIPSDDLPFT
FT                   IGFQLKVKF"
FT   gene            14890..15411
FT                   /locus_tag="Bxe_B3015"
FT   CDS_pept        14890..15411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3015"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32982"
FT                   /db_xref="GOA:Q13SF7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF7"
FT                   /protein_id="ABE32982.1"
FT                   /translation="MQGSRQKDNANTPTRKKPAAADRKKPVSGLEAHVGYWLRFVSNHV
FT                   SHGFQTKVEAHGVTVSEWVLLREIYSSGPTSATALAARTGMTKGAVSKLLARIEAKALL
FT                   ERETVEEDRRNHVVALSAAGLELVPELARLADQNDEEFFGHLPAPVKTAIVDAMKNVVA
FT                   VHGLKAVPIE"
FT   gene            15437..15844
FT                   /locus_tag="Bxe_B3014"
FT   CDS_pept        15437..15844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32983"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF6"
FT                   /protein_id="ABE32983.1"
FT                   /translation="MSAKLNEASRRVAENCAQRSHNGTIDFGSVVRALGEAGVESYFTD
FT                   YRRGEHTYYAPSGETHVIALPLPDTAIANAFDADAVNQAVRGAQSGAVKYAEFVSRTLA
FT                   AGCVGYFVWIAGRQVQYFGRRGEIHVERFPQ"
FT   gene            15841..16536
FT                   /locus_tag="Bxe_B3013"
FT   CDS_pept        15841..16536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3013"
FT                   /product="DNA-7-methylguanine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32984"
FT                   /db_xref="GOA:Q13SF5"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF5"
FT                   /protein_id="ABE32984.1"
FT                   /translation="MTPDAFASEIGAALAPHANAERALAMRAYMRHQFEFIGVPTPLRR
FT                   QAVLPVLKALQVQNADYLLACAHVLWTMPAREYQYVATDLLARKWKTLALGDIARLLTI
FT                   AQHASWWDSVDPLAAVVGDVLKAARVEALQAQAAMDTALRHESLWVRRIAMIHQLGWRE
FT                   HTDEDRLFAYARALAAESDFFIRKAIGWALRDYARHAPDVVSGFLSTSRDLISPLTLRE
FT                   ASKHLPPIC"
FT   gene            complement(16579..18354)
FT                   /locus_tag="Bxe_B3012"
FT   CDS_pept        complement(16579..18354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32985"
FT                   /db_xref="GOA:Q13SF4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF4"
FT                   /protein_id="ABE32985.1"
FT                   /translation="MNVSVRSYLSPTLVLLAFDWPEGGTREDFLGFAIKRTPGFLATDG
FT                   QEREASSWLPNRLTFKGAVPDTQKDAPSNEAPIQKFMWWDARIDEADREKSFTYLVYPV
FT                   IGKPEAPQLLDAQKGECKISLPAHREESIGSWFNRAVVSSQAFARKVAALHLAPHAVPS
FT                   AAQALRLRTWLANDLQEVFALTLDHAQRAASAVYHLTDPLWAIPAFEAFGKKQGKASLA
FT                   IVYDSHKVSQKGKPPAPSPNQPAVDELGDVATFAPRDKTHIMHDKFIVVNNGNGAASPA
FT                   RVLTGSANFTTEGITEQANVLHLFDSPELATLYSDRAKALAGNPTIAATAKLTPGWSDP
FT                   IQIGSAQVRVCFSPEAKDSRLQIDTIVDAIGKAKHSVVFCLFMPTDEPLREACFAAGDK
FT                   GLMMFGLVNHISPKSAEAAEEAEKNGQTVSTTALANMELYHRGRDKRDVIDAEYFSPAT
FT                   VPAGFEPELRLFPGEHAPDYAPVIIHHKFLVIDAEGANPVVYTGSANMSNNSEHFNDEN
FT                   LLEIRDRRIAGMYLAEFLRLYEHYRARALAIRQKKNGDTHERLMLAPDGSWAKKYFIAD
FT                   SPEDKARVALAHGGD"
FT   gene            18633..21023
FT                   /locus_tag="Bxe_B3011"
FT   CDS_pept        18633..21023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3011"
FT                   /product="CheA signal transduction histidine kinases
FT                   (STHK)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32986"
FT                   /db_xref="GOA:Q13SF3"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF3"
FT                   /protein_id="ABE32986.1"
FT                   /translation="MTIRHRITLLVVLMFVALSAIGGYAVYQTRGSAGEVRKVTEGVVP
FT                   SALASADLVSQVKDVQLATMTLVYAPDANMVAQAQDELNKKRASLQQALALQDKDAASH
FT                   AQKGLVSQANDSLQNYFSAIAETAKMKAEGKNELAQAYLFANVAQYRDELEGIVETLRV
FT                   EKNREKDEAITTLNATLATTTTAIAAVTGIAIILLTFIGALLYRQITRPLSRMQAMMSE
FT                   IASSQDFTRRVPVGRLDEIGHSIVAFNGMIEKIQESSAQLKQKTADIQAMLQNMQQGIL
FT                   TVIDGAVIHAEYSAYLEDIFETKDIAGRGLMDLVFADTDIGSDALSQVDAAVHACLGED
FT                   CINFAFNQHLLVGEISKRMPDGRVKILDLSWSAITDENDVIVRLMLCVRDVTELRKLAA
FT                   EASEQRRRLDMIGEILAVSEEKFHHFIESSAGFISENERIIRKHSAADHAAIAELFRNM
FT                   HTIKGNARTYNLQHLTNVVHETEQSYHELRQPDAGRSWDQEHLMRELTRVREAIESYAK
FT                   INEQSLGRKSKGQANEAGNSGHYVMVAREHIQHTLSMLEQTNAGELQELQSMRDALRRT
FT                   LRALGSESVRDALSGVLDSLPSLASELGKPAPSVRIEDNGYRLRGEAGGTLNNVFMHLL
FT                   RNSMDHGIETAETRSAHGKAPAGSIRIEVGLDSGALQITLSDDGRGLALERIRGIAMER
FT                   GWIGPDDTLSDEAIADFIFRPGFSTAETVTELSGRGVGMDAVRDFLKRANGSIELRFTD
FT                   DQKGAAYRQFQTIVCLPDSIAVDTLGVEARGEAGALQLDAMAD"
FT   gene            21069..21803
FT                   /locus_tag="Bxe_B3010"
FT   CDS_pept        21069..21803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3010"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32987"
FT                   /db_xref="GOA:Q13SF2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF2"
FT                   /protein_id="ABE32987.1"
FT                   /translation="MIQQYVLAAAAGSAVTALLAFAAHKLHSAKLTARLHAEAQARIDT
FT                   LEAAQAGHGAAIGERERAEQELQALTTQLRDELALQTANAEELRAALKAATEDKDQLAH
FT                   QAQKIAGEAERLKSLGATFERWHEQMISLMTQNNDMHAKNQELSSIVRHVVIVSLNASI
FT                   EAARAGPAGRGFAVVASEVRALAARSEELSKSYRDSLHRNDLTTTSTFQDIQAGGKMIA
FT                   ASLASVESLANQFHSKLHEVAV"
FT   gene            21800..22342
FT                   /locus_tag="Bxe_B3009"
FT   CDS_pept        21800..22342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32988"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF1"
FT                   /protein_id="ABE32988.1"
FT                   /translation="MISAHAKDSFDRIFRKAAQARLPLDAGDLCEIAPIADAGIGVSRD
FT                   TQVVVLTISSIVFRLLLILHFDEDGSTRAYYLKDAADERPFQEVFLEICNLCCGAMNQE
FT                   LLRYFPDLGMSTPYVLNARCLPHLHELKPGLLSSYSVTLNGTVRLAATVCVCADAPLDF
FT                   VADTSALEETGGELELF"
FT   gene            22380..23351
FT                   /locus_tag="Bxe_B3008"
FT   CDS_pept        22380..23351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32989"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF0"
FT                   /protein_id="ABE32989.1"
FT                   /translation="MNMNKPVSKVLVLDDCPAHKEALKRFCDENNLVGVKVGKNRLQSV
FT                   LRSNIDLGAVLFAERYGGSPEASAEIAIRINAVRPELPIIMRRDNDPGMDDLPEGLQRV
FT                   VCAAYVAHDMAPLRQVIDEYIFSLDYPNALVRGIADMTQAILGDVFKDLTITCDTPHIV
FT                   RDRIIFGEVFSLIPLESAWCRGYMMMQAEETPILDLLDRHQMIDNTQRGEADFRDLNSV
FT                   LGEVTNLIWGSFRNRYVGDADAWARSQVQVPLLVNHKHKYISFGSGNPQLCFTYWLKDP
FT                   KSNRAVKLHQRFVFSLSWSPEDFTEVADDVGAMVEAGELDLF"
FT   gene            23372..23737
FT                   /locus_tag="Bxe_B3007"
FT   CDS_pept        23372..23737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3007"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32990"
FT                   /db_xref="GOA:Q13SE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE9"
FT                   /protein_id="ABE32990.1"
FT                   /translation="MSKILVVDDSSTVRDEVAGFLKKNGLDVDTAVDGKDGLAKLKASP
FT                   GIKLVISDVNMPNMDGLTMVEKIRGELANKTVNVIMLTTESSPAMKERGKAAGVKGWIV
FT                   KPFKGDAVLETFRKLAG"
FT   gene            24457..25203
FT                   /locus_tag="Bxe_B3006"
FT   CDS_pept        24457..25203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3006"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32991"
FT                   /db_xref="GOA:Q13SE8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE8"
FT                   /protein_id="ABE32991.1"
FT                   /translation="MSQHILFVGADAGLTAVVGESLRGQGCGVSARPPGAGLKHVVEME
FT                   RPSLLVLDISAPHGDGLAVLRDLRMGGNDVPVILLSASSKAIDRVIGLELGADDFMSKP
FT                   ADPAELLARIRVLLRRRGAVAPGAPETRPPYRFGRCELNFSARELRRDNEHFALRSSEF
FT                   ALLKIFVNHAMTVLTRMQLNEKLRGNSVLHQGRSLDVSIWRLRRLIEIDPSEPRYVQTV
FT                   WGRGYVFVPHGELGAAERAAMVAPGI"
FT   gene            complement(25282..26040)
FT                   /locus_tag="Bxe_B3005"
FT   CDS_pept        complement(25282..26040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3005"
FT                   /product="putative short-chain dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32992"
FT                   /db_xref="GOA:Q13SE7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE7"
FT                   /protein_id="ABE32992.1"
FT                   /translation="MTTSSPIRAIVTGHTRGLGAALAEQLLARGIAVLGLSRSRHAELK
FT                   TRFPALLEEIELELADTARVTQWIATDALRAFASGAQTVLLINNAGMVQPIGPIEGQDA
FT                   AAIANAVSLNVATPLMLASALAAAAVDATDRRIVHISSGAARNAYAGWSIYCATKAALD
FT                   HHARAVSLDANRALRICSLAPGVIDTNMQAEIRGSGVEQFPMREKFEDLKRNGQLATPE
FT                   QCATQLLDYALSDAFGQTPVADIREIAKPA"
FT   gene            complement(26152..27111)
FT                   /locus_tag="Bxe_B3004"
FT   CDS_pept        complement(26152..27111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3004"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32993"
FT                   /db_xref="GOA:Q13SE6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE6"
FT                   /protein_id="ABE32993.1"
FT                   /translation="MPTVAIAIFPGVQALDVAGPVDVFSEANRFIAPNNRYEVTLLGAE
FT                   STPLRASNGMTLVADATFSEARHTFDLALIAGGPALPERAPDARVLDWLANAASQCGRY
FT                   GSICTGAFALGHAGLLDGHNVTTHWQHAAQLAAQFPNARVDFDRIYLRDGPLVTSAGVT
FT                   AGIDLSLALVAEDHGPQIALAVAKRLVVFAQRQGGQSQFSPYLTAPADETSPVAKVQAH
FT                   VMERIRESFTVKQLADVAGMSARNFARVFVQETGVTPHEFVERARVDAARKLLESSGAA
FT                   LKAIAYDCGFGTADRMRIVFTKRIGATPMQYRERFRSP"
FT   gene            27351..27989
FT                   /locus_tag="Bxe_B3003"
FT   CDS_pept        27351..27989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3003"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32994"
FT                   /db_xref="GOA:Q13SE5"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE5"
FT                   /protein_id="ABE32994.1"
FT                   /translation="MTTIAGIQIPDSMMAREATQLVRDTETELLYHHSRRVFLFGSLAG
FT                   ARKQLKYDAELLYIGAMFHDMGLVAPYSSEHDRFEVDGANAARDFLRRHGIGEDDIDQV
FT                   WNSIALHTTPGIPQHMKPVVALVTAGVEMDVLGLAYDEFSEHQRHEVIHAHPRGAHFKE
FT                   GIIDAFAHGTIHKPETTFGNVKADVLALKDPHYHRENFCTMILGSAWKD"
FT   gene            complement(28352..29077)
FT                   /locus_tag="Bxe_B3002"
FT   CDS_pept        complement(28352..29077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3002"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32995"
FT                   /db_xref="GOA:Q13SE4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE4"
FT                   /protein_id="ABE32995.1"
FT                   /translation="MQNSGFEAGVAPSPLMPKVERQRLHDTVVEHIRRFIVEGALEAGK
FT                   KLNERELCETLGISRTPLREALKVLAAEGLIEISPNRGASVSKMSEAELRETFELMSGI
FT                   EAFSGELAAERMTAAELSEIKALHYAMLACRTQNDLPGYYSRNQAIHDKINEAARNSAL
FT                   RQTYMAVNRRLQALRFRSNFQVPKWDRAIHDHDEMLKALEARDGKKLSAILRQHLLDKR
FT                   DAVLQVQSQEAAAASTLKT"
FT   gene            29238..30458
FT                   /locus_tag="Bxe_B3001"
FT   CDS_pept        29238..30458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3001"
FT                   /product="Serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32996"
FT                   /db_xref="GOA:Q13SE3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE3"
FT                   /protein_id="ABE32996.1"
FT                   /translation="MLKLDFHPAGRHFLQIPGPSPVPDRILRAMSYPTIDHRGPEFGEL
FT                   GLTVLDGIKKIFRTQQPVVIYPASGTGAWEAALSNTLSPGDHVLMFETGHFATLWKKMA
FT                   DSLGLKPEFLGLPGIEGWRRGVQPQMIEERLRADTQHAIKAVCVVHNETSTGVTSDIAA
FT                   VRHAIDAAGHPALLLVDTISGLACADYRHDEWGVDVTVSGSQKGLMLPPGISFNAISPK
FT                   AVAASKQAKLPRSFWDWAEIVEMNKTGYWPYTPNTNLLYGLSEALEMILGEGLDNVFAR
FT                   HERLAEATRRAVRAWGLEIQCADPAVYSPVLTGVMMPDGIDADAVRKLIYERFDMSLGT
FT                   GLGKMKGRMFRIGHLGDCNDLMLLATLAGCEMGLRLAGVPLEGSGLPAAMEWLSQPTTA
FT                   LGLKVAA"
FT   gene            30620..30763
FT                   /pseudo
FT                   /locus_tag="Bxe_B3000"
FT   gene            complement(30792..31709)
FT                   /locus_tag="Bxe_B2999"
FT   CDS_pept        complement(30792..31709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2999"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2999"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32997"
FT                   /db_xref="GOA:Q13SE2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE2"
FT                   /protein_id="ABE32997.1"
FT                   /translation="MDLRQLRYFVKVVECGNVTRAGEALHIAQPAISQQMRNLETDLGM
FT                   QLLERSVHGVAPTAAGQTLYRHAVELLRQADGTRELLRQDAELPQGKVSVAMPSSTARM
FT                   VAIPLARTIRDRYPGIALELIEAPSADLGTLVGGGRVELAVVVDAVETRGVAAQKLLTE
FT                   ALYLIAWPEFAMPQEPVSIAELARMPLILPSAPNTIRSRVEWALREAGQPCEILFEASS
FT                   TALLFAAVMAKLGVTVLPWTAAHVELDEHKLKLAKVDHPLFSRDLSLCWHDTALLSNAV
FT                   QKVKATILEVFDSLGKRPEWTASD"
FT   gene            31885..33213
FT                   /locus_tag="Bxe_B2998"
FT   CDS_pept        31885..33213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2998"
FT                   /product="major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2998"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32998"
FT                   /db_xref="GOA:Q13SE1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE1"
FT                   /protein_id="ABE32998.1"
FT                   /translation="MSKAIAASTPALEPRRTPLTREQIGGFWAVYSGWVMDGVDSVIYA
FT                   LVLIPALAELLPASGIAATPGNLGMYGSILFALFLIGWGLSFIWGPLADRFGRVKTLAA
FT                   SILIYSVFTGAAAFAHNVWELAAFRLIAGIGVGGEWALAGTYVAESWPEDRRRMGAGYL
FT                   QTGYYLGFFLAALLNYTVGATYGWRAMFLCGLAPALLAIFTVLKVKEPGQWRKATHGIG
FT                   QTSAPPARARQPLLEIFAPAYRRRTLTSASLVGVAIIGLWAGSVYEASAVVTLATRAGI
FT                   GRVGAVHLASIGAAVLSVGTILGCLAAPWLAERLGRRLALGAYFAGMAVSIVFAFGWVF
FT                   YLPNGLNLFMVSLLFLGFFGGNFAIFSLWLPEQYPTRIRATAFAFNASVGRLLGAGVNF
FT                   LLAAAIHWQGSLGLPVAWTAAAFVIGLLILPFAIETRHQTLPE"
FT   gene            33255..34514
FT                   /locus_tag="Bxe_B2997"
FT   CDS_pept        33255..34514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2997"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2997"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32999"
FT                   /db_xref="GOA:Q13SE0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE0"
FT                   /protein_id="ABE32999.1"
FT                   /translation="MQALQGIKVVELSRALSGPFCSMVLADLGADVIKVEPGPGGDMSR
FT                   TWGPFDRGVSTYYLSCNRNKRGVCIDFRHPEGLAAIHRLIDGADVVIENFKPGTIDSMG
FT                   LGYDVLSARNPGLVMGSINAFGAEGPMSGWPGFDQIAQGYSGLMSLTGFADGDPTRTGT
FT                   AIGDLSSGMWLAMAILAALLERERTGRGQHVSTSLLASLVGLLSVHGQRYLSLGDVPRR
FT                   TGNAHAVIAPYGVFETADGPLNLAPITSDMWLRLCQLLDLPALPDDPRFVTNEARVAHR
FT                   DELKAVLEARLKTRGKREWTAMFIGAGLPAGPINTLDEVFSDPQVQYCQLVETLDHPTL
FT                   GALRQVVTPVSDSAASEDGARHTSRHAPPRLGEHTVDVLREAGFDAAQIDALLAAKAVH
FT                   QLGGYHSLEKASERAAGVTP"
FT   gene            34511..35311
FT                   /locus_tag="Bxe_B2996"
FT   CDS_pept        34511..35311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2996"
FT                   /product="Putative enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2996"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33000"
FT                   /db_xref="GOA:Q13SD9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD9"
FT                   /protein_id="ABE33000.1"
FT                   /translation="MSTTHPSPFTVTVDIVDERIARLTFSHPTRRNALSAELLQALDTR
FT                   LVELAARRIPVVILGSGVGQDVWSAGHDLGELAHDRDPIAYGKPLEQALRRVRAYPGVV
FT                   IAMVSGSAWGGAVDLAMSCDLVVADETARFAMTPANIGLPYTTSGLLRFFNNVPIHVLK
FT                   EMFFAAQPLDAARAERFGVVNRLVGSDRLEATALDMARGIAAKAPLAIQAVKEQLRILE
FT                   DLQPLPVQAMEQIAELRRQACESADFSEGLAAFSERRPAVFGGT"
FT   gene            35915..36631
FT                   /locus_tag="Bxe_B2995"
FT   CDS_pept        35915..36631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2995"
FT                   /product="ABC glycine betaine/choline/proline family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2995"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33001"
FT                   /db_xref="GOA:Q13SD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD8"
FT                   /protein_id="ABE33001.1"
FT                   /translation="MIQRPARLIGSLVAIGVVVALLGRAIDFGALHQYTPDLVYYTKRH
FT                   LLLVGYSMALALLVGIPAGVLLSRPSFARHAERFMQIFNIGNTIPSLAVLAIALGIFGI
FT                   GDIPALIALFLASLLPITRNAYEGMKNVSPALREAARGLGMTGWQSLLRVELPNAMPII
FT                   IGGVRTALAINVGSAPLAYLIGADSLGTLIFPGIYLNNQQQLLLGAAATAILALVLDGI
FT                   VSAGSRYLLARRGVTA"
FT   gene            36628..37524
FT                   /locus_tag="Bxe_B2994"
FT   CDS_pept        36628..37524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2994"
FT                   /product="ABC glycine betaine/choline/proline family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2994"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33002"
FT                   /db_xref="GOA:Q13SD7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD7"
FT                   /protein_id="ABE33002.1"
FT                   /translation="MIDLFKRIRWIAAGALFCASLQAGAATLVLGGKNFTEQYVLTEIT
FT                   SQYLRAKGYTIDARTGLGSTLLRSAQENGQVDITWEYTGTAAIVYNKITEKLDPKTMYE
FT                   RVKALDAKRGLVWLDCSPLNNTYALGLPQQVAQQTGIRTISQLAAKMAAEPKKKHVFAM
FT                   DAEFANRPDGLKPLEAAYGMQFSREETRQMDPGLVYTALHNNQVPIGLIYTTDGRVKGF
FT                   NIVPLEDDRHYFPAYNATPVVRKATLDQNPQLAPQLNALSDALNNDTMLEMNKQVDVDG
FT                   RPVREVAAEFLRTHKLP"
FT   gene            37540..38193
FT                   /locus_tag="Bxe_B2993"
FT   CDS_pept        37540..38193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2993"
FT                   /product="ABC glycine betaine/L-proline transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2993"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33003"
FT                   /db_xref="GOA:Q13SD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD6"
FT                   /protein_id="ABE33003.1"
FT                   /translation="MTVFDYLSANWPELLQLTAQHVWLVGIAVGCAIFVGVPLGILINW
FT                   HEWLAAPLLSIATVVLTLPSIALFGLMIPVFSRFGQGIGAVPAITAVFLYSLLPIMRNT
FT                   YLALRNVDAGIKEAGIGIGMTVWQRLRLVDLPLAVPVILGGVRTAVVMNIGVMTIAAVI
FT                   GAGGLGTLIIRAIGQSSMMKLLVGAVLVSVLAIVADLLLQALQRLLTPKGVQKT"
FT   gene            38190..39392
FT                   /locus_tag="Bxe_B2992"
FT   CDS_pept        38190..39392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2992"
FT                   /product="ABC glycine betaine/L-proline transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2992"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33004"
FT                   /db_xref="GOA:Q13SD5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD5"
FT                   /protein_id="ABE33004.1"
FT                   /translation="MIELDKLTKTFTQKDGQQVKAVDSVSLTVGEGEICVFLGPSGCGK
FT                   TTTLKMINRLIAPTSGRVLINGEDTSGLNEVELRRHIGYVIQQIGLFPNMTIEENITVV
FT                   PRLLGWDRKRCRERATELMSMVALEPKQYLKRYPRELSGGQQQRIGVIRALAADPPVLL
FT                   MDEPFGAVDPINRESIQNEFFQMQRQLNKTVIMVSHDIDEAIKLGDRVAVFRRGRLVQY
FT                   DHPDTLLAHPRDEFVGAFVGQDSTLKRLLLVKAGDAATQPGTARAAMPVARAFQMMDDS
FT                   DSRYLTIVDENQQALGYVTRRAARTGEGLCGDHLSTFKATVSADENLRIVLSKMYQFNS
FT                   SWMPVLDGDGRYVGEVTQDSIADYLSSGRSRRQTGQPAIVSPAVAAAEAAAAQVATADH
FT                   A"
FT   gene            39594..39851
FT                   /locus_tag="Bxe_B2991"
FT   CDS_pept        39594..39851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33005"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD4"
FT                   /protein_id="ABE33005.1"
FT                   /translation="MTQDVTPKPPTGDRPELEHLDAALSHVDQQVSSGSIASGAAKGIL
FT                   YSLIETLGTFVGDPDLPEHARSGYEGLLEAARELRAKLDH"
FT   gene            40072..40671
FT                   /locus_tag="Bxe_B2990"
FT   CDS_pept        40072..40671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2990"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33006"
FT                   /db_xref="GOA:Q13SD3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD3"
FT                   /protein_id="ABE33006.1"
FT                   /translation="MLSVSAIALLAFGIVVVLITPGPTNTLLAAAGLRQGVRRSLRLIA
FT                   AELGGYVISISVWGHFLVKAAHALPWLPSLVRVAAGLYIAYLAVDMWRAAVALSDSAQQ
FT                   ASGMRTLFVATLLNPKGLLFAGTIFPAIAFAQLPAYAFAMLMLACLLVPIALAWITFGA
FT                   ALGSGKLTWLNPVKMQRGASIVLGVFSLSLAWAALH"
FT   gene            complement(40692..41942)
FT                   /locus_tag="Bxe_B2989"
FT   CDS_pept        complement(40692..41942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2989"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2989"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33007"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD2"
FT                   /protein_id="ABE33007.1"
FT                   /translation="MKTLSLSAARTLHLAAQGLLTPPRRKAVKADVLDAIRRMAQLQID
FT                   TIHVVARSPYLVLFSRLGAYPQQWLDEHLAEGKLFEYWSHEACFVPTEDYGLLRHRMLD
FT                   PSGMGWKYAAEWHKKHRKDIEKLLAHIRATGPVRSADFAREAGKGNGWWDWKPEKRHLE
FT                   VLFAIGQLMVAERRNFHRVYDLTERVLPDWDDARDLPPAHTVTEEVLRRTCRALGVARA
FT                   DWVADYYRLPRRPYRDELHALADQGELIPVRVEGWKQDTFVHRDFAPILDDAASGKLTS
FT                   TVTTVLSPFDPVVWDRKRAAALFDFDYAIECYTPAAKRKYGYFVLPLLSRGRLVGRVDA
FT                   KAHRTQGVFELKSLHIEPGVRLSARLAGDLRRALQRCADWHGTPQLEITAAPPEWLDAL
FT                   SVEDVSNEVRLRAGVAA"
FT   gene            complement(42064..42354)
FT                   /locus_tag="Bxe_B2988"
FT   CDS_pept        complement(42064..42354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2988"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD1"
FT                   /protein_id="ABE33008.1"
FT                   /translation="MFQRATLLAAIGLAAACASTAASARVDVGVFVNTPGPVYAAPPVY
FT                   AAPPVYAPPPVVYAPRPAYGYGYRDDYYRGRRWHHDHGRHRGWDRHHGRGW"
FT   gene            complement(42540..44270)
FT                   /locus_tag="Bxe_B2987"
FT   CDS_pept        complement(42540..44270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2987"
FT                   /product="cyclic nucleotide-regulated FAD-dependent
FT                   pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2987"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33009"
FT                   /db_xref="GOA:Q13SD0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD0"
FT                   /protein_id="ABE33009.1"
FT                   /translation="MLSTQEAEAQQGEAQQQAVVADAPFSSLSTRMHQMFPALTCAEID
FT                   RLRRFGEIGQWNAGELLFETGYTGPGMFVLLEGRVKVYQRDGIGREVLIGEHGAGHFLA
FT                   EVGQLSGRPALVNGMALSSVEALLIPPEGLRALIVAEAELGERIMRALILRRVSLIEKG
FT                   AGGPILIGNSNDARLVMLQGFLSRNGHPHSVIDERDEDALRLIEQFAAQKEDMPLVICP
FT                   DGSVLRHPSMPELATCLGLLPDLDDAHVYDVAIVGAGPAGLATAVYAASEGLSVIVLDS
FT                   RAPGGQAGASARIENYLGFPTGISGQALAGRAFVQAQKFGAHVAIPVNVKALHCAERPH
FT                   RLELKCGGHITARAIVIASGAVYRRPALEGLDRFEGRGVYYWASPVEAKLCKRQEIVLV
FT                   GGGNSAGQAIVYLATHAAKVHVLIRRSGFEATMSRYLIDRIRSLPNVFVHPNSEIGRLD
FT                   ADETGLSSVSLKKPLPDGTDHFDTRHLFLFTGADPNTDWLRTCGVELDAKGFVLTGTSA
FT                   EGASVCDLATTVEGVYAIGDARAGSTKRVAAAVGEGAAVVAQIHQLLAVAAGDAVPVDA
FT                   "
FT   gene            complement(44361..45353)
FT                   /locus_tag="Bxe_B2986"
FT   CDS_pept        complement(44361..45353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2986"
FT                   /product="putative DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2986"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33010"
FT                   /db_xref="GOA:Q13SC9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC9"
FT                   /protein_id="ABE33010.1"
FT                   /translation="MLHDLVEQYGPALVFVNVLAASIGLPVPALPSLVLFGAMAAMHPG
FT                   SVGTQLAPVLVLSIFATLIGDSAWYFAGRMYGGNTLKAICRLSLSRDTCVKKTERFFGR
FT                   WGVRVLAVAKFVPGLSIVSIPMAGAMGTRYRTFLTYDSIGAALWSGTGLIIGALFAKQI
FT                   DMLFALAGRLGRTAALVAVALLLAYAAYRWIRRRQLIAKLASARIEVDELAALVKAGNT
FT                   PVLFDIRSHEKRKLDPFVIPGTQFADERQLDEIVATYPRDQKLVIYCSCPNEISAAWMA
FT                   RQLNEAGFSDVLPLRGGMEAWRDSGKPVESLPDMPPPEVAVEDVAPKAV"
FT   gene            complement(45682..45906)
FT                   /locus_tag="Bxe_B2985"
FT   CDS_pept        complement(45682..45906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2985"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2985"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33011"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC8"
FT                   /protein_id="ABE33011.1"
FT                   /translation="MALLTEYDDATARELRSLRLESTEDGKGILLIEVDERKPGIHREV
FT                   RYEITPAELIAAIRAHGAELPGEQHNHRQ"
FT   gene            complement(46544..48241)
FT                   /locus_tag="Bxe_B2984"
FT   CDS_pept        complement(46544..48241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2984"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   Pas/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2984"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33012"
FT                   /db_xref="GOA:Q13SC7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC7"
FT                   /protein_id="ABE33012.1"
FT                   /translation="MRNNQPVTGHEYEFPSLQMLVSATDLTGRIQYCNPAFIAVSGFTR
FT                   DELIGQPHNLIRHPDMPREAFADMWATIRAGRPWTALVKNRRKNGDHYWVHANVTPVVE
FT                   KGTVVGYLSVRVKPERDAVRSAEALYARMRTGEARGIKLRRGVVVRTGLPGRLQALMRL
FT                   PVATRAATGYAITSLALLLTGLAAWQGAPPVQFWIAFGVTSAVGLVSWQLLKRQLAAPI
FT                   REMSGFATRLAAGDLTADLHIARHDDLGEVLQALNQLKANLAAIVYDVRAQITGMLDNA
FT                   REISSGNVDLARRTELQAASLEETAATMEQLTTTVQANADATVRALDLARDAQAAAAVG
FT                   GKIAGQVEQTMAGITAASQRIADITSVIDGIAFQTNILALNAAVEAARAGEAGRSFAVV
FT                   ASEVRMLAQRCAASSKEIKSVVEASATEVAAGTELVARTTSQMRVIDEAVGRVSSIIVD
FT                   VANASSEQAEGIRQVNQAVSHLDGATQQNAALVEQAAATAQRLAEQADVLDEAVRLFSV
FT                   AHAAPAQRAGGATRSRTLTSDAAQTGDIKRHSAPAVARETEHDEATMI"
FT   gene            48549..52052
FT                   /locus_tag="Bxe_B2983"
FT   CDS_pept        48549..52052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2983"
FT                   /product="Periplasmic sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2983"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33013"
FT                   /db_xref="GOA:Q13SC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC6"
FT                   /protein_id="ABE33013.1"
FT                   /translation="MQKILDRTQESLALAFATLAQNAKRQQRVYLATIGSLMLVVAIFA
FT                   LVLAVVAGLAQLDYRRTFASQNATDISLLLHQEESFSRRVELTFDYYYTAPHVRSAPEA
FT                   VQQSIRRTGVVRGKVDRIDAGFDMLVGEATTTAWGPQLGEKLGRLYEASQSTLATQQAF
FT                   ELQQRATLVGLTEDYAVILPSLAQPVAGKAAAAKLSAVPQQQLAFVRTLRETLERQLEA
FT                   QTGRRLPGKGERVWLGPYLDPLENVPVISAVSVYYDGGTPTTLISMNIRLDVLARRIAP
FT                   PGDEGTILLMAADRRIIASSKPLGMQTGKMLQQTVAATPSHVFHYGREGVIFHEPLGPG
FT                   FGFLVGYLPWGALAVALGWQLAVIAALTALILLAVALTARYFGFRLLRNAFAETSRSLE
FT                   SETINHVLVSATPVGLCVVRQGDYSVLTANALAAELLSIEPGGNRLPPHIVGEFLAQTP
FT                   GKPSAAAIARIAAFVVAARPQSPASAPSEEGAPPARFLQFTYAPARYAGENVLFCAILD
FT                   VTAQTLLEQQLRHAQQTSDAMMRARTNFFAAMSHEIRTPLNALLGNLELFARTPGLEAH
FT                   SQRLATLSVASDALRRVVNDILDFSKIDAGEMLLANEPFRPIDEFENIAFSHAPLCGDR
FT                   AIRFYALLSPTLDCTLIGDRMRIAQVVNNLLSNAFKFTSSGKITLYAEVKDDPQGRPTL
FT                   LCRISDSGAGMSEELLARLFKPFVQGALGTSRGTGGTGLGLVICARLCELMGGRISAES
FT                   VPGVGSVFHVSIPLVAVPGDQRTPVAIPASRGTALVLCTERQAGEFLDGWLQRAGWSSH
FT                   TVMSLAGAEAWLKANRPAVLIVSGEYDLEAIVGLRALQAVGVVWITSGGPTRPEARAQG
FT                   VLEVSEFSRTACLTAIELAVEGASAAPAEASAAASALTPSVEIDPALLGLAVLVAEDNP
FT                   LIQNLIAEQLVELGCVPTIAADGKQALALFERAPFEVVLTDVHMPVMDGHELLTALRER
FT                   HAELPVLAFSAAAEEQQAQSWHERGFNGYVSKPASLSELQAALLAVVPAPARAARAKAA
FT                   STAESASADSVAPVANVASMLSADDKARYTAMLREHLQKDLPRLLAIVEEEDVRALAGW
FT                   AHSASGAFVVVQEPEFFDQCRQLQRLCADNSEWTTEMDERAISLHEALSDHYGLDEQPA
FT                   R"
FT   gene            complement(52075..52452)
FT                   /locus_tag="Bxe_B2982"
FT   CDS_pept        complement(52075..52452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2982"
FT                   /product="Putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2982"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33014"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC5"
FT                   /protein_id="ABE33014.1"
FT                   /translation="MIPSAPTPVGPFSHAAEADGWVFLTGQMPTSPTDDAAPLPEGVVA
FT                   QTKRVMDNLVLVLQGLGLGLRHVVATRIFLTEFKRDYAPMNEIYRAYFPADALPARTCI
FT                   GVTGLARDALVEIDFVVKRPA"
FT   gene            52600..52911
FT                   /pseudo
FT                   /locus_tag="Bxe_B2981"
FT   gene            complement(52853..54253)
FT                   /locus_tag="Bxe_B2980"
FT   CDS_pept        complement(52853..54253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2980"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2980"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33015"
FT                   /db_xref="GOA:Q13SC4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC4"
FT                   /protein_id="ABE33015.1"
FT                   /translation="MSFVIVLAALAFLMFAAYRGYSVILFAPVAALGAVLLTDPAAVAP
FT                   VFTGIFMEKMVGFVKLYFPVFLLGAVFGKVIELSGFSESIVAAAIRYIGRSRANAVIVA
FT                   VCALLTYGGVSLFVVVFAVYPFAAELYRQSNIPKRLMPGAIALGAFSFTMDSLPGTPQI
FT                   QNIIPTTFFKTTSWAAPALGVIGSLFIIVVGLTYLEWRRRSAMATGEGYGTNLVNEPER
FT                   VESKQLPHPLLAVAPLVLVGVANFLLTRWIPNWYGASYTVAPDILPGIHAPVTTTIKAV
FT                   VAIWAVEGALLLGIVMVVITAFNRVRERFAIGTKAAVAGALLASLNTASEYGFGGVIAA
FT                   LPGFLVVSDALKSIPNPLVNAAVSVSSLAGITGSASGGMSIALAAMSDTFIKGAEAAHI
FT                   PMEVLHRVVAMASGGMDTLPHNGAVITLLAVTGLTHRQSYRDIFAVTVIKTMAVFFVIA
FT                   VYYATGLV"
FT   gene            54569..56044
FT                   /locus_tag="Bxe_B2979"
FT   CDS_pept        54569..56044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2979"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2979"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33016"
FT                   /db_xref="GOA:Q13SC3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC3"
FT                   /protein_id="ABE33016.1"
FT                   /translation="MMNDWAGLPATYGDVLRRAMDSLFRTFENFSEGTFIVDADARVVW
FT                   INKRYAARFGFSDPEQAIGRDCEAVIPNSLMREVVKTGKPILLDILETDREPLVVTRLP
FT                   LKDDSGTTVGAVGFALFDELKALTPLFSHYSRVQEELIATRQSLAQARRAKYTFGSFVG
FT                   TSAASLEVKRQARRAAQLESPVLLLGETGTGKELLAHAIHGGSARANQPLVTVNVAAIP
FT                   DTLLEVEFFGAAPGAYTGADRKGRVGKFELANGGTLFLDEIGDMPLPLQGKLLRVLQDK
FT                   EFEPLGSNRIVRADVRIIAATSADLPALVAAGRFRADLFYRLNVLTIHAPPLRERASDI
FT                   EALAYAMLEDLSTQASGASHFELQDDALRLLCSYGWPGNVRELRNTLERAVMLSDSERI
FT                   DARALAPFIGSAPGGGQRRQAAADVPSPARAPDAPTGAPEPASWSDAMAAFEKRFLTDA
FT                   LRANGGRVIETASQIGMGRATLYKKIAAYGIGV"
FT   gene            56098..56544
FT                   /locus_tag="Bxe_B2978"
FT   CDS_pept        56098..56544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2978"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2978"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC2"
FT                   /protein_id="ABE33017.1"
FT                   /translation="MIEKQDVFGVSDETQSFLIRAPCLRHAGDRRRGCAGRLQQQRAAV
FT                   PVGRPRHDAGAMPGWFRLLLAAGRRELRRRIRRRAPVDRERHAQPDLRLPGEITGRAGR
FT                   ARPARSASQAFLRSARRATTSAGVSIAASISLVLAEWLIRASSS"
FT   gene            complement(56883..57143)
FT                   /locus_tag="Bxe_B2977"
FT   CDS_pept        complement(56883..57143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2977"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33018"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC1"
FT                   /protein_id="ABE33018.1"
FT                   /translation="MTLAAAHRCRSSAFLPFLQREERGVEPFDAARLRRHPHRAGNGIN
FT                   TAAPIGQRDSVFSGDMRDYVFKMFNIFFELVMIHCFPRITR"
FT   gene            57357..58556
FT                   /locus_tag="Bxe_B2976"
FT   CDS_pept        57357..58556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2976"
FT                   /product="putative beta-lactamase class C and other
FT                   penicillin binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2976"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33019"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC0"
FT                   /protein_id="ABE33019.1"
FT                   /translation="MQPAGLCASRLTALTNAMQGYVERGEVAGVVAMVWRRGEIGYFEP
FT                   LGLRDEAAQLPMERDTLFRIASMTKPVTSAAILMLIEEDRLSLDTPVSLWLPELSTPRV
FT                   LRDPTGPLDQTDPARASLTVLDLLTHRAGFAYHFTATGPLSEAYAAAFNGFEARMDGNA
FT                   WLARIADLPLMFQPGSRWHYGIATDVLGVLIERVSGMPLGEFFRTRIFEPLGMRDTAFW
FT                   VPEAQLARLATAYGVEPGTRRRVVEDHPASSRWANPDRFQSGGGGLVSTAQDYLQFAQL
FT                   LLGRGRVGTTRLLSHRSVDLMRSNFLTRDQRRVPAFGHVQWAGQGFGLGLSIVDDPAQQ
FT                   LSLGYRSMGSFGWPGAYGTSWFADPVEDLIGLMLIQRRSIEPFPMAIDFERRVYDSIDD
FT                   "
FT   gene            58693..58983
FT                   /locus_tag="Bxe_B2975"
FT   CDS_pept        58693..58983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2975"
FT                   /product="putative H-NS-like transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2975"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33020"
FT                   /db_xref="GOA:Q13SB9"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB9"
FT                   /protein_id="ABE33020.1"
FT                   /translation="MASYKQLTAQLEKLHKEVAAAREKEIAQAIAEIKQKVAEYDLTAE
FT                   ELGFTSKRAVGRKTASVAKYRNPKTGETWSGRGRSPAWLAGKNRERFLIEV"
FT   gene            59158..59565
FT                   /locus_tag="Bxe_B2974"
FT   CDS_pept        59158..59565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2974"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2974"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33021"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB8"
FT                   /protein_id="ABE33021.1"
FT                   /translation="MSLVLPKRAPCGQLAAGRPPSLADFSETRASLCWRAFPGCAKNRC
FT                   GEGSRLFQPRLRCSALRGLSLCRCATDRPQAHLSAPFKVASASVPKTLTFASPTPAGHW
FT                   AFAIFYADHVRVFQSRQRVFAGSVLSPRCVL"
FT   gene            59712..59990
FT                   /locus_tag="Bxe_B2973"
FT   CDS_pept        59712..59990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2973"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2973"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33022"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB7"
FT                   /protein_id="ABE33022.1"
FT                   /translation="MRHVTIFVHDASLAWPIATSCRTVTTRFVHSVRVKRPVGQASSPL
FT                   LTYQINPSEISERGDLSHVILMLDNLTSHCLLPERHVRSLEQEASYS"
FT   gene            60092..60652
FT                   /locus_tag="Bxe_B2972"
FT   CDS_pept        60092..60652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2972"
FT                   /product="putative fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2972"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33023"
FT                   /db_xref="GOA:Q13SB6"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB6"
FT                   /protein_id="ABE33023.1"
FT                   /translation="MKLSLPAIAIAASSLFGLVPLGAHAADGTISITGTVTDSTCSING
FT                   NANGTPADKAITLATVPAGSLASAGAVAGTSNPTDLQLSLTGCTGTATKAIARFENGPT
FT                   VDQTNGYLSNTAGTAQNVEVRLLNAQMQPINVTTGANNDITTNAATISGGAATLQYFAQ
FT                   YYATGVATAGTVSSSVQYSMEYQ"
FT   gene            60728..61471
FT                   /locus_tag="Bxe_B2971"
FT   CDS_pept        60728..61471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2971"
FT                   /product="Putative fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2971"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33024"
FT                   /db_xref="GOA:Q13SB5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB5"
FT                   /protein_id="ABE33024.1"
FT                   /translation="MKLLKKMPIGIGFACALLAGSAQASVTIGGTRVVYPLEQREVTVK
FT                   LDNDSKTPSLVQAWIDDGNADAKPGEIKVPFVITPPIFRMDAKKGQTLRVMYTGEPLPQ
FT                   DRESVYWLNVLDIPPKASSATEVNSLSLAYRTRIKVFARPAGLPGKPEDAAAQLSWKIA
FT                   ASADGKSHALSVSNPTPYYVSFSEIDVESNGHTFRNEQGGMVAPRASAVLPIAKMNAVA
FT                   AGAKVHYIAISDYGGPIDGDAALGE"
FT   gene            61604..64246
FT                   /locus_tag="Bxe_B2970"
FT   CDS_pept        61604..64246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2970"
FT                   /product="Putative fimbrial biogenesis outer membrane usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2970"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33025"
FT                   /db_xref="GOA:Q13SB4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB4"
FT                   /protein_id="ABE33025.1"
FT                   /translation="MKDFPCCRSLVRAGEPGGAFGLNPVAAVVALAFAVLGGVQPIVAQ
FT                   ASGQAEAGAAVEFDSTFLRVDPNATVDVSRFTRGNPMSEGVYSVDVLVNGVRVARHDVR
FT                   FVATSGTATARPCFSRQMLETLGVDFARVAASSDAKTPAETGVTGECVDLAATVPDAMV
FT                   DFDFAEQKIALSVPQKYMRNAARGYVPPDMWQTGVNAAFLSYNANAYHSAGSGVESTQS
FT                   YVGLNAGVNLGAWHFRHQSSVTQQAGAATQFDNIATYLQRDITRIKSQLTVGDGYTTGD
FT                   VFDSVQFRGAQIATDDRMLPESLRGYAPIVRGTAESNARVTVRQNGQVIYETTVSPGPF
FT                   EINDLYATGYGGNLDVTVTEANGRTKSFTVPYASVAQSLRPGTTRFSVTAGELRNSTLE
FT                   TNPNFAQFTLQRGLTNLVTVYGGAVAANGYMAADMGAALNTKFGALSADVTGAQTQIPD
FT                   HGTLRGTSLRIGYSKFIDPTNTNIAIAAYRYSTAGYMNLSDAASVRDLAMHGGNPDSVY
FT                   RQRNRFQVTLNQNFKEYGTVFLNASAQQYWNRSGSDVFYQAGYTNRFKYGTYSISAGRT
FT                   RNSNGSMSDQIMLSTTLPLGRDQHSPLLSANLSSSGGNANLQANVSGSLGERNQFSYSG
FT                   YGAYGDGPGASTASAGASGTYRTPYAQLTGSASGGTGSSQVSAGISGSIVAHPGGVTFS
FT                   QTVGDTFGVIEAPGAAGASVTSSPGVKLNGRGFAVVPYLTPYGINTVDIDPKGTSTDVE
FT                   FESTSEQAVPRLGSVVMIRYKTVTGRAALIRAPQLGDKALPFGADVVDATGRTVGVVAQ
FT                   DSRIFARGLEDKGSLFVKWGASASEQCRIEYVLPRQTGKAGAAYTSVEGHCVGGTPTEN
FT                   TNFASGRTR"
FT   gene            64382..65398
FT                   /locus_tag="Bxe_B2969"
FT   CDS_pept        64382..65398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2969"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2969"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33026"
FT                   /db_xref="GOA:Q13SB3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB3"
FT                   /protein_id="ABE33026.1"
FT                   /translation="MCLTLVLGSALFAARPAHAALICNASGANNVISAGSISVPANPTI
FT                   GATIATLAPTQFQMPCRFDTSAPVETSATLWATFDSSLPPVSGFADVYQTNVQGLGIRY
FT                   TFNAPACNANNVPMTSGEVKLTCPVSGPVDGPYMPIDVTVTPSFVATGVIPLGARTLST
FT                   VPLVSIVYWTSDDPATGWDKPPLYTGAASGRIIHACAINQPDASVTLPTVNSSAFSGGV
FT                   GSVAGPQSFSLVFSCGSGAQVSIVLTDNTDPSNRSNVLTPTPDSTAKGIGIQILNDSGA
FT                   PVSFGPDSSEPFTTNQWVIGRSPDGRLEVPLIARYIRTGNVVAGAIRALATFTMSYQ"
FT   gene            65686..67287
FT                   /locus_tag="Bxe_B2968"
FT   CDS_pept        65686..67287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2968"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2968"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33027"
FT                   /db_xref="GOA:Q13SB2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB2"
FT                   /protein_id="ABE33027.1"
FT                   /translation="MSVSELKRRRTFAVISHPDAGKTTLTEKLLLFSGAIQIAGTVKGR
FT                   KSNRYATSDWMEIEKQRGISVASSVMQFEYGDAVINLLDTPGHEDFSEDTYRVLTAVDA
FT                   AVMVIDGANGVEAQTLKLLEVCRSRKTPIVTFINKLDREVREPLELLDEIEQHLGVAAV
FT                   PFTWPIGMGKDFQGVYDIQRDQVRLFRAGQDKAGGEVETLQALSDEEGERRFGHAWVKA
FT                   KEEIDLITGASPDFDREQFLAGQQSPVLFGSAINNFGVKEILDALVDLAPPPSMRMTVQ
FT                   RPVMPDEPKFTGVVFKVQANMDLAHRDRVAFIRVCSGHFERGMAVKVTRTSKTFRANNV
FT                   VTFLSQRRETVSEAYPGDIIGIPNHGTLSLGDTLTEGEQLQFVGLPFFAPEIFQTVEVV
FT                   DPMRAKQLGEALKQLGEEGAIQVFRPEVGGLMILGAVGQLQFEVVSHRLSTEYKVDVRM
FT                   APARYRMSRWVTCDDAAELRRFTDSYAARIALDASDAPTYLASHVSEIEVAQKAWPKIV
FT                   FNELREHSGAPFKRAM"
FT   gene            67616..70045
FT                   /locus_tag="Bxe_B2967"
FT   CDS_pept        67616..70045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2967"
FT                   /product="Putative acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2967"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33028"
FT                   /db_xref="GOA:Q13SB1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB1"
FT                   /protein_id="ABE33028.1"
FT                   /translation="MTVRNLDALFRPKSVAVIGASERPGSTGAMVWTRVLEGGFEGPLW
FT                   PVNPKYSTLGGHAVIGETGDLPEAPTVAVICTPPATWPGIIHKLGGLGTRAAIIVGEVR
FT                   SDDDRLALRHALSAARPNLLRIVGPGSLGVVSPALHAHLGAPSCTVKAGGVAWVSQSNA
FT                   LTNAVLGWAQARGLGFSHAVALGAEADVDAGDVLDYLASDPGTRAILLELDSVRAARKF
FT                   MSAARAAARNKPVLALRSGRADPADALYTAAFRRAGMVRVDSLDDLLDEIETLGVGRVA
FT                   AGATATLITSDSGLATLACDAFAAAGDTLAPWPDEASEALRQALPHAVGGNPLRLGDDA
FT                   RPEHFGTALELLANQRASGTAFVVHASTHSAPVGEVAQALIANQRFAYRGLLACFFGGV
FT                   DAATRDALHAQGIPVHTTPQRLARAFARLVDYRMGRELLMQTPEGLPAQIPAAIDAAQA
FT                   QAREALAGGEHQLTGEAAARFLGRFGLQVETAPQASDGAQASTGSTGKPIVDIVVELHD
FT                   DDNFGPVFRFTAPAADGLSEPLRVYGLPPLNPMLARDIVARSRYAQLIAPEPALAALTA
FT                   LSQAVCDVREIVGIRLTLRVYRDRVTVVDPSLSVAATRSRLAIVPYPRRFEETLDWQGL
FT                   RVTVRPIRPEDEAAHHDFVEAMTPEDLRLRFFGAVGSFDHSQLARMTQIDYDREMALIA
FT                   TVQSEEGFTRTLGVVRAVADPDNETAEFAVAVRSDQKGRRLGQLLMDRIIRYARARGIH
FT                   WLIGEALRENVAMIALAKASGFTMTRTEDPGVVGFRMALDEPAEPGTASAAPAAPG"
FT   gene            complement(70176..70721)
FT                   /locus_tag="Bxe_B2966"
FT   CDS_pept        complement(70176..70721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2966"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2966"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33029"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB0"
FT                   /protein_id="ABE33029.1"
FT                   /translation="MAKLLTDSEFQRFSELQQKQSSFTITPEEADELRDIVAHAQKRRD
FT                   DRAAAMQSIETFIQQFDISPDELFSAEQIGDAARTFGLIPAAKKERVLPPQFTFNGKPY
FT                   QWTTRPLPDDIRVPLFDAFKAGESVKSFIATPKDANRCAATIARLERETGAVYGDAWLE
FT                   ELSVTRTQVDEAAAKLPA"
FT   gene            complement(70853..71671)
FT                   /locus_tag="Bxe_B2965"
FT   CDS_pept        complement(70853..71671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2965"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2965"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33030"
FT                   /db_xref="GOA:Q13SA9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA9"
FT                   /protein_id="ABE33030.1"
FT                   /translation="MRTAHRTSLTMDAEDKDDADRYRAPALDKGLDILELLAEQKEGLT
FT                   RAEITKLLGRNASEMYRMLERLVARQYVVRSAAGDRYSLSLKLYALAHRHPPMNRLISE
FT                   ALPLMQRFADAAEQSCHLVVYDRGNLLVIAQVDGPGTWGMSVRLGSRVGLIDTGSGRVM
FT                   LAFQSIEQREQMLAEHTKVKGEVTIDRDALEQACERIRAAGFSQKDSQQTFGVTDVTFP
FT                   IQGPAGQAIAALTCPYLRRIDEYVAPTLEAATALLRETVQALSMFHENAA"
FT   gene            71907..72956
FT                   /locus_tag="Bxe_B2964"
FT   CDS_pept        71907..72956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2964"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2964"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33031"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA8"
FT                   /protein_id="ABE33031.1"
FT                   /translation="MSFAKEPHAARRLFRSSLSAAAAAVCFAGLGVTGAAQAADAGKIG
FT                   LDLPLLTSPFWQSYNNYLPKYAKDMGLDILAPVNSNGDPAQQITDMNNLLNLGAKGIVV
FT                   GPLDSAAISRALDAAAAKNVPVVAVDVAPTQGKVAMVVRADNRAYGEKACKYIGDHVKS
FT                   GKVVQIMGDLASVNGRDRSEAFRSCMKGYPGVSVLEIPAAWKGDVAATALDSLLTANPD
FT                   VKGIYMQAGGVYLSPTLQTLRRKQMLFPAGDPKHVVIVSNDGIPQEFDAIRRGDIDATV
FT                   SQPADSYAKYGLFYIKAALAGQTFKPGPTDHGSNIIQLAPGVLEDQLPAPLVTKSNVDD
FT                   KALWGNTVK"
FT   gene            72953..74473
FT                   /locus_tag="Bxe_B2963"
FT   CDS_pept        72953..74473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2963"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2963"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33032"
FT                   /db_xref="GOA:Q13SA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA7"
FT                   /protein_id="ABE33032.1"
FT                   /translation="MSELTPSAPVVEAFEITKRFGSTAALKDVSIRVMPGESHALVGRN
FT                   GAGKSTLVSILTGLRKPDTGEVRFSGVAAPSIADRDAWRERVACVYQHSTIIRDLSVAE
FT                   NLFINRQPLRGGMIDWQAMRRDARTLLDHWKIDVREDARAGDLTVEARQLVEIARALSY
FT                   GARFIILDEPTAQLDGDEIKRLFRRISELQREGVTFLFISHHLQEVYEICQAVTVLRDA
FT                   RHIVSAPVSALPREQLIEAMTGERGGLAVADAAARDALPADTAIALQVESLAGSDYEGV
FT                   SFTVKRGEVVGLTGATSSGRTSVAEAIAGLRAAKRGTIRVDGKTLPPGDVPAALAHGVG
FT                   CVPKDRHHEGLVLTQSVAENASMTIARLLGKFGIAPPAKKNAFGQKMIDALGIVAQGPE
FT                   HVVSGLSGGNQQKVVMARALATNPNVLVLIDPTAGVDVKSKEALLSVVDRVREDGKAVL
FT                   VVSGELDDLRTCDRVLVMFRGRVAAEFPAGWQDHDLIASVEGVSLHEE"
FT   gene            74463..75512
FT                   /locus_tag="Bxe_B2962"
FT   CDS_pept        74463..75512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2962"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2962"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33033"
FT                   /db_xref="GOA:Q13SA6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA6"
FT                   /protein_id="ABE33033.1"
FT                   /translation="MKNSVPSPAFGTAQAQAQPLAQATRGKRARSELARLRELALLPAL
FT                   ALLIVIGAFVSPSFLTKANLISVLGASAALALVVLAESLIVLTGKFDLSLESTVGIAPA
FT                   VGAMLVMPAASAGFGMQWPAAAGLLAIVAVGAVIGFINGFLVVRLRLNAFIVTLAMLIV
FT                   LRGMLVGATKGGTLFDMPPSFFTLATTIVFGLPLSVWLAAVAFAIAAFVLRYHRLGRAL
FT                   YAIGGNPEAARAAGIRVERITWGVFVLGSMLASLGGLIVTGYVGAINANQGNGMIFTVF
FT                   AAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLTLAQVPSFWIQAIYGAIILGSLMVA
FT                   RLASGEGQN"
FT   gene            75538..75873
FT                   /locus_tag="Bxe_B2961"
FT   CDS_pept        75538..75873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2961"
FT                   /product="Putative hydrolase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2961"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33034"
FT                   /db_xref="GOA:Q13SA5"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA5"
FT                   /protein_id="ABE33034.1"
FT                   /translation="MTSRPLQTNQTDPRLILLSPADNCLIAAARLEGGTQVEIEGERVT
FT                   LAKTIELGHKVARRELAKDDKVLRYGAVIGHVTEAVARGAHLHTHNLESDYLPTYTHDA
FT                   GHEFVHH"
FT   gene            75884..77236
FT                   /locus_tag="Bxe_B2960"
FT   CDS_pept        75884..77236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2960"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2960"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33035"
FT                   /db_xref="GOA:Q13SA4"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA4"
FT                   /protein_id="ABE33035.1"
FT                   /translation="MSWPSRRAGTIMTDTSVASPSAASQQPTLQGYLRRDGRKGIRNVV
FT                   AVAYLVECAHHVAREIVTQFREPLDAFDDPSAEREPPVHLIGFPGCYPNSYAEKMLERL
FT                   TTHPNVGAVLFVSLGCESMNKHYLVDVVRASGRPVEVLTIQEKGGTRSTIQYGVDWIRS
FT                   ARKQLAAQQKVPMALSELVIGTICGGSDGTSGITANPAVGRAFDHLIDAGATCIFEETG
FT                   ELVGCEFHMKTRAARPELGEEIVACVAKAARYYSILGHGSFAVGNADGGLTTQEEKSLG
FT                   AYAKSGASPIVGIVKPGDIPPTGGLYLLDVVPDGEPRFGFPNISDNAEIGELIACGAHV
FT                   ILFTTGRGSVVGSAISPVIKVCANPATYRNLAGDMDVDAGRILEGRGTLDEVGREVFEQ
FT                   TVAVSRGAASKSETLGHQEFILTYKTFEPVGPACLPSSAAPQHRMVAIEPQ"
FT   gene            77360..78400
FT                   /locus_tag="Bxe_B2959"
FT   CDS_pept        77360..78400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2959"
FT                   /product="Putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2959"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33036"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA3"
FT                   /protein_id="ABE33036.1"
FT                   /translation="MTATIASKIGQRRRIGRTALQVTGLGLGTAPLGGLYRDLSDEEAH
FT                   ATIAAAWDAGVRYFDTAPHYGNTKAEHRLGDVLRRYPRGDYVLSTKVGRRFVPRTTPFD
FT                   DREGWQNPLPFEAIYDYTHDGILRSFEDSQQRLGIVDIDILLVHDIGRVTHGDNHPHYW
FT                   RQLTEGGGFRALDGLRSAGAIKAVGLGVNEGAVILDAMAEFDIDCALLAGRYTLLEQST
FT                   LDDLLPACETRGVSILLGGAFNSGILARGVEGDLKFNYGEAPREVIERVARLDAVCHAH
FT                   AVPLAAAALQFPYAHPAVATVLTGARSADELRENAASFGQPIPAGLWSALRDEGLLDSR
FT                   APVPED"
FT   gene            78408..79238
FT                   /locus_tag="Bxe_B2958"
FT   CDS_pept        78408..79238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2958"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2958"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33037"
FT                   /db_xref="GOA:Q13SA2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA2"
FT                   /protein_id="ABE33037.1"
FT                   /translation="MHIDAHQHYWDPARGDYEWLTPELKILYRTFGPADLKPLRERAGI
FT                   ERTVVVQAAPTIDETRYLLDIARHEPSIAGVVGWVPLLLPTAPAVIEALAHEPKFKGVR
FT                   PMLQDLPDDTWIANPDLAPAIEALIAHDLAFDALIYARHAEPFETFATRFPALRIVVDH
FT                   GAKPPIRYGRAGYQSWADAITRLAQLPHVHCKLSGLATEASPGWTEATLQPYVDHLLKS
FT                   FGPARLMWGSDWPVLDLNGDYLLWHSVANTLLSSLSDGEREAVFGGNAAAFYRL"
FT   gene            79284..80027
FT                   /locus_tag="Bxe_B2957"
FT   CDS_pept        79284..80027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2957"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2957"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33038"
FT                   /db_xref="GOA:Q13SA1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA1"
FT                   /protein_id="ABE33038.1"
FT                   /translation="MTQRLAGKTALITAAGQGIGLATAELFAREGARVIATDIRIDGLA
FT                   GKPVDARKLDVRDNAAINALAAELGAIDVLFNCAGFVHAGNILECSEEDWDFAFDLNAK
FT                   AMYRTIRAFLPAMLDNGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFI
FT                   TRGVRCNAICPGTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAAL
FT                   ALYLASDESSFTTGHAHVIDGGWSN"
FT   gene            80084..80932
FT                   /locus_tag="Bxe_B2956"
FT   CDS_pept        80084..80932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2956"
FT                   /product="Fumarylacetoacetate hydrolase family protein"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2956"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33039"
FT                   /db_xref="GOA:Q13SA0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA0"
FT                   /protein_id="ABE33039.1"
FT                   /translation="MKLLRYGPKGQEKPGLLDAQGKIRDLSKVVADIDGAALTDEGLAR
FT                   LRALDPASLPLVEGNPRIGPCVGKIGKFICIGLNYADHAAESNLPVPAEPVIFNKWTSA
FT                   ISGPNDDVEIPRGSKKTDWEVELGVVIGKPAKYIDEANALDYVAGYCVINDVSEREWQI
FT                   EKGGTWDKGKGFDTFGPIGPWVVTRDEVADPQNLSLWLEVDGHRYQNGSTKTMVFGVAK
FT                   LVSYVSQCMSLQPGDVISTGTPPGVGMGVKPNPVFLKPGQTIRLGIEGLGEQTQKTYAA
FT                   E"
FT   gene            complement(81095..82447)
FT                   /locus_tag="Bxe_B2955"
FT   CDS_pept        complement(81095..82447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2955"
FT                   /product="Putative pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2955"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33040"
FT                   /db_xref="GOA:Q13S99"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S99"
FT                   /protein_id="ABE33040.1"
FT                   /translation="MDELALAADADRRAHAYLAGIGKRRVFPDAAALAQLAAFDEAFPQ
FT                   HGHAPADVLRLLDESGTPATVASNDPRYYGFVIGAVLPAAAAAERLMGAWDQCASTFDN
FT                   SPVAATLEKIAARWVLDALDLPREAAIGFGTSATACTLVCIAAARRALLARKGWDFDND
FT                   GLDGAPPVRVVISEMAHITVKKALRVLGFGMKRVVSAPVDEHGRIDPAQLPPLDDMTIF
FT                   CVQAGEVNTGEFDPFAELIPRAKAAGAWVHVDGAFGLWARASSKRTLTEGIDGADSWTT
FT                   DGHKWLNTPYDGAMAICRDARALSAAMNSDAVYLSGAHDAQKNLNLEFSRRARGIPIWA
FT                   ALRSLGRSGVQEMVDRHCAQASRIAEGLRAAGFEVVNRVVLNQVLVRANTDAQTVAIRE
FT                   AAQASGETWFGQTVWQGRPAFRISVSSWRTEDTHVDQLVALLARLLAEQRA"
FT   gene            complement(82511..82813)
FT                   /locus_tag="Bxe_B2954"
FT   CDS_pept        complement(82511..82813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2954"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2954"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33041"
FT                   /db_xref="GOA:Q13S98"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S98"
FT                   /protein_id="ABE33041.1"
FT                   /translation="MTDDLTRINALANASRLAVMRWLKEPTRHFPYQDHADIETVGVCC
FT                   TFITEKLGIAPATTTRHMRILADAGLVRAQRIGKFTYYKRIDAELQKLGRDLANL"
FT   gene            complement(82931..83365)
FT                   /locus_tag="Bxe_B2953"
FT   CDS_pept        complement(82931..83365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2953"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2953"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33042"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S97"
FT                   /protein_id="ABE33042.1"
FT                   /translation="MTDLLDRARGALHAQPFSMLLGAELMHTGTNELTLSLPIRDELRQ
FT                   QHGFVHGGVISYLVDNALTFAGALLLGPKVVTGEYKINYLRPAVNGMLIARAKVVYAGQ
FT                   HQATCQCNVFVMEGNREKLIAVAQGTVNRISESGEHEHGN"
FT   gene            83635..85257
FT                   /locus_tag="Bxe_B2952"
FT   CDS_pept        83635..85257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2952"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2952"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33043"
FT                   /db_xref="GOA:Q13S96"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S96"
FT                   /protein_id="ABE33043.1"
FT                   /translation="MFSKIKVASGLLCVLAAFCVFQLVTVGLGFWSLTRTHDDVNDLSN
FT                   IALKQVDAVNETTQRLMDARINLSRAGTRMVRGGSEPTDIVQHAREQLTAADQSFAAFM
FT                   SAPKTSDENGARAAALAERYRKLHDALAELVQFLDSNNIQAFLDQPTQSFQDAYLGESH
FT                   NFVQFGTAASRASLDSIDTRMATFRAVSIVILVALVAGTFAVHTALRRGVVTPLEEAGR
FT                   HFDRIAQGRLDQPIAAHGTNEIGRLFSGLAKMQASVARTVQTVRESADSIHLGADEIAT
FT                   GNADLSARTENQAASLEETASSMEELTATVRQNADHAREANALAGTALEATSRGSEVVN
FT                   QVVEKMRGIAQSSDKIAEIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVR
FT                   GLAQRSAQSAKEIKTLISESVAEIRGGSTLVEHAGEAMSNVSTSISRVTQMMAEISASS
FT                   LEQSTGIEQINQAVVQMDEMTQQNAALVEQAAAAAASLHQQTQQLKQAVSVFEISESVL
FT                   RTQQIDEARGRTVDFPLSGMRAI"
FT   gene            complement(85371..85604)
FT                   /locus_tag="Bxe_B2951"
FT   CDS_pept        complement(85371..85604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2951"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2951"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33044"
FT                   /db_xref="GOA:Q13S95"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S95"
FT                   /protein_id="ABE33044.1"
FT                   /translation="MQHTTFTGLKMATGTVKWFNDAKGFGFITPDDGGEDLFAHFSEVQ
FT                   GSGFKSLQENQKVTFEVKQGPKGKQAANIQPA"
FT   gene            85793..86068
FT                   /locus_tag="Bxe_B2950"
FT   CDS_pept        85793..86068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2950"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S94"
FT                   /protein_id="ABE33045.1"
FT                   /translation="MTHYLQEELTSFWSRLTPYLAILESKSPQEGAPDPVGRITVDTVD
FT                   RQAFALHTTDQKPHGDASDIPTGQSATYMRFKSAGSDWSPWQREEY"
FT   gene            complement(86135..87244)
FT                   /locus_tag="Bxe_B2949"
FT   CDS_pept        complement(86135..87244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2949"
FT                   /product="Putative isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2949"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33046"
FT                   /db_xref="GOA:Q13S93"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S93"
FT                   /protein_id="ABE33046.1"
FT                   /translation="MQSMNPPAASTIALATRLRDHFTGVVLPMWRGPGFNTALKLPYEA
FT                   LGAEDHQPLPPARYRAMACARQLFVFSQAGDEAHARVLFDSLTHTFQDTRHGGWFYSVD
FT                   PQGAPLDTTKDLYTHAFVVFACAEYGRRSGNRDALEIVHRTSALIQAHFAAEGDLFNAA
FT                   LTADFAGVTGTPIQNPLMHLTEAWLAAREATHDNAFDAALRRLAGAVARHFMHAPTGCI
FT                   AELPIGADDNRLEPGHQFEWFWLVRQAGAVFEGSGLAEAMPRAFSFAQQNGVDRETGGV
FT                   CASLDETGWVKDATQRIWAQTEYLRALASHDEPAALAALPRQIELFQQRFLRPQGWFEC
FT                   KTPAGEVARADMPSTTPYHLATAYAALPA"
FT   gene            87519..88205
FT                   /locus_tag="Bxe_B2948"
FT   CDS_pept        87519..88205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2948"
FT                   /product="MgtC/SapB family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2948"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33047"
FT                   /db_xref="GOA:Q13S92"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S92"
FT                   /protein_id="ABE33047.1"
FT                   /translation="MLGNLELIARLVLAAALGSVIGFERERLSWAAGLRTHMLVCVGST
FT                   LIMIVSAYGFAEVLSGEHVVLDPSRMAAQVVSGIGFLGAGSILLRGEIVRGLTTAASLW
FT                   SVAAIGLAVGGGLYTASIAATIIILIILAGIKPLERRFITVKQRRQLTMIVERGTMTFH
FT                   SLHDELGAASPRVKQFVMQQSEDAPECDEVVITLHRVSNTEYEAICGRLRQLRGVRQFR
FT                   QDDATS"
FT   gene            88338..89693
FT                   /locus_tag="Bxe_B2947"
FT   CDS_pept        88338..89693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2947"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2947"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33048"
FT                   /db_xref="GOA:Q13S91"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S91"
FT                   /protein_id="ABE33048.1"
FT                   /translation="MADSVASTQSRPSRAASKKRRQATVSTETENKLARAARSAQRLAQ
FT                   LSDASRDDATLDLFPDDPTRATLEAMNIDIRQGTLHGFELPDVVLAAVGAIDTGDSASL
FT                   EARAARRAPRTPKSDEPVPVNAQLSGLEIESVAAMAAMVSPVGELALGDTKPATDANAE
FT                   EKPAVSAPLTPAMAAATVARSVTALRQASEPGAATGVTTDTPVASTSGVGKAPQRFAAT
FT                   FAKAASASASASALRGTHTAETTSAVDEPAPAESDAAPTESKAGTETLAHPSAPAQAST
FT                   EFATPWREARRAEAAAAALRAAPELDRARATAFADTVDALYGVIADQRRAATDHSRRMK
FT                   WMLSIVVGALLVTVAIGITQTVLLIRLTRETTAQQHRIEQMMQNQQAAMTSLLDTHLAM
FT                   AMAMANAVAVNAAPAAATAAPATPQQATATAAHTRRTVRAQHSHRPKAASPH"
FT   gene            90021..90179
FT                   /locus_tag="Bxe_B2946"
FT   CDS_pept        90021..90179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2946"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2946"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33049"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S90"
FT                   /protein_id="ABE33049.1"
FT                   /translation="MSFIFALFQKVSDLFASPHLPLDADYSYKARSREAERVRRSQATL
FT                   FGIKLSD"
FT   gene            90619..90918
FT                   /locus_tag="Bxe_B2945"
FT   CDS_pept        90619..90918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2945"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2945"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33050"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S89"
FT                   /protein_id="ABE33050.1"
FT                   /translation="MKTFNKTSRSLIATLLAGGALLAAGSAFAQERVVVENGPGPAVYG
FT                   QPHMMPVGVSINIGWHGDRYYDGHRYWAHDDWMRHHPHDYDPHHHGDRRPPPHY"
FT   gene            91074..92027
FT                   /locus_tag="Bxe_B2944"
FT   CDS_pept        91074..92027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2944"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2944"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33051"
FT                   /db_xref="GOA:Q13S88"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S88"
FT                   /protein_id="ABE33051.1"
FT                   /translation="MLQSFYRRQQESGVDKAVIGVVGTGLMGVGIATQSALHGHRTIVH
FT                   DVDSARLASVASKAQAVLDELIDAGRIDRAASEAALARIETHAQLDMMASAKFVIEAIP
FT                   EVLELKHRLYAALTGLLADDAILASNTSGFPPDQLVAPLRAKERFVIAHFWNPPHMIPL
FT                   VEVVPGTATAPEVTQQSAALMSAIGMEPVVLAKAIPGFVGNRLQFAVLREALNIVRSGA
FT                   ATPEVVDRVMKASLGRRWGIVGPFEGADMGGLDTFLDISSHLMPELAKDEGVLDLLRAQ
FT                   VDAGRVGVRSGAGFYEWDDAHLAQVKEGRRRVISRG"
FT   gene            92146..92796
FT                   /locus_tag="Bxe_B2943"
FT   CDS_pept        92146..92796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2943"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2943"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33052"
FT                   /db_xref="GOA:Q13S87"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S87"
FT                   /protein_id="ABE33052.1"
FT                   /translation="MPFQPNPQSQLISMSHYFYDPATGHGLAHDPFKAIVAPRLIGWIS
FT                   SRDTEGTLNLAPYSFFGAFATFPPIIGFCSEGRKDSVTNIEATGEFVWNLANKPLAEQM
FT                   NRSSAPVPPSVDEFELAGLTPAPGRNVAVPHVAESPAALECKLLQVVRLHTLDGTPMDN
FT                   YLSLGQVVGVHINEAYLKDGLFDTHAAQPIMRAGYRADYAEIGDMFQMFRPGA"
FT   gene            92978..93412
FT                   /locus_tag="Bxe_B2942"
FT   CDS_pept        92978..93412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2942"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2942"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33053"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S86"
FT                   /protein_id="ABE33053.1"
FT                   /translation="MSTEFATQFSHVRPQDTSYEDQGLRDFFLYRDLGIAQATGGKVLA
FT                   QLVKANHAPEQGTGWHRHEADFHIVIMLKGWARFMYGDKETLVAAGDCVHQAPGIVHYL
FT                   FDYSDDMEYIEIVSPADFKSIEVEGPCDVPAVTPWKGVAA"
FT   gene            complement(93512..94990)
FT                   /locus_tag="Bxe_B2941"
FT   CDS_pept        complement(93512..94990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2941"
FT                   /product="Polyhydroxyalkanoate depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2941"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33054"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S85"
FT                   /protein_id="ABE33054.1"
FT                   /translation="MNLFAYPTYQAFADMMLPMRHGAALMNHSLDAWPAFGETPHGRSI
FT                   RAACELLTLAGLTPVRPPFGLDSVVTEGKSVAIVEEVAAHTPFCSLLHFRKETPPSVPQ
FT                   PRVLVIAPMSGHFATLLRGTVRTMLAEHDVYITDWHNPRDVPLSQGRFGFDEFVQHVID
FT                   FTETIGPGAHLLAVCQPTVAALAAVALMAADDHPAQPASMTLMAGPLDTRINPTRVNDL
FT                   AKSKPIEWFEQNLISAVPFGFAGAHRRVYPGFVQLTAFMAMNLNRHLDSFETMYYERAK
FT                   GDPAKADTIHTFYEEYFATMDLTADFYLETVDTVFQRHALPLHALEVKGRLVEPSRIRR
FT                   TALLTVEGEKDDICAVGQTLAAQDMCDKLRPYLKTHHVQTGVGHYGVFNGHRWERQVYP
FT                   RVRAVIYDNEPRAVLVGSRARTIRPVPAATAAEVTAAAPAAAAVVDMEVDAAMAAGSNE
FT                   SDAASGAGAGAGADSNAAIKPQTPSAPRRRPPAT"
FT   gene            95210..95863
FT                   /locus_tag="Bxe_B2940"
FT   CDS_pept        95210..95863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2940"
FT                   /product="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2940"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33055"
FT                   /db_xref="GOA:Q13S84"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S84"
FT                   /protein_id="ABE33055.1"
FT                   /translation="MANTTLTISSKNYSSWSLRGWLLTKFSGLPFEEIVMPIDDPAARA
FT                   ELLLLSPSILVPCLFHDGIKIWDTLAIAEYLNELKPDAKLLPRDIRARAHCRSICGEMH
FT                   SGFGSLRSALPMNLKAHFPGFKVWARAQSDIDRIVAIWSDCLKQYGGPFLFGERTTADA
FT                   MYAPVVTRFVTYDVKLDPEIVEYGQRIMALPEMREWIADAQQEAEEIDELDVEF"
FT   gene            complement(95986..98004)
FT                   /locus_tag="Bxe_B2939"
FT   CDS_pept        complement(95986..98004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2939"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2939"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33056"
FT                   /db_xref="GOA:Q13S83"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S83"
FT                   /protein_id="ABE33056.1"
FT                   /translation="MAHASRSCSLTPQSLMEFLSLRRASVGARLAILSCALVALIFAAF
FT                   TWALTRTAGKQISDQVLERIADKDRSIAAMIKLFDKALSNEVDRSMSLFASFLPTGYTL
FT                   DETQKVDIGGVATPTIKAGDKVLNMDFSIPDLFLERSGAVATVFARNGDDFVRVTTSLK
FT                   KQDGSRAIGTLLDRKAPAYALLLANRSYTGLAALFGKRLITQYRPITDASGRVIGALFV
FT                   GVNVDKEIQSVEDGIRNLKIGDTGYYFVVDASKGADRGKLIVHPAAAGQNAGNANAPYQ
FT                   QMLDMKDGRLEYSSADATLGERGARDKFVSFVTVPEWQWLVGGVAPRDEVMADVVATRN
FT                   EFLLLGFILVGVFAVVFLIAVRRLVSRPLEEAAKASERFASGDLSVRVANGANARADEI
FT                   GRLMQSIDGIGEGLARIVSQVRNASADMSHGTGKIATGSGHIAARIATQASSLEETAAS
FT                   MEEITSTVQQNADHAAQANTLVTRAADAALEGGRAVERVVSTMGEISRSSQKIAEITSV
FT                   IEGIAFQTNILALNAAVEAARAGEHGKGFAVVASEVRALAQRSAASVKEIEGLIATSTA
FT                   TVQSGFRIAEEASSTMQGIVQQVGEVRAIMGEISVASREQSGGIEQVNLAVTQIGEATQ
FT                   QNATIVGEAELAAAELRDQAARLAQVVSVFKLESGRD"
FT   gene            complement(98123..100510)
FT                   /locus_tag="Bxe_B2938"
FT   CDS_pept        complement(98123..100510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2938"
FT                   /product="Copper-translocating P-type ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2938"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33057"
FT                   /db_xref="GOA:Q13S82"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S82"
FT                   /protein_id="ABE33057.1"
FT                   /translation="MPPRALPAMTELATAPRPANTADAADISAHTAELDIGGMTCASCA
FT                   MRVEKALAKVPGVVSASVNLATETATVDLNGAAAGPDALIAAVRKAGYEAALVAPPDTP
FT                   ASANESAPADRKRDQTRRELAAVLASAVLTLPLIGPMVGEWFGFHAMLSPWLQFALASV
FT                   VQFVFGARFYRAAFRAVRAGAGNMDLLVALGTSAAYGISVYELATHPGDMMHLYFEASA
FT                   VVITLVRFGKWLEARAKRQTTDAIRALNALRPDRARIRVGAGERDVPLAQVRVGTIVIV
FT                   RPGERVPVDGTVLEGRTHIDESLITGESLPVPKQVADAVTAGSINGEGAIAVTTTAIGA
FT                   ETTLARIIRLVESAQAEKAPIQRLVDRVSEIFVPAILAIAALTLAGWLIAGAAGETAIL
FT                   NAVAVLVIACPCALGLATPAAIMAGTGVAARRGVLIKDAEALETAHRVTIVAFDKTGTL
FT                   TLGQPSVTAFEPIGGISRDEALALAAAVQRNSDHPLARAVVKAYEAEAAATAAAAEAAD
FT                   MPAAIGEAVASPTRTRALHASAARAVAGRGVEADVDGRTLALGSGRWLGELGIELPPEF
FT                   AARARELEAAGNTVSWLMQRAPLAPVALALIAFGDTVKPTARAAVERLAQMGITSVLVT
FT                   GDNRGSAASVARALGIDEFHADVLPEDKARVIRDLKIRSAGIVAMAGDGINDAPALAAA
FT                   DIGIAMATGTDVAMHAAGITLMRGDPALVADAIDISRRTWRKIRQNLFWAFVYNLIGIP
FT                   LAAFGLLNPMLAGAAMAFSSVSVVTNALLLRTWRGAQNGSGR"
FT   gene            complement(100613..101284)
FT                   /locus_tag="Bxe_B2937"
FT   CDS_pept        complement(100613..101284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2937"
FT                   /product="negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2937"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33058"
FT                   /db_xref="GOA:Q13S81"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S81"
FT                   /protein_id="ABE33058.1"
FT                   /translation="MYMPAHFEENRPEVLHRLIAEHPFGALITNGPNGLDANHLPFEFE
FT                   VPPAKDKSDAAAGETHGILRAHVARANPVWQEAEANPEALVIFQGPSAYISPNWYPGKH
FT                   ETHRQVPTYNYMVVHAHGRIVVRDDESFLRGLVARLTRKMEAGEPVPWKMGDAPADFIA
FT                   QMLGAIVGIEIEVTRLVGKWKLGQNKAAADRRGAAETLLARPGDEQQAVGQAMLDAPPA
FT                   F"
FT   gene            101605..103002
FT                   /locus_tag="Bxe_B2936"
FT   CDS_pept        101605..103002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2936"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2936"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33059"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S80"
FT                   /protein_id="ABE33059.1"
FT                   /translation="MLSIHWTCASFAGLAFLAGCASTPTASQKSTGWIKDEVADSYVFG
FT                   YPLVLMGVARDAAVGTDPGQAPLNTLRHAQALPPIGAANPPQPSLDTFDSTGWLDLGSE
FT                   PVIVSLPDSRGRYVDARVLDMWTNVVWSTSSQFGTRAAGIKAQAIAFVGPGWQGELPKG
FT                   VKRVDVPTRNAWVSVRIQSNGTRDLTAVRKLQRAIRVAPLSVYAGDTRSATIAPARSNA
FT                   ADAAAAASGSPAAQVAALDANGFFNRLAQALPDNPPTPADPHALKFLSDLGVTPGEPVK
FT                   LPNAPEAITAGLADGHDRVVTPPSNLLTGNGWSWFGDGVGTYGPDYALRAYAAYAQPGI
FT                   GTKDDEVRAVVTQDSDGHALNGANRYVIHFAPNQLPPVRGFWSITAYTKDGALGESAPA
FT                   RLAVGDRNGARRNRDGSLDVTVSSTRSRSGNWLPAPRADLKLVLRLYAPKPQATDGSWQ
FT                   PPAVVRQ"
FT   gene            103117..106968
FT                   /locus_tag="Bxe_B2935"
FT   CDS_pept        103117..106968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2935"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2935"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33060"
FT                   /db_xref="GOA:Q13S79"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S79"
FT                   /protein_id="ABE33060.1"
FT                   /translation="MCKPRLTFISRERFTTYTAACGIFVFAAGLPPHYPIPSMASLNKA
FT                   SLASSMQTVRDVAQSRRTRRVITGLLIFLVVFGLLGFFAAPPLIRHVAEQQLSKQLDRP
FT                   ATIGRIALNPYTLRLEADRVHIGERGGAGDFVDISRLIVQPSWSSLFRAAPIIDQVQLD
FT                   SPRFHIVRYDAQRFNFTDLIEKFSKQPARPDSKPTLFSVSNIRLENGQITFDDKLLGAT
FT                   HVIDQWKLGIPFIATLPSKTDIFVEPLLRARIDGSPLAIDGKTKPFAASRESEVSLRFD
FT                   GLDVPRLMSYAPTRLPVIVQSGKLSTDLKLNFVVSNDAPSLRVAGTIDLNDVDVQDQGK
FT                   APFFAARAVHVAAATLDPFRNLYHFDEIRIDAPTASLARDKDGVLSVEKMFAPEPAAAQ
FT                   PAASAPVAASAANAAAKAAPPLDLAIKRFVLNDGTVNVRDNAASRPVDAGLQKLAVTLT
FT                   DFSTLATAPAHYTLNTDLKDSGGSLGVAGAFGFAAKTASAKLDLKSLNLPQLQPYLDTA
FT                   TAAQLRDGKLSATANVGANWSKLPAAVMVTDTQLDLQSLKVAAPGAKDPVIALTQGSAR
FT                   VRQVDVAARTAEIASIDTTGLAVDAERLKDGSINLAALGGRHEATPQRTAIHAVKKAQA
FT                   EGPAWHYKIGELVLKDATANFTDNTTPQPVKLNITPLQLKVQNISDDLSRPLPVDLQAT
FT                   LNRKGTLGVKGDVTATPLKVAVKVNANRLDAAAFEPYFGGKLNAVIASALLNANGDLAL
FT                   SQAKSLKATYRGDMALVDVRMLDKASSDPFAGWGSLALSSLKADYDEHGTVVDAGRVTF
FT                   TKFYGRVLLDAQGKLNLRDVVAHETGAAQSLTRDKSGADPVPLTPQAASTVAAASAPVP
FT                   ASAAAATVTAATAPQSPVKLHFGQLVLQQGRVTYTDNFIKPNFTANLVGIQGTVGAFGT
FT                   QSTTAAPVDIAAKLAANGPLSIRGTINPLIAKPALDLTAVAHDIELTNLTPYSAKYAGY
FT                   PITKGKLNVDLHYTLENDQLNANNHIFIDQLTFGDHVENDTATRLPVRLAISLLKNSRG
FT                   EIDVNLPVSGSLSNPEFSIGGLIWHAVLNLLQKAVTAPFSLIANAFGGNGEELGYVEFE
FT                   PGSATLTDADTKKLDTIVKALADKSSIRMDLIGRVDPAIDEPALRTGYVERLVKQQKIK
FT                   DVVGNGESVDLSTVTVDPKEYDKYLSKAYKSADFKKPRNFVGLTKSLPDDEMKSALAAN
FT                   APIDDASLRQLAQQRAQSVQQYLEGKIDSSRVFIVAPKLNADGIKDKGATTRVDFGLK"
FT   gene            complement(106980..108521)
FT                   /locus_tag="Bxe_B2934"
FT   CDS_pept        complement(106980..108521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2934"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2934"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33061"
FT                   /db_xref="GOA:Q13S78"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S78"
FT                   /protein_id="ABE33061.1"
FT                   /translation="MILSDWLAARLDRSAAEPVYRQTLRLMQQAILTGQLPPGTKLPSS
FT                   RTLAQDLGIARNTVLHVYDQLTAEGYVISTTGSGTYVADTRPDTAAVNARKKPVVVSGI
FT                   ETDADAAIETTRRPKRDLGDLSTRGRRLIDTAGVSAKQWGAFMPGVPDVAEFPARTWSR
FT                   LQARLWKEANPDLLTYAPGGGYRPLRRALSDYLRVARSVNCTPDQIIITTGIHQSIDLA
FT                   VRLLTDVGDRAWVEEPCYWGARSVLQSSGITLVPVPVDDEGLNPREQDLQQPPRLALVT
FT                   PSHQYPLGMVMSLARRRTLLEYARQHNVWIIEDDYDSEFRYGSRPLASLQGLDDAGQVI
FT                   YVGSLGKMLFPGLRIGYMIAPEHLVDTFRTGVAELYREGQLMQQAVMTDFIMDGHLTSH
FT                   VRRMRALYGERRQILIDAITARFGSELPVMGDEAGLHLVLGLPDHANDRAVTAAAYDAG
FT                   VIVRPLASYYSGDTPARRGLLLGYACVPNDRIGPAFDTLARVIEQTALKTPTRAA"
FT   gene            108660..109757
FT                   /locus_tag="Bxe_B2933"
FT   CDS_pept        108660..109757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2933"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2933"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33062"
FT                   /db_xref="GOA:Q13S77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S77"
FT                   /protein_id="ABE33062.1"
FT                   /translation="MKTDDVIVSFRGVRKTYDGETLVVKQLDLDIYQGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIWLDGTLLNTVPPHKRNIGMVFQNYALFPHLTVEQNVAYP
FT                   LTVRKISAQERAHRTNNALKMVRMESFAKRYPAQLSGGQQQRIALARALVFEPKLVLMD
FT                   EPLGALDKQLREHMQYELKSLHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDRLYESPCNEFVANFIGDSNRLRGTIANVDGEYCEFRLSDGTRLTGRNIGGARAGTPA
FT                   VACIRPERMKLANGLSRPGANALAGEARGLIYFGDHVRMRCGLPQQDECFVKVPLGTDA
FT                   LDTFAPGAPVALEFAPEHLRVFAGA"
FT   gene            109867..110916
FT                   /locus_tag="Bxe_B2932"
FT   CDS_pept        109867..110916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2932"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2932"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33063"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S76"
FT                   /protein_id="ABE33063.1"
FT                   /translation="MSKIGKSRCAIAVGAVALALGAAQVNAAELTVVNFGGANGDAQKV
FT                   AFNQPFEKETSNKVTAVEYNGEQAKVKAMVEARHVNWDVVEVESGDIGRGCDEGLYEKL
FT                   DWSKIGKKSDLIPEAPQTCGVGFFVWSTALAYNADKLKTAPAGWADFWDVKKFPGKRAM
FT                   RKGARYNLEFALMADGVPPKDVYKVLATKAGQDRAFKKLDELKPNIQWWEAGAQPPQFL
FT                   VAGDVVMSTAYNGRIDAAQKEGKNLKVVWNGSIYDLDYWAIPKGTPNKALAEKYIAYSI
FT                   SSKPQQDYAHNIAYGPVNVTAIKALDPKTLANLPNSPANGKNAVLQDLAFWTDHGDELE
FT                   QRFSSWASK"
FT   gene            110992..112260
FT                   /locus_tag="Bxe_B2931"
FT   CDS_pept        110992..112260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2931"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2931"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33064"
FT                   /db_xref="GOA:Q13S75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S75"
FT                   /protein_id="ABE33064.1"
FT                   /translation="MTIAADSTPESSGRLKRELRAAESRKRAVALLLIAPLAIFLLLIF
FT                   VVPIGALLTRAAQNPEVVNALPHTLTALSAWDRKTPPPDAAYVALATDLAAVADSDGMG
FT                   ALARRLNVEIPGYRSLIAKSARAMPFVDDNSKPLQLTPAQVHAKFVELDERWNDIAYWQ
FT                   TIAKNSSAYSPFYLLASLDHKQDAFGHVIPTDPEQQIYLAVFSRTFVIGAAVTFFALLL
FT                   GYPLAYWISTLPERRANLVMILVLIPFWTSILVRVAAWIVILQSEGLVNKALIGSGLLH
FT                   DPLSLLFNRTGVYISMTHILLPFMILPLYSVMKSIPPTYQRAAVSLGSHPFAAFWRVYV
FT                   PQTYPGIGAGALLVFILAIGYYITPALLGGPNDQMVSYYVAYYTNVTINWGMACALGGL
FT                   LLAATLVLYVIYGRFTRSSLSLG"
FT   gene            112275..113114
FT                   /locus_tag="Bxe_B2930"
FT   CDS_pept        112275..113114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2930"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2930"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33065"
FT                   /db_xref="GOA:Q13S74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S74"
FT                   /protein_id="ABE33065.1"
FT                   /translation="MKLAKPLFAPHTSWVERVWYFALRGLAVLTLLYLILPVLAIVPLS
FT                   FSSSTFLVYPIPGWSLRWYQNLIASDEWRMAARNSFIVAPSATVVATVLGTLAAIGLTK
FT                   ANFRGKGLLMAILISPMIVPVVVVGVGMYLFFAPLGLANTYIGLILAHASLGVPFVVTT
FT                   VAATLQGFNYNLVRASLSLGANPVKTFFRITLPVIAPGVISGALFAFATSFDEVVVTLF
FT                   LAGADQTTLPRQMFTGIRENISPTIAALATILIIFSTSLLLALEWLRGRNAARAVRA"
FT   gene            113271..114350
FT                   /locus_tag="Bxe_B2929"
FT   CDS_pept        113271..114350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2929"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2929"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33066"
FT                   /db_xref="GOA:Q13S73"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S73"
FT                   /protein_id="ABE33066.1"
FT                   /translation="MKHQLTVLVCALALTACADHAARERLGIEDATLLKTGFGATQDEA
FT                   AGAVNAQWVSTYAPIASSNTALAGLQTRLDRLPGDKNSYFYAKAQCWINAAQQARQAND
FT                   RWGFVEEAIGQAATITIGLENGAPLSAANPALRTVSTVRPDLWKIVNTIKADPAVAQCP
FT                   QAQQPLACAEVELAQAGHDAWRRSFTNAEKRLPEVQDNLRQSAQRALQCKQALQAPASM
FT                   SAPEQGSVAKPQQKITLKADSLFRFNGGDEAAMLPAGKRQLDDVATGLNNAPALHELKI
FT                   TGYADRLGDKSYNLGLSMQRARTVERYLRAHGVSVPITAQGRGSANPLVDCRRTKRDAL
FT                   VKCLAPNRRVEIELVAARS"
FT   gene            114545..115186
FT                   /locus_tag="Bxe_B2928"
FT   CDS_pept        114545..115186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2928"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2928"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33067"
FT                   /db_xref="GOA:Q13S72"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S72"
FT                   /protein_id="ABE33067.1"
FT                   /translation="MSTILVIDDHPAFRMVIKMQLMQLLGVEEVIEADNGQTAVEMARV
FT                   HTPELAILDLDIPRISGLDVIPRLRLVHPPIRVMVLSGHDPATFAPRAMRSGVHGFVGK
FT                   SQEMKEIMRGVEAVLAGYTVFPVTANGSGMVAAVGAGGEEQRIGLLSDKELVILQMLSK
FT                   GMSNKAIGDALFISNKTVSSHKTRIMQKLAVKSLVELIDLARRCRIASVQ"
FT   gene            115183..115569
FT                   /locus_tag="Bxe_B2927"
FT   CDS_pept        115183..115569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2927"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2927"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33068"
FT                   /db_xref="GOA:Q13S71"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S71"
FT                   /protein_id="ABE33068.1"
FT                   /translation="MKPVGATKQAGFAGDPHLLQQKALELAGGDHVTARRLLEMIAQTD
FT                   RTALAALRDSFRTASWDGVGSAAHRIAGSARMLECHEVFALLTRLEAAARGRDIVLATA
FT                   LLPHVADALGELGASIGKALTSTD"
FT   gene            complement(115605..116441)
FT                   /locus_tag="Bxe_B2926"
FT   CDS_pept        complement(115605..116441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2926"
FT                   /product="Putative transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2926"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33069"
FT                   /db_xref="GOA:Q13S70"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S70"
FT                   /protein_id="ABE33069.1"
FT                   /translation="MSRGVKGGLAVLAGAVATRYCMASVRTLLPGVLIATSAYVSLDAR
FT                   AADATHARQRRSRGVVMMIGGMTSGGDTAVLPARAAPVAPLAAAGDAGRQSVVIQSGGL
FT                   ALNDVVRQTSASVASRVMALSPIINEAARVADVDSALLMAVIDVESGGNPQAVSPKGAT
FT                   GLMQLMPDTGARHGASDLFDPRQNVAAGARYLKALMRQFGGLPLALAAYNAGEGAVQKY
FT                   GGQIPPYAETLNYVPKVIARYRWYRDAASFPATASVQAVPNGVHDRFLLVGSGGVD"
FT   gene            complement(116441..117277)
FT                   /locus_tag="Bxe_B2925"
FT   CDS_pept        complement(116441..117277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2925"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33070"
FT                   /db_xref="GOA:Q13S69"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S69"
FT                   /protein_id="ABE33070.1"
FT                   /translation="MNPPDLKLQQIPSRRTRLTGNARRTSQSGQSMTEFIIIAPVLLFV
FT                   CFGILQFVLLYQAKSTLDVAALEAAREGAVNHGSMQSMRNGLARGLAPLYAHQANAEGV
FT                   AAALASAQTDAARFSSITVLNPTPAAIQDYSRPRYYADQAATYSEIPNDSLMYRDSSVP
FT                   PGAMSRMNIQDANLLKIHVHYCYDMYVPLVNKVIYYAANVIGAIGTGGILTREPANVTQ
FT                   DPYGDPKNGDYLCKVKLADGIATGHWPISLDSEAMVRMQSPLRASALNDSPNPTGN"
FT   gene            complement(117274..117624)
FT                   /locus_tag="Bxe_B2924"
FT   CDS_pept        complement(117274..117624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2924"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2924"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33071"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S68"
FT                   /protein_id="ABE33071.1"
FT                   /translation="MKRARLHVRGHDIGVEVSITETARECMRGLLGRAALASGEALLLD
FT                   RCGSVHTFGMRFAIDVLFLDRRQRVVAIHHDVPRRRMLFSLRATHTLEMPAHSARRHGL
FT                   AVGDSLVFEATS"
FT   gene            complement(117621..118502)
FT                   /locus_tag="Bxe_B2923"
FT   CDS_pept        complement(117621..118502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2923"
FT                   /product="Putative type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2923"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33072"
FT                   /db_xref="GOA:Q13S67"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S67"
FT                   /protein_id="ABE33072.1"
FT                   /translation="MLLFIAFLVSFGLIAFIAVGYRSLNGLAGAVPEEDRLFLDPLPKS
FT                   LRPLWPLVNFVVHHFGNSFSAKLVEKTDLQLRLTSLTFLMNARQFIALSIIASILASLV
FT                   TLLLMLALGMFSVLILILVAALGYFYPRIWTRDVRRRRVAQILRHLPIYLDFLTLAVEA
FT                   GLNINGAIQKAVEKGPEGPLRRELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNLVGT
FT                   VVQAERMGSGLAKSLRFQSEQRRSERFQRAEKQAMEAPVKLVFPLLFFIFPITFIVLGF
FT                   PIAMKFVQEGLL"
FT   gene            complement(118506..119354)
FT                   /locus_tag="Bxe_B2922"
FT   CDS_pept        complement(118506..119354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2922"
FT                   /product="Putative type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2922"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33073"
FT                   /db_xref="GOA:Q13S66"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S66"
FT                   /protein_id="ABE33073.1"
FT                   /translation="MSLPLILALAFFGSLFLIFLLSRMGTSTLRAGSRQMAGEIESSLA
FT                   DAFVFVNRQKAAAWSMVVMVGLPVIVFLFSHSILFALASVPIAMMLPKKYLKRMRKKRI
FT                   EALEKQLPDALLMMSGALRAGASFPAALEAVVYETAPPISQEFDLLMREIRLGIDLDIA
FT                   MRNVEKRIPIPDLLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIRALTSQGR
FT                   MQGIVMTCLPLFLMLVLRFMEAKAMAPLFSEPVGWATLAVIGVMECLGYFWISRITNID
FT                   V"
FT   gene            complement(119367..121283)
FT                   /locus_tag="Bxe_B2921"
FT   CDS_pept        complement(119367..121283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2921"
FT                   /product="type II/IV secretion system protein E"
FT                   /note="Putative type II/IV secretion system-relatedprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2921"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33074"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S65"
FT                   /protein_id="ABE33074.1"
FT                   /translation="MLNLQVHARNAPVRTLQVEQGCTIGKDASCDVIVKGLLIGKLQAR
FT                   IVREHNAYYIEDQGGIAATLVNGTAITRYGPLTEADQIEVGVTTIRIVRAAVAAQPQPQ
FT                   DAQHGQQAAQPSSETAHAGHAATPVARPLQAPASAHIEPSFAVAAQVQPMPEPFHPPAV
FT                   ERNAAPAGHYAPARHESIAMPTQRAAEVPPRTPPPQVKKTAAAPLPVAPINSPLGIELR
FT                   KQAHMKVIAALDLRRLNVARMEEDELRKTVSAALDDILNHDASFHTADIPLSALKKSVF
FT                   DEIIGLGPLEELIADPTVSEIMVNCHNEIFIEQNGQLTRSPVIFTDDRAVLGAIERIVA
FT                   PIGRRIDESSPMVDARLSDGSRVNAVIPPLALKGPSITIRKFSRQKLGGEDLIRFGSMS
FT                   PDMLEFLHTAVKEGANIVISGGTGSGKTTLLNVLSSYIPDDERIVTVEDAAELQLSQPN
FT                   LVSLEARPANMEGKGAIHIRDLVKNCLRMRPDRIVIGECRGGEALDMLQAMNTGHDGSL
FT                   TTAHANTPRDCIARLEVMTLMAGLDLPVQAIREQICSAVDLIVQQSRFSCGSRRVTHVT
FT                   EVSGMESGVITLQDVFVFKEEGFSEHGKIQGKFVPTAYVPDFYQELIRRRIPVNTDIFT
FT                   RIE"
FT   gene            complement(121307..123094)
FT                   /locus_tag="Bxe_B2920"
FT   CDS_pept        complement(121307..123094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2920"
FT                   /product="Putative type II and III secretion system
FT                   outermembrane protein, secretin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2920"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33075"
FT                   /db_xref="GOA:Q13S64"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S64"
FT                   /protein_id="ABE33075.1"
FT                   /translation="MKVKNNAAPLRRRVLPSVLVGMLLCEAAPAALAQTAQAAHAAYTA
FT                   ATDSPSASTRVLEMFRGEVRILHIPGTIKRIAIGNGKLLTANVVDGSLMLLGEQDGITS
FT                   LVVWNDKGIALQTTVRIAKAEVNASLEQLRAVLRSVAGLRIDAIGSNIVLSGVIHRDMA
FT                   GTVKAATQEMKNVVDTTTFDEGDALRKTVHFKVQIMEVTRTGQRNLGIAWDSAFRGPQI
FT                   GGAASVATGAAKAITAGTSYFLAGIASNITSQINFAVENGDAYVLAAPELNTKSGGTAS
FT                   FLAGGQVPIPQSGALGTTSIEYKDYGIKLSIVPVVDANNIISAHLTTEISQIDPSVTYA
FT                   GMPGFLTRNTSSDISMRAGETLAISGLVSADAANDSNGMPFLSQVPIIGQLFRSDRFRA
FT                   KKSDLVIFVTPVISDPELSPNTDLLARADKLDENFRKEYGNTDPLVADEDKAKHVTTPR
FT                   QPIVPTPALLPTPVRSTPQVPAEPQASAPVVAGAEGPATPLAASVQTPAYVPAQIPAQA
FT                   AAPVSAQAPAQTQAAGAPAQLPPSPPPASTPPAGVAEALRMLNDPQHAQAMPAHDPMQP
FT                   ASNGKVPQQQIGVLGTSNN"
FT   gene            complement(123119..124210)
FT                   /locus_tag="Bxe_B2919"
FT   CDS_pept        complement(123119..124210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2919"
FT                   /product="Putative Flp pilus assembly CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2919"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33076"
FT                   /db_xref="GOA:Q13S63"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S63"
FT                   /protein_id="ABE33076.1"
FT                   /translation="MLKKIKFRSLLANSWVLLFLAVLVAGGLTFLLYKYLNDREKKLKA
FT                   DMDAHRVRAGVTVVVPAQDVPVGTPLSSGDFVAREIAGDLVYDDMIRADNFEQYRSSHL
FT                   VKPVRRGLPLRAGDIDALRGRDFSDVLRPGTRALTVEIDTVNATALLLRPGNHVDVYWV
FT                   GKVFHEDHTSDEKKVAQLVMPNVLVLATGEDMRPRDAGEAAQQDQANANSSAMSRQAGM
FT                   GYTTVTLEIPVDDVARVALAQKIGGLRLILRNSEDKGADGPSLAQESDVFIDPARGRVT
FT                   GGTGPAPQTVEVISGGGANSTNVIVSQGPASAPAQEPQAPAPADAGQSASASPQRQPSL
FT                   YEQANAIARQLQKAAAPSTSKQN"
FT   gene            complement(124231..124437)
FT                   /locus_tag="Bxe_B2918"
FT   CDS_pept        complement(124231..124437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2918"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2918"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33077"
FT                   /db_xref="GOA:Q13S62"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S62"
FT                   /protein_id="ABE33077.1"
FT                   /translation="MSKAELVSSFATRRSRQRGQAYAEYLVVTTVLVGALVVADSNAIA
FT                   PVAALLSSFKSFFSAYSFTLSLP"
FT   gene            complement(124439..125155)
FT                   /locus_tag="Bxe_B2917"
FT   CDS_pept        complement(124439..125155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2917"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2917"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S61"
FT                   /protein_id="ABE33078.1"
FT                   /translation="MKYAYHLARGACLGSALLFTGNAVAANACNKTPVQPQSVQAIGRD
FT                   MIVNGVPTSVVGMQFSGTTEDVSRAFRDFWIREDVPAKGRTNSSGLLLSALDDHCLYIL
FT                   SIPPQPEGDHTRGLMSVVRLGSDQADHRIPDSAVPLPEESAILSDVESHDPGQTGRTWL
FT                   LDMPGNPQWNAQRYRNSLAAQGWVNVGRQPDYQSTGNRAAQGTAFAMQHGADSVDVSFS
FT                   DHGGRTAAVVNAIRNR"
FT   gene            complement(125152..126036)
FT                   /locus_tag="Bxe_B2916"
FT   CDS_pept        complement(125152..126036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2916"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2916"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33079"
FT                   /db_xref="GOA:Q13S60"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S60"
FT                   /protein_id="ABE33079.1"
FT                   /translation="MKRIDMRNSGQSGQAMVEFLVSMTLVMSVLLLAIAMLGKFNDIRH
FT                   RTLMASRYLAWERTVWSDGDATKNLASDPGTTEGWSGTYGGAALSASKLDTELKREVMQ
FT                   RLMANDGSPISGTDLKQNELPASQPAMWRDYGGNPLLASSSDIAVSTGVAADPASSLNG
FT                   TALSQWAVPTATGGQYLAHLSLPTSTMRSGTLSLSVGGNSDVLKRFWPKDAALPAFSGL
FT                   AFSDTNVLMTNSWMPDGSASNKALFSQAVPAANAVLVPPGGYQGLQKYAPEITSLQFGR
FT                   VQQDVVPANRLKQ"
FT   gene            complement(126033..127565)
FT                   /locus_tag="Bxe_B2915"
FT   CDS_pept        complement(126033..127565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2915"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33080"
FT                   /db_xref="GOA:Q13S59"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S59"
FT                   /protein_id="ABE33080.1"
FT                   /translation="MKRSARKGRVRVAGASGQALVPALIFLLAGCIGLYVAFNSFQMTS
FT                   AKIKLQNTADAAAYSAAVLQARDYNFSAYTNRAMIANQVTAAQVVALKSWIDELDATYS
FT                   LSELDEAVDSLADHPAQWSTPKQLGKNDIAPVRAALDALLPTVARNIGSLNRALSVAQA
FT                   NYHAAVITTVPDTADTVAQLNQPDTHVTSGYFTGSRNAAQLAAWTSYTATVIPAGTLGA
FT                   DEFADVVTAPGTLDGFVKNRNSNRSVAPNFQQLTDTAIRICGGANSTFTVNVTHAGGTQ
FT                   LRSDKSGWQSIDASTAQLNVSCLETFGDVAGSGGSANGNITSFMTNPPFAAWQDWQGYG
FT                   GYFNFGYQGSLTPGWQVPEAMAHQFSVGPGPSLDPANGGLLPYQEVNGARPGSEAPRIT
FT                   IEVTRNSDTLVKTIGLQGGGRMAVADNAAGGAMRALSSANAYFVRPDETSIGGSIMGGL
FT                   LNGSQWARADHATEYPSLFSPYWQARLAPVSDEERAAAQASQMSAATQVQKP"
FT   gene            complement(127591..127824)
FT                   /locus_tag="Bxe_B2914"
FT   CDS_pept        complement(127591..127824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2914"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2914"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33081"
FT                   /db_xref="GOA:Q13S58"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S58"
FT                   /protein_id="ABE33081.1"
FT                   /translation="MTEYIIIVALIAVSAIGVYSLFGQTLRNQTSGLAIEMSGQDAKSN
FT                   ISTAQTNANTATSNANHTKNMGTYNDSNNTGN"
FT   gene            complement(127841..128110)
FT                   /locus_tag="Bxe_B2913"
FT   CDS_pept        complement(127841..128110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2913"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2913"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33082"
FT                   /db_xref="GOA:Q13S57"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S57"
FT                   /protein_id="ABE33082.1"
FT                   /translation="MRVQTHLPIRGVACGIAPLILINFATLRSQQILILRPTPLPVGFE
FT                   RWVAFFISVQDTRGRKVVSRHYQIVHLTFFQVRDYENFSNPSQK"
FT   gene            complement(128407..128814)
FT                   /locus_tag="Bxe_B2912"
FT   CDS_pept        complement(128407..128814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2912"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2912"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33083"
FT                   /db_xref="GOA:Q13GN1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GN1"
FT                   /protein_id="ABE33083.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCAAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            128910..129806
FT                   /locus_tag="Bxe_B2911"
FT   CDS_pept        128910..129806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2911"
FT                   /product="heavy metal/H+ antiporter, CDF family"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2911"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33084"
FT                   /db_xref="GOA:Q13GN0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GN0"
FT                   /protein_id="ABE33084.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITAGALVAWTGSNYPDLIIGTI
FT                   AGGIVLNGARRILALKG"
FT   gene            129810..130322
FT                   /locus_tag="Bxe_B2910"
FT   CDS_pept        129810..130322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2910"
FT                   /product="signal peptidase II, Aspartic peptidase, MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2910"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33085"
FT                   /db_xref="GOA:Q13GM9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GM9"
FT                   /protein_id="ABE33085.1"
FT                   /translation="MLIIGKKLSPYALLSISGLLAASDQAVKWLVQQSMAYGEYVSVTP
FT                   FFNWVHLWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIAYSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKANTN
FT                   AEPDGSD"
FT   gene            130344..131633
FT                   /locus_tag="Bxe_B2909"
FT   CDS_pept        130344..131633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2909"
FT                   /product="Transposase, TnpA"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2909"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33086"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GM8"
FT                   /protein_id="ABE33086.1"
FT                   /translation="MTELPDNILHLPQYQVLGCKSTDDEMHFQVDVPDPIACEECGVQG
FT                   EFVRFGKRDVPYRDLPIHGKRVTLWVVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHE
FT                   YVEKESFNHPYTFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRY
FT                   RCILTNIEERTLLDLLATRRQDVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQA
FT                   RIVVDKFHVVRMANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIME
FT                   TWTGAFPQLLAAYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGN
FT                   WREETMTYFETDMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTA
FT                   KVSPFYKKTIGYGLPDFAEELNYGVDLSTI"
FT   gene            131732..141310
FT                   /locus_tag="Bxe_B2908"
FT   CDS_pept        131732..141310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2908"
FT                   /product="Putative hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2908"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33087"
FT                   /db_xref="GOA:Q13S52"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S52"
FT                   /protein_id="ABE33087.1"
FT                   /translation="MKKRGWPVSHIGEFMNKSYISVWNDASGTWVAAPETARTHSGTGA
FT                   VSSCTISSASDSASRQAAPFKAAFMPIAMAIGVAMLPGTAAAQAVTGNGGLELCPAGVG
FT                   GIGSSWGPLSSAVGIMSCAPMGGGDTSGDGMSFSLNNAASTDGAWGFNSGQITARVTGY
FT                   QDGHLELAAEKGIYMVNDVNMSGNKISSLAPGDVSSKSTDAVNGSQVYQYTRYFKANSP
FT                   SSDPSTDARAIGTSSVASGPSSLAIGKNSSAYGANTSAIGTNSVALGAGSVASRNDAVS
FT                   VGYLSADGTSQYTRQIVNVTAGAAGTDAVNVNQLNAAIASVSGGGSGDLAPNAVTYDTS
FT                   ASTLITLKGASGTKITNLTAGDISSIWSTDAVNGSQLYQTNQNVTNVANNVANVSGNLA
FT                   NVTNIVNNIVNNGIAGSPLVVTYDTSARDTVTLGGTDHTAAVKLTNVAPGDISSASSTD
FT                   AVNGAQLYATNQNVSALASNVGDIVVNLYNRGAKYFHTNSSLADSSAIGTNAVAIGGAA
FT                   IASADNSVALGANSVANRANAVSVGAAGTERQIINVANGTGATDAVNLQQLQAVAASIS
FT                   SGAVTGSFVAYDDSTKGSVTLKGASGSTITNLKAGALTASSVDAVNGSQLYQTNANVAN
FT                   VAGNLANVAGNVTYVTNTVNNIENGGGIKYFHANSSLADSSAAGADAVAIGGAANASAV
FT                   NSVALGANSVANRANAVSVGALNAERQIINVAAGTQNTDAVNVAQMNTAIANASMSGGG
FT                   SPDAVVYDSSSHNILTLGGVAASAPVALTNVAAGQIVSGSSDAVNGGQLYNVANSVAAA
FT                   LGAGSTVNKDGTVSAPGYTISGSTYGNVGDALNALNTAAGDLVSAAKYVKVVSSAAAAS
FT                   ASGSESVAIGGNAMATGSNSLAIGAGATAKYNNSTAIGVNAITDAANTVSVGARGAEMR
FT                   ITHVANGINDTDAATVAQLSALQSKLLQTTQQSSGVKSLLLGAAVPVTSYIAVSSNVTG
FT                   GGSTSASSDLNAMAIGPVAAATGIGALAVGSGSAAGSNASTAVGTGAGVASVNSTAIGY
FT                   SATIGANSANSLAIGYNSRAQATNSMALGSFASATSAGSVVIGYNAFVNQAATNGMALG
FT                   LNASVSAANGVAIGYNSIADRANAVSVGSSSQQNQIIYVAAGTNGTDAVNVNQLSGVTS
FT                   IIGGGAAVNPDGTIKKPSFAIGGQTYTDVGSAINAAVSGGTANGVQYDTSARTKVTLGG
FT                   TGATTAVTLSNVANGVANNDAVNVTQLQAMGATIGTSGVVTNSFVAYDDTTQGKISLKG
FT                   TGGTTITNVKAGALSSASLDAVNGSQLYQTNANVANVAGNVANVTNVVNNITNGGGIKY
FT                   FHANSTLADSSATGTNSVAIGGAASATAANSVALGANSVAGRANAVSVGAVGSERQIIN
FT                   VANATNGTDAVNLQQLQAMGANVNSSGVVTNSFVAYDDTSKGKVTLGGSGFTKAVTLTN
FT                   VANGVANADAVNMAQLKAMGGTIDSSGNVTNAFVAYDDTSKGKVTLGGAGSTKAVALTN
FT                   VANGVANADAVNMAQLKAMGGTIDSSGNVTNAFVAYDDTSKGKVTLGGAGSTKAVALTN
FT                   VANGVANADAVNMAQLKAMGGTIDSSGNVTNAFVAYDDTSKGKVTLGGAGSTKAVALTN
FT                   VANGVANADAVNMAQLKAMGGTIDSSGNVTNAFVAYDDTTLGKISLKGTGGTTITNVKA
FT                   GALSSTSLDAVNGSQLYQTNANVANVAGNVANVAGNVANVTNVVNNITNGGGIKYFHAN
FT                   STLADSSATGANSVAIGGAASATAANSVALGANSVAGRANAVSVGAAGSERQIINVANA
FT                   TNSTDAVNLQQLQAMGANVNSSGVVTNAFVSYDDTSKGKVTLGGSGSTKAVSLTNVAAG
FT                   VASADAVNMGQLKQMGATVDTSGNVTNSFVAYDDTTLGKISLKGTGGTTITNVKAGALT
FT                   SASLDAVNGGQLYQTNANVANVAGNLTNLTNVVNNITSGGGIKYFNAKSTLADSSATGT
FT                   NSVAIGGAANASATNSVALGANSVAGRANAVSVGAAGSERQIINVANATNSTDAVNLSQ
FT                   LQAMGANVNSSGVVTNSFVAYDDTSKGKVTFGGAGSTAPVLLTNLAAGAVTSTSSDAIN
FT                   GSQLYQTAASMAGALGGGAALAKDGTISAPAYEITGSTYNNVGDALAAVDTQLGDINTN
FT                   FSTNLKYVKIISQSNAAQASGSEAIAIGGNAMATGSSSLAIGAGATSKYDNSTAIGVNA
FT                   STDAPNTVSVGARGAEMRITHVANGINDTDAATVAQLSALQSKLLQTTQQSGVKSLLLG
FT                   AVPVTNYIAVSQNVTGGGSTSASNDLNAMAIGPLAAASGVGALAVGAGSIAGSDASTAV
FT                   GTGAAVGSVNSTAIGYSASVGVNSANSLAIGYNSRAQALNSLAIGTEASATSAGSIAIG
FT                   YGAFLNPSATNSMALGLNSSVSAANAVAIGYNAVADRANAVSVGSSKQQSQIINVAAGT
FT                   ANTDAVNLGQMNAAINAVAGGGSPNAVVYDTSAHMSVTLGSAGTPVKVSNVANGVANND
FT                   AVNVAQLTAMGGTINSSGVVTNSFVAYDDTTKGSITLKGASGTTITNVKAGSLTANSTD
FT                   AINGGQLYQTNANVANLAANVANITGNVTNTVNNIVNGGGIKYFHANSTLADSSATGTD
FT                   SVAIGGAANATAANSVALGANSVAGRANAVSVGAVGAERQIINVANATNSTDAVNLSQL
FT                   QAMGANVNSSGVVTNAFVAYDDSTKGKVTLGGVGSSMPVTLANVAEGQVTSTSKQAING
FT                   SQLYGTANSVASALGGTSSVGSNGNVTAAFSLDGKTYNSVATTMDALNAKIATGSTDGV
FT                   VYDTSAHNKLTLGGVNATTPVTVANVAAATSDDQAVNLAQLKAAGLNVDTSGNVTNSFV
FT                   AYDNTTRGTVTFNAGGAPTQLKNVAAGTDLTDAVNFGQMQSYVAQNGGGGTTNGVSYDD
FT                   SLRGKVTLGGVGSTTPVTLTNVAAGSAATDAVNYSQFSSLESQVNNLANGGAGSTTYVN
FT                   INTPASGGTAAVASGSDSIAIGNGASASGSESIAIGKNTVTTGDNSVAMGAGASAPNAN
FT                   AVALGTNSTTDRDNSVSVGSAGAERQITNVAAGTQGTDAVNLNQLNSAMGNMSNSINNV
FT                   DRNAAKGIASASALNIVTPYLPGRTTLNAGVANYRGYQSVGLGVSRWNEKGTINYNLGV
FT                   STSGGNSTIVRAGIGIVLGN"
FT   gene            141407..142525
FT                   /locus_tag="Bxe_B2907"
FT   CDS_pept        141407..142525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2907"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2907"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33088"
FT                   /db_xref="GOA:Q13S51"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S51"
FT                   /protein_id="ABE33088.1"
FT                   /translation="MKYSLIAIALVAMLAGCSSSTTRDQLQIQDPTVLQNGFSATQSQA
FT                   AGAVTPQWIATYGGAKNGAMLSAVQTRLNALGERKNNYFGDKAQCWLNAAAEERSSHDG
FT                   WGFVEEALSQANRLTTALESGQGLSADNPELRTASVLRPDLWKQVLAVKTSPLFPQCQE
FT                   AQRLTACSEVELIHAGHEAWTRDFDESKRLVDGVEKGMPGVAAALEACTPPPVAATVPA
FT                   VPQKMTLQADATFRFDRGDLAGMLPAGKAKLDELVRNLKQADDVTSIRIDGYTDRLGSD
FT                   SYNRQLSAKRAETVKRYLLSGGVTAPISARGRGKEDPVVQCNDHNREALIACLAPNRRV
FT                   ELDFVRAGARTSALPQNQRTQDQPELQGQQEH"
FT   gene            142878..143489
FT                   /locus_tag="Bxe_B2906"
FT   CDS_pept        142878..143489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2906"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2906"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33089"
FT                   /db_xref="GOA:Q13S50"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S50"
FT                   /protein_id="ABE33089.1"
FT                   /translation="MKRIVIIDDHPIIRGTIASVLRADPELDLIGTCGDGEEGLAMVLT
FT                   ENPDLVIIDLDLPRLDGLSLIRRIREKDTKICILVLSAKPEHIMAGYTRSAGANGYVGK
FT                   GREISELVTALKTVLFGYDCFPADSADAVAAASGLSALSAREVEVLQYLARGVSNRDIA
FT                   GRLSLSDKTVSTYKSRIQEKLGLSSLAGLIEFATSHRLID"
FT   gene            143502..144521
FT                   /locus_tag="Bxe_B2905"
FT   CDS_pept        143502..144521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2905"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2905"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33090"
FT                   /db_xref="GOA:Q13S49"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S49"
FT                   /protein_id="ABE33090.1"
FT                   /translation="MNPVSLSRSSSCTWNQTLGDLLDDSPLESRAFVLDETVTNLREVI
FT                   HGVVALLTPLAHRRDLRLRACVDQSVAETIRTDAARLGQLVFHLLNRTIQLTTHGEISL
FT                   AVRAQPVNLGSQRIYVSVVDTAVKFAPNALPPHPGPAIEDPQMARWLGDANACLPLCRI
FT                   LAQRMGGKLSVSSGTGEGPRAIFDAPFGVEQWAPSAETARGNVQASAFSSAAAQPREIS
FT                   ASDSFEPFDSRYLDALTEEGVDLQVFLNNWRDAMNEDLEQLSGLLREGRFDHLHDVLHR
FT                   LSGAVGLVGASSLMEALRRASTPPEEHSAASVEALLVRAKTLVTQLETTSRAYRSPSQ"
FT   gene            144518..145525
FT                   /locus_tag="Bxe_B2904"
FT   CDS_pept        144518..145525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2904"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2904"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33091"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S48"
FT                   /protein_id="ABE33091.1"
FT                   /translation="MNRPLALIEGDLALPIARPFDALPPPFGSRRRPVQTAAQPEPQAR
FT                   SRTAAQQAIQHAVQRREPGARRGPFPPGVKFLLFYKLPQQRDHSRRFDEQLAEARYYLE
FT                   TGRVRPRSTRSDHVLGAAIFAGCGIALAWLLATCTTHNADKAATAIARSAAVRPPAEFA
FT                   GTIAQSEPSAAHSAPKAAVSEAPASANATPGAVFGNVPTPEPQRAEHLVPRPSARVSAD
FT                   QTAPSRPAKANHEPSIARLSKPHVDGRLASSRMTNPATQPSASKSAEWTARSSSANETA
FT                   GRAALFDWAAQQRRAAMTTRAGMPAPGDTDWTARMTQRRITDNPDAFETARSTK"
FT   gene            complement(145631..148348)
FT                   /locus_tag="Bxe_B2903"
FT   CDS_pept        complement(145631..148348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2903"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2903"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33092"
FT                   /db_xref="GOA:Q13S47"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S47"
FT                   /protein_id="ABE33092.1"
FT                   /translation="MAHNLHKTLKEFDSGSGKGKFYSLPQLGRALDIKIDRLPVSIRIV
FT                   LESVLRNYDGKKIAEEHIEQLANWKPTASRVDEIPFVVSRVVLQDFTGVPLLADIAAMR
FT                   GVAKHMGKDPKSIEPLVPVDLVVDHSVQIDHFREKNALDLNMKLEFQRNNERYQFMKWG
FT                   MQAFDTFKVVPPGVGIVHQVNLEYLARGVHKKAEGADTVYYPDSLVGTDSHTTMINGIG
FT                   VVGWGVGGIEAEAGMLGQPVYFLTPDVVGVNLKGKLREGVTATDLVLTITELLRKEKVV
FT                   GKFVEFFGEGTRSLSLPDRATIGNMAPEYGATMGFFPVDEKTIDYFKGTGRTDAEISAF
FT                   QNYFKAQNLFGIPKEGDIDYTKVVTLDLGSVAPSLAGPKRPQDRIEIGNVKATFSDLFS
FT                   KPVAENGFAKKAEDLEAQYTTSNGVDVKNGDVLIAAITSCTNTSNPSVLLAAGLLAKKA
FT                   VEAGLTVAPHIKTSLAPGSRIVTEYLTKTDLMKYLDKLGFTLAAYGCTTCIGNAGDLTP
FT                   ELNEAITKNDIVAAAVLSGNRNFEARIHPNIRANFLASPPLVVAYAIAGNITRDLMTEP
FT                   VGKGKGGKDIYLGDIWPTSEEVNDLLKFALDPEAFRKNYSALTKKGDLWSKIEGEEGQV
FT                   YDWPKSTYIAEPPFFGKDFSMTPADSIAAVTNARALGIFGDSVTTDHISPAGSIKEDSP
FT                   AGKWLKENGVQKADFNSYGSRRGNHDVMMRGTFANVRIKNLMIPTKADGSRVEGGLTIH
FT                   QPSGEQLSIYDAAMKYIEAGTPTIVFAGEEYGTGSSRDWAAKGTQLLGVKAVVARSFER
FT                   IHRSNLVGMGVLPLQFKGSDSVQSLGITGEETYDIEGLGADFKPQQEVTLVIRGKDGKE
FT                   KRVQVLLRIDTPIEVDYYKHGGILPFVLRSLLAA"
FT   gene            complement(148394..149845)
FT                   /locus_tag="Bxe_B2902"
FT   CDS_pept        complement(148394..149845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2902"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2902"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33093"
FT                   /db_xref="GOA:Q13S46"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S46"
FT                   /protein_id="ABE33093.1"
FT                   /translation="MSAPISNVRPDPDQVLVDIVDYVLDYPVDSTLALETARHCLIDTL
FT                   GCGLEALTYPACTKLMGPIVPGTIVPNGAKVPGTSFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRSAIAAGKPPLAMKDVLIAMIKAHEIQGCIALENS
FT                   FNKVGLDHVLLVKLASTAVVGQLLGLTRDELINAVSQAFVDGHALRTYRHAPNTGSRKS
FT                   WAAGDATSRAVRLALIAKTGEMGYPSVLTAKTWGFYDVLFKGNAFRFQRPYGSYVMENV
FT                   LFKISFPAEFHAQTAAEAAMNLHAQLNAAGKRVEDIRKITIRTHEAAIRIIDKKGPLNN
FT                   PADRDHCIQYMIAVPLIHGRLTAADYEDSTAQDARIDVLRAKMECVEDPQFTKDYHDPE
FT                   KRSIANALTIEFNDGSTFDEVVVEYPIGHKRRREDGIPLLVEKFRTNLARRFPVKQQLA
FT                   ILDVSLDQARLEAMPVNEYVDLYVI"
FT   gene            complement(149871..150377)
FT                   /locus_tag="Bxe_B2901"
FT   CDS_pept        complement(149871..150377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2901"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2901"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S45"
FT                   /protein_id="ABE33094.1"
FT                   /translation="MKKLMIAAVIGALSTTMLSVATDAVAQTATTTKPATKAVPKKPQP
FT                   KRLIKRKPNPAKEAKVDPVPEGAEKWSCNEGLAFELKGDMKRDQIVTVHWANKNYNLPR
FT                   EATTTGADRFHDAATGMDLVVIPTKAMLFSDKDSSRLADECKTAAMIEGAPAPTQSNAI
FT                   NKTSN"
FT   gene            complement(150478..151665)
FT                   /locus_tag="Bxe_B2900"
FT   CDS_pept        complement(150478..151665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2900"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2900"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33095"
FT                   /db_xref="GOA:Q13S44"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S44"
FT                   /protein_id="ABE33095.1"
FT                   /translation="MSETTQTAGTPGGNEPKSGFKPKKSVALSGVTAGNTALCTVGKTG
FT                   NDLHYRGYDILDIASACEFEEIAYLLVHEKLPTQAELTAYKTKLKALRGLPANVKAALE
FT                   WIPAAAHPMDVMRTGVSVLGTVLPEKDDHNLPGARDIADRLMASLGSMLLYWYHYSHNG
FT                   KRIEVETDDDSIGGHFLHLLHGVEPSNAWVDAMHVSLNLYAEHEFNASTFTGRVIAGTG
FT                   SDIYSALTGAIGALRGPKHGGANEVAFEIQSRYQTPDEAEADIRRRVENKEVVIGFGHP
FT                   VYTISDPRNKVIKEVAKKLSKEAGNTRLFSIAERLESVMWDAKKMFPNLDWFSAVSYHM
FT                   MGVPTAMFTPLFVIARTAGWSAHIIEQRIDNKIIRPSANYTGPENLKYLPLNRRK"
FT   gene            complement(151826..152842)
FT                   /locus_tag="Bxe_B2899"
FT   CDS_pept        complement(151826..152842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2899"
FT                   /product="Lyase"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2899"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33096"
FT                   /db_xref="GOA:Q13S43"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040186"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="PDB:3R4I"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S43"
FT                   /protein_id="ABE33096.1"
FT                   /translation="MRALTPAEVLFDGEVPPAVLPACDHYAGSEKLMLKSLALQQQLGP
FT                   VFDITLDCEDGAQVGREAQHAELVASLLGSEHDRFGRVGVRIHDFDHAHWRDDVRLILR
FT                   AAKRAPAYITLPKIRHVHDAAEMVAFIEATRRELGIAQPVPVQLLVETHGALTRVFDLA
FT                   ALPGVEALSFGLMDFVSAHDGAIPDTAMRSPGQFDHPLVRRAKLEISAACHAYGKVPSH
FT                   NVSTEVRDMSVVANDAARARNEFGYTRMWSIHPAQIEAIVAAFAPRDEEITTATEILLA
FT                   AQSAQWGPTRYHDTLHDRASYRYYWSVLRRAQATGRAVPQDAAPLFTKVGTNVQAAS"
FT   gene            complement(153092..154075)
FT                   /locus_tag="Bxe_B2898"
FT   CDS_pept        complement(153092..154075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2898"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2898"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33097"
FT                   /db_xref="GOA:Q13S42"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13S42"
FT                   /protein_id="ABE33097.1"
FT                   /translation="MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP
FT                   QAQGAVKGVVMELDDCAFPLLSGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLS
FT                   ANAEIFTVQGKALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPKKNFTAMLRLDHNR
FT                   ALSQLAAKSGKPVASIEKLAVWGNHSPTMYPDFRVATAEGQDLTKLINDEEWNRNTFIP
FT                   TVGKRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNGKWVTMGIPSDGSYGIPEDIIY
FT                   GVPVTCENGEYKRVEGLEIDAFSREKMDGTLQELLEERDGVQHLLG"
FT   gene            complement(154106..154465)
FT                   /locus_tag="Bxe_B2897"
FT   CDS_pept        complement(154106..154465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2897"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2897"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33098"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S41"
FT                   /protein_id="ABE33098.1"
FT                   /translation="MSNKGLRVFSEAVPCSAATHRQPLCTMLFPRSSGFDFAAIRWPDA
FT                   CRNALFAGARIVQRLPGAVRMCHPAPTRLYRFPAWRSCRNAPLGLGRLRGSPRTVISAV
FT                   FHNASLNAHIEWRFP"
FT   gene            154580..155383
FT                   /locus_tag="Bxe_B2896"
FT   CDS_pept        154580..155383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2896"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2896"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33099"
FT                   /db_xref="GOA:Q13S40"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S40"
FT                   /protein_id="ABE33099.1"
FT                   /translation="MNSNPANTTNPNGQGAAGEGVPAAAAPATSPTFSPLYQQIKGLIT
FT                   QSLESGEWKPGEIIPSEVELAARYKVSQGTVRKAIDELAADNLLVRRQGKGTFVATHNE
FT                   DRAQFRFLRLLADDGAEHPHVSRLLECRRLRASADIARQLDLKPADPVVLIKRLLQFDG
FT                   EVTVLDEIWLPGAVFRGLTLERLSEYKGPLYAMFETEFGTRMIRATEKIRAVAAEPAVA
FT                   DLLHVPSGFPLLSVERVSYTYGDRPVEVRRGWYVTTGYYYQNDLS"
FT   gene            155541..155954
FT                   /locus_tag="Bxe_B2895"
FT   CDS_pept        155541..155954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2895"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2895"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33100"
FT                   /db_xref="GOA:Q13S39"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S39"
FT                   /protein_id="ABE33100.1"
FT                   /translation="MAEAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRLSGGLLFV
FT                   FLPFLLYLFDQSLTSELSFEVFKGFLSNIIVKLITLVLAWAFLFHFCAGIRHLVMDTHR
FT                   AVTKEGGKQTSVVVLVVSSLLTIAFALKLFGAF"
FT   gene            155959..156327
FT                   /locus_tag="Bxe_B2894"
FT   CDS_pept        155959..156327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2894"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2894"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33101"
FT                   /db_xref="GOA:Q13S38"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S38"
FT                   /protein_id="ABE33101.1"
FT                   /translation="MAANNRIGPKRLVVGAHYGLRDWLAQRITACVMAIYTVILLVWFF
FT                   GARDFSYEGWSSIFATQWMKLATFVTLLSLFYHAWVGIRDIWMDYVKPVGTRLFLQALT
FT                   IVWLLACAGYAAQILWRV"
FT   gene            156332..158107
FT                   /locus_tag="Bxe_B2893"
FT   CDS_pept        156332..158107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2893"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2893"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33102"
FT                   /db_xref="GOA:Q13S37"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S37"
FT                   /protein_id="ABE33102.1"
FT                   /translation="MAAIKNSLPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEYMCREAPNAVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKT
FT                   QFFVEWMALDLIRDAEGDVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARSGIALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSKGAEDPVNGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVKHVKEIKEHKPLPADAADFALSRLAKLDSSSSGEY
FT                   AQSVANDIRGTMQKHAGVFRTSALLAEGVERIREVADRVDNIHLKDKSKVFNTARIEAL
FT                   EVANLIEVARATMVSAEARKESRGAHAQDDFEHRDDENWLRHTLWFSKGDRLDYKPVHM
FT                   QPLTVESVPPKARTF"
FT   gene            158132..158836
FT                   /locus_tag="Bxe_B2892"
FT   CDS_pept        158132..158836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2892"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2892"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33103"
FT                   /db_xref="GOA:Q13S36"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S36"
FT                   /protein_id="ABE33103.1"
FT                   /translation="MAKRTFEIYRYDPDKDAAPRMQTYEIEIDSHERMLLDALLKLKAM
FT                   DETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDF
FT                   TQFFNQYHSIKPYLINDTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPD
FT                   KFVGPAGLLQAYRFIADSRDEATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAI
FT                   GKIKELMVRRAV"
FT   gene            158838..159110
FT                   /locus_tag="Bxe_B2891"
FT   CDS_pept        158838..159110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2891"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2891"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33104"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S35"
FT                   /protein_id="ABE33104.1"
FT                   /translation="MDDTSHQSDPLRRARLRWRARRGLLENDLIFERFFGRYEHDLSDA
FT                   DVGALTRLLELSDNDLMDLLLARKEPEGDLADPDVVRVLELLRNA"
FT   gene            159193..160494
FT                   /locus_tag="Bxe_B2890"
FT   CDS_pept        159193..160494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2890"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2890"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33105"
FT                   /db_xref="GOA:Q13S34"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S34"
FT                   /protein_id="ABE33105.1"
FT                   /translation="MTPSDVKATLSFSDNSPSVEMPIYKGTLGPDVIDIRKLYGQTGKF
FT                   TYDPGFMSTAACNSAITYIDGDKGELLYRGYPIDNLAENADFLETCYLLLKGELPNAQQ
FT                   NAEFVKTVTNHTMVHEQMHFFFRGFRRDAHPMAILVAAVGALSAFYHDSLDINNPRHRE
FT                   VSAIRMIAKLPTLVAMAYKYSIGQPFAYPKNDLSYSANFMHMMFSNPCEEYKVNDVLVR
FT                   ALDRILILHADHEQNASTSTVRLAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLE
FT                   EIGSVDNIPEFIKQVKDKNSGVKLMGFGHRVYKNYDPRAKLMRETCHEVLEELGLHDDP
FT                   LFKLAMALEKIALEDEYFVSRKLYPNVDFYSGIVQRALGIPTSMFTCIFAMARTVGWIA
FT                   QWNEMIADPEQKIGRPRQLFIGDTQREAKPIAQR"
FT   gene            160825..162234
FT                   /locus_tag="Bxe_B2889"
FT   CDS_pept        160825..162234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2889"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2889"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33106"
FT                   /db_xref="GOA:Q13S33"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S33"
FT                   /protein_id="ABE33106.1"
FT                   /translation="MAQTLYDKLWNTHVVHTEEDGTTILYIDRHLLHEVTSPQAFEGLK
FT                   LAERPVWRISANLAVSDHNVPTTDRSHGIADPISRLQVDTLDSNCDAYGITQFKMNDLR
FT                   QGIVHIIGPEQGATLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLLQKKS
FT                   KNMLVKVEGALPRGCTAKDIVLAIIGKIGTAGGTGYAIEFGGSTIRALSMEGRMTVCNM
FT                   AIEAGARAGMVAVDDTTIEYLKGRPFSPEGVEWNHAVEYWKQFKSDDGAQFDRVVELNA
FT                   AEIVPQVTWGTSPEMVTAVDGRVPDPDREKDPVKRDALERALKYMALEPNAPIESIKPD
FT                   KIFIGSCTNARIEDIRAAAYVVKKLGRRVAPNIRLAMVVPGSGLVKAQAEREGLDKVFT
FT                   DAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAI
FT                   EGHFVDIRKLG"
FT   gene            162488..163141
FT                   /locus_tag="Bxe_B2888"
FT   CDS_pept        162488..163141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2888"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2888"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33107"
FT                   /db_xref="GOA:Q13S32"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S32"
FT                   /protein_id="ABE33107.1"
FT                   /translation="MEKFIVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDE
FT                   WRYLDHGEPGQDNSQRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALEQYGF
FT                   RALIAPSFADIFYNNCFKNGVLPIVLTEQQVDHLFNETYAFNGFKLTVDLEAQVVRTAD
FT                   GGTEYPFEVAAFRKYCLLNGFDDIGLTLRHADKIRQFEAERIAKQPWLAHRIVG"
FT   gene            163293..164360
FT                   /locus_tag="Bxe_B2887"
FT   CDS_pept        163293..164360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2887"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2887"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33108"
FT                   /db_xref="GOA:Q13S31"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S31"
FT                   /protein_id="ABE33108.1"
FT                   /translation="MKIAVLPGDGIGPEIVKEAVKVLNVLGEKFELEEAPVGGAGYEAK
FT                   GHPLPDSTLALAKEADAILFGAVGDWKYDSLERALRPEQAILGLRKHLQLFANFRPAIC
FT                   YPQLTGASSLKEEIVSGLDILIVRELNGDIYFGSPRGVREAPDGLFAGSKEGFDTMRYS
FT                   EPEVRRIAHVAFQAAQKRGKKLTSVDKANVLETSQFWKDVMIDVSKEYADVELSHMYVD
FT                   NAAMQLVKAPKSFDVIVTGNMFGDILSDEAAMLTGSIGMLPSASLDKNNKGLYEPSHGS
FT                   APDIAGKGVANPLATILSAAMMLRYSLNKAEQADRIENAVKKVLEQGYRTGDIVTPGCK
FT                   QVGTVAMGDAVVAAL"
FT   gene            complement(164383..164655)
FT                   /locus_tag="Bxe_B2886"
FT   CDS_pept        complement(164383..164655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2886"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2886"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33109"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S30"
FT                   /protein_id="ABE33109.1"
FT                   /translation="MSGHDGRSAFRDRFRGNRFNGSFGGNGELNRTGRFAVQFRNRGDL
FT                   SCVRHRYNIHENRNPATSISAVIARIARESASFEANSRFKGRLTT"
FT   gene            164719..165840
FT                   /locus_tag="Bxe_B2885"
FT   CDS_pept        164719..165840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2885"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2885"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33110"
FT                   /db_xref="GOA:Q13S29"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S29"
FT                   /protein_id="ABE33110.1"
FT                   /translation="MNVGLVGWRGMVGSVLMQRMQQEGDFDLIEPVFFSTSNAGGNAPS
FT                   FAKNETKLKDATSIEDLKKCEAIISCQGGDYTNEVFPKLRAAGWNGYWIDAASSLRMKD
FT                   DAVIILDPVNLDVIKNALVKGQKNFIGGNCTVSLMLMALGGLFRENLVDWMTAMTYQAA
FT                   SGAGAQNMRELLQQMGTLYGAAKEDLADPSSAILDIDRRVLSAMNSDRMPTGNFGVPLA
FT                   GSLIPWIDKDLGNGMSKEEWKGGAETNKILGKPAMGTPGSIPVDGLCVRIGAMRCHSQA
FT                   LTIKLNKDVPLDEVNSILASGNDWVKVVPNEREASMRDLSPAVVTGTLTVPVGRVRKLA
FT                   MGGEYLSAFTVGDQLLWGAAEPLRRMLRIVLDK"
FT   gene            165980..168628
FT                   /locus_tag="Bxe_B2884"
FT   CDS_pept        165980..168628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2884"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2884"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33111"
FT                   /db_xref="InterPro:IPR020011"
FT                   /db_xref="InterPro:IPR038440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S28"
FT                   /protein_id="ABE33111.1"
FT                   /translation="MNLRLSSLRAMFVHRGAGQLMATAALAFALAGAGLGSAVAAPGDA
FT                   ASAPDAAAVSYANGGQVTVRAGQSLNDVAIAVTQSHDRATLARASRALFEANPNAFMSH
FT                   DPSRMRVGAVLTVPVLDASGALAASSAGAASAVSATAATTPASAPGTAVASGPASGVAQ
FT                   VNAAAASAVSAASAAARAATPAAPAVAATASVAAEASSAAPAAVVSSAPLVGSQAAALP
FT                   ASGAHEWAGSIQPSASEPAEGASAPGAATTAGTSAAQPASQPRAQVSSLQQLLALKNRV
FT                   LMELQKHGIGGTPAVTATAPTGVAQPAPGASSAAAAPGHVATPVASTSKDAGMSQTELS
FT                   VAAAVGAALVVLLAALRMGRRKRERVAAAEAVSTEGDSAVSARVTGQQDIASTREEIPV
FT                   HEAPDAADEAAVRNAAALAATEREAAEGEAAAREMAERVAAERDAEIRRAAAREAEEQA
FT                   AERAAEERAAAGRAAEERAAAERVAAEQAAAEHAAEERAAAERAVEEQAAAERAAEQQA
FT                   AAERAAEEQAAAKRATEQQTAAERAAEEQTATERATAEQAATERAAAEHAATQQPASGH
FT                   EATAHATFPTQDPATPQRVWQERDVTSASAEPAQVDPNIAPSAQSDFAPEPLPAPPLDH
FT                   FDDATMAASLAAAAELGAEALPLAPPEPLDEAFPHEEPVHRLQWDDEPAAPQEPLPEPA
FT                   APVHSQPAPTVPTEFPRDAVDAFGSLDMPLPPRVESSADHVHAPASLSTQPMSSQEATA
FT                   KQSAAEHHPDDTPHIADEISAGTAGHAAVAGLGAGLGTGLGAGLGASGFGALKLDFDLE
FT                   LPPGPAEPLPAFTQADLTRIARNKLDLATEYIELGDLSGARALINEVIETNDPATRTEA
FT                   RALLSTLAPLS"
FT   gene            168625..169437
FT                   /locus_tag="Bxe_B2883"
FT   CDS_pept        168625..169437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2883"
FT                   /product="tRNA pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2883"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33112"
FT                   /db_xref="GOA:Q13S27"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13S27"
FT                   /protein_id="ABE33112.1"
FT                   /translation="MKRIALGVQYDGSVFCGWQSQPHGNTVQDELERALREFAQTPVQT
FT                   IVAGRTDTGVHGLGQVVHFDTELDRADVSWVRGTNSFLPKTISVQWAKPMPDEFHARFS
FT                   AFERTYYYVLYVHPVRSPMLAARAGWVHAALDVDAMQAAAAHLIGEHDFSAFRSSQCQS
FT                   KTPVKHLYQIDVRQQGDFIHFRFRANAFLHHMVRNLMGCLVYIGRGRRPVEWMAEVLAS
FT                   RDREFAAPTFMPDGLYLAQVGYPEQFAVPAPQTGSVPWSTVWTEQAQT"
FT   gene            169434..170147
FT                   /locus_tag="Bxe_B2882"
FT   CDS_pept        169434..170147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2882"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2882"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33113"
FT                   /db_xref="GOA:Q13S26"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S26"
FT                   /protein_id="ABE33113.1"
FT                   /translation="MKSTENLARESSSGMEQLPAPHRTRIKLCGLSKPEDVAHAIDLGA
FT                   DAIGLVFYPPSPRSVSVAQAVELVRDVPPFVSVVGLFVNATPDWIREVVSNVGLTLLQF
FT                   HGDETAGQCESLAGVAGLPWLRALRVAADTQPADLVKSALSYSAASGLLFDTHVEGYGG
FT                   GGKVFDWSLIPAGLARRAVLSGGLSAQNVSDAIHCVRPYAVDVSSGIESPGAKGVKDHA
FT                   RMAAFVRAVRAADAE"
FT   gene            170208..171401
FT                   /locus_tag="Bxe_B2881"
FT   CDS_pept        170208..171401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2881"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2881"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33114"
FT                   /db_xref="GOA:Q13S25"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S25"
FT                   /protein_id="ABE33114.1"
FT                   /translation="MYNLPDERGHFGQFGGTFVAETLVHALDELRAAYGKYQKDPDFVA
FT                   EYERELKYFVGRPSPIYHAQRWSDMLGGAQIFLKREDLNHTGAHKINNVIGQALLAKRM
FT                   GKPRVIAETGAGQHGVATATIAARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVE
FT                   SGSRTLKDALNEAMRDWVTNVEDTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPEL
FT                   VGRQPDAVIACVGGGSNAMGIFYPYIDDASVKLIGVEAAGDGIETGRHAASLIGGSPGV
FT                   LHGNRTYLLQDENGQIIETHSVSAGLDYPGVGPEHAWLKESKRAEYVGITDEEALKAFH
FT                   DCCRIEGIIPALESSHALAYATKLAPTLPKDKYLLVNLSGRGDKDMHTVAERSGIQF"
FT   gene            171413..172318
FT                   /locus_tag="Bxe_B2880"
FT   CDS_pept        171413..172318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2880"
FT                   /product="Putative modification methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2880"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33115"
FT                   /db_xref="GOA:Q13S24"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S24"
FT                   /protein_id="ABE33115.1"
FT                   /translation="MRDEFDEPQPAIETVPAASAPAAGAPATLLPQVPAGIQLLNRDFL
FT                   SDVANIPDGSIDLILCDPPYGLGKDYGNDSDMRTGDDFLSWTRGWLELAIPKLKPSGSL
FT                   YIFCTWQYAPEIFSFLKTKLTMINEIIWDRRVPSMGGTVRRFTSVHDNIGFFAVSKDYF
FT                   FDLDPVRIPYDAATKKARSRKLFEGSKWLEVGYNPKDVWSVSRLHRQHAERVAHPTQKP
FT                   LEIVERMVLASCPKGGRVLDPFMGSGTTAVACARQQREFVGYEINESYCAIARERVSAA
FT                   AAPPVARRVKAKTQRQTEVQ"
FT   gene            172335..173180
FT                   /locus_tag="Bxe_B2879"
FT   CDS_pept        172335..173180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2879"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2879"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33116"
FT                   /db_xref="GOA:Q13S23"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S23"
FT                   /protein_id="ABE33116.1"
FT                   /translation="MLRSNSIREYSMSRIKNTFAALSAQGKKGLIPFMTAGDPDPARTV
FT                   EFMHALAAGGADVIELGVPFSDPMADGPVIQQSSERALAQGVSLRHVIADVKRFRETND
FT                   TTPVVLMGYANPIERMGTEAFARAAKEAGVDGVLVVDYPPEECANFAEQMRSAGIDPIF
FT                   LLAPTSTDERIAEVGKIASGYVYYVSLKGVTGAANLDVSSIASKIPAIKSRVPLPVGVG
FT                   FGIRDAQTARAVAEVSDAVVIGSRIVQLLEQAAPESAAATLTRFIAEVREALDSVATAR
FT                   "
FT   gene            173263..174135
FT                   /locus_tag="Bxe_B2878"
FT   CDS_pept        173263..174135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2878"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2878"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33117"
FT                   /db_xref="GOA:Q13S22"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S22"
FT                   /protein_id="ABE33117.1"
FT                   /translation="MSWLDKLLPPKIKQTDPKNRKGIPEGLWIKCPSCEAVLYRNDVEA
FT                   NLHVCPKCDHHMRIGARERLDGLLDPEGRYEIGQEIVPVDALKFKDSRKYPDRLKEAMD
FT                   DTDETDAMVVMGGAIHTLPVVVACFEFSFMGGSMGSVVGERFVRGAQNALEQKVPFICF
FT                   TASGGARMQESLLSLMQMAKTTAMLTKLAEARLPFISVLTDPTMGGVSASFAFLGDVVI
FT                   AEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLTKGAIDMIVDRRKLREEIAQLMALL
FT                   SHQPADAVA"
FT   gene            174431..175741
FT                   /locus_tag="Bxe_B2877"
FT   CDS_pept        174431..175741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2877"
FT                   /product="Folylpolyglutamate synthetase"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2877"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33118"
FT                   /db_xref="GOA:Q13S21"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S21"
FT                   /protein_id="ABE33118.1"
FT                   /translation="MTTFPTLDAWLTHLESAHPVGIDMGLARIAQVRDAMQLSFACPVI
FT                   TVGGTNGKGSTCAILESILLRAGYTVGCHTSPHLLSFNERARVNGEMASDADLLPHFEA
FT                   VEAARLSLAEPVTLTYFEFTTLAIMSLFASRGLDAVIFEVGLGGRLDAVNILDTDCAII
FT                   TSIDIDHTDYLGDTREKIAFEKAGIFRPGKPAICADPVPPQSLIDYAEKIGAQLWLFGR
FT                   DFRYEGQAGSERQQWSYVGPTMRRSALAYPALRGANQLINTSAALAGLEALRDRLPVSA
FT                   QDIRLGLANVELPGRFQVLPGKPAIVLDVGHNPHAAAVLTQNLGNMGFFPYTYAVFGAM
FT                   RDKDIAGLLTHLKGEIDHWCVTDLPTPRAASAEQLEAALREQGVGESADSSVTRYATPA
FT                   EAFQDALKRASENDRIVVFGSFYTVAGVMAYRKSQQH"
FT   gene            175771..176709
FT                   /locus_tag="Bxe_B2876"
FT   CDS_pept        175771..176709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2876"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2876"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33119"
FT                   /db_xref="GOA:Q13S20"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S20"
FT                   /protein_id="ABE33119.1"
FT                   /translation="MGIFSFGKKDDAPTRRGANTSSTRAARGERVERRTRRTERTVDAD
FT                   AMLLDPTLPEKQRARRRLVGAIAMVVAAVVILPMVLDSHPKPVTDDISIDIPSRPAPKL
FT                   AKAEEDTQAGVAPDNPTPDAALAASGLAPATAARQGQSAATKPPGADTNAAAPAARPAV
FT                   KPQAPSVAANTTPVAPAAPAKPAKPPVTHNAATAPAPATPAPTAQAPSSDDTNAAAGAD
FT                   ANSGTPASPPGSRFAVQLGAFANDTNARNWAAKLKAAGVPAYTEHRKQADGSTLTLLRA
FT                   GPFADRAAASAAIAKVREAGLMSGANSGAAQ"
FT   gene            176717..177211
FT                   /locus_tag="Bxe_B2875"
FT   CDS_pept        176717..177211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2875"
FT                   /product="Putative bacteriocin production related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2875"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33120"
FT                   /db_xref="GOA:Q13S19"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S19"
FT                   /protein_id="ABE33120.1"
FT                   /translation="MFTAFDYAVMAVIGLSALRGTWRGFLSEIFGLIGWIAAFFIACRF
FT                   VGYVVPLIPSNWPGGALTQWLLAFALVVIGVVLVASVLNALLSRIVQATGLSGVDRSLG
FT                   LMFGLVRGVILVLILVALAGLTELPQQEFWRNALLRPYAVEGVHVMKPLLPETLAAYVR
FT                   V"
FT   gene            177374..178924
FT                   /locus_tag="Bxe_B2874"
FT   CDS_pept        177374..178924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2874"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2874"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33121"
FT                   /db_xref="GOA:Q13S18"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S18"
FT                   /protein_id="ABE33121.1"
FT                   /translation="MCGIVGVVSHSPVNQLIYDSLLLLQHRGQDAAGIATANGSNFHMH
FT                   KANGMVRDVFRTRNMRSLPGTTGIGQVRYPTAGSASSEEEAQPFYVNAPFGIILAHNGN
FT                   LTNWQQLKDEMFRIDRRHINTNSDTEVMLNVLAHELQLSSSGLQLDPAALFNAVSGVHR
FT                   RVRGSYAIVSLIAGYGLLGFRDPFGIRPLCLGKQETAEGVEWILASESVAIEGIGFEFV
FT                   RDVAPGEAIFIDLEGNLHSQQCATNPSLNPCIFELVYLARPDSVLDGVPVYNVRLRMGD
FT                   YLAEKIRRELPDVAIDVVMPIPDSSRPAAMQVAKKLGVEYREGFFKNRYVGRTFIMPGQ
FT                   AVRKKSVRQKLNAMGIEFKGKNVLIVDDSIVRGTTSHEIVQMARDAGANKVIFASAAPP
FT                   VKFPNVYGIDMPTRGELVAHGRSDDEVARMIGADHLVYQDVDALKQAVRDINPALKEFE
FT                   ASCFDGNYVTGDVTTEYLDRIETARLAPSSQSDRDAASEALDGGGPARSQLHLQLSVG"
FT   gene            179237..180427
FT                   /locus_tag="Bxe_B2873"
FT   CDS_pept        179237..180427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2873"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.2.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2873"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33122"
FT                   /db_xref="GOA:Q13S17"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S17"
FT                   /protein_id="ABE33122.1"
FT                   /translation="MDDSLNFDTLAVRSGTVRSDFNEHSEAIFLTSSFVFASAADAAEK
FT                   FRNSEDNYTYSRFTNPTVSMFQDRLAALEGGEACMATASGMAAIMSVVMSALQAGDHLV
FT                   SSQALFGSTLGMFSQIFSKFGITTTFVDPTDLDAWKNAVRPETKMFFLETPSNPLTEVA
FT                   DIEAIGKIAKASNALFVVDNCFCSPALQQPLKLGADVVMHSATKFLDGQGRVLGGALVG
FT                   SKQFIMEKVFPFVRSAGPTLSAFNAWVLLKGMETLSLRVEKQSANALEIARWLETHPAV
FT                   NRVFYPGLESHPQHALAMRQQKAGGAILSFELKGDTPEQMRANAWRVIDNTKICSITGN
FT                   LGDTRTTITHPATTTHGRVTSEARAAAGISEGLIRLAVGLENAGDIRGDLERGLAG"
FT   gene            complement(180579..181358)
FT                   /locus_tag="Bxe_B2872"
FT   CDS_pept        complement(180579..181358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2872"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2872"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33123"
FT                   /db_xref="GOA:Q13S16"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S16"
FT                   /protein_id="ABE33123.1"
FT                   /translation="MSHAAVTAPSVSLRRYGAIEASDVHDFHQVVLGLDGAMVMTVDGV
FT                   AHQIDAGSAWLIPAGARHDYAGVGENRQLVLDLPASSLAVPERLFDRARAVAVDGSLTQ
FT                   LVHRIAAHAAGGVQGNDLDARRFHWDAAARLGAALVADAGTTAGAQAAGAGLDFARIDR
FT                   WLRAHLSEPVRIAELAAHCGFGMRRFHQLFIEAFGETPHRYLQRLRLDTSLTLLADPRL
FT                   SLTDIALDIGFGDQSAYTHAFTRRFGLAPGQWRALRH"
FT   gene            complement(181394..181732)
FT                   /locus_tag="Bxe_B2871"
FT   CDS_pept        complement(181394..181732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2871"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2871"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33124"
FT                   /db_xref="GOA:Q13S15"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S15"
FT                   /protein_id="ABE33124.1"
FT                   /translation="MSVTTESGLKYEDIVEGTGAEAVAGKTVSVHYTGWLTDGQKFDSS
FT                   KDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGTRKLTIPPQLGYGVRGAGGVIPPNATLV
FT                   FEVELLGV"
FT   gene            181921..182727
FT                   /locus_tag="Bxe_B2870"
FT   CDS_pept        181921..182727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2870"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2870"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33125"
FT                   /db_xref="GOA:Q13S14"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S14"
FT                   /protein_id="ABE33125.1"
FT                   /translation="MTTSSTGNAGEKPVPSGFAVSGRTALLRAETALFMRDHVLSLVSH
FT                   DLRGPLNAIHSWAYVLERKLDANDPNAQRAVTGIRNGVDQQVKLLETIVDATRAETKSL
FT                   VLAYAPFSLHPLLEETVEEVRSGLGRARGVEVTVDSQLATEQLNGDRERLAAALWLMLM
FT                   FAVETGAEGATVTLVTKADTNAWHASVGYEANGTALDDPALPHVLEAFARKQAREPREA
FT                   KRIAWVLALCKRVAEAHGGSFEQVDATGSDTATLALRVPLSATAAK"
FT   gene            182821..184164
FT                   /locus_tag="Bxe_B2869"
FT   CDS_pept        182821..184164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2869"
FT                   /product="Putative CorC/HlyC Co++/Mg++ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2869"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33126"
FT                   /db_xref="GOA:Q13S13"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S13"
FT                   /protein_id="ABE33126.1"
FT                   /translation="MIQVVALIGALFLVALNGFFVAAEFGLVKLRQTRVQSLAVGHGMR
FT                   GRLLGKVHGRLDAYLSACQLGITLASLGLGWIGEPAFAELLTPVFSLLGVESEKLIHGI
FT                   SLFFAFSCISFLHIVVGELAPKSLAIREAEKVSLWAATPLYGFYWAMYPAIWVLNTSAN
FT                   AVLKLARLDADHGHDSHYSTDELKLILRGRRANVATELGSPDGAYSQDEWNTIAHSLDF
FT                   SRMTVSDLMRPAYEMVGLRRDLPLRENMQVVARHRFSRYPLFEDASGERVAGMIHLKDL
FT                   LLARHAGSTLDDLSRYARPVQYVTPDLPALELFRRFRKGAPHFALVGHKGEKPIGFLTL
FT                   DNLLGALVGQIHDEFRQGDADWTRMDDGTLMGKGSLPVVSLERALGIDIDEGKAESVGG
FT                   LVIQALNDLPSEGQRVEFDRFDVVVKKMKGPRIVLVRVYPKAFDDEGG"
FT   gene            184266..184988
FT                   /locus_tag="Bxe_B2868"
FT   CDS_pept        184266..184988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2868"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2868"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33127"
FT                   /db_xref="GOA:Q13S12"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S12"
FT                   /protein_id="ABE33127.1"
FT                   /translation="MGYLLVLCVGLLAGMLSGVVGTGSSMMLMPVLVMLFGPQEAVPIM
FT                   AIAAIMGNFGKVLAWWREIDWRACGAYCVTAVPGAALGVRTLLALPPHAVEIALGLFFV
FT                   AMVPTRRWLARRAIKFSLWQLSLIGGVVGFLTGIVVSTGPITVPVFMSYGLVKGAFLAT
FT                   EAAGSLTVYASKVAVFNHFGALPLHVVIDGLITGSALMVGSFAARAIVVRMSPATFKLV
FT                   VDGLMLSSGLSLLWAAGR"
FT   gene            complement(185197..188055)
FT                   /locus_tag="Bxe_B2867"
FT   CDS_pept        complement(185197..188055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2867"
FT                   /product="maltooligosyl trehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2867"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33128"
FT                   /db_xref="GOA:Q13S11"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S11"
FT                   /protein_id="ABE33128.1"
FT                   /translation="MTVPRSTLRLQFHRGFTFDDAAKHVDYFAELGISHVYASPVTTAE
FT                   PGSMHGYDTVDYTQVSAECGGEAALKRLADKLRARDMGLIIDTVPNHMGVGGASNAWWL
FT                   DILEWGRHSAYARHFDVDWHSPDPALRGKVLLPTLGAPYGEELAAGRIALHFAADIGRF
FT                   YIGYGPHVFPVCPIDYPSILQSADRPDLTALAERFHGLTTQPTDHPRAAEGRDMLREFV
FT                   VQNGGSAIEFVLETYSPDDPVTRDRLHRLIERQHFRLAWWRTASDEVNWRRFFDISTLA
FT                   GVRVERPEVFEAVHALPFRLYQEGVVDGLRIDHVDGLAEPREYCQRLRQRLTELRDTAP
FT                   YVVVEKILGRGEPLRDDWPVDGTTGYDFMSDVGALLHDPAGAAPLAQTWTELTGRSGLF
FT                   ADEALAARRQILAENLAAELDRAARALHRIARDSLSTRDFTFTTLRRVLTELVVHFPVY
FT                   RIYPQNGLRSTADNVYFEQALEGARRSLSRADHVALERVNAWLGGSAEEAPTGRSGLPA
FT                   QPGQNGVPPSHAGSARRTAQTLFAQLTAPVAAKAVEDTACYRYGRLLSRNEVGSDPGEF
FT                   ALSVEQFHAANLERSQRFPHAMLATATHDHKRGEDVRARLAVLSEIAHEWSATLRAWST
FT                   LNAPHRRALDGKPVSSVGQDTSYDWAPGPAAEAMLYQTLVGCWPPDLQPDDEAGVKELT
FT                   ERVAQWQLKALREAKLQTNWLAPDEAYEAGCRDFLFDILAPQRRDGFLKELSAFVARIG
FT                   RAGALNSLQQTVLRLASPGIPDLYQGTELWDFSLVDPDNRRPVDFAKREAWLAQTPPSE
FT                   FLPGWHDGRVKLAVVQRVLALRAHLPELLSQSEYLPLAVRGKHASSVIAFARRHGNAWA
FT                   VVVASRLAAGLLGEEGDLPMVDPAKWEDTAVEMPSDLSARALFDWLSPAAPKVEENGLL
FT                   YLRDALASMPIAVLVEDGVPRS"
FT   gene            complement(188052..190262)
FT                   /locus_tag="Bxe_B2866"
FT   CDS_pept        complement(188052..190262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2866"
FT                   /product="Glycoside hydrolase, family 77"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2866"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33129"
FT                   /db_xref="GOA:Q13S10"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S10"
FT                   /protein_id="ABE33129.1"
FT                   /translation="MITRRHNDTIVNLAARAGFEVEWQDAHHTTQHVPENTLAVLLERM
FT                   GLPCGNATQIRQSSAVLEAELSGRKLPPLMTAEVGRGIALPAAAIRSGSHYRIELESGS
FT                   IIDGRFTAPKGEEALLAPIDEPGYHTLVINEQRVTLAVAPPRCYTVADAWRTLHDDGDG
FT                   HDKTAPPLWGIAAQLYGLRRIGDGGIGDYSALAQIAVESAKRGAHALAVSPTHAMFSAE
FT                   PNRFSPYSPSSRLWLNVTHIDPAAVFGTDAAHAALEAAQAGDAWSKLEDLPLIDWPGAV
FT                   VLKLKVLRALYEQFCVKERAQNTPRALEFHGFCERAGRALEDHARFEALQAAQLSQEGG
FT                   NGHWRNWSEALRDPRSPEVEAFAEANRHEVDFHLFLQWLAAKGLSHAQHAAREAGMAVG
FT                   LIADLAVGCDSAGSHAWSYRDDMLQGVSVGAPPDLFNQAGQAWGLTTFSPRAMRMQGFS
FT                   AFIDMLRAAFAHAGGIRIDHILGLRRLWLVPEGESARNGAYLRYPLEDLLRLIALESWR
FT                   HRAIVIGEDLGTVPPGFRERLEEHGIAGIRVLWFESAHDGKGFKPPRAWDRNAVGTTTT
FT                   HDLPTVAGWWRGSDITWRNRIGQTMARADGRDPEEAAQEERAKDRALLWHAFQQAGVAA
FT                   HDVPAPPPDSAPVDEALAFVAATPGPLVTFPLEDLLAQVEQPNLPGSIDEHPNWRRRVT
FT                   LPVDELFQDDTFCDRLLAVDRERRAAAASVPSSNAYSEPDTP"
FT   gene            complement(190259..192181)
FT                   /locus_tag="Bxe_B2865"
FT   CDS_pept        complement(190259..192181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2865"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2865"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33130"
FT                   /db_xref="GOA:Q13S09"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S09"
FT                   /protein_id="ABE33130.1"
FT                   /translation="MSESPIDPHAHHHAHCLPFGAQLIGATGAKPRTRFRFWAPSCKHV
FT                   QVEIENGPAQGAHDMTPAGNGWFEASVDSGAGTLYRFRLDGEHAVPDPTSRFQPQDVHG
FT                   PSEVIDPRAYRWQQTNWHGRPWEETVLYELHVGALGGYAGVQKRLPELAALGVTAIELM
FT                   PLNDFPGKHNWGYDGVLPYAPDSAYGRPEDLKALIDAAHGLGLMVFLDVVYNHFGPDGN
FT                   YLHEYARSFFREGTHTPWGPAIDFERSEVSDFFTDNAVYWINEYRIDGLRFDAVHAIDN
FT                   HAWLRELSDHIRARVQHGRHVHLVLENEHNSANLLETHFDAQWNDDAHNTLHVLLTGET
FT                   EGYYHAYEDQPIRRLARVLSEGFAYQGDPSPIHDGKPRGEASAHLPPTSFVMFLQNHDQ
FT                   VGNRAFGERLRKLTSDEALRAATGLLLLSPQIPLLFMGEEYGSTQPFLFFTDYTGDLAD
FT                   AVREGRRREFARFSSFSDEKRRAQIPDPNDVKTFAASSPPAPDETSQHTDAEAKDRLDW
FT                   MHFYKSALAVRARLITPRLKHSKACGATVLSAANGGDANALIARWKLGDGETLSIALNL
FT                   SKENVALADLPAGKVIFETPPRVREQVDVKVLPAHAFVAWLTGDVSGYAIRHDARIAGQ
FT                   QERHA"
FT   gene            complement(192302..194521)
FT                   /locus_tag="Bxe_B2864"
FT   CDS_pept        complement(192302..194521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2864"
FT                   /product="Putative glycogen operon protein GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2864"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33131"
FT                   /db_xref="GOA:Q13S08"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S08"
FT                   /protein_id="ABE33131.1"
FT                   /translation="MSHAMPDRLLPGSPYPLGASWDGLGVNFAVFSANAQKIELCLFDP
FT                   TGRKELRRFTLPECTDEVWHGYLPNAHPGTAYGFRAHGPYQPQHGHRFNPHKLLLDPYA
FT                   RKLVGQFRWSDALFGYRVHSNRADLSIDRRDSAPAMPKCVVIDEAFDWSHDKRPNVPWG
FT                   ETIVYETHVRGASMLRADLRQHERGTFAALASPEFIDHLLKLGVTAVELLPVHAFLNDR
FT                   FLVERGLRNYWGYNSAAFFAPEPSYLSTHRLDEMRIAVRQLHAAGIEVILDVVYNHTCE
FT                   GNEMGPTVSWRGLDNASYYRLIPGDERHHINDTGCGNTVNLPHPRVLQMVMDSLRYWST
FT                   AFNMDGFRFDLGVTLGREQHGFDPGSGFFDALRQDPILSQRKLISEPWDIGPGGYQLGN
FT                   HPPGFGEWNDRFRDTVRRFWRGDAGLRPDLAARLTGSADLFNRRFRKPWASVNFVTSHD
FT                   GFTLADVTAYEQKHNEANREDNNDGHNENCSRNWGVEGESDDPAILATRKRVARSLIAT
FT                   LLMALGTPMVLAGDESLRTQHGNNNAYCQDNELSWLDWARAESPDGRQMTAFVARVIAL
FT                   RKQHPLLRETRFLFGDREVLPGLFDVGWFDERGDPLTIEAWQDPEGRAFTLRRAGPGLN
FT                   GETEVLLMMLNANEKTLRFTPPAPHLEWHVLLDTAEPENAPHRLAVPEIEVAAHGLVML
FT                   AAQPVGEADWQAGWKPGPQHGPRLLTALPPDPGAHAPTNDASPTT"
FT   gene            complement(194628..196838)
FT                   /locus_tag="Bxe_B2863"
FT   CDS_pept        complement(194628..196838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2863"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2863"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33132"
FT                   /db_xref="GOA:Q13S07"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13S07"
FT                   /protein_id="ABE33132.1"
FT                   /translation="MSEHDPAAGLQPLDIDALVEARHPDPFSQLGLHHTDAGPVVRALL
FT                   PNAAHVSVISRADGALLGELEQLRPGLFAGRITSAAPYRLRIDWHGVVQEIEDTYSFGP
FT                   VLGDEPLGRLAGGDPYAVLECLGARPMEVDGVPGVRFAVWAPNARRVSVVGDFNAWDGR
FT                   RHPMRLRHQAGVWELFVPRVGPGTRYKYELLSRDGHPLPLKADPCAMQTEKPPGTASIV
FT                   AHVDEVEQFPWSDHEWIQSRAGKQTARSPISIYEVHAESWLRVAEEGQRGLDWEELAER
FT                   MIPYVKSMGFTHVEFMPIAEHPFGGSWGYQPLGQFAPSARFGKPEQFARFVDKAHEAGL
FT                   GVILDWVPAHFPNDAHGLIDFDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIAS
FT                   GLAWLKRYHVDGLRVDAVASMLYRDYSRAADQWVPNIYGGRENLESIAFLKRLNHEVGY
FT                   VPGVPGAITIAEESTAWPGVTARVEDGGLGFQFKWNMGWMHDTLHYMEEDPVYRQYHHH
FT                   NMTFGMVYAYSERFVLPLSHDEVVHGKGSLLGKMPGDRWQKFANLRAYFGFMWTHPGKK
FT                   LLFMGGEFGQLAEFNHDASPHWHLLDDSNHHGVQMLVRDLNRLYSDEPALYLLDCEPGG
FT                   FEWLIGDDSGNSVFAYRRTDGAGRELVVVCNMTPVPRLGYRIGMPRGGRWVEVLNTDAG
FT                   VYGGSNMGNGGLIHTDSQSSHGWPHSAALTLPPLATIVLRAD"
FT   gene            complement(196831..200295)
FT                   /locus_tag="Bxe_B2862"
FT   CDS_pept        complement(196831..200295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2862"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2862"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33133"
FT                   /db_xref="GOA:Q13S06"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S06"
FT                   /protein_id="ABE33133.1"
FT                   /translation="MKRDDPAQTTSQAHSSAATGGVAKARTHRRGKPAALSDDPLWYKD
FT                   AIIYQVHIKSFFDANNDGVGDFPGLIAKLDYIAELGVNAIWLLPFYPSPRRDDGYDIAD
FT                   YRNVHPDYGNLSDVKRFIQEAHARGIRVITELVINHTSDQHPWFQRARRAKPGSNHRNY
FT                   YVWSNTDQKYLETRIIFIDSEPSNWTHDPVAGAYYWHRFYSHQPDLNFDNPAVLREVLQ
FT                   VMRFWLDMGIDGLRLDAVPYLVEREGTNNENLPETHAVLKKIRATIDAEYPNRMLLAEA
FT                   NQWPEDVKEYFGDEDECHMAFHFPLMPRIYMSIASEDRFPITDIMRQTPDLAETNQWAI
FT                   FLRNHDELTLEMVTDSERDYLWNTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLL
FT                   LSMPGTPVIYYGDELGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGS
FT                   LYGFDAVNVEAQSRDPHSLLNWTRRMLATRRAKQTFGRGTIRFLKPENRKILAYLREMP
FT                   GEPPILCVANLSRAPQAVELDLSEFDGSVPIEMTADSVFPPIGQLTYLLTFPPYGFLWF
FT                   MLCPGGQRPTWAQAPSEPLPEFVTIVIREGQVGPTPENVRLLESEVLPSWLSRRRWFAS
FT                   KDQKLNAVRLAALTTIPNGGFAFTEIEADVGKHTERYVVPIAITWGGETTFPLFKQLAL
FT                   ARVRRGRNVGHLTDAFALPIFAHGVMRKLRERAVVPTVQKSEIRFLPTERFAELEGLGE
FT                   RPEIRWLAAEQSNSSLIIADAAVLKLVRRLVSGIHPEAEISRYLTQLGYANTAPLYGEV
FT                   VRVDPEGVPHTLCILQGYIDNQGDAWNWSLDYLRRSVDELAIAVDTETQSVPDRSNEAI
FT                   LVEGYSTLAGIIGRRLGELHVALASPTDDPAFAPEPASAEQVKAWVDGTQAMLASALDL
FT                   LAPRIEQMSDTETRALAQSLIDRRAALVAAVDSLVSANAGALRIRIHGDFHLGQVLVAQ
FT                   GDAYLIDFEGEPARTLEQRRQKSSPLRDVAGLLRSLSYASAAAQSTTEAAPQQTADRKR
FT                   ALFDRFRAHAAEKFLNEYRAAAAEAATPLVAPEAEQALLDLFLIEKAAYEIRYEAANRP
FT                   TWLSLPVRGLAALTSRLLGDTGAPGHDSSNQAPGAATPPNPAEGDYE"
FT   gene            complement(200292..203732)
FT                   /locus_tag="Bxe_B2861"
FT   CDS_pept        complement(200292..203732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2861"
FT                   /product="Putative alpha-amylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2861"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33134"
FT                   /db_xref="GOA:Q13S05"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S05"
FT                   /protein_id="ABE33134.1"
FT                   /translation="MESPNGYAPRIYFFHSLLVGPLDAWPAQFAHAAGLGFDHALIGSL
FT                   FEPGQAGHGQVVGNHARLHPVFEAQQPATEAIRTLANAAAQNGLTLLADLVIDRMAADG
FT                   ALYAEHADWFHPFESEEARLDPRHVHREDNVAYANFNDPGSSAALAGWWTQQLLTLADA
FT                   GVGGFRFDSPHRVPGAVWRQLRDAVRAKHPEVRFLAATPGLAREDLRGLEGAGFDSVFS
FT                   SVRWWDFRSSWMVEEHAALARIGAPIAFPEAPYGTRLAAELSDAHDAAIVERAYRRALF
FT                   ASVAIGTGWMMPMGFEYGITEPMSQTRGDASQFALAAQAKQFDLSERITHVNQVVRNTK
FT                   TLHANGELRPLSGPGAPAAILLRADQPDLRDAREAVLIAINPELGAPLRVDPARFLAGV
FT                   PGNFTRFVPLDAPANASPATLTPFTLAPGAVRLLRAVAEKPIRLAPPIDKANSKRSGRK
FT                   TVLEAINAPRVAIESVTPSVDNGRFAAKRTVGEHAEITAAIFAEGHDKIAAAVIWRAAD
FT                   ETAWHEVPMTPAEPAGLDIWKARIPLERLGRHEFTVIAWRDDFASLVEHIQKKLKAGQT
FT                   VELELDEAAHLFALVLAEVETSEGAVTAPLEHIVKEFTKADAETKLALLLAPTTARAMT
FT                   AARHRPFLSRDPVIYKIDADRTAARFASWYEIFPRSMSDDESRHGTFADVTKKLPRIRD
FT                   MGFDVLYFPPIHPIGVANRKGRNNTLNAQPGDVGSPYAIGGVEGGHTAVHPQLGTLDDF
FT                   KAMLAAAHEHGLEIALDFAVQCSPDHPWLKEHPTWFAWRPDGTLRYAENPPKKYQDIVN
FT                   PDFYAHDAKPDLWLALRDVFLFWIEAGVHIFRIDNPHTKPLPFWEWVIGDIRARYPDTI
FT                   FLAEAFTRPRMMNRLGKIGFSQSYTYFTWRESKRDFIEYMTELTQTGARDSYRPNFFVN
FT                   TPDINPRHLQSQGRTGFLIRAALASTLAGLWGVYSGFELCEAAALPNSEEYLDSEKYQL
FT                   RAWDWNRPGNIVGEISALNRIRRANPALQTHLGLTFLPAHNDNVLFFEKATESRDNVIV
FT                   VAINLDPFNEQGADIELSWETFQKWNLPDHGPLEVTDQMTGARFEWHGRWQHVQLGSGQ
FT                   PFSIWRIAPLGGLPAERPDEADSDYHADAGNPTPTEGAT"
FT   gene            complement(204200..204775)
FT                   /locus_tag="Bxe_B2860"
FT   CDS_pept        complement(204200..204775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2860"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2860"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33135"
FT                   /db_xref="GOA:Q13S04"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S04"
FT                   /protein_id="ABE33135.1"
FT                   /translation="MPGHPRPMVRVLAGWDAAIWSYLAMIWVYMAVADEGSVRESARRD
FT                   DENAGVVLMVICVATIASIAAIVLELASAKGTAGASTVWHYALTGLTMFGAWFLIPTIF
FT                   TQHYARLYYDPDLTETPLLFPDKALQPDYWDFLYFSFTIAVASQTSDVVLRSRSIRRAT
FT                   LAQSVLSFYFNVAVLGLCVNIAAGLLGS"
FT   gene            204865..205407
FT                   /locus_tag="Bxe_B2859"
FT   CDS_pept        204865..205407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2859"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2859"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33136"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S03"
FT                   /protein_id="ABE33136.1"
FT                   /translation="MVCERLRCRGFYSCCGRYLSNRQVTGYVFRNALACRFQLKGEWQA
FT                   AVFSPCVPCHAGGFIRMSSARRSPARIEFMRARKTARAAPDQVWGRGIDATRERHHAGT
FT                   VRQVENDSPSGVPMTDVPENNDAHHEVTHPAASLLLSSDSFSAARRAWVPGACAAAAPG
FT                   RANAAGPMAEVVTDSTQ"
FT   gene            205707..206465
FT                   /locus_tag="Bxe_B2858"
FT   CDS_pept        205707..206465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2858"
FT                   /product="Putative serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2858"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33137"
FT                   /db_xref="GOA:Q13S02"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S02"
FT                   /protein_id="ABE33137.1"
FT                   /translation="MPHYHGLMASVLVNPVEHHPANRSGRDFVVGDLHGCVDALRYLLR
FT                   VITFDPARDRLFSVGDLVDRGEHSELALALLDKPWFFAVLGNHEDMLCAVADGRVRRQW
FT                   WYGIGGLWAAQLSDERLQHYAEVLRGLPLARVVGSGKERFNVLHAEFFGTDAELDAGNF
FT                   SAETRQQLLWGRELALGNGDPQRQRGLSLTYCGHTPMRDIKQVGSQVFIDTGAFGPGGK
FT                   LTIVEPLALRRWSISVEEARAEGAAALALP"
FT   gene            complement(206497..207198)
FT                   /locus_tag="Bxe_B2857"
FT   CDS_pept        complement(206497..207198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2857"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2857"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33138"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S01"
FT                   /protein_id="ABE33138.1"
FT                   /translation="MTQPHWQDRWRTTQLDWAPAYRVIPTRFPAVNLFDRVASPEDFDA
FT                   LYALEAMTNDRLRTEVGELDLVPREERRFGPGYGPIMAALTHLNPLGSRFSDGTYGVFY
FT                   CARSRTTAIAETRYHTGKFLEATAEPPMRQQMRLYTVVAQGNVVDIRGDESVDLAVLSP
FT                   DDYLAGQSLGRAIREAGAPGIVYPSVRDDEGECLAAFSTTLLRDCHHAAYLEYNWNGKQ
FT                   VDIVFELNQVG"
FT   gene            complement(207195..207632)
FT                   /locus_tag="Bxe_B2856"
FT   CDS_pept        complement(207195..207632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2856"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2856"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33139"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S00"
FT                   /protein_id="ABE33139.1"
FT                   /translation="MAHAARATQAEEPIRRPSSAPTLTEMSAAGLRAFFNIARDWNLSA
FT                   EEQIVLLGSPGRSTYFKWKAAPETARLGRDTLERLSLLLGIYKALQILLPQASTADTWI
FT                   KRPNSAPPFGGRRALDRMLAGNISDLVAVRQYLDAMRGGWA"
FT   gene            207719..208393
FT                   /locus_tag="Bxe_B2855"
FT   CDS_pept        207719..208393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2855"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ9"
FT                   /protein_id="ABE33140.1"
FT                   /translation="MTVEDQEKQEMRVRAVAAGAALAVWCMSGAAVAAGYAEVWNPPEE
FT                   TGHTTKQAGKKTGPATTGGTSAVGSKGASKAAPQHMAGAGHAASSVASAHGNKPSAHAS
FT                   VKKVAASGITKSKTQAAGANKTQRKAAVMTQSKKPNAQVVQAKPGQGKVAQANLVPRRT
FT                   AHPPAAKVAAKSDAAKPAASGVNVPALSANPAPSTKVDANPANASSNPATASSGSLPPI
FT                   IH"
FT   gene            complement(208643..209494)
FT                   /locus_tag="Bxe_B2854"
FT   CDS_pept        complement(208643..209494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2854"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2854"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33141"
FT                   /db_xref="GOA:Q13RZ8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ8"
FT                   /protein_id="ABE33141.1"
FT                   /translation="MKVLDLDAVRAFVLVADLHSFTRAADALDTTQSAVSLKLKRLEAH
FT                   LGKPLLERTPRVVRLSADGNAFLNAARELLNAHERALGSLSVERRRLALGLSEHVAGPD
FT                   LPLLLGRLNAHDPGLVIELHLGTSAALLAQFDERRLDAVIIRYGADEPPRGDAQALFTE
FT                   PLGWLATPAWLPRVGEPLALALLSPPCNVRDVALRTLAQAGIGWQEVFVGGGVAAVGAA
FT                   VAAGLAVSPLARRVAPRGLVDVGPRLGLPLLPQSRVTLHSRVRDERSLETLRLVTNGLA
FT                   SA"
FT   gene            209596..209979
FT                   /locus_tag="Bxe_B2853"
FT   CDS_pept        209596..209979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2853"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2853"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33142"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ7"
FT                   /protein_id="ABE33142.1"
FT                   /translation="MPLTRIALRAGKPVEYRKALTESIQRSLVETFNVPKDDIFMLITE
FT                   HEAGNFVYDNQYLNVERSDDLVIIQITLNNTRTLEQKKTLYKRMADELAESPGLRREDV
FT                   FINLVEVLKENWSFGNGIAQYAL"
FT   gene            complement(210064..210858)
FT                   /locus_tag="Bxe_B2852"
FT   CDS_pept        complement(210064..210858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2852"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2852"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33143"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ6"
FT                   /protein_id="ABE33143.1"
FT                   /translation="MNIDLSGKTAIVSASTAGIGFAIATGIAASGARTIINGRKQDAVD
FT                   HAIEAVRKSAPQAELQGFAGDLGTPQGCDALIKAVPQADILVNNLGVFGPGDIFSTADD
FT                   DWERYFQVNVMSGVRLTRHYLKGMMERKWGRVVFISSESALNIPPDMLAYGFSKTAQLS
FT                   IARGIAKHAAGSGVTVNAVLPGPTLSDGLRAMVEETARQQGKTVEQVATEFVREHRGSS
FT                   IIQRAATTEEVANMVVYVCSPQASATTGAALRVDGGVIDTIA"
FT   gene            211062..211898
FT                   /locus_tag="Bxe_B2851"
FT   CDS_pept        211062..211898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2851"
FT                   /product="transcriptional regulator, ModE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2851"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33144"
FT                   /db_xref="GOA:Q13RZ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ5"
FT                   /protein_id="ABE33144.1"
FT                   /translation="MTLHRTDPSRETLELGGSVWFQAGAQTLGGASRIALLAAIGETGS
FT                   ITSAAKAVGMSYKGAWDAIDTMNNLAGEPLVVRLTGGKGGGGTTLTPRAVKLIETFRAV
FT                   EREHRRFLERAGAAIEGFATDWDLIGRIGVKTSARNQLYGTVSAITRGTVNDEVTLVLP
FT                   GGHAIVSVITHESTETLGLVEGAAAFALIKASWVVLFVDNQSGVPLKLSARNQLRGTVQ
FT                   SVKRGAVNAEVSLVLAGGAVITAVVTNESVDTLGLVEGGNAVAVFKASSVILGVKD"
FT   gene            complement(212011..212712)
FT                   /locus_tag="Bxe_B2850"
FT   CDS_pept        complement(212011..212712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2850"
FT                   /product="ABC molybdate transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2850"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33145"
FT                   /db_xref="GOA:Q13RZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ4"
FT                   /protein_id="ABE33145.1"
FT                   /translation="MLLAVDIRKTFQSAERRFTLDVAFQATSQRVVLFGPSGAGKSLTL
FT                   QAIAGLLRPDEGTITLHGNALFDSARGIDLKPQARRVAYLFQDFALFPHLNVRQNIGFG
FT                   LQHGWLNPRARISHPQIDYWLDALELKSVAGNHPAQLSGGQKQRVALARALVAQPRLLL
FT                   LDEPFSALDSALRERMRRELSELQTRLDIPMVLITHDPDDVAAFGDQVVQVSNGQVREN
FT                   QPFAGYARSEP"
FT   gene            complement(212714..213388)
FT                   /locus_tag="Bxe_B2849"
FT   CDS_pept        complement(212714..213388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2849"
FT                   /product="ABC molybdate transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2849"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33146"
FT                   /db_xref="GOA:Q13RZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ3"
FT                   /protein_id="ABE33146.1"
FT                   /translation="MQQAWIPLLLSLKVAGWATALNLVFGVAAGLGLSRWRSGARDVVD
FT                   SLLMLPLVMPPTVLGYYLLVLLGRRGLIGSWLDRFDIQLVFTWQGAVIASTVVAFPLVL
FT                   KSARAAFEAVDPQLEQAARTLGVSETAVFFRVTLPLAARGILAGGLLAFARALGEFGAT
FT                   LMIAGNLPGRTQTLSVAVYSAVQAGDDSTANFLVLVTSVTCVVILLLAGRLVPQHTLLK
FT                   SG"
FT   gene            complement(213411..214184)
FT                   /locus_tag="Bxe_B2848"
FT   CDS_pept        complement(213411..214184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2848"
FT                   /product="ABC molybdate transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2848"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33147"
FT                   /db_xref="GOA:Q13RZ2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ2"
FT                   /protein_id="ABE33147.1"
FT                   /translation="MTLARRLLKQALFVASAVSVAISANARADELVVSAAASLTNAFKA
FT                   VSEVFEQQHPGTKVLLNFGASDVLMQQIVKGAPADVFASADQKAMDKAVAEKVIVPASR
FT                   KDFAANSLVLIVPTDSHFTPTSLNDLASASVKRVAYGDPASVPIGRYAQGALQAAGVWD
FT                   AVSAKAVLASNVRQSLDYVSRGEVDAGFAFSTDAAIMPDKVKVAMNVPTQTPVTYPIAQ
FT                   VEGSRHAADAQAFINFVLSPAGQSVLARYGFKPAH"
FT   gene            complement(214319..215020)
FT                   /locus_tag="Bxe_B2847"
FT   CDS_pept        complement(214319..215020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2847"
FT                   /product="Putative phosphoesterase, PA-phosphatase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2847"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33148"
FT                   /db_xref="GOA:Q13RZ1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ1"
FT                   /protein_id="ABE33148.1"
FT                   /translation="MPDLPAHLWYSITNLGGAGLTLPLAFAIALWLAVGYTWRMAAGWL
FT                   ALLGAAIGIVTVTKLAFLGWGVGVRELDFTGVSGHAMLSTAVYPVVLFLMLLPARPAIR
FT                   LIGVLLGLAAGIAVGLSRVVLSAHSPSEAITGCLTGALAALVFVRLAWHAEPGRLSALP
FT                   VAASMMVLALVMHGVHVPTQRWVTHIALKVSGHDRPFIRAKWKAVRDVRPATAPLSQTL
FT                   NTLAPPHSSRA"
FT   gene            215391..216587
FT                   /locus_tag="Bxe_B2846"
FT   CDS_pept        215391..216587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2846"
FT                   /product="Esterase, PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2846"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33149"
FT                   /db_xref="GOA:Q13RZ0"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ0"
FT                   /protein_id="ABE33149.1"
FT                   /translation="MAKSLSKIWLRGLKRLLAIQTEHARTTTKRTTTRPARPASAKPST
FT                   KVRPLKPAAAVRAPAKREAPRAAARESRVRPRASAWASGSWTRSFHSAPAAPGRLVNHL
FT                   QYGLYVPAGQAPEAMPLVVMLHGCTQSIDEFAEGTRMNVLADRFGFAVVYPEQSKHVHS
FT                   HRCWHWYDASESAGGAEARAVVSLVDALVAQYGFDRERVYVAGISAGAGLTALLAVKYP
FT                   EHFAAVALHSGPAFGEAHSGITAMDVMRRGTRREPAELVDETADVANYPGMPAIIIHGD
FT                   ADHVVAPINADQLAVQFLRLNRIVDETGARKAGEVREERKGGVVMRDYVRGGRRIVRLC
FT                   RVQGLAHAWSGGDDAVPFHSAKGPDASGMVWEFFRHQRRTGAGHIAEGATTAATAGAR"
FT   gene            216697..216876
FT                   /locus_tag="Bxe_B2845"
FT   CDS_pept        216697..216876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2845"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2845"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33150"
FT                   /db_xref="InterPro:IPR021946"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY9"
FT                   /protein_id="ABE33150.1"
FT                   /translation="MYLLSRLFLFLTKSPDQLAKERADAFLAEATDLYDLEFRMRKLDR
FT                   EANVRQPSWMSQQH"
FT   gene            complement(217111..218610)
FT                   /locus_tag="Bxe_B2844"
FT   CDS_pept        complement(217111..218610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2844"
FT                   /product="deoxyribodipyrimidine photo-lyase type I"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2844"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33151"
FT                   /db_xref="GOA:Q13RY8"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY8"
FT                   /protein_id="ABE33151.1"
FT                   /translation="MTRVRRLNDTFDTGLVWLRRDLRNTDNAALYYALKHCERVWCVFV
FT                   FDTTILQPLVDAWHARHPDTQPQDRRIEFILAALGELDEALRADGGGLIVLYGNPAELV
FT                   PKLADELGVDAVFANHDYEPVAIERDGTVRERLAEAGRQWLTFKDQVIFERDEVLTGQS
FT                   KPFTVFTPYRNAWLRQLSAFDLKPYPVETYAKRLAALPSKFDRQLPTLEQLGFAPSNLG
FT                   ELNLPAGMSGAQRLLDDFMTRIDSYADRRDFPAAKGPSYLSIHLRFGTVSIRTLARLAH
FT                   EMSLQPDGQGSATWLSELIWRDFYFMILAHHPRLARGASFREEYDRLRWEQGLQADEAF
FT                   AAWCNGRTGYPLVDAAMLQLNRTGYMHNRLRMVTASFLVKDLGVDWRLGERYFAEQLND
FT                   FDFSANNGGWQWAASTGCDAQPYFRIFNPVTQSEKFDAEGRFIKRYLPQLAKLPSKWIH
FT                   APWLAGAERLADCGVVLGKDYPAPIVDHAEARARTLARFGK"
FT   gene            complement(218830..219249)
FT                   /locus_tag="Bxe_B2843"
FT   CDS_pept        complement(218830..219249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2843"
FT                   /product="Organic hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2843"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33152"
FT                   /db_xref="GOA:Q13RY7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY7"
FT                   /protein_id="ABE33152.1"
FT                   /translation="MNILYKASATSTGGRDGRAVSSDNALDVKLAAPRELGGTGAAGTN
FT                   PEQLFAAGYSACFLSAMKFVAGQHKQTLPADTQVTAEVGIGPNDKGGFALDIDLRVSLP
FT                   GLDANAARELVDAAHQVCPYSNATRNNVAVRLQIA"
FT   gene            complement(219424..219876)
FT                   /locus_tag="Bxe_B2842"
FT   CDS_pept        complement(219424..219876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2842"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2842"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33153"
FT                   /db_xref="GOA:Q13RY6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY6"
FT                   /protein_id="ABE33153.1"
FT                   /translation="MTQRPALPFTLDEQLCFALYSTSLAMTKAYKPLLDRLGLTYPQYL
FT                   AMLVLWESDDVTVKDMAARLNLDSATVTPLLKRLEAQGLVERVRGVDDERLVYIRLTKA
FT                   GSALKRQAREVPAEIFCATQQTPEFLLRLRDDLTRLRGTLNDYMDR"
FT   gene            complement(220049..220855)
FT                   /locus_tag="Bxe_B2841"
FT   CDS_pept        complement(220049..220855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2841"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2841"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33154"
FT                   /db_xref="GOA:Q13RY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY5"
FT                   /protein_id="ABE33154.1"
FT                   /translation="MQLIEVPAKAGYVWFRQGIWLFRKNPLAFLTLFFTYLLVMTLVSQ
FT                   IPVIGGVLPLAFIPGVAVGFMAACRNTIAGKPVFPTILVDGFHSYGPVVAKRLLVLGVL
FT                   YVVAMALVLAGSALADGGMLLKVMLGGATMDQDAIANSNIPLAVLTALALYIPVAMIFW
FT                   FSPILTAWHDVPPVKAMFFSIVSCWRNRGAFVVFGALWFAVAITVSLGLSALMQALGAG
FT                   DFAFAVLMPATMIVTTMLYCSFYATYRGCFGVQTPETPDLPTTPAA"
FT   gene            complement(220846..221841)
FT                   /locus_tag="Bxe_B2840"
FT   CDS_pept        complement(220846..221841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2840"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2840"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33155"
FT                   /db_xref="GOA:Q13RY4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RY4"
FT                   /protein_id="ABE33155.1"
FT                   /translation="MAVFTAVTEPQLAEWMRHYDLGDVVEFRGISSGIENSNFFLTTTR
FT                   GEYVLTIFEKLTAEQLPFYLDLMRHLAAHRVPVPDPMPREDGALFGLLQGKPAAIVTRL
FT                   EGAPELAPGVEHCIEVGQMLARMHLAGRDYPAYQPNLRSLPWWKETVPTILPFLEGGQR
FT                   ELLSSELAYQEAFFASADYAALPEGPCHADLFRDNAMFAHAEPGTGHEVRLGGFFDFYF
FT                   AGCDKWLFDVAVTVNDWCVDLATGKLDAARTEAMLRAYQTVRPFTAEENRHWGDMLRAG
FT                   AYRFWVSRLYDFHLPRAAELLKPHDPGHFERILRERLSGVALPGIHTSCN"
FT   gene            complement(222067..222462)
FT                   /locus_tag="Bxe_B2839"
FT   CDS_pept        complement(222067..222462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2839"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2839"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33156"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY3"
FT                   /protein_id="ABE33156.1"
FT                   /translation="MKPLLPVAVALALAFGNAAMAAQPVDDTPPPGAPQSANERAGLPD
FT                   LEKINRPAAEVSSKVEINVPRTPSFYERSPNGTEITEYRDKGKPVEINVHSNLGTRYQM
FT                   SAPLDTSPTVRDNGRASTRLPSVHLTY"
FT   gene            222655..224187
FT                   /locus_tag="Bxe_B2838"
FT   CDS_pept        222655..224187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2838"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2838"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33157"
FT                   /db_xref="GOA:Q13RY2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY2"
FT                   /protein_id="ABE33157.1"
FT                   /translation="MKMNNDTNQRAVQTPANSFPTESFEDATEAVTRLSAIYEANTSFL
FT                   RDAFARYRRNELFQSRVRACYPFVRVCTEVNTHIDSRRSYGFVAGPGVFETTVTRPDLF
FT                   GNYYREQLRLLAKNHHVQIEVGVSDQPIPIHFAFAEGIHLEGDLDRERLFLMRDVFDTP
FT                   DLALLDDRIVNGTYEPQPGKPHPLALFTAARVDFSLHRLKHYTATSPTHCQNYVLYTNY
FT                   QFYIDEFVKLGRTMMAHTDDEELRAYRSEYTSFVEPGDVVTYNENLGEQAQEGTAPPRL
FT                   PQMPAYHLKRADGSGITMVNIGVGPSNAKTITDHIAVLRPHAWIMLGHCAGLRNTQRLG
FT                   DYVLAHGYVREDHVLDDDLPLWVPIPALAEVQVALERAVAQVTQLDGVELKRVMRTGTV
FT                   ASVDNRNWELRDHREPVQRLSQSRAIALDMESATIAANGFRFRVPYGTLLCVSDKPLHG
FT                   ELKLPGMADQFYRAQVDQHLQIGVKAMELLRMNGLHRLHSRKLRSFAEVAFQ"
FT   gene            complement(224284..224814)
FT                   /locus_tag="Bxe_B2837"
FT   CDS_pept        complement(224284..224814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2837"
FT                   /product="Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2837"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33158"
FT                   /db_xref="GOA:Q13RY1"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY1"
FT                   /protein_id="ABE33158.1"
FT                   /translation="MNDTLISLAVIFSQLSLLAFGGGNTILPEMQRQVVDVHHWMPASE
FT                   FSALFALAQAAPGPNLMVVTLVGWHVAGWAGMLVTSVAKFGPSSLVTVLAMHAWERCKD
FT                   RPWRRYAQLGLVPVTAGVVAASAALIAEASNPTAIAWAITAFTAVMAIKTRIHPLWLLA
FT                   AGSLIGLTGIGQL"
FT   gene            complement(224811..225380)
FT                   /locus_tag="Bxe_B2836"
FT   CDS_pept        complement(224811..225380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2836"
FT                   /product="Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2836"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33159"
FT                   /db_xref="GOA:Q13RY0"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY0"
FT                   /protein_id="ABE33159.1"
FT                   /translation="MDHDPTSSEPALARPPTVWEIFGGFLGLGLISFGGALPLARRALV
FT                   EQRRWLSADKFTDLLGLCQFLPGGSVINLSVAVGMRFRGVPGALAGLLGLIAGPSLIVI
FT                   GLGVLYEHTQNDPHVRHLFAGLAAAAAGLLISMAVKILLPLRHKPVAALIAALGFIAIA
FT                   IMRLPLLPTMLVLTPLSIYIASRKAQ"
FT   gene            complement(225695..226438)
FT                   /locus_tag="Bxe_B2835"
FT   CDS_pept        complement(225695..226438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2835"
FT                   /product="Conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2835"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33160"
FT                   /db_xref="GOA:Q13RX9"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX9"
FT                   /protein_id="ABE33160.1"
FT                   /translation="MTKRKVIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLS
FT                   EIRPAVSIYGSARLKPNSPYYKLATQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKA
FT                   PSVGLNIELPHEQSGNQWQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELAEVL
FT                   TLIQTKKSRHVPIILVGAEFWEGLLAWFRNSLTPMGLINPADMDLMQVIDDPDQVLEAV
FT                   LKFYEDREEAEPQPTKSDEDRMFYL"
FT   gene            226440..229181
FT                   /locus_tag="Bxe_B2834"
FT   CDS_pept        226440..229181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2834"
FT                   /product="DNA polymerase A"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2834"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33161"
FT                   /db_xref="GOA:Q13RX8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX8"
FT                   /protein_id="ABE33161.1"
FT                   /translation="MPEERSLEGKTLLLVDGSSYLYRAYHAMPDLRGPDGGPTGALYGM
FT                   INMLRRMRKEVTAEYSACVFDAKGKTFRDDWYADYKANRPSMPDDLSRQIEPIHVAVRA
FT                   LGWPLLMIEGVEADDVIGTLSTEAEKRGMNVIVSTGDKDLAQLVSDHVTLINTMTNEKL
FT                   DRAGVLAKFGVPPERIIDYLSLVGDTVDNVPGVEKCGPKTAVKWLTQFDSLDGIVAHAD
FT                   EIKGAVGDNLRRALDFLPMAKKLVTVERNCDLTDHIVSIGESLQSQPESRAELREVFTR
FT                   HGFKTWLREVEIADAVEGPETDVPPALSVDHERHYDTVQTWEQFDAWLGKINAAELTSF
FT                   DTETTSLDPMIAQIVGLSLSVEAGRAAYVPLAHRGPDAPVQLPRDEVLARLKPWLESAG
FT                   HKKVGQHLKYDEQVLANYGIEMRGIEHDTLLQSYVVESHRTHDMDSLALRHLGVKTIKY
FT                   EEVAGKGAGQIGFDEVALDKAAEYAAEDADITLRLHQVLYPQVAAEKTLQYVYHDIELP
FT                   TSRVLRKMERTGVLIDSEKLRQQSSEIATRLIQLESEAYVLAGGEFNLGSPKQIGQIFF
FT                   EKLELPVVKKTPSGAPSTDEEVLQKLAEDFPLPKILLEHRGLSKLKSTYTDKLPRMVNA
FT                   TTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTGEGRRIREAFIAPAGHKLVSADYSQI
FT                   ELRIMAHISGDESLLHSFSQGEDIHRATAAEIFSVTPLEVSNDQRRVAKVINFGLIYGM
FT                   SSFGLASNLGITRDAAKLYIDRYFARYPGVARYMDETRVSAKAKGYVETVFGRRLWLPE
FT                   INGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVQKWIEESKIGTRMIMQVHDELIL
FT                   EVPDAELSDVRKRLPELMCGVADLKVPLVAEVGAGLNWEEAH"
FT   gene            229350..230699
FT                   /locus_tag="Bxe_B2833"
FT   CDS_pept        229350..230699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2833"
FT                   /product="Putative NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2833"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33162"
FT                   /db_xref="GOA:Q13RX7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX7"
FT                   /protein_id="ABE33162.1"
FT                   /translation="MHRFIVVGGGAGGLELATRLGDRYAPHKNKGAVRAQVTLVDRNPT
FT                   HIWKPLLHEVAAGSMDPFTQELEYAAQARWHGFEFQQGELTGLDRANRRLMLGTVLDDD
FT                   GAELLPERELEYDTLIIAIGSTTAFFGVKGAPEFSLALDTVSQAERFRKRLIAACMRAE
FT                   HQVHEPVESAPGTPSTDEPRIQVAIVGGGATGVELSAELRNTAQVLSAYGLHKLDPRHD
FT                   VGIVLIEAGPRILPALQERVSTATAELLTKLGVKLMTSETVAEVAPGLIRTASGKTVRA
FT                   DLTVWAAGIKAPAILSELDGLPVNRLGQLVVRRTLQTEIDDDIFALGDCAACPWPGNER
FT                   NVPPRAQAAHQQASFLMKALTARLDGRPLPEFTYRDFGSLVSLGHFSAVGNLMGGVIGG
FT                   NMLIEGLFARFMYMSLYRLHIAALHGYARMVLDTFAHWLRRTTLPRVKLH"
FT   gene            230803..231675
FT                   /locus_tag="Bxe_B2832"
FT   CDS_pept        230803..231675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2832"
FT                   /product="Dienelactone hydrolase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2832"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33163"
FT                   /db_xref="GOA:Q13RX6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX6"
FT                   /protein_id="ABE33163.1"
FT                   /translation="MLKPEIDSLVPHVPFDRRTFIKAALGTGFAAAVLPVSAQTIHTDS
FT                   DGLEAGEVAVRSGDTLVPAYRAQPKGRTHLPVIVVVHEIFGVHEHIADVCRRFAKQGYL
FT                   AIAPNLYERQGDPTVYTSMQQLNEQLVSKVPDDQVMGDLDATVAWAGEHGGDLNRLGVN
FT                   GFCWGGRIAWLYAEHNPRLKAGVAWYGRVTGAKNAMTPANPLDQVAQLHAPVLGLYGLQ
FT                   DQSIPQDTLEQMKQAIAQGPQAGRGSQFVVYDDAGHAFFADYRPSYKKADAEDGWRRAL
FT                   VWFKQHGVA"
FT   gene            complement(231794..232663)
FT                   /locus_tag="Bxe_B2831"
FT   CDS_pept        complement(231794..232663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2831"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2831"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33164"
FT                   /db_xref="GOA:Q13RX5"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX5"
FT                   /protein_id="ABE33164.1"
FT                   /translation="MPHTHYTTLISAANLAERLAAAPGSVFVIDCRFDLADPEAGEKAY
FT                   LAGHLPGAHYLHLDRDLSGPKNGQNGRHPLPDRARLVETLESRGLKQGQQVVAYDAQGG
FT                   MYAARAWWLLRWLGHDAVALLDGGLQAWEAGGYPLTQDAPAQNTGDFKAGAPLSVTVDA
FT                   QTVERNLGSKERVVVDARAADRYRGENETLDRVGGHIPGALNRFFKDNLTADNRFKPAH
FT                   TLREEFHALLAGTPPEHVILQCGSGVTACVNALAMEVAGLHGAALYAGSWSEWSSDPKR
FT                   PVATGPNP"
FT   gene            complement(233024..234130)
FT                   /locus_tag="Bxe_B2830"
FT   CDS_pept        complement(233024..234130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2830"
FT                   /product="Putative osmotic adaptation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2830"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33165"
FT                   /db_xref="GOA:Q13RX4"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX4"
FT                   /protein_id="ABE33165.1"
FT                   /translation="MSNLSNALQLRSVHSQLPVTAYFDEALLTREIDTLFKKGPRYIGH
FT                   DLMVPEAGNYFALPSESEGRVLVRNQQSQVELLSNVCRHRQAIMLNGRGQTENIVCPLH
FT                   RWTYDLNGQLLGAPHFADNPCLNLGATPLQNWQGLLFEAQGRNVARDLARLGTKEHFDF
FT                   SGFMFDHVEVHECNYNWKTFIEVYLEDYHVAPFHPGLGSFVNCDDLTWEFGDWYSVQTV
FT                   GVHKDLEQPGSPTYRKWHDEVLRFRGGNPPDFGAIWMVYYPGIMIEWYPHVLVVSWLIP
FT                   RGPQKTTNVVEFYYPEEIALFEREFVEAERAAYMETAREDDEIAERMDAGRRALMNRGE
FT                   SQVGPYQSPMEDGMQHFHEFLRRELGTI"
FT   gene            234415..234723
FT                   /locus_tag="Bxe_B2829"
FT   CDS_pept        234415..234723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2829"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2829"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33166"
FT                   /db_xref="GOA:Q13RX3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX3"
FT                   /protein_id="ABE33166.1"
FT                   /translation="MAKTASKDTAATPAEGVDTTPLPENYEAAQAELEGLVARMESGNL
FT                   SLEESLTAYRRGAALVAFCQQQLEKVEQQVRVLDGETLKPLPMNTAGTAATESGDDL"
FT   gene            234720..235601
FT                   /locus_tag="Bxe_B2828"
FT   CDS_pept        234720..235601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2828"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2828"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33167"
FT                   /db_xref="GOA:Q13RX2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX2"
FT                   /protein_id="ABE33167.1"
FT                   /translation="MTFEQWMRSVLERVETALDHYLPGEATEPATLHEAMRYAVLGGGK
FT                   RVRPLLCHAAGELTGARAECLDAAAAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVK
FT                   YDEATALLVGDALQSQAFVALTSDVLAPAQQAALVRELALASGSVGMCGGQAIDLASVG
FT                   HTLTRTQLETMHRMKTGALLRAAVRMGALAGETPDAAAMRSLDAYSAAVGLAFQVVDDI
FT                   LDVTTDSATLGKTAGKDAKDGKPTYVSIIGLDASRALAAQLRSDAHAALAPFGARAQRL
FT                   AELADLVVNRVS"
FT   gene            235687..237594
FT                   /locus_tag="Bxe_B2827"
FT   CDS_pept        235687..237594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2827"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2827"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33168"
FT                   /db_xref="GOA:Q13RX1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RX1"
FT                   /protein_id="ABE33168.1"
FT                   /translation="MYDLLKTIDDPAALRRLDRRQLQPLADELRAFVLDSVSQTGGHLS
FT                   SNLGTVELTIALHYVFDTPHDRIVWDVGHQTYPHKILTGRRDQMHTLRQLGGISGFPKR
FT                   DESEYDTFGTAHSSTSISAALGMAVASKLKGDNRMGIAVIGDGAMTAGMAFEAMNNAGV
FT                   EDDVPLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVLRVAPPMLDLAR
FT                   KLEEHAKGMIVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELRGPQFLHVVTKKGQ
FT                   GYKLAEADPVLYHGPGKFNPAEGIKPAATPSKKTYTQVFGEWLCDAAELDARVIGITPA
FT                   MREGSGMVEFEKRFPDRYFDVGIAEQHAVTFAGGLAAEGMKPVVAIYSTFLQRAYDQLI
FT                   HDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLYT
FT                   ALQQPNPTAVRYPRGAGTGVATIKQMTALPLGKGEIRRETSQPAGKRIAILAFGTMVAP
FT                   SLAAAEQLDATVANMRFVKPLDADLVRQLAETHDAIVTVEEGCVMGGAGSACVEALLAS
FT                   GVTRPVLQLGLPDRFIDHGDPAKLLAACGLDAVGITKSIRERFLLSGAVGGQSSVKRVA
FT                   "
FT   gene            237858..238664
FT                   /locus_tag="Bxe_B2826"
FT   CDS_pept        237858..238664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2826"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2826"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33169"
FT                   /db_xref="GOA:Q13RX0"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RX0"
FT                   /protein_id="ABE33169.1"
FT                   /translation="MNQMNPAFVMPDVQSTPDTRQIPIQRVGVKAVRHPLTVRTQGGEV
FT                   QPTVGTWNLDVHLPADQKGTHMSRFVALLEENKAPLEPATFRTMLAAMLEKLEAEAGRI
FT                   EVSFPYFVNKTAPVSGVQSLLDYEVTLTGETRNGATRLFLRVRVPVTSLCPCSKKISQY
FT                   GAHNQRSHVTINAELAGDVAVEELIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFV
FT                   EDLVRDVAQRLNADERIVAYVLEAENFESIHNHSAYAVIERDKRAG"
FT   gene            complement(238737..239765)
FT                   /locus_tag="Bxe_B2825"
FT   CDS_pept        complement(238737..239765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2825"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2825"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33170"
FT                   /db_xref="GOA:Q13RW9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RW9"
FT                   /protein_id="ABE33170.1"
FT                   /translation="MLVLGIESSCDETGLALYDTERGLLAHALHSQIAMHREYGGVVPE
FT                   LASRDHIRRALPLLEEVMERAGTAAGDIDAIAYTQGPGLAGALLVGASVANALAMAWDK
FT                   PTIGIHHLEGHLLSPLLVDEPPPFPFVALLVSGGHTQLMRVTDVGVYETLGETLDDAAG
FT                   EAFDKTAKLLGLGYPGGPEVSRMAEFGTPGAVVLPRPMLHSGDLDFSFSGLKTAVLTHA
FT                   KKLGGANICEQAKADLARGFVDAAVEVLAAKSLAALKKTGLNRLVVAGGVGANRQLREA
FT                   LSAAAKKRNFYVHYPDLSLCTDNGAMIALAGALRLQRWPDQSGKDYAFTVKPRWDLTSL
FT                   AR"
FT   gene            239890..241107
FT                   /locus_tag="Bxe_B2824"
FT   CDS_pept        239890..241107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2824"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2824"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33171"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW8"
FT                   /protein_id="ABE33171.1"
FT                   /translation="MESFDIAVIGAGAAGMMCAAVAGQLGRRVVLIDHSQRLAEKIRIS
FT                   GGGRCNFTNLYAGPANYLSANPHFCRSALARYTPRDFMALLKRHHVTWHEKHKGQLFCD
FT                   QSSDAVINVLKSECDAGRVAWRTPLSVEQVRQDAAGRFALDTRSGPITARALVIATGGL
FT                   SIPKIGATDFAYRLARQFGHKLIDTRPALVPLTFAAADWEPFSALSGVSLEVQLATGNK
FT                   KTGAEFNEDLLLTHRGLSGPGVLQISSYWQPGEPIHINLLPEQDATTALLEAKTGTKRQ
FT                   IGNLLSEWVPQRLAHVWLEAHQVPAEARVADLPDKTLRRVGEALSRWTLTPNGTEGYRK
FT                   AEVTRGGVDTRELSSSTMMSARAPGLYFIGEAVDVTGWLGGYNFQWAWASGVAAGQAAA
FT                   EYVQGA"
FT   gene            241176..241388
FT                   /locus_tag="Bxe_B2823"
FT   CDS_pept        241176..241388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2823"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2823"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33172"
FT                   /db_xref="GOA:Q13RW7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RW7"
FT                   /protein_id="ABE33172.1"
FT                   /translation="MTTIRVKDNEPFEVAMRRFKRTMEKTGLLTELRAREFYEKPTAER
FT                   KRKKAAAVKRHFKRLRGQMLPKKFY"
FT   gene            241638..242084
FT                   /locus_tag="Bxe_B2822"
FT   CDS_pept        241638..242084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2822"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2822"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33173"
FT                   /db_xref="GOA:Q13RW6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW6"
FT                   /protein_id="ABE33173.1"
FT                   /translation="MSLKDRINDDMKAAMRARETERLGTVRLLLAAIKQREVDERITLD
FT                   DTAITAVIDKMIKQRKDSISQFEAAGRTDLADKEKAELAILSAYMPEQMSEAEIVAEVQ
FT                   AAVAQTGAAGPQDMGKVMGVLKPKLAGRADMTAVSAQVKAALAK"
FT   gene            242165..244033
FT                   /locus_tag="Bxe_B2821"
FT   CDS_pept        242165..244033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2821"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2821"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33174"
FT                   /db_xref="GOA:Q13RW5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW5"
FT                   /protein_id="ABE33174.1"
FT                   /translation="MIPPSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAIGFLMEHVGSSFPEAVNELAQSVGLTVPNEPSPGYGG
FT                   GGSGGYAPAASKAVTTALSEVMQTACDFYRKQLRSAPVAIQYLKKRGLTGEIAARFGLG
FT                   YAPDGWQNLEAAFPNYRDDSLVESGLVIVSEKSDAQGQNRRYDRFRERIMFPIRNVKGQ
FT                   VIGFGGRVLDGGEPKYLNSPETPLFNKGSELYGLFEARLAIREQHYVLVVEGYMDVVAL
FT                   AQLGFQNAVATLGTACTPIHVQKLMRQTDTVIFSFDGDSAGRRAARRALDACLPHAADN
FT                   RTIRFLFLPAEHDPDSYVREYGTEAFAEQVERAMPLSQFMLNEVLTGKELDQPEGKARA
FT                   LFDAKPLLQALPANALRAQIMHMFADRLDVPFDEVAALCEVDSRIAAAARAAPARKDRR
FT                   SVTGIEEKTLRNLVMHPRTVAVLDEEAEQALLTVTRHGELFEEVTTHARALGDSAEFQL
FT                   LSDLLRNGANAPTFEEIFRKILDYDENVRDLLLKDPEDATVIEERREQERIVGEELKAA
FT                   ILKMRYDAYCDRLEQLSRQSRHTPEEFAELSELNRKRADMKRRLGL"
FT   gene            244486..246528
FT                   /locus_tag="Bxe_B2820"
FT   CDS_pept        244486..246528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2820"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2820"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33175"
FT                   /db_xref="GOA:Q13RW4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW4"
FT                   /protein_id="ABE33175.1"
FT                   /translation="MTKKLNEVPVDDDATQSEENPAAVPAKVEKAKARDRRAKEKALLK
FT                   DAFASSQPGTVEELEERRSKLRALIKLGKERGFLTYAEINDHLPDNFTETEAIEGIIST
FT                   FNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEDGLKHMVMAISACPTTIADILAMAERVANEEIRIDEL
FT                   VDGLIDANAEDADGFSAQEAEAIESEDEEVEEDSEEDEEEDDGTAQATANAAQMEALKR
FT                   ASLEKFAMISEWFDKMRRAFEKEGYKSKSYLKAQETIQNELMTIRFTARTVERLCDTLR
FT                   AQVDEVRQVERQILHTVVDKCGMPRAEFIARFPGSETDLEWADKIVGEGHAYSAILTRN
FT                   IPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVISIAK
FT                   KYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
FT                   IPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETP
FT                   IGDDDDSHLGDFIEDNNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIEMST
FT                   DHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
FT   gene            complement(246949..248352)
FT                   /locus_tag="Bxe_B2819"
FT   CDS_pept        complement(246949..248352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2819"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2819"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33176"
FT                   /db_xref="GOA:Q13RW3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW3"
FT                   /protein_id="ABE33176.1"
FT                   /translation="MTKHQTAPDGVESETGQLAEADWIARYVQTDGGGDLVHSIRDLIR
FT                   TGRLQAGARLPTVRVLAPLLGVSPATVAGAWSRLRDLGLIDTRRRGGTVVTDTGTRETA
FT                   RADSPDDHSWDLAQGLIDYALLPDLGQALLAGSREPSAHRASKEHAIPSLIAAVAPTWP
FT                   FRPEAWSTAGSGTEGTLLAIEAAVGEQRLLAIESPTSPRLLDICSTLGLELIAVECDGR
FT                   GPTPSSLRTALERRPAAFVYQPRAQVPLGHAVDAARLDELARLLHESPQTQIVEDDFIG
FT                   PLSLRSAPSMGALLPERTLLVRGYCNTYGIDLRTCVLAGSSRLIDRTRKLRSFGAAMNS
FT                   RILQGALAWLLTDTRTNAAVDHARQRYAARRSALRELLLARGMSAQGDDGLNLWVAVPH
FT                   EETAIVALAAHGISVASGSRCHVGPRTGEFLRVSTARLPDSAEALRRIADKFATLVNLQ
FT                   AGQSSRQLA"
FT   gene            248627..249043
FT                   /locus_tag="Bxe_B2818"
FT   CDS_pept        248627..249043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2818"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2818"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33177"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW2"
FT                   /protein_id="ABE33177.1"
FT                   /translation="MSEQRSATAKTIGVTGRYLVESRGNFFASDSPSARDGETAAVEPS
FT                   ELLLSALGVCALGSVEKAAREFELNVRHADATVDSLRDPDDRTRFARVHIEVTVYGVTQ
FT                   PQAQRLIDHFTSGCVIYNTVRRAGPISVAVTAHP"
FT   gene            249074..250375
FT                   /locus_tag="Bxe_B2817"
FT   CDS_pept        249074..250375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2817"
FT                   /product="Putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2817"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33178"
FT                   /db_xref="GOA:Q13RW1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW1"
FT                   /protein_id="ABE33178.1"
FT                   /translation="MARKPFHLAWFISRGFGPKAWRLPWGGPNPKGWTSPDLFVDLSRA
FT                   LERAAFDYVMIEDSSNIPYTYQNSHDIYLRYAVDSPKLDPAVLASFLIQATRRLGVVTT
FT                   LSTTEYHPFQLARLTNTLDHVSHGRAGWNLVTGSNDGGAQNFGLDRQYPHDQRYDMADE
FT                   YVDLVTRLWESWDADAVVMDQQNEIFADPSKVHPVHFEGQYFRSRGPLGAPRSPQGRPV
FT                   ICQAGGSPRGRQFAARWAETVIGTARSVASMKAFRDDIRAKAREAGRDPDSIKVLFLIT
FT                   PIVDESRENAEMRRRAQLEDASRHLDVHLASLSRTSGIDFSKFDLDEPLPELKSNGHQT
FT                   LVAQYSGRTLREISGTGKMLSDVNLVGTAQDVAARLSEVVDEVGGDGFLLMDPDLTRRY
FT                   IAEITDGLVPELQRLGVVRTQYEHEQFRDNLMAF"
FT   gene            250438..251706
FT                   /locus_tag="Bxe_B2816"
FT   CDS_pept        250438..251706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2816"
FT                   /product="major facilitator superfamily (MFS) aromatic
FT                   acid/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2816"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33179"
FT                   /db_xref="GOA:Q13RW0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW0"
FT                   /protein_id="ABE33179.1"
FT                   /translation="MYANQSIREPSAPGSTSLTRHAWVVIAIVTTFWIADGYDTFVLLV
FT                   TARPALADLLPHEASPFFARYLGYLVTITLAGWATGGVLGGVLGDRLGRRKVMLLGVVL
FT                   YSLATTASALTSTWQWLALARFLTGIGIGAEWGVGTSLLQETWPEKWRTRGAGLLQAGF
FT                   SVGGLLVSGLWILVGSSFGLSWRWMYLFGIVPLLIIFAVYRHIPESARWTQTRNEVSPL
FT                   ALFAQPYVRRRLLAALAVSVAITGGWWAVTSFLPTFVASLAHDPREAASLAGWAGALYN
FT                   LGEIVGCIAMGFLAEAWGRRPTTIVYLLGSLLIVPFVFAGLGSAKAVTVAQLVSGFFTG
FT                   GLYSWYAIHTPELFPTRIRATAISVIFSGARYLAMAGAIAAGTLAAALGGMGKVALWFA
FT                   PIYLLGAVAVLFLPETRGKGLPD"
FT   gene            complement(251746..252192)
FT                   /locus_tag="Bxe_B2815"
FT   CDS_pept        complement(251746..252192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2815"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2815"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33180"
FT                   /db_xref="GOA:Q13RV9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV9"
FT                   /protein_id="ABE33180.1"
FT                   /translation="MSEHGMDTQDITAIANYLRIVSHPSRLAIAMLLLEGPRAVSEIEL
FT                   ALGLRQPNLSQHLGVMRDAQVLTASRRAKSVVYDVADGPPRILMQALRQCAPVRTTAAP
FT                   LATPLVAQPAGAALDRKNSLNESDDGLMFAQVVQRQSTPSGPDN"
FT   gene            complement(252189..252893)
FT                   /locus_tag="Bxe_B2814"
FT   CDS_pept        complement(252189..252893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2814"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2814"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33181"
FT                   /db_xref="GOA:Q13RV8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV8"
FT                   /protein_id="ABE33181.1"
FT                   /translation="MDNIEEDFRAQRPPFLYEPAPDFEARSTMGMVSSADYRGKWLLFF
FT                   SHPADFTPVCTSELIAFARIAPRFKELGCELLALSIDGLYSHLAWLRSIQERFNMDIPF
FT                   PVVEDPSMAVAKAYGMLPPKAVSSSTVRGMFLIDPEGIIKAISWYPISTGRSVEEAFRL
FT                   FQAVRMTWQENLYAPADWQPGSPCVVPPPKTIEDASKRLSEGDVLDWYYQTRQIAQDAP
FT                   PERAPVKRGRRA"
FT   gene            253060..253995
FT                   /locus_tag="Bxe_B2813"
FT   CDS_pept        253060..253995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2813"
FT                   /product="Putative dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2813"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33182"
FT                   /db_xref="GOA:Q13RV7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV7"
FT                   /protein_id="ABE33182.1"
FT                   /translation="MNTIKSANFKTTPALVVPPLTPFDSSLKVDRAALATHIDYVVEGC
FT                   RATMVVAAGVETQEYHYLPFEERKALVRATVEAVDARVPVVVGISHPSIRSAVELGQLA
FT                   SSLGAHAIQLLAPLRPFGGAPSTAEVVRYFELIARETELPIMLYLNPGPGADLGPEATV
FT                   ELAKLERVKYVKESSRDLARVGRLIEQIDRAGHAQYLTTSQMLLITLQLGGSGATMPPP
FT                   LAELGAKIIAAFDAGNAAEAARLQQQFSLFPARWMHRGLMPTMKAALHALGRGIGEPYP
FT                   PFGTLTDDEAAQIATYLQSTDLSHVTENHA"
FT   gene            253988..254422
FT                   /locus_tag="Bxe_B2812"
FT   CDS_pept        253988..254422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2812"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2812"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33183"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV6"
FT                   /protein_id="ABE33183.1"
FT                   /translation="MLEIQRLSVAEAAILLEGARLKATELAIPMCTAVTDESGHLITFE
FT                   RMDGGKISSISIAIDKAFTGAVARKGTHVYNQLCVPGKGTFGIHVTNGGHFSIIGGGLP
FT                   VTVNGAIVGGVGVSSGTADEDLIVAEAAVAWFRERTGFAE"
FT   gene            254466..255644
FT                   /locus_tag="Bxe_B2811"
FT   CDS_pept        254466..255644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2811"
FT                   /product="Putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2811"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33184"
FT                   /db_xref="GOA:Q13RV5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV5"
FT                   /protein_id="ABE33184.1"
FT                   /translation="MSTITVNSSTALRGPLDFPDSPLSQAAKQPLMLGLFLPIQTGGFS
FT                   QSTYPRGTDWSFEYNRALALRAEAHGFEFAFGLQQWVPKGGFGGASHYRENFLDPFMAT
FT                   VALSALTRRLITISTVHILYGDLHPLHLARFAATVDHIAGGRFGLNIVTGYDAAEPRMF
FT                   GMERIVHDERYDRASEFASVLETLWAGEENLTHEGRFYRLEGAYVSPRPKYGRPIMVSA
FT                   SASRAGFEYASRHSDVVFTSSPAGAVFERAIEALPEHVAQIRAPYAGTGRDPKVIIFPM
FT                   IICKPTREEAFAYRDSIVAQADYESIRAYTARHSGGDAQGWKGHVPADRVLGGHIQIVG
FT                   SPTDVADALQKLHEAGFDGVQLGFYDYAPELEFFAQNVVPLLEARGLRSKAV"
FT   gene            255641..256930
FT                   /locus_tag="Bxe_B2810"
FT   CDS_pept        255641..256930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2810"
FT                   /product="Putative nitrilotriacetate monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2810"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33185"
FT                   /db_xref="GOA:Q13RV4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV4"
FT                   /protein_id="ABE33185.1"
FT                   /translation="MSTGLILNAVVLGVGMHPGAWRYRRDEAFSSLGLPFYRELGRTAE
FT                   AGCLHALFLADTLAVGEENFERPNLGAVDPLLALAAIADATTHLGLVGTASTTYNEPFS
FT                   LARRVSTLDHLSGGRAGWNVVTTFVPDVAANFGDAPLPAPASRYARAEEFVDVVRALWQ
FT                   SWSPRALVGDKAAGVFVDAAQVHVIDHRGEHFSVRGPATLPPSPQGSPVLFQAGSSEAG
FT                   RALAARTADAVFTAQNTLAGAQAFRADIRARARAFGRDPDRVAVLPGLLAVLGGTEAQA
FT                   RERKRELDALAGDAELRKLALRVGVPVDALELDKPLPFDAIRANTAFKGSEGFRRAALE
FT                   LGLQENLTVREILYRNGGGHLQVVGTPEQVAATIETWHREQGCDGFNLMIDVLPEGLAD
FT                   FTQHVIPHLQKRGLFRSEPVGTTLRSNLGL"
FT   gene            256939..257640
FT                   /locus_tag="Bxe_B2809"
FT   CDS_pept        256939..257640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2809"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2809"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33186"
FT                   /db_xref="GOA:Q13RV3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV3"
FT                   /protein_id="ABE33186.1"
FT                   /translation="MLQYTKTDDVARITFDSLTTSNAITYRMMNDYIAALAAARESRAR
FT                   FLLIDAKGADFTVGRDQKERVPDVTREQNLTLILKANAALRAFDGVSIALIQGRALGFG
FT                   SGIALHSTISIGADDAVLGFDEIHHGLAPLVVAAYAPYFIAPRIAQELVITGRAVPAEE
FT                   ARAIGLLSRVVPRAELERAGQALIESLQGYLPSALRLLRDYHEGVARYPDDATLGAAVQ
FT                   RLATWIEQGKP"
FT   gene            257670..258887
FT                   /locus_tag="Bxe_B2808"
FT   CDS_pept        257670..258887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2808"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2808"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33187"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV2"
FT                   /protein_id="ABE33187.1"
FT                   /translation="MLKEQIAATLLGLARIAAVAAATVSMAQAAQAAEAPYKLGYLVDA
FT                   SGPQSTTLKPTFDAFQLYIAQLNRAGGVNGRQVQIITRDIQSDTQRSLNAVEQLRSESV
FT                   SAVLGLGATNTHAPVYAAAQKLGLPVLASNPINIPIVLPPVKPYAFGLGQELTLAGIIG
FT                   GHFAHRLRPQGKTIACVAFEVPGSILSCNKILEQAKAEGYQRGELYTVPISQRDFRAVV
FT                   DRIVSLNPDVVADCIGREHLAALLPVLAASAYSGIFLSMDTGIGDKTLIDAVPANSKLQ
FT                   VYSFTRFVTHGDGAGPQASALRTALAAAHMPDDDASYAGGWALGLVVTDALRRCRGACG
FT                   PDALRAALENVDIDSGGLTGARLTFTPNDHYGPSAWRLYRYDAAGKSLSAVGGWQRIAS
FT                   DGKLTP"
FT   gene            258896..259771
FT                   /locus_tag="Bxe_B2807"
FT   CDS_pept        258896..259771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2807"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2807"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33188"
FT                   /db_xref="GOA:Q13RV1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV1"
FT                   /protein_id="ABE33188.1"
FT                   /translation="MNVWSFSLDLLSSAVTYALLALAVVLAWRTSRVLMFCVGEIGMTS
FT                   AYVMNGIARAAGGGVWGFALGVAGALVVAALIGWLLFALLRQLSAAGDYFVGTVVTIAV
FT                   SIFLTGLMSSVWSGETVQLPLPHPVLAWGGVTFSAVSACIVVIGAALIGVLLFAFYQSR
FT                   AGIELQAVAANWTLAVLSGIPAARWFAAVWIVASMLSAVGGISSGAISAVSISGAAVGF
FT                   SGIVAAIMGGLTSPAGALAGAFALALGENLTSLWFDARYSVAVPVVLLVLLLAMRPAGL
FT                   SGRVEHISRS"
FT   gene            259779..260810
FT                   /locus_tag="Bxe_B2806"
FT   CDS_pept        259779..260810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2806"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2806"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33189"
FT                   /db_xref="GOA:Q13RV0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV0"
FT                   /protein_id="ABE33189.1"
FT                   /translation="MSSLQSGALEPHTRTIFPRGAVQPALLAVAIAALAAPFALGGYGL
FT                   YIASSGGVMALGAMALTVLSGSAGLPSLGTAAFMAIGAFSAGILATQWGLGMLPALLLA
FT                   LVLGFAAGAGVALLTLRVSGLYLAVGTLALQHVVQIVATDLDLKFTYASGFMLESPHIA
FT                   GLAIDTPAKWWGMTIVLLLGVYVLFRSLQRGHVGREWALLRTEPTAAATLGVSPVRARL
FT                   TVFALTSAVIAASGAIDGYRLGNVQATGYSLHLAIMYLTVVALGGAGRLVGAVVASYAI
FT                   VVLPDAIAAVLATLGIDATTRLAGIDNMLLGALLVCALLDLPARARRAILRPGAASAAR
FT                   REP"
FT   gene            260807..261580
FT                   /locus_tag="Bxe_B2805"
FT   CDS_pept        260807..261580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2805"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2805"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33190"
FT                   /db_xref="GOA:Q13RU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU9"
FT                   /protein_id="ABE33190.1"
FT                   /translation="MTEAQLMEVRALSITYGVDRAVDHVSFAIARGTSLVLAGNNGAGK
FT                   TSVLGALAGLRLRGQRVSGEAVFGGVVLRMGDIAQRIRQGVRLVPDREKVFGLLSVADN
FT                   LRIGAARTRSNAIRLDDVLGWFPRLAERRGSLAGNLSGGEQQMLGIGMALLASPQLLLL
FT                   DEPTLGLAVPVIEDLCERLARLRREAGLTMLVAESDSQWLAALADTAAVLDRGRLLRTF
FT                   GTLSRGDLGTIHDLMLGLGANGDEADRPEDRHATV"
FT   gene            261567..262358
FT                   /locus_tag="Bxe_B2804"
FT   CDS_pept        261567..262358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2804"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2804"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33191"
FT                   /db_xref="GOA:Q13RU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU8"
FT                   /protein_id="ABE33191.1"
FT                   /translation="MQRSDPSIVLSLQRVNLSFGGLQVLRDVELCLQAGEVLALIGPNG
FT                   AGKSALLNCITGVYRPAAGSEIRLHDTRIDGLAPHRVARLGIGRTFQGLKLLRERTVLD
FT                   NILLGWTTRFSLGALGSLARPWRARREEREARERVYAMAELCGLAELRDVYCGELPLGV
FT                   LRRVDLARALLRDPDVLLLDEPASGLSHDERPLIGELVRIACQDAKRSVVWIEHDLDLV
FT                   LTEAHRAVVLHHGTVVTSDNPAQPSGRARLLTAYRKGRLTA"
FT   gene            262470..263552
FT                   /locus_tag="Bxe_B2803"
FT   CDS_pept        262470..263552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2803"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2803"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33192"
FT                   /db_xref="GOA:Q13RU7"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU7"
FT                   /protein_id="ABE33192.1"
FT                   /translation="MKKLNGLFGAVIAVFTVAAHAQSSVTLYGSIDEGVTYTSNIKGHG
FT                   TASVGPVAVPDFYGIRGSEDLGGQFKAIFALQNGFLSSTGAGTIAGEAFSHFAWVGLSS
FT                   NRYGALTLGRQLDLTTETLRLDSDGSVQYTFYLFHPANLDNLGIRGDSINNSVKYATAD
FT                   FHGLKAAVLYGFDDTSTQPGRVVSADVIYTNGPLRASAVYSSWRNHSIDVGSQLGYASF
FT                   LGQSLAKGSVFLAKKQDIGGLSATWSVNQNLALHGVLTQVNLSSDYGSGRMRTVELGAD
FT                   VHTSVANMVTLGGYASWLTGTRYTEVGVGDVYSLSKRTIVYAQAVYQHAQGSGNAAIPL
FT                   LSPSNSPNQTALRVGVHQFF"
FT   gene            263646..264284
FT                   /locus_tag="Bxe_B2802"
FT   CDS_pept        263646..264284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2802"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2802"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33193"
FT                   /db_xref="GOA:Q13RU6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU6"
FT                   /protein_id="ABE33193.1"
FT                   /translation="MSLRLGDIAPDFERQSSVGPIRFHEWLGDSWGVLFSHPADFTPVC
FT                   TTELGLTAKLAGEFEKRNVKTIALSVDSAESHKEWIKDINETQAANVGFPILADGDRKV
FT                   SELYDMIHPNANETLTVRSLFVIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQLTDSH
FT                   SVATPGNWKQGDDVVIVPSLKDEEIIKQKFPKGYKALRPYLRMTPQPNK"
FT   gene            complement(264292..264858)
FT                   /locus_tag="Bxe_B2801"
FT   CDS_pept        complement(264292..264858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2801"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33194"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU5"
FT                   /protein_id="ABE33194.1"
FT                   /translation="MRSHTINLLDNKEHDSMRNLHPHAMDLNGYPGNRTRPMRHAAWRI
FT                   GLRVWGFAESEVNAWIRDLPVLDGSLCWEIAHQRDGSGADMIIHLVRSSSPALGSFCWN
FT                   SVGANDAIRASRWSSRVEMALFSGDVTRLPQVRYGLWAMAGTRPAESALHTLAQAVIVP
FT                   QFLRRRVTQGTGAVRVVPRRLALVR"
FT   gene            complement(264963..265964)
FT                   /locus_tag="Bxe_B2800"
FT   CDS_pept        complement(264963..265964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2800"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2800"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33195"
FT                   /db_xref="GOA:Q13RU4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU4"
FT                   /protein_id="ABE33195.1"
FT                   /translation="MECHIDLHNTVIQRRVPRDGRAAKHIGIAVFNGFSLLDTVSIVEA
FT                   FETANRFAEASRHDAPRYVVRLLSSAGGRIASSSSVFVWTDSVEARGHAHDFHALFIAG
FT                   GTGVHDAARDGRLLAWLRRTHLRSENVLSIAEGQFLLEAAGFASSAGIGSARGLVPRHY
FT                   FRRETDPATQREVSSPLESALNLIEADLGTEITCKAAASLAPRASTQFTSVLNRNASGS
FT                   VSDKIRASAQWLEANGHQPISIDRAAGIAAMSERNFLRRFKAEIGVTPSGYLLYVRLDM
FT                   SCRLLVETALPVDKIARRCGFGDGGQLARLFRKHMGTTPSEYRNSHRQPHDR"
FT   gene            266423..267271
FT                   /locus_tag="Bxe_B2799"
FT   CDS_pept        266423..267271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2799"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2799"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33196"
FT                   /db_xref="GOA:Q13RU3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU3"
FT                   /protein_id="ABE33196.1"
FT                   /translation="MAILDIEVISMQEERLQQAVAWLREADGLLITAGAGMGVDSGLPD
FT                   FRGNEGLWRAYPALAEAGCDFQSIANPRAFMDKPELAWGFYGHRLKLYREVEPHPGFAI
FT                   LRRWGDRLRQGAFVFTSNVDGQFQRAGFAESRIEECHGSIHYLQCTEPCFSLIESATDF
FT                   VPSIDERECRCIGPLPRCKRCGAISRPNILMFWDSAWLSSRADAQAARLAGWLRTVERL
FT                   VVVEVGAGTALPTVRRFSERHGPRVIRINAREAQIDPARGVGIEGRAVEILTAIDSGLD
FT                   V"
FT   gene            267596..268354
FT                   /locus_tag="Bxe_B2798"
FT   CDS_pept        267596..268354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2798"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33197"
FT                   /db_xref="GOA:Q13RU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU2"
FT                   /protein_id="ABE33197.1"
FT                   /translation="MQITDTQAMQIVGFRSAYAYPAAHLVLDDHAGDFGLPGGQWAKVV
FT                   TPAQGDVTDAALDAYHERLLRSANPTERLLGTASIVFWGFYTFGPAFAAIRVHRHLFGR
FT                   GNQQITRAEQIADVLEEADTAIKAGNPGAALGMFTGINQLSRTPFASKVVALLDPRRAA
FT                   VYDNRICKGLRSSPWAANGPFANGVGSVQLRRVQREYANWCSFTQAIAEQMNEGCSRGL
FT                   AWHWRDRRDAPQSWRAIDAERAIFAMFQPD"
FT   gene            268591..269610
FT                   /locus_tag="Bxe_B2797"
FT   CDS_pept        268591..269610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2797"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2797"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33198"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU1"
FT                   /protein_id="ABE33198.1"
FT                   /translation="MDTLDSKIISVLPNAGGNAGFLSTPGVHKKLEVIESDVPVIKTVQ
FT                   RRLEKLHLEGLVEMEKRGAAWFWRKGAGAGGMAGKSGSIMTREEALALHVLRSFTSRQI
FT                   PTLVAEALSDLFKVADKRLEAAVTEDERRYSRWADKVAVEHSGFALRYPQIDPEIFGTI
FT                   SQALFHERKLEILYRPRSNVTNDKCKVILPLGLVEVGGLVYLIGGTEGRSNPTMYRLDR
FT                   LASANMMLESFSYPRSFKLDDYVKQQRQFDFMVEGEVTLKLRFVNGAGDHLLETPFAAD
FT                   QETRQTSTGLEVQGTVLLSQRLRWWLRSFGPYVEVMEPEKLRAELADEAHALAALYRR"
FT   gene            complement(269720..270082)
FT                   /locus_tag="Bxe_B2796"
FT   CDS_pept        complement(269720..270082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2796"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33199"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU0"
FT                   /protein_id="ABE33199.1"
FT                   /translation="MLVFKRPAANGTLPGRHRNSSSQCGIQNQLIYKYAVQIKSELRSL
FT                   YLPYSYGIPHYLLETITPIHHGEKSKSTFWLRCIIHSPPHRKWRVTEKANMLADYYIRP
FT                   LHAGRIDGARSSAPCR"
FT   gene            270091..272469
FT                   /locus_tag="Bxe_B2795"
FT   CDS_pept        270091..272469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2795"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33200"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT9"
FT                   /protein_id="ABE33200.1"
FT                   /translation="MGGNLFGHEPRVGRKTLALAAALSFSTSAHAVDPALNALGQAGGL
FT                   VIPYGFALPQGVGEVQYNDFIDPRYGKAATGSQIYWGAVGLFPYVELSGGLANYPANVG
FT                   VPLSHEEHFVLRHLMADVKLEVPKFFKYQPSIAFGVTDIGGQTHFFRSKYGVVSQAFGP
FT                   VTLTAGYGQGDRLDGLFGGAQVSLWNTGLSLLAEDDSRTPYAGVRYQSPRISWLADANV
FT                   IGTFMRSIRSTDGVSPRTSFSVAIQIPLGRRFSSTRCADGLCEGPQLPATQTANADDGG
FT                   PIRLASLQPVNTRAAAGNGGALAAAPITYVPPLQSYASVMLSDVTAAGSPDVRSPVVPE
FT                   ALNASALDEIAAQLFAAGLERVRVGMSGRDLVVEYENHRYNQNEADALGIVLGVASMNA
FT                   PHGTNRIHVVIKKANEPLGEVIVDRDAFAQFVEGGAPTAASTSLTMRTRPTYDADSIAW
FT                   HGNEHTHGLTRIQIEPIVSYLYGTEYGNFDISLGANIQGFVPLWRGAELYASYIAPIYN
FT                   TKNMDEGRVFSDYRLRGGLNAVALAQSFWIMPRVFNVASVGKFDYSYVGVQNETTVFVP
FT                   GRPDLIRLRLAYLHHEPGHDELPGEKNAELTYRWVQPSWKLWIEAGVARFVGGDKGPVA
FT                   TITRWFDDVSVSVHGEHSGQGTFVGAAISFPLTLRQGMKPGISQVYGAEQFGLDFRTRV
FT                   GSTNFLSPNAAENMTFPYSTQQYLLNQGRFSGEYFSTQLYRMRDAYLRYGRPGSDETKP
FT                   KQQVSAPAISAGSTLSRRLCGRGLQGVDDGPALAPVNCE"
FT   gene            272489..273205
FT                   /locus_tag="Bxe_B2794"
FT   CDS_pept        272489..273205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2794"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2794"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33201"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT8"
FT                   /protein_id="ABE33201.1"
FT                   /translation="MKLLNGAALRTLQFGSIVLATSALVACGGGGDSPGATVSGTAAVG
FT                   QPLANAGIVLTCKNGAGSATANASGAYSATFHFDGPCAITASSGSTVLHSFAAGAGTYN
FT                   VTPLTELLLSYLAGQLGTTVSGLLSGISSNATYQGVLSNSTVVANAQAAVAQLIKTQYG
FT                   VTLSSSSFLTVSFAPGQPPDIDLDSLQTAGAITASGQPAPSLTTAVVGAGAAAPISGGG
FT                   NGGGATGGTGGSGGAT"
FT   gene            complement(273307..273615)
FT                   /locus_tag="Bxe_B2793"
FT   CDS_pept        complement(273307..273615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2793"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2793"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33202"
FT                   /db_xref="GOA:Q13RT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT7"
FT                   /protein_id="ABE33202.1"
FT                   /translation="MGEFIPEYLIREQAALGALVLFGVLRIVAAAVAAEKSWRVSVMQG
FT                   YCILIAVLYCLPQLFDLLTHAYGMQAAAAAAELEGKAAGSAIALFFSPILSHRLGYE"
FT   gene            complement(273853..274137)
FT                   /locus_tag="Bxe_B2792"
FT   CDS_pept        complement(273853..274137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2792"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33203"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT6"
FT                   /protein_id="ABE33203.1"
FT                   /translation="MREFAHSVTHIEAALFALAIIGASSASALQAVLRSPILDSDHQQD
FT                   DLTGSRKRVHHYLGIKPASFSERRLFFFAAIANGGKEAIACHHDMRRAW"
FT   gene            complement(274257..275240)
FT                   /locus_tag="Bxe_B2791"
FT   CDS_pept        complement(274257..275240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2791"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2791"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33204"
FT                   /db_xref="GOA:Q13RT5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT5"
FT                   /protein_id="ABE33204.1"
FT                   /translation="MDLVQTLPLNSRQSAVPMQTNAVTRVDIALFNGFALPTIAAIIEI
FT                   FQKANSLVAAQRSGRTRYDVSLLSAAGGRIASSSSVFVWTDDVQSHRGTNDTHLLFIAG
FT                   GAGVQQASRDERLSDWLRRRHPFSEIVHPIAEGQQLLQAAGLPSRYCPLLYTGSEVRGL
FT                   PVARSLTETPGAVSTALRIVEEDLGAELAQQVAESIAPQPKTPFNSSVTLGAAPQISEK
FT                   ILASARWLEANVDRPISIDDAAQVAAMSERNFLRRFKSEIGMTPSDYLLQARLNMSCRM
FT                   LVESRLPIDKIARRCGIGSGGQLSKLFRKYLATTPTDYRMRNEVAP"
FT   gene            276003..276188
FT                   /locus_tag="Bxe_B2790"
FT   CDS_pept        276003..276188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2790"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33205"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT4"
FT                   /protein_id="ABE33205.1"
FT                   /translation="MHKQDIQTIVSAARETADAIVGAREWKTAEDASAMYDVIFWDMLA
FT                   KRLPDTNIADLLSMFD"
FT   gene            complement(276295..276492)
FT                   /locus_tag="Bxe_B2789"
FT   CDS_pept        complement(276295..276492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2789"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33206"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT3"
FT                   /protein_id="ABE33206.1"
FT                   /translation="MQLPNVDNFIKDVQRGVTYNICAYRKLSGQEMTRAMQVFIQQQGQ
FT                   HQPKQGSVVKIFSLVGLGEQ"
FT   gene            276838..277101
FT                   /locus_tag="Bxe_B2788"
FT   CDS_pept        276838..277101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2788"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33207"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT2"
FT                   /protein_id="ABE33207.1"
FT                   /translation="MARRLHKLDFRTLSITRTVMQPDHTATEFAPPPSLLATPLEGADE
FT                   STPQRQIGALARVTFCFAWLFGLEPFLTGAAGEMPLSRSDRH"
FT   gene            277216..277515
FT                   /locus_tag="Bxe_B2787"
FT   CDS_pept        277216..277515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2787"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33208"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT1"
FT                   /protein_id="ABE33208.1"
FT                   /translation="MCPCGTGEFAPGPVCRDEEALRRLRHKSRVTRPWAVVIRETPCEK
FT                   RHGRAVKWTRTVVRRFAVRFQHGFCHAAVGAAFHLRAMPVLKVFLFGRVTDAFK"
FT   gene            278236..279369
FT                   /locus_tag="Bxe_B2786"
FT   CDS_pept        278236..279369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2786"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2786"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33209"
FT                   /db_xref="GOA:Q13RT0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT0"
FT                   /protein_id="ABE33209.1"
FT                   /translation="MKKSLIVVAVAASFASVAHAQSSVTLYGLLDAGLTYTSNVNHNSK
FT                   WAAGSGGINQSMFGLRGSEDLGSGLKAVFTLESGFNINNGKFANNNGMFNRQAFVGLSS
FT                   AQFGTVTLGRQYDAAQDYLAPLTATGSWGGTYFAHPFNNDNLNTNGGYAVNNSIKYASA
FT                   NYAGFSFGGTYGFSNQAGAFANNREYSVGAAYQWQGLRLGAAYAQQNNPGAGNNGASDS
FT                   SYVNALAGNVGNFRQREFGVAGSYAFGPATVGLAWTQSRSDNFTGGQQSLRANNYEVNG
FT                   KYNVTPALGLGVAYTFTDGKGYGVGANGGSESVRYHQIGLQADYSLSRRTDVYAQAVYQ
FT                   HAMGDGGVASIYSGDITQLPSSSKNQTAATVGLRHRF"
FT   gene            279648..280019
FT                   /locus_tag="Bxe_B2785"
FT   CDS_pept        279648..280019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2785"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2785"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33210"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS9"
FT                   /protein_id="ABE33210.1"
FT                   /translation="MPSYRMNTFASESRLHSPPHSPPNCDLTDEQWHRITPLLPEMKEH
FT                   GPRRGRPSIDIRWVVNSVMWVLHARAPWSAMPERYAPYQTAHRYYLRWKKSGVLASIVL
FT                   TLFGSDAIMERPVTRRRAA"
FT   gene            complement(280141..281769)
FT                   /locus_tag="Bxe_B2784"
FT   CDS_pept        complement(280141..281769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2784"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2784"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33211"
FT                   /db_xref="GOA:Q13RS8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS8"
FT                   /protein_id="ABE33211.1"
FT                   /translation="MRTMQRRLQPFLLSSLNVLSNPIMNRLTLKQKLWVPLLLCWAALL
FT                   IVTVVNAYEARNDQMDARRADLADVTDMAASIVADYAKQADAGKLSVDEAKRQAIARVN
FT                   AQRYGASGYVTIVRSDSVMIDHPMSPKLNGKDMSAFRDAKGNALYHDIAQAGGSAAGAG
FT                   YLRYWWPKPGETAPSEKIGYVKRFGPWGWDFIAGAYMDDIQAQFYATLARSAGMLVVLG
FT                   VIVSFVASRVVRNVSRSIGGEPSTAAAIAMQIARGDLATHIDLRRDDTSSLLFSLREMR
FT                   DQLASTVARIKTSAETITIASKEIAAGNLDLSSRTEEQAASLQQTAASMDELTKTVTQN
FT                   ADNAATASELARDASDVAARGGQVVNDVVEKMAGITDSSRKIGEIINVIEGIAFQTNIL
FT                   ALNAAVEAARAGEEGRGFAVVAGEVRNLAQRSATAAREIKVLIDQSVTQVGEGSTLAGK
FT                   AGSTIGEVVDAVRRVTAIMNEISAASKEQSSGIGEVNLAIRQMDDVTQRNAALVEQAAA
FT                   AAGSLDEQTDRLRHAVAVFKVGEAA"
FT   gene            complement(281890..282636)
FT                   /locus_tag="Bxe_B2783"
FT   CDS_pept        complement(281890..282636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2783"
FT                   /product="Cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2783"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33212"
FT                   /db_xref="GOA:Q13RS7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS7"
FT                   /protein_id="ABE33212.1"
FT                   /translation="MNDAPLTAPADARPNRRERVARADLPGLFATCAWFRALAAEHQAL
FT                   VVASAHAEHMEGGAWIARRQEPSDYWIGVHSGLLKLAIYNASGRSCTLSGVPPGGWFGE
FT                   GSVIKRELRKYDVAAIQPSLVMFVPSDTFHALLESSLPFTGFVIRQLNNRMGEFIASIQ
FT                   NSRLLDVDARVAQSLAQLFNPDLYPDTGRALAISQEEVGLLAGVSRQRINQALQNLERL
FT                   QILRLSYNQIHVLDLERLTAFGREQI"
FT   gene            282802..284433
FT                   /locus_tag="Bxe_B2782"
FT   CDS_pept        282802..284433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2782"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2782"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33213"
FT                   /db_xref="GOA:Q13RS6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS6"
FT                   /protein_id="ABE33213.1"
FT                   /translation="MKHMFEAGLERREANYIPVTPIDFIVRAAEVYGDRLAVVHGEIRR
FT                   NWRETYERSRRLASALQRAGIERGDTVAALLPNIPPMIEAHFGVPMAGAVLNTLNTRLD
FT                   ISSLLFMLRHGEAKALIVDTEYGEFAHRASLEFPDLRVISVADAMPANADQFIRATDYE
FT                   AFLQSGDPEFAWTMPADEWDAIALNYTSGTTGDPKGVVYHHRGAYLNAVSNILEWDMPK
FT                   HAVYLWTLPLFHCNGWCFPWTVAARAGVNVCLRKFDAKTVFDLIRNEGITHYCGAPIVQ
FT                   SALANAPAEWRDGINHRVSTMVAGAAPAPAVIAKMKEIGFDLTHVYGLTETYGPAAVCA
FT                   KQEAWETLDDSARAELNARQGVRYHLQAAVTVLDPQTLALVPNDGETIGEIMFRGNICM
FT                   KGYLKNERATEAAFEGGWFHTGDLGVRMPDGYIRIRDRSKDIIISGGENISSIELEDTL
FT                   YRHPAVAVAAVVAMADPKWGEVPCAFVELKEGAQVSAEEIIAHCRLFLAGYKLPKAVRF
FT                   GELPKTSTGKIQKFELRARIKTEENQ"
FT   gene            complement(284555..284779)
FT                   /locus_tag="Bxe_B2781"
FT   CDS_pept        complement(284555..284779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2781"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33214"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS5"
FT                   /protein_id="ABE33214.1"
FT                   /translation="MQNTPIHHYNGYAVKPSAHRLPDGTFSSNLLLERADSARAEGRYQ
FT                   FYSLDYFTNEEQALQHSASWARHWVDTRG"
FT   gene            complement(285068..285271)
FT                   /locus_tag="Bxe_B2780"
FT   CDS_pept        complement(285068..285271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2780"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2780"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33215"
FT                   /db_xref="GOA:Q13RS4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS4"
FT                   /protein_id="ABE33215.1"
FT                   /translation="MDTGTVKWFNDSKGFGFITPDKGGDDLFAHFSEISGDGFKTLAEN
FT                   QKVSFETKQGPKGLQAANIKPM"
FT   gene            complement(285567..286202)
FT                   /locus_tag="Bxe_B2779"
FT   CDS_pept        complement(285567..286202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2779"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2779"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33216"
FT                   /db_xref="GOA:Q13RS3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS3"
FT                   /protein_id="ABE33216.1"
FT                   /translation="MSASTAIIAILAALLVGAMSPGPSFVIVARNAIGLSRGDGLATAI
FT                   GMGVGGVFFSGIALLGLYTLLASVEWLYVGLKVAGGLYLIYLASKIWRGAAKPLAFDTT
FT                   QAVPANARKSFWIGLSTQLSNPKTAVYYGSIFAALLPQHPPLWCYFALPPAIFAIEAGW
FT                   YTVVALCFSSKRPREIYLQWKAWVDRVAASAVAALGLRLILTAHKVGI"
FT   gene            286332..286628
FT                   /locus_tag="Bxe_B2778"
FT   CDS_pept        286332..286628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2778"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33217"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS2"
FT                   /protein_id="ABE33217.1"
FT                   /translation="MSNTACTRSIAKPAGIEKQRVAGSPVRCSGQKKLDARMTFHTLKQ
FT                   PRTTRQDKSAIRSGCRRVPPNAGFIGHDFQVRVLTHRNRHREFDSHSIHLNHA"
FT   gene            286700..286963
FT                   /locus_tag="Bxe_B2777"
FT   CDS_pept        286700..286963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2777"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33218"
FT                   /db_xref="GOA:Q13RS1"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS1"
FT                   /protein_id="ABE33218.1"
FT                   /translation="MKEREEQRLFDLDGNARERLIVWIRRRMDEYGITMEALAEAIEAD
FT                   ASATRAVMYRDAYGNTWDGHGDKPDWLARAIYAGQSMDHFRC"
FT   gene            complement(287144..287731)
FT                   /locus_tag="Bxe_B2776"
FT   CDS_pept        complement(287144..287731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2776"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Protocatechuate pathway; Citation: Biochem. Biophys.
FT                   Res. Commun. 295 (4), 903-909 (2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2776"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33219"
FT                   /db_xref="GOA:Q13RS0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS0"
FT                   /protein_id="ABE33219.1"
FT                   /translation="MTTLKQTPSQTVGPYFAYGLCPQQYDFDFRSLFTPVVADREAAGE
FT                   HITIVGQVFDGDGKVIGDAMLEVSQVDANGRFPESREEILKTGFRGFARVGTGTDPHKR
FT                   FVVETVKPGRVGPDEAPHLNVVVTMRGMLLHTFTRIYFEDETAANEKDPVLTAVPADRR
FT                   DTLIARREPNVANIYRFDIHMQGEKETVFFDL"
FT   gene            complement(287735..288439)
FT                   /locus_tag="Bxe_B2775"
FT   CDS_pept        complement(287735..288439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2775"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Protocatechuate pathway; Citation: Biochem. Biophys.
FT                   Res. Commun. 295 (4), 903-909 (2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2775"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33220"
FT                   /db_xref="GOA:Q13RR9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR9"
FT                   /protein_id="ABE33220.1"
FT                   /translation="MDESFLTARDFASHPSYIYPGYGSSVKRGPTRPLIPLKEKLRDQH
FT                   VPVYGTEDLGALDHDLTRNAVRNGEPLGERIIVTGRVLDEGNRPVRNTLVEIWQANAAG
FT                   RYVHKADQHDAPLDPNFLGAGRCITDNEGRYRFMTIKPGAYPWGNHPNAWRPNHIHFSL
FT                   FGDHFGSRLVTQMYFPGDPLLAFDPIFQGTPEHARDRLIANFSLDTTQEAYALGYDFDI
FT                   VLRGRNETPMER"
FT   gene            288548..289561
FT                   /locus_tag="Bxe_B2774"
FT   CDS_pept        288548..289561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2774"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2774"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33221"
FT                   /db_xref="GOA:Q13RR8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR8"
FT                   /protein_id="ABE33221.1"
FT                   /translation="MQRSLADSRVKFRHLQCFLAVAQFGSVQRAAGSLSITQPAVSKTV
FT                   AELEAILGVKLFERGRHGAVPTREGQLFMPHASACVSALRQGVDLLAHAEGAAAATLEI
FT                   GILPTVAAVLIPPVLKRFAALWPRVIVRLATGANPELLESLKAGTIEFAIGRLADPERM
FT                   VGLSFEQLFSEPLIAVVRAGHPLALGAGLPATSLEDFPVVLPPFGTLIRQSAESLLSAW
FT                   GVPPLSAFVEVLSVSTGRALTLENSAVWFVPLSAVEYELAHGMLVRLPLPFAGTGEPVG
FT                   LIRRSDTQPSPAGRAFIDAVREVAQQRMAASAASAAGADKTAGAATGKGVRKRSRK"
FT   gene            289822..290955
FT                   /locus_tag="Bxe_B2773"
FT   CDS_pept        289822..290955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2773"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="Tyrosine degradation; Citation: J. Bacteriol. 186
FT                   (15), 5062-5077 (2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2773"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33222"
FT                   /db_xref="GOA:Q13RR7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR7"
FT                   /protein_id="ABE33222.1"
FT                   /translation="MPSDLPTPDAALRAVSAPEHNPLGTAGLEFVEFAARDPRALGETF
FT                   TKLGFKAIARHISKDVTLYRQGEMQFLINAEPDSFAARYAEEYGAGICAIGIRVADAQR
FT                   AFGRAIELGAWAFEGEKIGAGELLIPAIQGIGDSHIYFVDRWRGRGGQRGGLGDISIFD
FT                   IDFRPIQIDTAQADLSHVGTGLVAVDHLTQTVGEGRMQEWLDFYRDLLNFREIHELHAN
FT                   WHVSAESRVMVSPCGAIRVPLYEEGTRRTNLMHEYLPDHPGEGVQHIALATDDIFACVE
FT                   QLLANGVEFVEPPARYYEQLDARLPGHGLDVERLRRTHLLVDGEIGTDGVPLLFFQTFV
FT                   RRRAGEIFFEIVQRQGHHGFGEGNLSALAQAREQAGA"
FT   gene            complement(291011..291943)
FT                   /locus_tag="Bxe_B2772"
FT   CDS_pept        complement(291011..291943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2772"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2772"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33223"
FT                   /db_xref="GOA:Q13RR6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR6"
FT                   /protein_id="ABE33223.1"
FT                   /translation="MRKFKIPNMGALLAFEAAARHESFTHAARELFLTESAVSRQINTL
FT                   ESNLGVRLFVRVKQRVMLTRAGKVYSAQVRRSLEQLDRDTLSIIAHGSGGGYLELAVLP
FT                   TFASQWLIPRLAAFNAQYPDVRVNMGVRTGTFPFAETHFEAAIHYGKPTWPGTSADFLF
FT                   SEEVVPVCAASLLKRPVQSAADLLDYPLVHSTTRPDGWAAWFANMGIDDNRTMQGVRYE
FT                   LHTMLISAAAAGLGIALVPRFFVDAQLEQLGLVIPLDAPVVADSAYYLVYPTELSHGKP
FT                   LASFREWLLREAAAYSAVNPELGGPRDMD"
FT   gene            292120..293157
FT                   /locus_tag="Bxe_B2771"
FT   CDS_pept        292120..293157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2771"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2771"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33224"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR5"
FT                   /protein_id="ABE33224.1"
FT                   /translation="MRNIKNANVEQLLLKLLGADKTARLFATLNHPQILNEWEAGIVTR
FT                   AELAQAMNMALFEDLLARSANGRRYTEEAVAAGGSVYFDHGALRTVRWPHSGALPMGEA
FT                   AFARILRPLGFSINGRYPLDRLGMTGRAWAHDDAPDEIAQFFVSELHPERFSAEFQQAV
FT                   TNVIGESRDPLTPRALGQLWELERDGVLPLDAAHELLPVMVGAFACQHETPREADYEVL
FT                   LKESAEMAWIATEGNAFNHATDRVADVFQLSDDEKAKGRPMKPEVERSRSGRVFQTAYR
FT                   ADTVLREFRAADASIVTREVPGSFYEFITRKRTFDQDARRWETDLRFDAGNAQGIFKMT
FT                   ANQAA"
FT   gene            293197..296196
FT                   /locus_tag="Bxe_B2770"
FT   CDS_pept        293197..296196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2770"
FT                   /product="Putative FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2770"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33225"
FT                   /db_xref="GOA:Q13RR4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR4"
FT                   /protein_id="ABE33225.1"
FT                   /translation="MGTSFDEEQGAGLHESGDAGRRALKDTPRVATPYAGSAAVMQALE
FT                   TDLRSHVRGEVRFDQGSKALYAADASNYRQVPLAVVVPADIDDLLATLAACRRNDVPFL
FT                   ARGGGTSQNGQCVNVAVVADASKYVNRVVSVDPAARVAIVEPGVVCDTLRDAAEQHGLT
FT                   FAPDPATHSRCTLGGMIGNNSCGAHSVMAGKTVENVEALEIATFDGARFWVGPTSEHEL
FT                   ERIIAAGGRQGEIYAALKRLRDTYAEQIRAKFPQIKRRVSGFNLDQLLPENGFNVARAL
FT                   VGTEGTCAVTLQAKVRLVKSPAKRVIVVVGFTDIYTAADAVPHFMRCGPIAIEGLDRAI
FT                   IRGLQARGLKKDEIALLPEGDAWVVLEFGADTQEAVMLQAQAAAAYFRAGEAGPNVSAM
FT                   LVEDRALQAKVWSIRETGASAVALSVDSGMPDPVVGWEDAAVDPLRLGDYLRAFQALVD
FT                   RYGYETSLYGHFGDGCVHARITFDLRSAQGVSTWRKFLREAAELVVEFGGSLSGEHGDG
FT                   QAKAEFLPIMYGPELMQAMEQFKAIWDPAHRLNPGKVVHAYRADENLRMGPAYKPVTLQ
FT                   TKLTFASQEGNGFQREIERCIGMGKCRSLEGGTMCPSYRATREEKYSTRGRAHLFWEML
FT                   QGGVIDNGWQSREVKEALDTCLACKGCKSDCPTHTDMASYKAEFLSHYYETKRRPRQAL
FT                   FMGRIGEWAPWAARFPRLTNFMTSAPGLASFGKWVAGVAQARELPRFAHATYRQIARRS
FT                   PQTASAARGEVKKVILWVDTFNDHFTPEIAQAAADVLKQLGWHVVLPKNRLCCGRPLYD
FT                   FGLLERARELLTHILDDLADDIAAGVPLVGLEPGCLSVFKDELLKQLPGHALAKTLSAQ
FT                   TFLFSDFVARQPFDWPTLAADVIVHGHCHQKALFGMQGDIALLDRLGVKWKLLDTGCCG
FT                   MAGSFGFNAEHHGLAEKIGEDKLFPAVREAAAETIVLTNGFSCREQIQQGTGRHAMHIA
FT                   QLAQRALAAR"
FT   gene            complement(296228..297058)
FT                   /locus_tag="Bxe_B2769"
FT   CDS_pept        complement(296228..297058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2769"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2769"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33226"
FT                   /db_xref="GOA:Q13RR3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR3"
FT                   /protein_id="ABE33226.1"
FT                   /translation="MRALNTRQSCPTASSPSPCAGHPGTPGKRAGRDPTVHETGACPPN
FT                   VIIGNNTVPQKRAFEASSPMDTRLAKPADPSTTDLGRRVRAARQAQDLTLETASRLCGV
FT                   SRSTLSKVENGLMSPTFDVLQKIVLGLKIEIGELFGSTPKVSASGRRALTRKNEGQRHA
FT                   YRGYQMELLATDLAHKAMLPFRIRISAHTLDAFDDWGRHEGEEFLYVISGSVCLYSELY
FT                   APTHLNAGDSLYFDSRTGHAAVSTSEEDAEVLWMATSADIPHTPPATESESTKK"
FT   gene            complement(297066..297806)
FT                   /locus_tag="Bxe_B2768"
FT   CDS_pept        complement(297066..297806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2768"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2768"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33227"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR2"
FT                   /protein_id="ABE33227.1"
FT                   /translation="MKTTNRHHTMHLIHATSPRHTAMRISFLHTMDGNRQVFEQAAKTL
FT                   GMRAEDLHHEVRADLREAVTQTGTFSSELKAETNQRLLALAAHSDAVILTCATLGPAVA
FT                   DIGHSPVPIVRADIALAAAAAEAGGKIVVLCAAESAVESTRKLFVEQASGNNASVEVVH
FT                   LPEVWALFKAGALDACLAAIALAADDAYEAGATVVAFAHPWMAPGADLVRKGRRPLDSP
FT                   SAALRAAAQRFSESSASSAKASFR"
FT   gene            298103..300427
FT                   /locus_tag="Bxe_B2767"
FT   CDS_pept        298103..300427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2767"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33228"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR1"
FT                   /protein_id="ABE33228.1"
FT                   /translation="MSTDADTITDEQIAAIADRMVEEGRRVSPVTIWKEVRGGSLVAIV
FT                   AALQRWREARQGETPALQVQPGLPEGLAETVMSAADRIWSASQHDAERAFSQRLAAVNQ
FT                   DLEAAVAERDEALAEYQKMIDEVETGRQRVIALTDTLSASESIALRLEAELATVTGRAE
FT                   AAETHVEELAQRASAQDADLEAMKASLDKERLAREESATALASKNDEVAQLTQERDQAR
FT                   HEIVTLSDVCHARTEEVTQWSQEARAASSRAELAEARIEELVQRAAVDHANLEAMNASL
FT                   EAERKAREELAAVVSSKTDELTRVVQEREQALQQVTTLDAACRANAQEVTRWSQEANAA
FT                   TSRAQAAEARIEELVQRVSSQDAGLEAAKASLEEERKGHEELAAVVSGKTDELTRVTQE
FT                   RDQALQQVTTLDAACQANAQEVTRWSQEANAATSRAQAAEVRIEELLQHATSQAAEQQA
FT                   TVALLDEERKARAELATAISGKSDELAQAAQERDQAQQQIVTLSDAHQAKSEEAIRLST
FT                   ELGAALSHAKAAEVQASGSLAKLAALEAELEQARAALAAEREAAAARADQMSVHLNDLQ
FT                   RVTQELEETRQQIATMNEAKAAASADLARVSQDASAAKERAEAAEQQVVQLEQRLAAQA
FT                   AAIAQQNQRAQQASVRADEAERAEEVAALQRQIAAQARANAKALSELRATAEQWVAHAK
FT                   DLKQRLGLASERILFIDARSTGEVALVRRLSSELERLKPDHELIARETQQKLIGATMSH
FT                   QLAQKGYRYDPATAVMSKVTA"
FT   gene            complement(300508..301533)
FT                   /locus_tag="Bxe_B2766"
FT   CDS_pept        complement(300508..301533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2766"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2766"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33229"
FT                   /db_xref="GOA:Q13RR0"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR0"
FT                   /protein_id="ABE33229.1"
FT                   /translation="MNLKQLTLILCALCASAAHAADITGAGSTFAAPIYTKWADAYQKT
FT                   GGGKVNYQGIGSSGGIKQILAKTVDFAGSDAPLKDDELAKDGLFQFPTVVGGVVPAINV
FT                   PGLKAGELVLSGEVLGDIYLGKIKKWNDPQIAALNPKIKLPDTDIAVVRRADGSGTSFI
FT                   WTNYLSKVNPEWKSKVGEGATVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKQNH
FT                   MTYASMKNASGTIVEPTTDTFKAAAAGADWSKSFYQILTNEPGKNAWPVVGATFVLLYT
FT                   TQDKAAQGAETLKFFDWAFRNGGKAADDLDYISLPESVTAEIRAQWKQKVKDASGKPVA
FT                   P"
FT   gene            301843..302880
FT                   /locus_tag="Bxe_B2765"
FT   CDS_pept        301843..302880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2765"
FT                   /product="Mg2+ transporter protein, CorA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2765"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33230"
FT                   /db_xref="GOA:Q13RQ9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ9"
FT                   /protein_id="ABE33230.1"
FT                   /translation="MKSDLLLQTYGADSSGMVCGFLFSSMRAGRPVDADEVVEWLQAHD
FT                   ANGPPKESSEFLWLHFNLAHSASERWMRTQLDLPETFFDALREGSHSTRIEHADGALRA
FT                   VVNDVMFNLEFIPSEIATLWIYANQRIIVTARLKPLRSVDRLRASVRQGEVFRSPAELL
FT                   VHLMRDQADLLVQIVRRTSADVDRIEDRFLSQRPTQNRIDLGAMRRMLTRLQRMLAPEP
FT                   GAIFRLLARPPRWLHSEDVQDLRESTEEFSVVLSDVAGLIERVRLLQEEIISRLEEQNN
FT                   RTLFTLTLVTVLAMPINIVAGFFGMNVGGIPLAENRHGFWVMVLLVAGFTGLAGWWAFR
FT                   RRKER"
FT   gene            complement(302949..303875)
FT                   /locus_tag="Bxe_B2764"
FT   CDS_pept        complement(302949..303875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2764"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2764"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33231"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ8"
FT                   /protein_id="ABE33231.1"
FT                   /translation="MRDVASTQERTSDNAGRRTSTVSANMSPAAAFSTLVTPMVATVAQ
FT                   RVGTLCVSADPESLHKLRVVLRRLRSLWWAYDPLIDGSQARRQRREFKALADSAGQTRD
FT                   WDILKHLLADDAQMPHSFAALIERVDLLRGDALLHSRTTIAAANVEALLAQGIADVMLQ
FT                   LEARPFDEPLVGFAADRIATAKKALRKRMKRLLRDQHAGYAEFHEVRIAAKKVRYLLEF
FT                   FAPLIDSGNGIGIVELTQMQDELGKLNDIVSSESLLLVHKDRLGECGMVDDAIAYLRYL
FT                   KGHHMQSADASLRAVGDMLASEHSGSD"
FT   gene            complement(303899..305161)
FT                   /locus_tag="Bxe_B2763"
FT   CDS_pept        complement(303899..305161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2763"
FT                   /product="Putative transposase IS110"
FT                   /function="PFAM domains of IS111A/IS1328/IS1533transposase
FT                   and IS116/IS110/IS902 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2763"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33232"
FT                   /db_xref="GOA:Q13RQ7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ7"
FT                   /protein_id="ABE33232.1"
FT                   /translation="MPRLATDVAGQTVQPAKPSMQENQQHSSVDVFVGVDVGKGHHHAV
FT                   ALDRTGKRLYNKALPNDEAKLRALITELKTHGQLLFVVDQPATIGALPVAVARDEGVLV
FT                   AYLPGLAMRRIADLHAGEAKTDARDAAIIAEAARSMPHTLRSLRLADEPLAELTMLCGF
FT                   DDDLAAQITQTSNRIRGLLTQIHPALERVLGPRLDHPAVLDLLERYPSPAELAATSEKT
FT                   LANRLTKLAPRMGKSLATEIVQALSEQAVIVPGTQAATIVMPRLAQQLASLRKQRDEVA
FT                   SEVERLVHAHPLWPVLTSMPGVGVRTAARLLTEVAHKAFASAAHLAAYAGLAPVTRRSG
FT                   SSIRGEHPSRRGNKVLKRALFLSAFAALRDPVSRDYYARKVQQGKRHNQALIALARRRC
FT                   DVLFAMLRDGAFYQPKSAPNA"
FT   gene            305732..306766
FT                   /locus_tag="Bxe_B2762"
FT   CDS_pept        305732..306766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2762"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2762"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33233"
FT                   /db_xref="GOA:Q13RQ6"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ6"
FT                   /protein_id="ABE33233.1"
FT                   /translation="MSYTQTLLTGVVGALLAVTAHGADIAGAGSTFAAPIYTKWAGAYQ
FT                   QAGGGAVSYRAVGSTEGVKEIMESQVDFAGSDAPLSDDELARNGLLQFPMVIGGVVPVV
FT                   NLPGIKPGELILSGRVLADIYLGKIINWDAPAIAAINPRIKLPDTPIAVVRRLDGSGTT
FT                   LIWTHYLAQANSEWKSRIGEGTSVRWPRGIGGRGNEGVATFVQHLPGAIGYVAWDFTKQ
FT                   NHMSYTAMENASGAVVQPGPETFKAAAASADWSRSLFPILTNEPGANAWPVVGATYVLL
FT                   HSTQNKPERGEATLKFLEWALTNGDQAAEDLDYVPLPPPVVSEIRTQLHARVKNPSGKA
FT                   IAGE"
FT   gene            complement(306816..307247)
FT                   /locus_tag="Bxe_B2761"
FT   CDS_pept        complement(306816..307247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2761"
FT                   /product="Putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2761"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33234"
FT                   /db_xref="GOA:Q13RQ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ5"
FT                   /protein_id="ABE33234.1"
FT                   /translation="MQNAIDFQQLANAIGDAIIISDSQGSITFWNPAAERMFGFTQDEA
FT                   LGNSLDLIIPERLRGRHWDGYHKTMTTGETRYGNDVLRVPSVHKDGRSMSIAFTVALLH
FT                   SPDNELTGIVAVIRDETSRFQEDRLLRKRLAELEASAGA"
FT   gene            complement(307353..308603)
FT                   /locus_tag="Bxe_B2760"
FT   CDS_pept        complement(307353..308603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2760"
FT                   /product="Putative formyl-coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2760"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33235"
FT                   /db_xref="GOA:Q13RQ4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ4"
FT                   /protein_id="ABE33235.1"
FT                   /translation="MTKPLEGIRIIDFTHVQAGPACTQLLAWFGADVIKVERPGSGDVT
FT                   RNQLRDIPDADALYFTMLNSNKKSLTLDTKKPEGKEVLEKLIRESDVLVENFGPGALDR
FT                   MGFSWERLNELNPKMIVASVKGFSDGHHYDDLKVYENVAQCAGGAASTTGFWDGPPTIS
FT                   AAALGDSNTGMHLAIGILTALLGRDKTGKGQKVAVSMQDSVLNLCRVKLRDQQRLERVG
FT                   YLEEYPQYPHGEFSDVVPRGGNAGGGGQPGWVLKCKGWETDPNAYIYFTIQGHAWEPIC
FT                   KALGKPEWIDDPAYKTAEARQPHIFDIFQTIETWLADKTKFEAVDILRKFDIPCAPVLT
FT                   MKELANDPSLRASGTIVEVPHKKRGTYLTVGSPIKFSDLKPEVTASPLLGEHTDEVLAS
FT                   LGYSQQQIFNLREVKAV"
FT   gene            complement(308629..310371)
FT                   /locus_tag="Bxe_B2759"
FT   CDS_pept        complement(308629..310371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2759"
FT                   /product="Putative oxalyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2759"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33236"
FT                   /db_xref="GOA:Q13RQ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ3"
FT                   /protein_id="ABE33236.1"
FT                   /translation="MAEADQPTTDDTLKQQATETTDGFHLVIDALKLNDINTIFGLVGI
FT                   PITDLARLAQAQGMRFIGFRHEQHAGNAAAISGYMTQKPGICLTVSAPGFLNGLTALAN
FT                   ATTNCFPMILISGSSEREIVDLQQGDYEEMDQLNAARPYAKAAYRVLHAEDIGIGVARA
FT                   IRAAVSGRPGGVYLDLPAKLLAQTLDAVKAQQSLVRVIDAAPRQLPAPESVKRAIDVLK
FT                   SAKRPLILLGKGAAYAQADAEIRAFVEQSGIPYLPMSMAKGLLPDTHEQSASAARSFVL
FT                   QEADVVVLIGARLNWLLSHGKGKTWGAEPKKFVQVDISPTEIDSNVAIAAPVIGDIGSC
FT                   VAALRAGIEAGFTKPDAEWTSAISERKNRNLAKMAATLDKNPSPMNFHSALRAIRDVLK
FT                   TRPDINVVNEGANTLDYARSIIDMYEPRKRFDSGTWGIMGIGMGFAIGAAVTSGKPVVA
FT                   IEGDSAFGFSGMELETICRYDLPVCTIVFNNNGVYRGTDVNPTGGKDVAPTVFVKGARY
FT                   DRMIEAFGGIGYHASTPEELTKALREAIASGKPSLINAVIDEAAGTESGRLTNLNPQSA
FT                   AMKK"
FT   gene            complement(310436..311767)
FT                   /locus_tag="Bxe_B2758"
FT   CDS_pept        complement(310436..311767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2758"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2758"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33237"
FT                   /db_xref="GOA:Q13RQ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR026355"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ2"
FT                   /protein_id="ABE33237.1"
FT                   /translation="MGHSGVSETGRTAFTHHRWFQLAIGIVCMGLVANLQYAWTLFVVP
FT                   MDNAHHWGQAAIQSAFTIFIVTETWLVPVEGWLVDRFGPRPVVIGGSLCAALGWIIDAH
FT                   ASSLAALYVAAVIAGIGAGCVYGTCVGTALKWFPDKRGLAAGLTAAGFGAGAAVTVIPI
FT                   ADMIQRSGYQHTFMFFGIFQGVCILLLATMLIRPKPPTAAVVAKRVVASKIDYTPGEMI
FT                   RSPLFWVLYLMFVFVAAGGIIATAQLGPIAKEYGFAKLPVNLMGITLPLLTMTLSIDNL
FT                   CNGFTRPLCGFLSDRIGRENTMFMIFLGEGVALLGLMQFGHNPYAFMFFAAAVFLCWGE
FT                   IFSIFPATCADTFGSKYAAANAGTLYTAKGTASMLVPLASVLSANGGWSTVFIAAAVVS
FT                   IAAAVSAKFILAPMRKRWIENSGAPASVVIAEARLQPSSGGSPE"
FT   gene            312153..312590
FT                   /locus_tag="Bxe_B2757"
FT   CDS_pept        312153..312590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2757"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33238"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ1"
FT                   /protein_id="ABE33238.1"
FT                   /translation="MRASILGRATCLKEMTMNHAQLNAGDSVHDAEIDAQLCAYNAAFD
FT                   ELGLRFRWDAQTLTSLAVIDGERAQIAAYIESHHPHLLKAYSAEFLSQAILDRKSARYP
FT                   APLPRRVGSASLSTHAVRQSGTSSRRERVSYDIELPALAGV"
FT   gene            complement(312752..313102)
FT                   /locus_tag="Bxe_B2756"
FT   CDS_pept        complement(312752..313102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2756"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2756"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33239"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ0"
FT                   /protein_id="ABE33239.1"
FT                   /translation="MKKALVYLVLAASALSAPVFAFAQSNGPVTRAEVRSDLVKLEQAG
FT                   YNPAQGNDANYPTDIQAAEAKVAAQTSQQLATQGYGGVTQNGSSSSGGPARVAMHSTCV
FT                   GPVSFCTPYFGS"
FT   gene            complement(313326..313913)
FT                   /locus_tag="Bxe_B2755"
FT   CDS_pept        complement(313326..313913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2755"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2755"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33240"
FT                   /db_xref="GOA:Q13RP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP9"
FT                   /protein_id="ABE33240.1"
FT                   /translation="MEERIKHLLNQISVLESELQAELHQREVKLFYRITGKHVEFDKAV
FT                   GKAHRELKVGIVRWILSSRPQNFLAAPFVYGLVFPLVFLDLCISIYQAICFPIYGIAKV
FT                   KRADYIVMDRWQLHYLNFMERFHCAYCEYANGLIAYASEIAARTEQYWCPIKHARKVLG
FT                   THARYERFLAYGEAEQYQERLAQFRDALRKQQ"
FT   gene            complement(313997..314266)
FT                   /locus_tag="Bxe_B2754"
FT   CDS_pept        complement(313997..314266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2754"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33241"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP8"
FT                   /protein_id="ABE33241.1"
FT                   /translation="MKRIFPALLIALATVGTTQVWAQNTAPSGADGAQPGDNIVQMRSE
FT                   IRAANEAYRARVRAANKARDREVAKAQADRVKAVQAAQSGGSGG"
FT   gene            complement(314541..315275)
FT                   /locus_tag="Bxe_B2753"
FT   CDS_pept        complement(314541..315275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2753"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2753"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33242"
FT                   /db_xref="GOA:Q13RP7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP7"
FT                   /protein_id="ABE33242.1"
FT                   /translation="MAGLAKGLAIIEAFGASTARMTVSDAAHLADLSRPAARRCLLTLV
FT                   DLGYLAHDGKFFTPLPRMLRLGSAYLSTSSLTQIAQPLLTSARDELQESVSLAVLDEGY
FT                   SVFIARAEAVRIVSTGVKLGGRLPAYCSATGRVLLSGLSEEEIRRHLDATPMKHLTTRT
FT                   LATTETVLRAIAAAAQNGYAISNEELEIGMSAMAVPVRNRSGAIEAAVSVSVFSGRVSV
FT                   ETLEEKFLPVLKAVAARMQRAL"
FT   gene            315530..316786
FT                   /locus_tag="Bxe_B2752"
FT   CDS_pept        315530..316786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2752"
FT                   /product="terephthalate 1,2-dioxygenase, alpha subunit"
FT                   /function="Rieske-type bacterial ring
FT                   hydroxylatingdioxygenase, alpha subunit"
FT                   /note="Citation: FEMS Microbiol. Lett. 220 (2), 255-
FT                   260(2003); Terephthalate degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2752"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33243"
FT                   /db_xref="GOA:Q13RP6"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP6"
FT                   /protein_id="ABE33243.1"
FT                   /translation="MRARRASITWPSEGLTRVPYALFQDEGVYADEQDAIFRGPNWSYL
FT                   CLEAEVPNQGDFRSTFVGDAPVVVTRDTDGEIYAFENRCAHRGAMVCLEDQGNARDFSC
FT                   VYHAWTYSLQGDLVGVAFKDGIDGKGGMKPDFCTGDHGLRKLRVATLHGLVFGSFSDDV
FT                   PPLDEYLGEEIVERIARVLENRKPVVLGRFTQMLPNNWKLYFENVKDSYHASILHLFFT
FT                   TFQLNRLSQRGGIIVDPSGGHHVSYSAVDHAAEAAAQRKATSDYADQKIRSESEHRLED
FT                   TSVLAGVDEFGDGVTLQILSVFPGFVLQQIQNAIAVRQILPRGTQQTELNWTYLGFEDD
FT                   TPELREMRLRQSNLVGPAGYVSMEDGCVGGFVQRGIEGAGDGRSVIEMGGDSAESSASR
FT                   VTEASIRGFWKAYRNAMGY"
FT   gene            316789..317259
FT                   /locus_tag="Bxe_B2751"
FT   CDS_pept        316789..317259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2751"
FT                   /product="terephthalate 1,2-dioxygenase, beta subunit"
FT                   /EC_number="1.14.12.15"
FT                   /note="Terephthalate degradation; Citation: Environ. Health
FT                   Perspect. 103, 9-12(1995)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2751"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33244"
FT                   /db_xref="GOA:Q13RP5"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP5"
FT                   /protein_id="ABE33244.1"
FT                   /translation="MAQDIYQLIARAQADYVRCIDDGDLAQWPDFFTDACVYRVTTADN
FT                   YRRGLTGSMIYAASRGMLVDRIASLRGANIYERHSYRHLLGQPSVISAAEREARSETSF
FT                   MVARIMRDGSTSLFATGRYCDVYAVEENGVRLRERIVVCDSSRIDTLLALPL"
FT   gene            317256..318305
FT                   /locus_tag="Bxe_B2750"
FT   CDS_pept        317256..318305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2750"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="Terephthalate degradation; Citation: Environ. Health
FT                   Perspect. 103, 9-12(1995)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2750"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33245"
FT                   /db_xref="GOA:Q13RP4"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="PDB:4ATY"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP4"
FT                   /protein_id="ABE33245.1"
FT                   /translation="MSRTRDRAMTVALAIGDPNGIGPEIAVKAAAQMARDERSEHGGHA
FT                   VHSQPRIVLFGDAFVIRRYARQCCPELMLRLVQLDDLPSAEPNAIDMVDVASLPAEAFV
FT                   PGEVAAAAGTATLAYVSAALRAARAGQVDAVIACPHSETAINASGVRFAGYPGFVAHEM
FT                   GMPAEDVYLLLIGGGLRIVHATLHEGIASALARLDQRHVERAARAAVQALQLMGIAHPV
FT                   VGLMGINPHAGEGGLFGRDDIDITEPVARKLRDDGMTVIGPQGADLLLTNPDIDVFVAM
FT                   YHDQGHIPVKLRAGRHSAALSIGAGVLFSSVGHGSGFDIAGTLLADPAPLLGAIRLVTT
FT                   GTVLAPLAE"
FT   gene            318335..319339
FT                   /locus_tag="Bxe_B2749"
FT   CDS_pept        318335..319339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2749"
FT                   /product="Putative flavodoxin oxidoreductase"
FT                   /EC_number="1.5.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2749"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33246"
FT                   /db_xref="GOA:Q13RP3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP3"
FT                   /protein_id="ABE33246.1"
FT                   /translation="MDYQISVADSDIAFHCEAGETVLDAAERSGYSVPYSCRKGVCSTC
FT                   EGGVVAGAGRSSVQGDVQGPAGHVLLCCLRPSSDMTIAPRKIDRREPVVRKTLDMSVYR
FT                   ITQPAADVSIVQLRLPTGVRAKFRAGQYLQIELEDGSRRNYSMANPPHESDSIQLHVRH
FT                   VPGGRFSEGMLRRLDKGHKLRVELPFGEFSLQDDSTKPVILLATGTGFAPVKSIVEDAI
FT                   KRRLDRPLTLYWGARRAEDLYLAELAQKWHDSGKLKFVPVLSEPNADWNGRRGFVHETV
FT                   LEDFGSLDGYQVYACGNPAMTTAAHESFLKAGLPDDDFFSDAFVHTDTAPAMT"
FT   gene            319374..320726
FT                   /locus_tag="Bxe_B2748"
FT   CDS_pept        319374..320726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2748"
FT                   /product="major facilitator superfamily (MFS) aromatic
FT                   acid/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2748"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33247"
FT                   /db_xref="GOA:Q13RP2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP2"
FT                   /protein_id="ABE33247.1"
FT                   /translation="MASPLIDVVEVIERQKVGIGQCLVVLLCALLMFLDGFDTQAISYI
FT                   VPALSKDWHLPREVLGSIFSAALVGLMVGYLAIAPLSARFGHKRMMLASSVLFALFTLL
FT                   TLFATNVTELIGLRFLTGIGLGAAAPSAVALTCEFAPKRLRATFVLLVYCGFSLGFVVA
FT                   GLTAGALMPAFGWKSLMLVGALAPIALTVPLAWLLPESLVVLQRRPNGDERMRAVLLGF
FT                   FPRLDVPVGSRFRLEDQGEARASVTALVRGRTSAGTLLLWLIFFLNLAEFYFMQSWLPT
FT                   MLTGLQYSPATVVWVTALPTIAGVLSAVPLGLAMDRVGPYVTLTVMYLAGCVFMWLVGG
FT                   AFSGSVAWLMVMVFCAGFCISGGQKSVIALAAVYYPLNLRSTGVGWALGIGRLGGIAGP
FT                   LSAGMLYSAHWTPAEIFRFSAWPVLIAGLAVFVMGRIYGSRPVAVEVSTPH"
FT   gene            320909..322045
FT                   /locus_tag="Bxe_B2747"
FT   CDS_pept        320909..322045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2747"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2747"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33248"
FT                   /db_xref="GOA:Q13RP1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP1"
FT                   /protein_id="ABE33248.1"
FT                   /translation="MKKITLALLTLPLLASAAHAQSSVTLYGFVDAGLVYVNNQSGHSN
FT                   VQMVTGQTNGSRWGLRGSEDLGGGLKAIFTLENGFDPSNGKLLQNGREFGRQAFVGLSS
FT                   DTWGAVTLGRQYDPMTELIGGIAATSMWAWLGTHPGDFDDLNSTFRVNNAMKYLSPTFY
FT                   GLQASGMFAPGGVAGNFASSRIYTLGLKYENGPLSAALAYDNINNPSVSVLDSALSPGQ
FT                   AGYVTPGRSPVTSGYVSANVWQIFGAAASYRIGQGMVGIVYTNARFQDIRRTASTPNTG
FT                   TAAFNSYEINGRYSITPALLIGASFDYTTARDAKYEQIDFGPNYSLSKRTDLNLVGVWQ
FT                   HASGVDSTGRPAVAAITTLGQSSTPTQVAVKLSLRHRF"
FT   gene            complement(322152..323468)
FT                   /locus_tag="Bxe_B2746"
FT   CDS_pept        complement(322152..323468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2746"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2746"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33249"
FT                   /db_xref="GOA:Q13RP0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP0"
FT                   /protein_id="ABE33249.1"
FT                   /translation="MRLLNRLVVSMGLPLAACAIGPSSIGDGGFGASPAMPAPQSTLIP
FT                   MVNIAPVQPRPAGFIPTVPGGFSVTQFAGGLSHPRWLYTLPNGDVLVAESDAPEQHDEG
FT                   SGLSGWARRQVMKRAGAGVASPDRIVLLRDANNTGVARTQTVFLGGLHSPFGMALIGNE
FT                   LYVADTDALLRFDYVKGATQITGPGVKVADLPAGPINHHWTKNILADHSGKHLYITVGS
FT                   NSNAGENGVDAEEGRARILEFDVGTGRLRPYATGLRNANGLSWQPDSGALWTAVNERDD
FT                   LGNNLVPDYMTAVKEGAFYGFPYSYYGQHVDSRVKPQRADLVAAAIAPDYALGNHTASL
FT                   GLVFYDRTLFPVHYRGGAFIGQHGSWNRKPRSGYKVVFVPFVDGKPAGAPEDFLSGFLT
FT                   TDGHAVGRPVGVALDAHGALLVADDVGNTVWRITPRSSM"
FT   gene            323725..324300
FT                   /locus_tag="Bxe_B2745"
FT   CDS_pept        323725..324300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2745"
FT                   /product="Putative cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2745"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33250"
FT                   /db_xref="GOA:Q13RN9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN9"
FT                   /protein_id="ABE33250.1"
FT                   /translation="MAKVQQSTHPAYDAVARTLHWLTVLLIAMQFVIGWTMPDIHKGTQ
FT                   PVGLIAWHLGVGSTLIAVMVIRVVWRLTHWPTPDELPPLLSVVSRITHFLLYAALVAVP
FT                   LLGWINASSRGWTVRLLGLVPYPALSETGSDFGHEMGDVHGVLAWVLFALIALHVAAAL
FT                   FHRFVLKDHVLQRMLPHAGPSNDSPRNQ"
FT   gene            complement(324317..325063)
FT                   /locus_tag="Bxe_B2744"
FT   CDS_pept        complement(324317..325063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2744"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN8"
FT                   /protein_id="ABE33251.1"
FT                   /translation="MAAITSPRQHRMPDTLTSYFWSGDAIRSRRVSDIVLSGSLDVPVP
FT                   PLRLLADWEREISSHMVLEAGDVEPMPLARARARWPDYSRCVQAVSDWMCALGLPGVLA
FT                   SSDVALMACRGARYHHDAAQYGSAAFCNLFMSEDKGLDLHFPALGHRIPLTRGTVVIFD
FT                   TAQPHGVIQRGSSGFDAADFAPGQDCIQIFLTWELPIEDAHVAHALEVAFDTAPSTSSQ
FT                   LDAEQVQLNGEQVIVCPASGRWRPSD"
FT   gene            complement(325188..326207)
FT                   /locus_tag="Bxe_B2743"
FT   CDS_pept        complement(325188..326207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2743"
FT                   /product="Putative lipase/esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2743"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33252"
FT                   /db_xref="GOA:Q13RN7"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN7"
FT                   /protein_id="ABE33252.1"
FT                   /translation="MQGINDAVRTAIFAVAISLLAACGGNGGDSGNAGATAPAGGVNLQ
FT                   IVSFGDSLSDVGTYAPIAGAVGGGRFTTNPGQVWTQDIAQYYGDTLNVAYTINLTHKLS
FT                   AQGGLGYAEGGATVATPANQSAFLTDVIGDVEMPVNQQVSSYLAAHTSFNSNQLVLVWA
FT                   GANDVLRAGALPAAAQTVERAATTLAQVVGQIVQNGAAHVVVVNVPDIGLSPHGIASSD
FT                   GGANLTQLSQLFNSSLNAALQTDGLQGKVIQIDSYTWLNQITANFQANGFAVSNTGVAC
FT                   DPRKTPDETALLCSPATYVSANADQTYMFADDLHPTTHLHALFAQYVEHQIASSGLGH"
FT   gene            326491..329283
FT                   /locus_tag="Bxe_B2742"
FT   CDS_pept        326491..329283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2742"
FT                   /product="ATP-dependent transcriptional regulator, MalT
FT                   related, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2742"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33253"
FT                   /db_xref="GOA:Q13RN6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN6"
FT                   /protein_id="ABE33253.1"
FT                   /translation="MSRDLSHVYPSISFPRMSESIEHSLDARVSPRLTIAPVTGTRLIP
FT                   PRAARQLIPREALMARLLEARRQRCVVIQGPAGSAKTSTMLALRQAMLTLDFDVAWLSL
FT                   APEDDDLTAFFHGLLASLASVDPAIVREAELLVGRESEETAVEHWVITLVRGITRRKRE
FT                   LVLMLDDVHYLQNARILDALRWLLDYAPPQLHVVLASRRALPVSLARLRSQGLATELDR
FT                   EDLRFSAEESERFLREQLGDITKRDAQVVHELTDGWAAGLQLFAIDLKTRKGAAFAPAT
FT                   VRDAETFAHYFEREVLVRLAAEDLLLLTRAALCERFCARLCASLMQHASSAGDVAARLS
FT                   RLEGDNLFITQTGVGQDGETWYRLHPLLREVLQRRVAGLPAAELRELHAAAWQWLSVQG
FT                   YVDEAVHHAVLADNAQAAADLVEGCAHDLLARGELRQLAGLVRRLPPAQIAERFDLRVI
FT                   TAYLQMYAGETDALMQSIQQIASRSERPDPRQRYALELLRGGLALQRDDTDSVVALLPE
FT                   LQRVPADADDFIRAGRGNILSWMFIHRGDYQQARKVLEEGAPHGGAPRGILLGRCMSGM
FT                   THAAEGQVLLAERVFCDVLAEAEKQGPAYVGIACMAAALLGEALYELNDVDASLRLLAE
FT                   RIGVLERVSIPDTVLRALVVLARAHRFAGRRSEAYDYLERLEDYAKRHGVDRLLANALC
FT                   LRSRWLLEEGRLDEAEAALLRCETLAARYTGAVRSTAWEISVCADLARIRMCLHLNDFD
FT                   GAMSRLKPLSALSEAGGRWCRVIGLRLQMSIAEQGRHNDRAAREHLVEALRLGHRLGLM
FT                   RSLLDELGPCRQILDALPLEQDFDPVLAFYAQRLIDAGQASAPAAPPAAAAHVPIQSLS
FT                   ERENEVMGLLALALPNKKIARVMDVSLDTVKWHLKNIYRKLEVSGRDGAVAKMRDASAR
FT                   "
FT   gene            329435..330574
FT                   /locus_tag="Bxe_B2741"
FT   CDS_pept        329435..330574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2741"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2741"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33254"
FT                   /db_xref="GOA:Q13RN5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN5"
FT                   /protein_id="ABE33254.1"
FT                   /translation="MEVKRNVYREDHEMLRETARRFFERECLPRQAQWDEAGCVDRETW
FT                   LKAGREGLLCVTVPEEYGGGGGDFGHSAIVAEELHRAGVSGFSYSVHSDITAPYIVRLG
FT                   TEEQKRNWLPPICRGEKILAIAMTEPGTGSDLKSIRTTAVRDGDDYVINGSKTFISNGL
FT                   NCDMVVVVCKTDPSAGAKGVSLIMVETDRAGFRRGRKLEKVGQAAADTAELFFDNVRVP
FT                   ATNLIGNENGGFIHLMEELPQERLIIAVYCAAKLERQLELTLQYVKDRRAFNQTVWDFQ
FT                   NTKFKLADVKAQAVAVRTLVDYYIREHMERKLTLQEAAIAKLFATEAMWKCIDEMVQLH
FT                   GGYGYMLEYPIARAFADMRVTRIFGGTSEVLRDLISRKL"
FT   gene            330601..331788
FT                   /locus_tag="Bxe_B2740"
FT   CDS_pept        330601..331788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2740"
FT                   /product="Putative lipid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2740"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33255"
FT                   /db_xref="GOA:Q13RN4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN4"
FT                   /protein_id="ABE33255.1"
FT                   /translation="MSEKVLVAGVGMIQFAKPGASQSYTEMGAEATRRALADAGIAYDL
FT                   VQQAFAGYVYGDSTCGQTAIYEVGMTGIPIVNVNNNCSTGSTALYLARQAIATGDADCV
FT                   LALGFEQMQAGALKSHWDDRPVTRARFVPIMHGLTADLAHLPQALRTFGGAGREHMQRY
FT                   GTRMETFAAVRAKASRHAANNPLALFRKQVTTEDVMNDTVLMPGVMTRLMACPPTCGGA
FT                   AAILVSEKFAKKHGLRTGVQIVAQSLTTDPPASFDPPSMLNYVGTHMTRSAANKVYEKA
FT                   GIGPEDIDVCELHDCFAHNEVICYESLGFCPEGGAEKFVSDGDNTYGGKVVVNPSGGLL
FT                   SKGHPLGATGLAQCYELTHQLRGTADQRQVQGAKLALQHNLGLGGACVVTLYGKH"
FT   gene            331864..332799
FT                   /locus_tag="Bxe_B2739"
FT   CDS_pept        331864..332799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2739"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2739"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33256"
FT                   /db_xref="GOA:Q13RN3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN3"
FT                   /protein_id="ABE33256.1"
FT                   /translation="MQQLCKDRVVVITGAGRGLGREYALEFARQGAKVVVNDLGGKGDG
FT                   SGAASGPALDVVAEIEALGGEAVANFDDVADWNGAKNMIDTAISAFGGLDVLVNNAGIL
FT                   RDRTLANMSEEDWDSVIRVHMRGTFAPSRHAAAYWRDEAKAGRERVARLINTSSSSGLY
FT                   CNPGQANYGAAKAGIAAMSVIAARELERYGVTVNAIYPTAMSRLTEDIFAKRRDEFTAG
FT                   AAPGFDPLDAGNVAPLVAWLGSSASSGITGRVFGVRGGRITVAEGWHAGPRIEKDGRWD
FT                   VAELGALIPGLVEQAAPNALTSGEIPAAVA"
FT   gene            332836..334404
FT                   /locus_tag="Bxe_B2738"
FT   CDS_pept        332836..334404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2738"
FT                   /product="Putative acyl-CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2738"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33257"
FT                   /db_xref="GOA:Q13RN2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN2"
FT                   /protein_id="ABE33257.1"
FT                   /translation="MSGTPKYLGDHAGLTPDKAAAINSTSGEVLTYRELDERSNRFAQC
FT                   LYAAGLRRGDHIAMVLENNMRCFEVCWAALRSGLMITPVNRYLTAAEAAAIIEDSHAQV
FT                   VVSSYAMRELAAGLTGMMPTCRLRLMVDGTISGWDSYEALTGRYPATRLADEWLGAMMI
FT                   YSSGTTGRPKGIIRAQPQGRVTEGSGSARRPQFERYGFDAQTVYLSPAPLYHTAPLGYG
FT                   IETQFGGGTVVFMEKFEPLEALQAIERYRVTHSQWVPTMLIRLLKLGPAVRNAFDLSSH
FT                   RVAIHAAAPCPQEVKRQMIDWWGPIIEEYYSSTEGNGVTTLNTEEWLAHPGSVGRALLG
FT                   VIHICDDDGNELPVGETGTVYFERDQLPFRYHNDPDKTRAAQHPRHPAWTAVGDIGHVD
FT                   ADGYLYLTDRKAFMIISGGVNIYPQAIEDALAVHPDVQDAAVIGVPDAEMGEQVKAIVE
FT                   PAPGVAPSDALAERLLAYLRTRVARYMVPRSIDFIDAMPRLPTGKLYKRALRERYGARA
FT                   ERADS"
FT   gene            334443..335600
FT                   /locus_tag="Bxe_B2737"
FT   CDS_pept        334443..335600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2737"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2737"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33258"
FT                   /db_xref="GOA:Q13RN1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN1"
FT                   /protein_id="ABE33258.1"
FT                   /translation="MNNLLDAFHLTALPAAAEDFRAEVKHFLDGHLPPAPADVRARSWM
FT                   GFDADFSRRLAARGWIGLTLPASYGGAGMDAFRRFVLVEELLAAGAPVAAHWIADRQSG
FT                   PLILRYGTGAQKDFYLPRICAASAFFCIGMSEPDSGSDLASVRTRAVRCDGGWRLTGRK
FT                   IWTTNAQHCQYMIALVRSSGVPEDRQKGLSQFIVDLSLPGVEVRPIVDLTGDAHFSEVT
FT                   FDNVFLADDALIGDEGAGWQQVTAELAFERSGPERLYSSVVLLDCWRAQLRRHGASDAD
FT                   LALLGSFATQLATLRCLSIAVTARLAHGESPVVEAALVKDIGTEFEQAIPAQLEAAISA
FT                   DPAQTIDPELFRTVAYLSQISPTFSLRGGTREVLRGMIARGLGLR"
FT   gene            335627..336628
FT                   /locus_tag="Bxe_B2736"
FT   CDS_pept        335627..336628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2736"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2736"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33259"
FT                   /db_xref="GOA:Q13RN0"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN0"
FT                   /protein_id="ABE33259.1"
FT                   /translation="MFTEAIEAILRDRATPEAIRAIENGGAPAPIWNAVEEAGFLELLT
FT                   PESAGGAGLSLPAIAPVFTAFGRYAVPVPLAQSIAARALLRDTGVAAPAGMTTLAGTCR
FT                   RRENGALEAPQVPFGMTCDYVLANVDGDLLLLDAARAERKPCGVHGSFSGTLGWGLDAV
FT                   PAPLGSNGEEVRLFSAAIHAAAIAGAMNRVFAVTLQYCNDRSQFGKSIGKFQAVQHQLS
FT                   VMAQHVASAGIASELAFSGAGAAPERLATAIAKARTSMAVPLVASTAHALHGAIGVTAE
FT                   YDLQLYTRRLHEWRMADGSEAFWNRVVGNAVLAQERGTIADFARNAPYAVAA"
FT   gene            336747..337541
FT                   /locus_tag="Bxe_B2735"
FT   CDS_pept        336747..337541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2735"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2735"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33260"
FT                   /db_xref="GOA:Q13RM9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM9"
FT                   /protein_id="ABE33260.1"
FT                   /translation="MSQFLNYEQDEHIVTLTMNEPERRNPLTGNTAVEEFLAAIARIEA
FT                   DRSVRTVILTGAGTAFSSGGNIHDMERHASGSMPGMAIRQDYRRGIQQLPLALFNLEVP
FT                   VIAAVNGAAIGAGLDLACMCDIRIASELARFAESFVKLGIIPGDGGAWLLPRIIGLSRA
FT                   AEMTFTGQMIDAPQALEWNLVSRVVPHDDLLTIARGLARSIAANPPHAVRLAKRLLREG
FT                   MHCRLDTLLEMSAAYQALSHQTADHREAVSAFIGKRSPSFNG"
FT   gene            337657..338616
FT                   /locus_tag="Bxe_B2734"
FT   CDS_pept        337657..338616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2734"
FT                   /product="Putative 2-nitropropane dioxygenase"
FT                   /EC_number="1.13.12.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2734"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33261"
FT                   /db_xref="GOA:Q13RM8"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM8"
FT                   /protein_id="ABE33261.1"
FT                   /translation="MHHLGESGIVAAVVNAGAMGFITARSFSSTDALRGDLRRCRALTG
FT                   GRPFGVNLTLSRRAEQNREVADWIRTALEEGVRHFESAGASPEQLVEPIQRGGGLLIHK
FT                   CPSVRHAVSAQRLGVDALALVGLEEGGHPGANQLSAFVNGAYALEEIHIPLVIGGGIGN
FT                   GRQIAAALALGADGVVMGSRFMVATEIVAHDALKQRIVAAGAHCSTAILASLGDTWRVM
FT                   DNEAAREVQRLEAAGARRHSEFGDLILSSRTRQRVYRDGEVEAGIVSLGPAGGFADAIV
FT                   PAAQIVGQLIGEAAQAAHAFARRVVDADASCPATGAVS"
FT   gene            338706..339989
FT                   /pseudo
FT                   /locus_tag="Bxe_B2733"
FT   gene            339977..340261
FT                   /pseudo
FT                   /locus_tag="Bxe_B2732"
FT   gene            340406..341575
FT                   /locus_tag="Bxe_B2731"
FT   CDS_pept        340406..341575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2731"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2731"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33262"
FT                   /db_xref="GOA:Q13RM7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM7"
FT                   /protein_id="ABE33262.1"
FT                   /translation="MGVLSGIRVLEFEAIGPGPFGAMLLADMGADVLRIDRPLPPQDLG
FT                   PKTNGKRADVTGRGRRSVTFDLKQPQAVEAALDLMSRADVVIEGFRPGTMERLGLGPQA
FT                   ALARNPRLVYGRMTGWGQTGPLAERAGHDLNYIALSGVLSGIGRAGEPPVPPLNLVGDY
FT                   GGGGMLLALGVVAALFNVQRGGEGQVVDAAMIEGAAQLGSVIWGLLASGNWREERASNL
FT                   LDGGTPWYDSYRTKDGGYMAVGAVESRFYAELLAKLGLAEAGLPGQHDRSGWPVLRERF
FT                   AAAFLTRTRDEWCAVFEGSDACVAPVLSFSEAPAHPQHRARGSFVEVAGVVQPAPAPRF
FT                   SATPSTIAKPAPQRGEHGLAALRDWGFDAAAVERMREHGLGYQPERPEA"
FT   gene            341615..342364
FT                   /locus_tag="Bxe_B2730"
FT   CDS_pept        341615..342364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2730"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2730"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33263"
FT                   /db_xref="GOA:Q13RM6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM6"
FT                   /protein_id="ABE33263.1"
FT                   /translation="MKVLVAVKRVVDFNVKIRVKSDGSGVELANVKMSINPFDEIAVEE
FT                   AVRLREKGVVSEVIAVSCGTSASQETLRTAMAIGADRGILVETDAELQPLAVAKLLKAL
FT                   VDREKPQLVILGKQAIDNDCNQTGQMLAALAGCAQATFASRVELSNDCATVTREIDGGL
FT                   ETLRLKLPAVVTSDLRLNEPRYATLPNIMKAKKKPLDVVTPEQLGVDVAPRLKALRTIE
FT                   PAGRSAGVKVPDVAALVAKLKNEAKVI"
FT   gene            342375..343319
FT                   /locus_tag="Bxe_B2729"
FT   CDS_pept        342375..343319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2729"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2729"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33264"
FT                   /db_xref="GOA:Q13RM5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM5"
FT                   /protein_id="ABE33264.1"
FT                   /translation="MTASNQVLVVAEHDQGSIRTATLNTVAAALQCGAEVHMLVAGYDA
FT                   TGAAQAAAAIKGVAFVLHADAPQLADGLAENIAAQVVALAANYGHILFPATSAGKNIAP
FT                   RVAALLDVAQVSDIVRVLSPDTFQRPIYAGNALVTVQSSDPVKVLTVRVTGFDAVAAEG
FT                   GAAQIEAIDTVADSGLSTFVERVVAKSDRPELGDAQIVVSGGRALGSNEKFTEVLTPLA
FT                   DKLGAALGASRAAVDAGFAPNDWQVGQTGKIVAPQLYVACGISGAIQHLAGMKDSKVIV
FT                   AINKDPEAPIFSIADYGLEADLFDAVPQLVNAI"
FT   gene            complement(343725..344549)
FT                   /locus_tag="Bxe_B2728"
FT   CDS_pept        complement(343725..344549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2728"
FT                   /product="Putative 3-oxoacyl-acyl carrier protein
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2728"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33265"
FT                   /db_xref="GOA:Q13RM4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM4"
FT                   /protein_id="ABE33265.1"
FT                   /translation="MGKLDGKVALVTGSGRGIGRAIAEKLASEGARLVINDLDADPAHE
FT                   TVEALKKMGAEAVACVGNVGAPDFADRFINTAMSTYKGIDIIVNNAGYTWDDVIQKMTD
FT                   EQWYAIIDCHMTAPFRILRAAYPHVKALHAADKEAGRDVYRKIVNISSTSALNGNAGQM
FT                   NYSSAKAGVIGMTRALSREWGRFNVNVNCVAFGLIHTRMTTADAHAGATVKIEGRDIRV
FT                   GLNPELLKTHAQRNPLGRGGTPEEAAGGVYLFCSPESNYITGQTIAVAGNLQ"
FT   gene            complement(344575..344991)
FT                   /locus_tag="Bxe_B2727"
FT   CDS_pept        complement(344575..344991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2727"
FT                   /product="Putative MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2727"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33266"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM3"
FT                   /protein_id="ABE33266.1"
FT                   /translation="MSTLSFDEVKVGDTLPPLTLAPIDRTTLALFAGASGDHNAVHIDL
FT                   DFARRSGMPDVFAHGMLSMAYLGRLLNAWVDQRQLRQFGVRFVGITHLGHQITCSGRVV
FT                   EKFEADGERRVKVEIQTANQYGEPRVLGDAVIAL"
FT   gene            complement(345004..345444)
FT                   /locus_tag="Bxe_B2726"
FT   CDS_pept        complement(345004..345444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2726"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2726"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33267"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM2"
FT                   /protein_id="ABE33267.1"
FT                   /translation="MIDKKHIGKVIPAFRTVAEAGRLRFFAKATGETNPVYFDESAARD
FT                   AGHPTLPLPPTFLFSLELEQPDKSWRDEIGIQVARILHGEQSFTYHKMAYAGDVLLFEC
FT                   RIADIYDKKGGALDFVVRETRVTNQKGEHVADMRSVLVHRNG"
FT   gene            complement(345472..346656)
FT                   /locus_tag="Bxe_B2725"
FT   CDS_pept        complement(345472..346656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2725"
FT                   /product="Putative nonspecific lipid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2725"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33268"
FT                   /db_xref="GOA:Q13RM1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM1"
FT                   /protein_id="ABE33268.1"
FT                   /translation="MTRNVFVAGVGMIPFKKPGTSDPYDVMGAGAVREALIDAGIDYAD
FT                   VQQAYAGYVYGDSTCGQKALYHVGMTGIPIINVNNNCATGSSALFLARQAVQSGAVDCA
FT                   LAVGFEFMQPGALSSKWSDRAPALERALSVVNELVDRTDLPSAIRQFSGAGRAHMEKYG
FT                   TKLETFAKIRAKASQHAARNPLAVFRTVVTPEEVLASPMIWEGVLTRLMACPPTCGAAA
FT                   AIVVSEEFARKRGLRTDVLIAAQSLTTDLPSTYDSRDMIRVVGFDMTRAGAKLAYEQAG
FT                   VGPEDIDVIELHDCFAQNELLTYEGLGLCAEGEAEKLVNDGDNTYGGKWVVNPSGGLLS
FT                   KGHPLGATGLAQCYELTHQLRGTADQRQVEGAKVALAHNLGLGGACVTTVYKAA"
FT   gene            complement(346687..347826)
FT                   /locus_tag="Bxe_B2724"
FT   CDS_pept        complement(346687..347826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2724"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2724"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33269"
FT                   /db_xref="GOA:Q13RM0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM0"
FT                   /protein_id="ABE33269.1"
FT                   /translation="MQITRTVFRDDHEMLRTTVRRFLERECTPKQAEWDKAGRVDRETW
FT                   LKAGREGLLCLTLPTEYGGGGGDFGHAAILNEEVNRAGLSGLGFGVHSDVIAPYIARIG
FT                   NEEQKQKWLPKTCTGESILAIGMTEPGTGSDLKAIRTTALRDGDEYVINGSKTFISNGL
FT                   NADLIILVCKTDPSAGSKGVSLIVVEATREGFRRGRKLDKVGMHSQDTAELFFDNVRVP
FT                   VSNRLGEEGKGFAYLMGELPQERLSIAIGAAAKLEACLEHTINYVKDRRAFNQTVWDFQ
FT                   NTKFKLADIKAQATAVRVLVDHYLAEHVRRRLTLEEAAIAKLFATESLGKALDDMVQLH
FT                   GGYGYMLEYPVARAFADARVNRIYGGTSEVMRDLISRKL"
FT   gene            complement(347872..349752)
FT                   /locus_tag="Bxe_B2723"
FT   CDS_pept        complement(347872..349752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2723"
FT                   /product="Putative AMP-dependent long-chain-fatty-acid--CoA
FT                   ligase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2723"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33270"
FT                   /db_xref="GOA:Q13RL9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL9"
FT                   /protein_id="ABE33270.1"
FT                   /translation="MTTLMASEYTAAPYRPVRFPERRPLVERRPDGTLMLSSASPPPDI
FT                   AQNSFAAFVPEWAERRGDSPAFCERDSSGDWRTMSWRELWRQLQTVAACLLEMGLGQQR
FT                   PLVLLSGNSIEQAVLLLAAEYVGIPAAPVSPAYSTLSKNFARLKGVLELVPPAAVFVQD
FT                   AAAFERALAIDELAATPVIAVRNVQPSHHAWADLLAADMTPARVAAVAAAHAAIRESDT
FT                   ARVLFTSGSTGTPKGVPLAYSNLKAVAAYYADNLGWLRESQPVFLDWLPWHHGLGGVLN
FT                   IGRSVQFGATHYIDDGRPLPGMIERTVRNLREVSPTVFTSVPSAWAVLAGELERDPMLA
FT                   RSLFANVQYLGYGGASLPTDVWHRIQRVAVDTIGKRIVFSTGLACTETSGMGTYCGWAA
FT                   TDLGNIGGPVPGSEVKLLPLEGGDGRYEIRMRGANVFAGYIGNAVLTAAAFDEEGYFRL
FT                   GDAVRLANPEDPAAGLLFAGRVVEDFKLTNGTWVRTGAVRLGLLDLCAPLISDAVICGH
FT                   DHEFLAALAWPNVAACRRLAPELAELDAAALVEHPVLVAALRERLGRHKGGGASRTIER
FT                   LMLMAEPPSIDANEIAEKGYVNQAVTRARRAHLIEQLYHTEPAAHIACAR"
FT   gene            complement(349962..352805)
FT                   /locus_tag="Bxe_B2722"
FT   CDS_pept        complement(349962..352805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2722"
FT                   /product="ATP-dependent transcriptional regulator, MalT
FT                   related, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2722"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33271"
FT                   /db_xref="GOA:Q13RL8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL8"
FT                   /protein_id="ABE33271.1"
FT                   /translation="MPQNSPPVDPRRSQRGAAESRADPRLIPPRDTARVVARERLLTQL
FT                   LEARRNRCVVLQGPAGCGKTSLLIAWREALLSLGFDIAWLTLAPEDNELAHFLDYLVAS
FT                   LAQVDPAMCHEAALLGGRGMDDEAVERTIIALVRGIAAHSNDVVLVLDDLHHVANARNH
FT                   EALQWLLDYAPANLHLVLVSRGAVPLSLGRPRDQGLVLELDMRDLRFTAAESEAFLKAQ
FT                   LGEIGQREARHMHELTDGWVAGLQLFAIRLKRKKQGITDLAPSDPLANAQLLDARGFAA
FT                   YFEREVLSRLAPSEVEMLVRMASCTRVCAPLCIALIGHGQSPAEVRALLTRLENDNLFI
FT                   APIESSGSETWYRLNPLFRETLLERFRARSELHQREVHLAAWLWFRDHRQHDDAVRHAL
FT                   LAGEPAAAADLVLRVARTMQIEGDLRKLVGLIRLLPLAEVQTRIGLRLWMLHLQLYARE
FT                   FDACAAAIARLHADIPESDTHSRYRLILLRAALAVQRDDTDEALSVLPHLRQIPAHADS
FT                   LTVGGRNNLLSWIHMRRGEYDEARRVQSEAPQPLVDGVPLMGTSAGILNGRCIAGFSYA
FT                   LEGKFIQVERISRDVLFEADQRGSAAAEAACFAAALLGEVLYEFNDLEAARKLLEDRVD
FT                   VLERVSIPDSVLRVLTVLSAVHWAEGHHLDAFAYLERLEEYATQYGLPRLVAHSVAEQI
FT                   HRHLLSGQFDAAEAGLARLDMIAARAAGTVTDAATGTAAEIHAMTESSHINWCIAHEDF
FT                   EGAACRLQALIPFCEARGWQRHVAHFQMQAAVVDAGRGRAEAAREAVLAALRRGHRLGL
FT                   VRSLLDADPSALDLIAAVVQGEPHDPVLSFYVSRLNAAKAASSSGAEPPAKPASRSAPP
FT                   TAAETLSEREVRVVGLLAQALPNKKIARTLGISPETVKWHLKNIYGKLSVTSRDEAVAR
FT                   VRDLELGSTPVAGEETD"
FT   gene            complement(352939..353580)
FT                   /locus_tag="Bxe_B2721"
FT   CDS_pept        complement(352939..353580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2721"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2721"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33272"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL7"
FT                   /protein_id="ABE33272.1"
FT                   /translation="MSASASEISMSAIPSNPSTRQLVHTRRVECMGFKRRDGLFDIEGH
FT                   IRDTKADDSDLLFKTVPAGSPIHDMRIVVTIDSELLIHRIEAHTDSSPSRFCTEINEAY
FT                   AGLEGMTIGAGFMKEVKSRLSGPKGCTHLTELLGPIATTAIQTLMGWRKAAPAGRDSGE
FT                   ATGSAQAHPMVDTCYAWRAGGDVVQFVARRKQESVRGEAQTAGATPPPDQ"
FT   gene            353935..355098
FT                   /locus_tag="Bxe_B2720"
FT   CDS_pept        353935..355098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2720"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2720"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33273"
FT                   /db_xref="GOA:Q13RL6"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL6"
FT                   /protein_id="ABE33273.1"
FT                   /translation="MRFMSQSICGASLILAAGGAAAQSSVTLYGVADVFVQYLDNGGNH
FT                   SFSERSGGSTGSLFGLKGSEDLGNGLKAVFDVETGFNLNNGAFFADSTAMFYRQSWVGL
FT                   KHDSYGQLSFGRQYQPSFWAVYFTDPFRGNEVMSPLAAADLAGATDRSTLATQYVSGRT
FT                   SNSIVYTSPDMRGVHVYAMYGMPATVTQPVPVRSGAMIDLAANYSGYGFYAGVGYQYQH
FT                   GSQETAPLVAAAPSLLTTFDLMGTEHFTGALAYRWGIVNFQFNYSYNRPKDAPAGALVT
FT                   VTPTVKLPLASLVHSYSIIELGATIQATPADVIEIAGIERDVRGVHDNTPGIEVGVDHS
FT                   LSKRTSLYMRAGYLKNNGTANMSWPGTTGVASGSKQILAVLGMTHRF"
FT   gene            355198..355548
FT                   /locus_tag="Bxe_B2719"
FT   CDS_pept        355198..355548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2719"
FT                   /product="Putative phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2719"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33274"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL5"
FT                   /protein_id="ABE33274.1"
FT                   /translation="MNQNKVFTLAGGVLLVLASFNVYAQGSDAAPASGHAYAPDAKAIK
FT                   AADRALQKNVVRALSRTKGLRAATITVRAHNGAVILEGTVPEQAQVGLATQAAEGVEGV
FT                   TSVTNALTLSTL"
FT   gene            complement(355648..357069)
FT                   /locus_tag="Bxe_B2718"
FT   CDS_pept        complement(355648..357069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2718"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2718"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33275"
FT                   /db_xref="GOA:Q13RL4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL4"
FT                   /protein_id="ABE33275.1"
FT                   /translation="MKTLNTFYIGGHWVEPSAGSTQTDIVNPATETLTGHLAMGTAQDA
FT                   DRAIAAARAAFPAWSESSRAERVALLERIIECYRARLDDIAEAVRIEIGAPITLCKHLQ
FT                   AAIGLSQLEAALETLRHFEFETRHDKSYVRREAVGVAALITPWNWPLNQIAAKVAPALA
FT                   AGCTIVLKPSEIAPLDAVIFAEIMHAAGTPPGVFNMIFGEGRVVGARLSSHPGVDMVSI
FT                   TGSTRAGVEVAVSAAPTVKRVAQELGGKSPLLILDDADLQQAVTSGVMQCMANSGQTCV
FT                   APTRMLVPRERYDDAIAIAAAVANGIVVGDPADPATRMGPISNRAQYEKVQHMIRAGIE
FT                   EGARVIAGGPGRPEGLAQGFYARPTVFADVRNDMMIAREEIFGPVLVMIPYDGEEHAIT
FT                   IANDTQYGLAGYIATRDPERARRVAARLRVGSVRINGAMLDITVPFGGYKTSGNGREYG
FT                   REGLAEFLECKSVTG"
FT   gene            complement(357104..358021)
FT                   /locus_tag="Bxe_B2717"
FT   CDS_pept        complement(357104..358021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2717"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2717"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33276"
FT                   /db_xref="GOA:Q13RL3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL3"
FT                   /protein_id="ABE33276.1"
FT                   /translation="MQATEIAPDTAVVHSNSDAWPFVVERYTPTIGAEIRGVDLRDPLD
FT                   DETYAALRRALLKFKVLFFRDQDITPAQHVAVAKRFGELEIHPAFPHHPEHPELVILGR
FT                   NDTKRGRENLYHSDVSWREIPSMGSMLRCVQCPEVGGDTMWINMVAAYDNLPGDVKARI
FT                   AGLNAVHDFLPLFGIAVPKDQHATMRAKFPPVEHPVVRIHPETGEKILYVNEAFTTHLS
FT                   NYGQLTATEYRVGFDYKLAELDLLQYLFRQAQAPEYQVRLKWRPNTIAFWDNRSCQHYA
FT                   VQDYFPAPRHMMRATVIGDRPLAA"
FT   gene            complement(358175..359863)
FT                   /locus_tag="Bxe_B2716"
FT   CDS_pept        complement(358175..359863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2716"
FT                   /product="Putative GMC oxidoreductase"
FT                   /EC_number="1.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2716"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33277"
FT                   /db_xref="GOA:Q13RL2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL2"
FT                   /protein_id="ABE33277.1"
FT                   /translation="MIRPGNNAQNTMIAAEYDYVVVGAGSAGCAVAARLAEDLSVTVAL
FT                   LEAGPHDHHMSVWVPIGLASTVQKAGPRNYAYYTERQPGLDGRPSFQPRGRGLGGSSSI
FT                   NGMVYIRGHRNDYDEWAGMGCTGWGFDDVLPYFRRSECNQRHAGRTDDPWHGGDGPLHV
FT                   SDLRSPNPFSHRFVNAALQAGLPLNTDFNGAEQEGAGLYQVTQFNGERWNAARAYLHNG
FT                   NAKDANLNGGRPNLDVLPDTQVLRLVVEDKRARGVRVVRAGIEQTVRARREVVLSCGAF
FT                   NSPQLLMASGIGPAGHLRSHGIEVIQDLPGVGENLQDHLDVIVNKQVKSNDLYGYSAGG
FT                   FLRLASGIWRYRRDRSGMVSSNFAEAGAFVKTRPDLAVPDVQLAFVLALLGNRTVAKRS
FT                   KLGHGYSCHAYILRPQSRGHVRLRSADMRDAPSIDPRFLSAEADMDALVAGVRIVRRIF
FT                   AQPALAEAGGQELLTDDFGPDDSNEEAIRAFVRSRADSVFHPVGTCKMGIDSMAVVDPS
FT                   LRVRGIEGLRVADASIMPTLIGGNTNAPAIMIGEKAADLIRADNR"
FT   gene            complement(359944..361233)
FT                   /locus_tag="Bxe_B2715"
FT   CDS_pept        complement(359944..361233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2715"
FT                   /product="major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2715"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33278"
FT                   /db_xref="GOA:Q13RL1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL1"
FT                   /protein_id="ABE33278.1"
FT                   /translation="MTASPDFQAKSAWTMTLLLTGLALINFLDKIVLGLVAVPLTAELH
FT                   LSPEKFGLVAGSFFWLFSISTVLVGFLSNRFQTRWLLLAMGLSWAALQLPQAMATSALA
FT                   LLICRVILGAAEGPAFPVSVHALYKWFPDRQRNLPVAIINQGAAFGMLLAGLVIPLVTR
FT                   QWGWRMNFLLLGAIGAAWSVLWACFGREGGLGRQQAAPIVRTRVSRLPYRRILTDRSVL
FT                   SVFALGFTAYWTLGLSLTWIPTYLEKGLGFNGVEAGRCFAVVVATATPVNVGLSWLSQR
FT                   MLGRGVSTRKARVHLICLSAVAGALLYITLMLLHLPPLQKVALLAIAGALPTLSFTLAP
FT                   ALLAEMVPDTQRGSLVAIHTALASLGAAFAPAVMGRIVQVYGGNNSHAYELGFTVSAVL
FT                   LIAASLAALRWLHPDRSHKTLNHFATQATA"
FT   gene            361966..363642
FT                   /locus_tag="Bxe_B2714"
FT   CDS_pept        361966..363642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2714"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2714"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33279"
FT                   /db_xref="GOA:Q13RL0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL0"
FT                   /protein_id="ABE33279.1"
FT                   /translation="MSIPTFLSDDEITREAIEYDVVIVGGGPAGLSAAIRLKQLAAEQG
FT                   AEIGVCVLEKGSEIGAHILSGAVMDPRAMTELIPDWKEKGAPLTVDVTEDRFLFLTETG
FT                   SKSVPVWALPDNFKNHGNYVISLANVTRWLGQQAEALGVEIFPGFPAAEILYNEDGSVK
FT                   GVATGNLGIGKDGQPTENFQLGMELHAKYTLFCEGARGHLGRQLNDKFRLRDGVDPQVY
FT                   GIGIKELWEIDPSKHKPGLVMHTAGWPLESDTYGGSFLYHMDNNQVVVGFVVGLGYTNP
FT                   YLSPFEEFQRYKTHPEIRKVLEGGKRVSYGARAITAGGLMSLPKLVFPGGALVGDDAGF
FT                   LNASRIKGSHAAIKTGMLAAEAAFEAVQAGRQSDELMAYPESFRTSWLHTELHRARNFK
FT                   QWMSKGLYLGTLMVGIEQKLLGGNVPWTLHHQHWDHEMLKPASQCKPITYPKPDGKLTF
FT                   DRLSSVFISNTNHEENQPPHLTLKDPSVPVNVNWQTYAGPESRYCPAQVYEFVKNDDNT
FT                   ERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM"
FT   gene            complement(363836..365875)
FT                   /locus_tag="Bxe_B2713"
FT   CDS_pept        complement(363836..365875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2713"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33280"
FT                   /db_xref="GOA:Q13RK9"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015289"
FT                   /db_xref="InterPro:IPR038964"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK9"
FT                   /protein_id="ABE33280.1"
FT                   /translation="MMSRGIGLVTVLLAISVGLAACDGDSGGPTASQAANVSTSGLAPA
FT                   NAAPASNDNASIDAATTTPLPCDAAATANTPCSAAHSVTRLLTRNYRGPLFQVQRASDN
FT                   AKQDIYPYTSSTLPHGADRSLIGSANVKSANTFCNNTTCSVTYIYDQIDLVAPLKGGAF
FT                   GNVPATLTLNPDGTESLTVPNSGSRPQKTTTVPVLNGFATITLPGTSGALAVQLSQPPT
FT                   ALTAQSPTLQLSIGNDLPALSGTPAKLGFVPLQGAQIPALGTLAGQAYRNRFGTVNQSI
FT                   GDSDIAEYMVAGAHYSQSSTCCGTYGNMENSANPGTYAHGEIEGEMFALAFSNGNAAVF
FT                   GYCDGNSNQPPNVKDPVCNARDTNWPGVDAEAGVYLYGPPQPAREKFVTVLSKYSPVTA
FT                   SNIFAVKGGSASQSVLTALYDQAPPEAYNFGNDAGHAFNGQWQGGLSLGEGGDGSAAPI
FT                   QFFEGAVITKATSDTTDNAIQASIASFYGPPADKAVAACYANNLINSPLSLATPDIWSQ
FT                   QNGGTAVPATDISGVNRGAATVTSTNGSSVSNVREIIRVQGGQSYSFTDYVLATSNATV
FT                   FPGGSIQTDDPSGTEFAWVLNTNTGAVVRGTWGAGQPTALSAVRSGNWWKVTMTLTAPA
FT                   GSNNASVFIDPPTSNAAGARSQQASYLSATHYCPSLAIVASSGT"
FT   gene            complement(366562..367944)
FT                   /locus_tag="Bxe_B2712"
FT   CDS_pept        complement(366562..367944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2712"
FT                   /product="putative TRAP-type uncharacterized transport
FT                   system periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2712"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33281"
FT                   /db_xref="GOA:Q13RK8"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK8"
FT                   /protein_id="ABE33281.1"
FT                   /translation="MPPVRSTDQRDQTVPRHNPVLQRARKAPVKPRRPWLFITGAILLL
FT                   AVSGWVLAIILAPAFQHTIVVTSGADGGIYRGFADRYAPILKQKGITLDIRSSSGSVEN
FT                   YQRLKDPRSEYQVGFIQSGTTRPKETDDLKTIAAVSYEPIWVFYRGDTTIDRLAQLRGE
FT                   RISIGVPGSGLLNVALQLLAYSGVSGDNTTLLQMDAAKAYQSLENGQLDAAFFIGRPDA
FT                   EMQRTLLNSNLKLMSFAQADALVQKFPSLSKVIFPRGSTSIANDRPSADVTLLAATALL
FT                   VAKESLHPAFVYLLLDAASAVHGREDYFTPLGKFPNVNTDEFPVSDESIRYFKSGRPFL
FT                   QRYLPFWLASFVERRLLILLPFAALLLGVLQALPRIAETRIKNRLVVWYREVKLLEDEI
FT                   WRSDRPGREQISQWSEEIEQIDAHANQIRLPQRYLPDIYALKQAIDVVRGRISYMARQT
FT                   EK"
FT   gene            complement(368052..368681)
FT                   /locus_tag="Bxe_B2711"
FT   CDS_pept        complement(368052..368681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2711"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2711"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33282"
FT                   /db_xref="GOA:Q13RK7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK7"
FT                   /protein_id="ABE33282.1"
FT                   /translation="MWFRHSLLATARRVAKGRCLATHSRSVARRTASPWRNRFLACARR
FT                   QLIDSRRAGGKKTGPNPTDRRKLGSKHHLIVDAQGIPLAVILSAANRHDITQLDALVDA
FT                   IPRIRGKRGRPLHKPRIVQGDRGYSSEPHRQRLRERGITPLLAKVGAPHGSGLGKTRWP
FT                   VERSIAWLHSFRRLKIRYERYAHVHEAFLSLACALICWTRLKPLFN"
FT   gene            complement(369038..369391)
FT                   /locus_tag="Bxe_B2710"
FT   CDS_pept        complement(369038..369391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2710"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2710"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33283"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK6"
FT                   /protein_id="ABE33283.1"
FT                   /translation="MTDIVRIETNQRMSRVVKAGGLVFVGGQTSADHTADVKVQTAKVL
FT                   EKIDNYLEKAGIDKTRLVSAQVWLADIARDFAGMNEVWDAWVPQGSAPARATVQAKLAA
FT                   PELLVEIAVVALA"
FT   gene            complement(369471..370643)
FT                   /locus_tag="Bxe_B2709"
FT   CDS_pept        complement(369471..370643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2709"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Endoribonuclease L-PSP domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2709"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33284"
FT                   /db_xref="GOA:Q13RK5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK5"
FT                   /protein_id="ABE33284.1"
FT                   /translation="MNDATDIQEADVLVIGGGLHGTSSAFHMARRGANVIVLEADYVAR
FT                   HSSGVNAGGVRTLGRPLPEIPLALMSREIWHGMNDLLGEDGGFVPSGQLKIAETDDELE
FT                   ACRQRVALLESHGFTHEKVIDRQTVLDLEPALARHVTGGIWAERDGYALPYRTTTAFRL
FT                   AAQRLGARFLEGTPVRRIEQRGTRWFAVTPHGTFSAQKLLVTAGAWSGELAQQVGEPVP
FT                   VHPEGLMLMVTHRVAPFCSATLGATGRPLSFKQFDNGTVVIGGKLIGIADLAHRHGEVD
FT                   FVRLVRSARTVTDLFPHLRHLGVNRAWAGVEAFTEDELPVISASRKASDLYYSFGYCGS
FT                   GFQLGPGCGKLVSELMLDGAPSISLDAFAIDRFGRNAASSLTRAASLATH"
FT   gene            complement(370636..372054)
FT                   /locus_tag="Bxe_B2708"
FT   CDS_pept        complement(370636..372054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2708"
FT                   /product="Putative opine oxidase subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2708"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33285"
FT                   /db_xref="GOA:Q13RK4"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK4"
FT                   /protein_id="ABE33285.1"
FT                   /translation="MAADFASEFASETVDVVVVGAGPAGMSAATRTARAGLRTVLIDEQ
FT                   DAVGGQIYRGIGRADARRKEILGPDYAAGAAIADAFAASGAHHVTNATVWQVTRERGVN
FT                   YLKDGKIGSFDAKCVILASGALERPFPIPGWTLPGVLTAGAAQILLKSAGEVPAAPPVL
FT                   AGCGPLLYLLGWQYVRAGVPIRALVDTTRHEDRWRAKRHVVSALRAWPFLSKGLQLIRT
FT                   LRQAGVPIFEAADDLRVEARIGTDHVERAAALHFTTQGTAHRIEADVILLHQGVVPNTQ
FT                   FTQALRAAHRWDNAQLCFTPKVDAWGELDVPGIFIAGDGAGIGGAQAAALQGTLAGLAA
FT                   AAQLGALTTAMRDAEAVAHRRALADVMRIRPFLDSLYRPRDINRIPRDETIVCRCEEVT
FT                   AGELRKFVELGCVGPNQAKSFGRCGMGPCQGRMCGLTVTEVIADARRVSPAEVGYYRIR
FT                   PPIKPLTLGELAGE"
FT   gene            complement(372044..372415)
FT                   /locus_tag="Bxe_B2707"
FT   CDS_pept        complement(372044..372415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2707"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2707"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33286"
FT                   /db_xref="GOA:Q13RK3"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK3"
FT                   /protein_id="ABE33286.1"
FT                   /translation="MTTQPTHTLFKPLPGAQGAAAANVAIWFNDQPLSVPGGRSVAAAL
FT                   LAAGVSRFRATPVSGAPRGPFCMMGACFECLVEIDGVPSRQACMVEVKAGMRIHSQEGA
FT                   RDLPPASMTDAPLENAHGR"
FT   gene            complement(372423..373559)
FT                   /locus_tag="Bxe_B2706"
FT   CDS_pept        complement(372423..373559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2706"
FT                   /product="Putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2706"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33287"
FT                   /db_xref="GOA:Q13RK2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK2"
FT                   /protein_id="ABE33287.1"
FT                   /translation="MTLTSTASPDVLVLGGGLVGSAVAYGLAREGARVTVLDEDDGGFR
FT                   ASRGNFGLVWVQGKGYGLSPYARWSRSSATRWPGLAEALLEETGLNVALRQPGGFHFCF
FT                   NDNELAERDKRLSTLQAELGDYPYQMLDAAEVRARIPQVGPAVIGASYSPMDGHVNPLK
FT                   LLRGLHTAMQARGVRLVSSERAERIEPQAQGFVVHGKRGTYRAARVVLAAGLGNRTLAP
FT                   FVGLDAPVAPNRGQVLVSERVAPFLDYPTLNVRQTDEGSVQFGDSMEEVGFDDFTTTHV
FT                   LADIARRGVRAFPMLQHVRLVRMWAALRVYSPDGFPIYDQSAAHPGAFVVTCHSGVTLA
FT                   AAHALRVAPWIMGAPMPEELPTFSARRFEHARELTPAH"
FT   gene            complement(373556..374353)
FT                   /locus_tag="Bxe_B2705"
FT   CDS_pept        complement(373556..374353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2705"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2705"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33288"
FT                   /db_xref="GOA:Q13RK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK1"
FT                   /protein_id="ABE33288.1"
FT                   /translation="MKQNGILGLVYNAFFLTFILAPLVVVMLVAFTDKGFISMPFDGAS
FT                   LRWFRAILENDDIVSAFWLSVRLAFVAATIGVLLAVPAALAIARYRFPGRAALTSFFLS
FT                   PMMIPAVVLGIAFLRFLSLLHLSGSFWSLVCAHVIIVLPYALRLALSSAVGLDRDAERA
FT                   ALSCGASRFTAFRRVVLPMIRTGVAGGWVLSFIQSFDELTMTIFVATPGTTTLPVAMYN
FT                   QIAQTIDPLVASVSAVLIVGTVLLMILLDRMVGLDRILIGEAR"
FT   gene            complement(374370..375242)
FT                   /locus_tag="Bxe_B2704"
FT   CDS_pept        complement(374370..375242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2704"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2704"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33289"
FT                   /db_xref="GOA:Q13RK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK0"
FT                   /protein_id="ABE33289.1"
FT                   /translation="MATLDDARPGAAPWLLSGPALLLFVGLLLVPLLLTLMLSFRVFSD
FT                   TAGVTAAYTLANYWEVVSDPYYGTIFLRTAGLAFAVTLLSIVLGVPETIVLARMKRPWQ
FT                   SLCLLIVLGPLLISVVVRTLGWQILLGNNGVLNNILQTLHITDEPIRLVFTMTGMIIAL
FT                   THVLVPFMVMSVWATMQKLDPQVEWAGRSLGGSPFAVFRRVVLPQIMPGVLSGSIIVFA
FT                   LSASAFATPALIGGRRLKVVATAAYDEFLGTLNSPLGASIAVLLLIANVAIVMGCSRLA
FT                   ERRFQHIFD"
FT   gene            complement(375229..376308)
FT                   /locus_tag="Bxe_B2703"
FT   CDS_pept        complement(375229..376308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2703"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2703"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33290"
FT                   /db_xref="GOA:Q13RJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ9"
FT                   /protein_id="ABE33290.1"
FT                   /translation="MAFLTLQNISKRYGDFTAIEHLDLSVERGELLSLLGPSGCGKTTT
FT                   LQMVAGFVTPTTGSILLDGRDITHERPEKRGIGVVFQSYALFPHMTVAGNVGFGLEMRK
FT                   VRRKEREERVAEALSLVRLKGLGHRYPKELSGGQRQRVAIARAIAMQPELLLLDEPMSN
FT                   LDAKLREEMHIELRTIQKRLGITTILVTHDQVEAMTMSDRIAVMHRGTIAQLSTPYDAY
FT                   ERPATPFASTFLGRTNAFSGEVLRRNPRCAEVDVAGTTLHVPHEGRHVVGAVNVYIRPE
FT                   KVYLANGDARVRGRISTRVFVGNQWLLEVDTELGKLRIAQPNHGAPPPEEGQEVGLAWT
FT                   DDDLRVLTQDNPERTHGHA"
FT   gene            complement(376367..377518)
FT                   /locus_tag="Bxe_B2702"
FT   CDS_pept        complement(376367..377518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2702"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2702"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33291"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ8"
FT                   /protein_id="ABE33291.1"
FT                   /translation="MIGRRETAFYSTGSEARPPPTPELEIVVMRSALHRRLSAPSRTAI
FT                   AALSFVSALAAPLAAHAETTLYVANVGGSNEQVYRQKIIPPFEKAHNVRIVYVAGNSSD
FT                   TLAKLQAQKGHQQINVAVMDDGPMYQAMQLNLCAKLDDAPVMKDLYPLAKLGPTAIGVG
FT                   MVATGIGYNEEAFRKAGLPPPDSWKALTDPRIKGKLGVPPITNTYGLHTLVMLARLSGG
FT                   GEKNIDPGFTAMTKQVAPNVLSWAPTPGEMDGQMQSGDVILAPYGSGRAVALQNTGFPL
FT                   KFIYPKEGAVALQVAACVVAENAQPQLSQQFVQYLLSPEVQALQAQGIGLGPVNKTVKL
FT                   TPEVAARVPYGPEQISKLTAMDWTTINQHRTEWTERWNRSVER"
FT   gene            377596..378549
FT                   /locus_tag="Bxe_B2701"
FT   CDS_pept        377596..378549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2701"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2701"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33292"
FT                   /db_xref="GOA:Q13RJ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ7"
FT                   /protein_id="ABE33292.1"
FT                   /translation="MNLKHIEAFRAVMVSGSMTAAAKALFTSQPNVSRLIAQLERDTGL
FT                   QLFQRSGVRLIPTSEGEAFFREVERAFVGLQGLANAAAQIRNLGSGRLRIAAMPSAGMT
FT                   LVPHAIKRFVELFPDVTVSLHVNTSGTVNHWTASQFCDLGVAVYVSEASDCEVEQLSDL
FT                   AAVCVMPAAHRLAAKRSIKPEDLEGESFISLCHGDGTRALMDEVFQRAGVQRVMAIEAQ
FT                   YTAMCCEMVRHGMGVTLAHPIVARDFAGPDIAIRPFLPATRFQTYLLFPPHRPRERLAS
FT                   AFVEVLRELHDELLAEVVVPTPSVGRRRVVRSASKG"
FT   gene            378773..379360
FT                   /locus_tag="Bxe_B2700"
FT   CDS_pept        378773..379360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2700"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2700"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33293"
FT                   /db_xref="GOA:Q13RJ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ6"
FT                   /protein_id="ABE33293.1"
FT                   /translation="MRIPPLKAIVAFESVARTKSVNRAADELGLTPSAVSHQIANLESM
FT                   VGRPLFTRLGRGLVLTPTGQQYLSDVTGSLADLSRATERASSQSGMEILRIHSSPSFGL
FT                   MWLLPRLASFQEANGDIQLNLACSYEDVSFTSGYYDVDVRHGYAHWTDGEIKTLRNEFI
FT                   APLASAEYLGRHPRRSAMRWFNWLARRRAWSA"
FT   gene            379348..380214
FT                   /locus_tag="Bxe_B2699"
FT   CDS_pept        379348..380214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2699"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2699"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33294"
FT                   /db_xref="GOA:Q13RJ5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ5"
FT                   /protein_id="ABE33294.1"
FT                   /translation="MVGMTADLGKYTDLHIFGKEFPERYYQMGMAEQLLMGAAAGMAHE
FT                   GAQPFVTTYAVFATRRAYDFMHQAIAEDNLDVKIICALPGLTTGYGPSHQAAEDLALMR
FT                   AMPNMTVIDPCDALDTEQMVPAIAAHNGPVYARLLRGNVPAVLDEYDYQFELGKAKLLR
FT                   DGAEVLIISSGIMTMRSLEVAKLLQADKVGVGVLHVPTIKPLDTETILREARRTGRMVV
FT                   VAENHSVIGGLGEAVATTLLTAGVTPTYRQIALPDQFLAAGALPTLHDRYGISTSVMAE
FT                   NIKGWLG"
FT   gene            380545..380853
FT                   /locus_tag="Bxe_B2698"
FT   CDS_pept        380545..380853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2698"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33295"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ4"
FT                   /protein_id="ABE33295.1"
FT                   /translation="MNKATSTLIAAVAALALSGGAYAQSNNTLATPSVVSPAAVSPANA
FT                   TSGYGTSGATNSDSGMSGGSANPGLQQTTNTSSTPNASAYGVNNTLATPGTASPAGK"
FT   gene            381232..381975
FT                   /locus_tag="Bxe_B2697"
FT   CDS_pept        381232..381975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2697"
FT                   /product="Putative short-chain type
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2697"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33296"
FT                   /db_xref="GOA:Q13RJ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ3"
FT                   /protein_id="ABE33296.1"
FT                   /translation="MKIASPVALVTGSTSGIGAAIARRLSSEGFSVVLHSRSSAETGQA
FT                   LARELGSAIYVQADLADDADRIRLIREAVAAWGRLDVLVNNAGISRVIPHADLAAATPA
FT                   VWAELHEVNVVAPFRLIAEAEPALRDAVQRVRPGCVINISSHAGVRPKGASIPYAATKA
FT                   ALNHMTRLLAVSLAPDIRVNAVAPGLVDTPLTADWTQAQELWKTRAPMRRSASPEDIAQ
FT                   AVMMLVASDYLTGEILLSDGGLNLT"
FT   gene            complement(382265..383428)
FT                   /locus_tag="Bxe_B2696"
FT   CDS_pept        complement(382265..383428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2696"
FT                   /product="Putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2696"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33297"
FT                   /db_xref="GOA:Q13RJ2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ2"
FT                   /protein_id="ABE33297.1"
FT                   /translation="MVIRSNGTRIHVTQQGSGELALVFLHYYGGSSRTWDAVAGELSDR
FT                   YRIIATDHRGWGDSEAPADGYRIADLAADAEGVIEALGLRRYVLVGHSMGGKVAQLIAS
FT                   RRPRGLEGLVLVAPSPPSPMLLSDEQRATLTGAYQTRESVEFVIDHVLTAKPLDAARRE
FT                   RVIEDSLRGAPQAKAGWPNVAMREDISAATASIDAPTIVISGELDQVDRVATLQAELLP
FT                   RIPHAAMHVLPGTGHLSPLEAPAEVARLIARFVAAIESKSVVCNSPEQVPVAFDAALNA
FT                   GDLDALLGTFSNLATMRMTNGEVVQESPAGLRIGFAQLLALRPHIRNEVRRVLTSGDIA
FT                   LVLLDWTLNVTLPDGREHEERGTATQVMEKGRDGGWRLRISNPPGLN"
FT   gene            383544..384485
FT                   /locus_tag="Bxe_B2695"
FT   CDS_pept        383544..384485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2695"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2695"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33298"
FT                   /db_xref="GOA:Q13RJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ1"
FT                   /protein_id="ABE33298.1"
FT                   /translation="MDRLTSLGVFVAAVEEGSFAGAARRFGLSAAMAGKHVSALEAELN
FT                   ARLLHRTTRRLSLTDTGQTYYERSKRILEAFDEAKREASDSQGTARGVLRIAAPVTFGA
FT                   MHLGEVVARYMEDHPHVNVEVLLGDRYVDLIDAGVDVAIRIGKLEDPGLVTRRLAPCRM
FT                   VVCASPAYLKRHGTPRKPDDLLRAQRLAFSEAVSAGDWTLHDRKNRAHVIDGPCRMTAN
FT                   NTQMLLASAIAGAGIVYGPTFVFGAHIRSGELVALLPAYRAADLTIQAVYPSARRIPLK
FT                   VRRFVDYLAETFGDEPSWDRKEMPQKSGCSGC"
FT   gene            complement(384709..385455)
FT                   /locus_tag="Bxe_B2694"
FT   CDS_pept        complement(384709..385455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2694"
FT                   /product="Putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2694"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33299"
FT                   /db_xref="GOA:Q13RJ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ0"
FT                   /protein_id="ABE33299.1"
FT                   /translation="MPAHLPNLNDRVALVTGGSRGIGRAISIALAAAGASVAVNYRQRG
FT                   NEAAGVVAEIERAGGRAIAVRADVSVADDVKAMFREVENHLGLIDVLVNNAGTGTIVDI
FT                   DDLTEAEFDRTLAVNLKSAFLCTQAALPGMRARHWGRIVNLSSAAARGAGLLGVHYNAS
FT                   KAGVEGLTRGYAAKLAREGITVNAVAPGPIDTEMAGPLKAANVADKLPVGRLGEASEVA
FT                   QAVLMVVGNAFITGQTIPVNGGVSFI"
FT   gene            385681..387087
FT                   /locus_tag="Bxe_B2693"
FT   CDS_pept        385681..387087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2693"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2693"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33300"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI9"
FT                   /protein_id="ABE33300.1"
FT                   /translation="MYSKTQIDPVVSFRNSQGEQVRGTIINLQRKSLVMEVYNPYSIVQ
FT                   VSEVLSDLSVKMGTEHAYSGKAVVISMVNTGLTAIVSVTLIAEWLELSGGALEAPAVGE
FT                   EARRFVQDWSERFKIRRDYQIAVNQIRAFLSDMSRWVEQADLVDTMPKEGKTLRQDFFL
FT                   ELASPLMERTKVYFDEFEGEARLVDEELAPAHRAFAQAALHPLLLRSPFVFRTFTKPLG
FT                   YAGDYQMVNQMLDDPRQGPSTYFQIVNAAFLQTAVARAHRNRVELLVDYLTRLANEARA
FT                   AQRPFRVLNVGCGPAQEIQRFMHEYDEPEWLTFELLDFSQETLDWTRDRLGSIAQKTGR
FT                   RMTISYTHDSVHHLLKRRMDADAADVREFDAVYCAGLFDYLSDKVCARLNQHFASRTRR
FT                   GGRLLVTNVHADNPERFSMEHVLEWYLIYRNEAQMAEIMPDSCGEPRLYTDSTGVNVFA
FT                   EATIGPQQVA"
FT   gene            387089..388426
FT                   /locus_tag="Bxe_B2692"
FT   CDS_pept        387089..388426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2692"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2692"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33301"
FT                   /db_xref="GOA:Q13RI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI8"
FT                   /protein_id="ABE33301.1"
FT                   /translation="MTTSLAGLHSNYREELRDYRLLCSKAGGLTVIVLVLMGVALDYVV
FT                   YPAEQKRFAIVRVLTSAAIGLALLSLCTEAGKRHVQIITFFWLLLPQAMISWMIYVTQG
FT                   GESLFYAGLMLTIFAVGILFPSGYWQTLAFGLVTVLLYYVACAAHPGGIQNPSKFQFQL
FT                   ILIFFCALASSIYTYFNEKGRFQLFRLKDEVAHKNDQLARTNDNLAQIKGQLLQQEKMA
FT                   AIGTLSAGLLHEVNNPVNFCLMAIEVAMEEPQAKDSPSLQECLTDVKQGMLRIQHIVSD
FT                   LKTFAYRKPGATADDVPFLFEKALDASIRLSAHELRGVNVTRELPGDTLVLGDEAAIIG
FT                   VLINLFSNAALAMHKAGTVSPQVRITAQWRDDRLHVNVRDNGPGIAAENLARVFEPFFT
FT                   TRDVGQGLGLGLSISYAVVERHGGTLFAESQLGEWTAFNFDLPRVE"
FT   gene            388434..388838
FT                   /locus_tag="Bxe_B2691"
FT   CDS_pept        388434..388838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2691"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2691"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33302"
FT                   /db_xref="GOA:Q13RI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI7"
FT                   /protein_id="ABE33302.1"
FT                   /translation="MRETQQARHTVVYVDDEELARKYFARAAGSDFEVLLADGADEAMT
FT                   ILRREGPRVAILVTDFRMPGRHGGDLLRQVSQEYPHIVRILVTAYADKNALLEAVNSGE
FT                   VFQILEKPLGVGRVREVLASAATAPVLRPK"
FT   gene            388838..389026
FT                   /locus_tag="Bxe_B2690"
FT   CDS_pept        388838..389026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2690"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33303"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI6"
FT                   /protein_id="ABE33303.1"
FT                   /translation="MQRLPAAPVITHAGVSGFGMIFCNRVTQFFRGSIRIASASGAGMT
FT                   VTPEFPNFKDRTHRSYQ"
FT   gene            389023..390042
FT                   /locus_tag="Bxe_B2689"
FT   CDS_pept        389023..390042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2689"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2689"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33304"
FT                   /db_xref="GOA:Q13RI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI5"
FT                   /protein_id="ABE33304.1"
FT                   /translation="MSNTIANQTPLPAILFVDDEATAAKYFERAIGAIAPVVTGASVEE
FT                   GKAMLDAHAASLTVLVSDQRMPGEYGNELLRYARERYPHIVRILTTAYSELDQTVEAVN
FT                   QGQIHRYIKKPWDISALRMEMKQALELAGLRKERDQLVREKLGVLQTQTVATRIGTVYT
FT                   LCASLIGPGRFQPVETYLAGTELAGARNVEPDWQRMDYADLVHVESECSGSFGHAVGTR
FT                   LAELRTQNAGRSAVDAVQVLTEILGASVRGDGDALIWTSPATLSEFLARPVGQAVSAEH
FT                   AGWLAGLLWLEEAGGALRFVREGDTIVCRAGTRAASFSADRLAVWIERFSEQAFEQAT"
FT   gene            complement(390220..390981)
FT                   /locus_tag="Bxe_B2688"
FT   CDS_pept        complement(390220..390981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2688"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2688"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33305"
FT                   /db_xref="GOA:Q13RI4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI4"
FT                   /protein_id="ABE33305.1"
FT                   /translation="MNTVPQAPLILITGGGRGVGAATARLAAAQGYDVAISFVSDESAA
FT                   LAVAADVEAAGRRALAVRADSADPEQVARLFAAIDRTFGRIDVLVNNAAIIAKQSRLED
FT                   LEFARMQRIFAVNSIGPILCAQQAVKRMSHRYNGRGGVVINISSASARLGSPNEYVDYA
FT                   ASKGALETFTTGFAKEVARDGIRVNCIRPGHIYTDMHASGGEPGRVDRVRDSIPMGRGG
FT                   QPEEVARAILWLASAEASFITGTFLDVTGGK"
FT   gene            complement(391136..392053)
FT                   /locus_tag="Bxe_B2687"
FT   CDS_pept        complement(391136..392053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2687"
FT                   /product="Putative epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2687"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33306"
FT                   /db_xref="GOA:Q13RI3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI3"
FT                   /protein_id="ABE33306.1"
FT                   /translation="MLKRIATSLLDIAYDEQGNADGWPVVLLHGFPYDIHAYDAVTPRL
FT                   TSQGARVITPYLRGYGPTRFLAPTTLRSGQQAALGADLLALLDALQIGQAVLGGYDWGG
FT                   RAACIVAALYPSRARGLVSVNGYNIQNIAAASQPADPEKEYRMWYQYYLHGERGRAGLT
FT                   ENRREFCRLLWSLWSPTWHFGDDTYARSAAAFDNPDFVDVVVHSYRHRFGLVDGDPQFD
FT                   DIERRLSAMPPITVPAITLEGDADGVSPPGGRQANSQRFTGRHQNRVVPNAGHNLPQEA
FT                   PGAFADAVLDINAWAARRSCACGD"
FT   gene            complement(392261..395146)
FT                   /locus_tag="Bxe_B2686"
FT   CDS_pept        complement(392261..395146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2686"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2686"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33307"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI2"
FT                   /protein_id="ABE33307.1"
FT                   /translation="MRVRQKSRNGTRREAGTLLLAALAGLPFMAMASPASPHADTAAVL
FT                   SGASSHAADPRLALANRTTPCALMLDNRGWSVTPFEKPKDERARCMNEAAQGNLTARAL
FT                   YGQMLTYGYGGERDTATGVAILKSSALDGSLLARRMLGNLYRNGSVVPQDYLAARQWFE
FT                   SAAADGDATSATVLGAMSANGEGQPVDNAAAYRYFVQAAEGGSANGAANAAQFAALGRG
FT                   VPKDPAVAASWMIRGASGGDAGAQFLLGLALLRGEGVPRDAGNGAGWLREAVRQGNTGA
FT                   EAALGDVYLSGVGVQRDTRRGFDLMSHAARQGWVYAQRRMGDLYATGTGVARNDVLARS
FT                   WYRKAAVEGDAAARFALADLYRTGRGGPVDLEAAIGWMRGAADAGLATAQNDLGVMFRE
FT                   GWGTHKDSAEARTWFEKARAQGLGVASFNLAIYALRGEGEPVDFGKAFKLASEGADRGS
FT                   EEAAVTAAAMAWKGQGTPVDKAQALRWYRFAADHGNVEAARWIGNQYLAGTEVPRDEAL
FT                   GLHYLTLATNAGDPASSVSLGAYLTEHGQSLSGKTGVEWLEAAAKRRVPAAYAALGYTY
FT                   ARGIAGKQDSGVALGWFSQGAQLGDPASQAWLCSAYAYGSPGVQRRPDYAARWCQAASR
FT                   SGNVLAMSILADARNGIANDTSRVYWQWKVADRGDPKYQSMLGDSYDLGDGVAPDLSAA
FT                   TYWFRRAADQGNASAQSSLAWHLLTGLGGRVDEYEAFAWASKAAPADPEAKRMVGVAYA
FT                   YGRGVGRDPAAGRVWLEKALAAGDDWAASDLATLYEIGPLAQREPARAMQLHRQGARGG
FT                   AEQSQIALALHALAAGTETDLGNNERRWLVPADAASNLWHDDSLAPAGELRQRWDGLSC
FT                   LNEALLGNPLMQYDVGMRFLTGNGVPRDRALGAAWIARARAGFEARGGVPAYTAAIRIV
FT                   EARLSERMGDDEKQRAREIAANLDATVREWQ"
FT   gene            complement(395143..396516)
FT                   /locus_tag="Bxe_B2685"
FT   CDS_pept        complement(395143..396516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2685"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33308"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI1"
FT                   /protein_id="ABE33308.1"
FT                   /translation="MKLKTSFYGVMLFFTAVSANALDMRSAQPVAPAAQAQTAAPVDPA
FT                   ALTNERIRQIVGQAGLDPDSDKGRLLVKLVTRVAADAEFRNRLSTWSQTRGMFGGQLSP
FT                   DDRMRVLHLLKGLAQGPKSDCDALATNGRDFFLMAKTLSTQSFQNLLEIMEISVDHSTP
FT                   DSNDERYTTAELLDADAELESKVPSQFIAKGPSNACELIRVAVDAVDGLPPASRQAATY
FT                   ELFQIMDHKPSARAKVLTDPYAYLDDMFDERRMPDSIRRKLPENGSRPLPFSRLVVDAE
FT                   WKNPSTPNQPTPFKDTFVNRRNNGVVAELVTPAADSARLDWSDFYLSYGVASLLTQTVG
FT                   THELTPLGTLKDDVAVDTASRPLVEGHSIELALPLPSEKGETSRTCEIGKTVPASTLFR
FT                   SLDGDAVGLHCQSVTKRGETVRFDASLLVNYGIAWTTSIDDKDGRTDAIIRNVTVQQP"
FT   gene            complement(396578..396910)
FT                   /locus_tag="Bxe_B2684"
FT   CDS_pept        complement(396578..396910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2684"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33309"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI0"
FT                   /protein_id="ABE33309.1"
FT                   /translation="MLPGWPRGRRWPFRRLTEIGGIRPVSTPGIPLSSSLPCKTYGVGA
FT                   FASVKPDSTAYGGDSTRHPANSTSASHSGGTSGEKRAESKATPLKNSGHLADIHTATST
FT                   SCMPLE"
FT   gene            complement(397427..397717)
FT                   /locus_tag="Bxe_B2683"
FT   CDS_pept        complement(397427..397717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2683"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2683"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33310"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH9"
FT                   /protein_id="ABE33310.1"
FT                   /translation="MDNADAALEKMSRLVTANMETVSMLGARAMVLGKFLDAALPQLTT
FT                   SQRAEVALSFRQGIEDAMALMDDVPLHAGYHSALLELTNTILATLAQGSVR"
FT   gene            complement(397729..399471)
FT                   /locus_tag="Bxe_B2682"
FT   CDS_pept        complement(397729..399471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2682"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2682"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33311"
FT                   /db_xref="GOA:Q13RH8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH8"
FT                   /protein_id="ABE33311.1"
FT                   /translation="MKLFARFSLTHRLYAVSAALIVALTAVAVISWIQLIDAQRIAANA
FT                   GNVRMQQLERIASTELSVTQVLLDLRHAMLVSSADDVQAAARNIDAERQQIRRNDDAFF
FT                   SNITDEAGKDAFRNVWLKMQADAWPVAEANLRLVRDGHRDEAFQMLTAQTIPTFARIQK
FT                   WLGEERARQGEQLGGQVSEIERALQWTRLLLVSLVAAIAMGLMALSWYIGSCLRSRVAE
FT                   AQKVAERVRDGNFTVAVVDSHADEISPLLGTLGAMQNSLTEVVRSVRSNAESVAMASAE
FT                   IAAGNADLSSRTEEQAASLQETASSMEELAGTVRHNADNARQAMTLANTASDIARRGGD
FT                   VVGRVVETMHGISDSSAKVAEIITVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRTLAQRSASAAKEIKDLIDDSASRVDTGSKLVEEAGSTINDVVQSVRRVTDIMGEMA
FT                   AASAQQSTGVEQVSQAVSQMDQVTQQNAALVEEASAATQSMAQQAQALRDAVAVFKLDD
FT                   RGVPASRPAASRAVTRRPAPTTRTPAARTPSRATPATAAPVGTADKDAAIAATDANSVD
FT                   WQAF"
FT   gene            399817..400260
FT                   /locus_tag="Bxe_B2681"
FT   CDS_pept        399817..400260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2681"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH7"
FT                   /protein_id="ABE33312.1"
FT                   /translation="MNRLIIYIVVVASFLVFPGTTAAWLPFGNEVTVYMLSCDGEQKSG
FT                   LCHGREKTDIPFTYKVLADQLSVWYWRADDPDEPRRLSFCAIHDMKNWLCQWGSEEIPK
FT                   SRFGMVSGRYAEIATCVTVTSTPLFYQVSRLRWWFVWLREQLS"
FT   gene            complement(400294..402237)
FT                   /locus_tag="Bxe_B2680"
FT   CDS_pept        complement(400294..402237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2680"
FT                   /product="Bilirubin oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2680"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33313"
FT                   /db_xref="GOA:Q13RH6"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH6"
FT                   /protein_id="ABE33313.1"
FT                   /translation="MMETNQQVLPPGSYAQCGAGVTLGQTRVWAYQTTDSSTGAVLGPA
FT                   RWPAVTIVAQRGTATRATYVNRLPSFDPAQPTGPGLVQGELPFDQTVHWADPLKTGCAM
FT                   PMQGASANPSCKQNYIGPVPATVHLHGAELPAAYDGDPESWFTPNGLKGADYHTIGSPG
FT                   PGTAIYEYPNLQEPGTLWFHDHALGVTRLNVYAGLAGFYFLKDPNTEPQGYPSGPYEIE
FT                   MAVQDRMFDASGQLYLPTQQASINHPFWSPIFEGDVAVVNGAAFPYLNVEPRRYRLHIL
FT                   NGSLNRGYTFVFGNAPVYLVGADDNYFDKPVPLAVSSGGVSDGLPVSPGERADIIVDFS
FT                   KFAGQTIELTNSQPGQDVQLPDIMQFRVAASTSTPDASCDPAHPDTTAGVCARKNPVPH
FT                   LTDGNGNVLPGVKVDRVRQMILYDHVEKSGGPVPADIKEYVNNTTWNGLESASIAHDFP
FT                   SDGISELPRVGSVEMWEIVYLSTMPGASHPVHIHLSQFQVLNRQAINTSQYLADWNKAF
FT                   GATGSSAAPLPGGCTAGTYCADYGPPLDYATPNKDGALGGNLPFSGYLQGANLPPAAGE
FT                   SGWKDTADAHAGQVLRILVRWTPSSIPVVPNQSYAGQNLYEFDPTQGYYVWHCHVITHE
FT                   DNEMMRPYRVTN"
FT   gene            complement(402979..403785)
FT                   /locus_tag="Bxe_B2679"
FT   CDS_pept        complement(402979..403785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2679"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2679"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33314"
FT                   /db_xref="GOA:Q13RH5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH5"
FT                   /protein_id="ABE33314.1"
FT                   /translation="MNTPLIRPELVTSPEGPFLAAAELTQRESRATASHSHARGQLMGA
FT                   LSGLVSVGVNRQHWVVPAIHAIWIPPHCEHSVRSHGPFSGWSVFIAEQRCAELPGEPRA
FT                   IRTTSLLRAAVRRAASWDGTQLDTQRSRIAEVILDELAASQAESLGLPAPEDARLLRIT
FT                   DALVRDLSDSRRLEQWAEWAGLSPRTLSRKFSAETGLSFAQWRAQARLLRALELVADGV
FT                   SVTTIALELGYDNVSAFIDMFRRATGTTPGRYGTAEPGLTGDGRDE"
FT   gene            403883..404167
FT                   /locus_tag="Bxe_B2678"
FT   CDS_pept        403883..404167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2678"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2678"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33315"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH4"
FT                   /protein_id="ABE33315.1"
FT                   /translation="MRADQLLPDHADHIDVHGATIRKGTIAAFLANALVWSDAHASEPA
FT                   RAQAAADIVDALPALRASGLFGVLEIRDPELRAWIDAQLAGLPSDEVRS"
FT   gene            404164..405123
FT                   /locus_tag="Bxe_B2677"
FT   CDS_pept        404164..405123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2677"
FT                   /product="Putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2677"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33316"
FT                   /db_xref="GOA:Q13RH3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH3"
FT                   /protein_id="ABE33316.1"
FT                   /translation="MKAAVVTQAGRMPVYAGFDAPVATAGYALIDVEASALSHVTRARA
FT                   SGSHYSSSGRFPFVAGVDGVGRREDGTRVYFFGPREPSGALAQRTLVAEGQCFAIPDTL
FT                   DSVTAAAIAIPGMSSWAALTERAKFVAGETVLVNGATGASGRVAVQIAKHLGAGKVIAT
FT                   GRHPQTLAGLKSVGADCVIRLDQDEPSLHRALEPHFREGVDVVLDYLWGPSAQTLLTGA
FT                   ARLLPDGYPMRFVQIGSIGGETLALLGAVLRASAITLLGSGIGSIPFERLLHAASEVLR
FT                   AAVPARFEIATRAVPLSELAVHWENDGNRSRTVFTMHP"
FT   gene            405256..406461
FT                   /locus_tag="Bxe_B2676"
FT   CDS_pept        405256..406461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2676"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2676"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33317"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH2"
FT                   /protein_id="ABE33317.1"
FT                   /translation="MTQIFSDALHEQLGMWPIAYIPYGGADFGEVRSVAQTIGDGDDNA
FT                   FYDAWTEAADRMMDEGRVAEAHGHRVSAREYYLRAACFYAKAFHPHFGYPVDPRIFESS
FT                   RWQIDAFNRALALGDDPVEPVRIPFETSSMLAYVIPAQGRPNERRPLLILTNGYDGTIT
FT                   DPFFASAVAASRRGYHCLIFDGPGQGTTLIDQGIHMRPDWEIVIRAVVDFALTLPNVDA
FT                   SRIVSSGWSLGGYLSPRAASGEPRLAACVADPAQSCIADGFRAYAIKLGATPKQAAQLS
FT                   LLPDALIERMEEIIAHDRKLTWSFLKRGYWVNGASNLREYLASVEQFTMSGRIGNIQCP
FT                   TLFTLAEDDPLASGTQAFFDALQCPKKLLRFNKTQGAGEHCEMTNRSLLNRKVLDWLDE
FT                   VL"
FT   gene            complement(406533..407834)
FT                   /locus_tag="Bxe_B2675"
FT   CDS_pept        complement(406533..407834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2675"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2675"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33318"
FT                   /db_xref="GOA:Q13RH1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH1"
FT                   /protein_id="ABE33318.1"
FT                   /translation="MSLNNDAAFWRNARQHLIRYGGTFEPMIIERAQGSFVYDADGRAI
FT                   LDFTSGQMSAVLGHSHPDIVSVIKEYAGKLNHLFSGMLSRPVVDLATRLAEITPDGLDR
FT                   ALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGGAASATYSAGRKGVGPAAVG
FT                   SFAIPAPFPYRPRFERDGQYDYLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELP
FT                   EGYMAALKRKCEERGMLLILDEAQTGIGRTGTMFACQRDGVTPDILTLSKTLGAGLPLA
FT                   AVVTSAQIEERAHELGYLFYTTHVSDPLPAAVGLRVLDVVEREGLVARANLMGERLRRG
FT                   LLDLMERFECIGDIRGRGLLLGMEIVKDRRTKEPADGLGAKITRECMNLGLSMNIVQLP
FT                   GMGGVFRIAPPLTVHENEIDLGLALLGQAIERSL"
FT   gene            407919..408803
FT                   /locus_tag="Bxe_B2674"
FT   CDS_pept        407919..408803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2674"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2674"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33319"
FT                   /db_xref="GOA:Q13RH0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH0"
FT                   /protein_id="ABE33319.1"
FT                   /translation="MADRSGPNILSLSLEIDLLRSFIVVAEVRALSRAASRIGRTQSAL
FT                   SQQMKRLEEIVEQPLFQRTGRGVVLTNPGERLLIHAQRILRLHDEAMADLSGKGLSGTI
FT                   RFGCPDDYAAVFLPHLLRQFSSQHPHALVEVVCAPTPRLLEQLEMHALDLAMISLPENA
FT                   ADDDIIRREPLVWVGCPGMDSAHFDPLPLAVSDPDTLDHVAACEALQRAGRAYRIAYAS
FT                   SSLAGLTALVRSGQAFAVITQTAVAPDLHILNADAALPPLPTIGITLKFERKRPSHLVT
FT                   VFAEHIRLTLPLL"
FT   gene            complement(408855..409277)
FT                   /locus_tag="Bxe_B2673"
FT   CDS_pept        complement(408855..409277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2673"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33320"
FT                   /db_xref="GOA:Q13RG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG9"
FT                   /protein_id="ABE33320.1"
FT                   /translation="MCSLLYLRGYPLKFRRRGNPITARQPLSFFNHHRGHQMQQVWLFL
FT                   AGVLLCNSVPHLASGLQGLPFPTPFARPSGVGNSPPLVNVLWGFANLVIGLLIVARHAN
FT                   TSAIGLDAAAGLAGALAIGVFLALHFGKVQRDRLPD"
FT   gene            409404..410030
FT                   /locus_tag="Bxe_B2672"
FT   CDS_pept        409404..410030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2672"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2672"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33321"
FT                   /db_xref="GOA:Q13RG8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG8"
FT                   /protein_id="ABE33321.1"
FT                   /translation="MTSSKPAPDTARATEPKGAKGRQRVAAIMEAGVAVFTEKGYDAAT
FT                   MTEIAARSGTAIGSLYRFFPSKEALADALLLRYALHVRNALAEMAQQVPDMTLESVADS
FT                   FVDFMLVLQSQRSFAAALVDARGGNADERARFREAMRGGVADILRKAVPGLKPAKAKVM
FT                   AVVLVHMLKGVVSTASEEPAARAMLLAEVRELVRMYLASVSGREK"
FT   gene            complement(410094..410981)
FT                   /locus_tag="Bxe_B2671"
FT   CDS_pept        complement(410094..410981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2671"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2671"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33322"
FT                   /db_xref="GOA:Q13RG7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG7"
FT                   /protein_id="ABE33322.1"
FT                   /translation="MDRLTSMAIFVKAAESGSFAAAALAFGISSQMAGRHVIALEERVG
FT                   APLLARTTRRQSLTEIGQIFYERCKALLADAEAAESVAMDFSASPRGRLRVTAPVTFGS
FT                   CCLAPLITRYLRANPEVQVDLTLTDRFVDLVDEGYEVAIRLGPLSDSSMIAKPLMPYRL
FT                   LACASPAYLKEHGEPRTPEALARHECLGFSFTSLPPYNEWVFGSARGKHAVTVTGRFQA
FT                   NDTKALIAAAIDGFGIALAPEIAIKDDIAAGRLVRLLRKYEAPERPMHALFTARRPTPK
FT                   LRAFIDLVVAEFGP"
FT   gene            411110..411769
FT                   /locus_tag="Bxe_B2670"
FT   CDS_pept        411110..411769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2670"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2670"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33323"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG6"
FT                   /protein_id="ABE33323.1"
FT                   /translation="MKMGILGAGFIGRAMATLAKQSGYDVMISNSRGPQTLMSTAAAIG
FT                   CHVGTAREAAVFGDVVVVAVPFHSYPALPVAELEGKIVIDTCNYYPERDGHIDALDQYA
FT                   TTTSELIARHLHGARLVKAFNAILAKDLETDGTPPGTPHRRALPMAGDDLAAKQAVAGV
FT                   LDQFGFDAVDAGPLSASWRFERAKPVYCVRLDREGLLEKLAEAKRDVEVPHGSWRR"
FT   gene            411966..412367
FT                   /locus_tag="Bxe_B2669"
FT   CDS_pept        411966..412367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2669"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33324"
FT                   /db_xref="GOA:Q13RG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG5"
FT                   /protein_id="ABE33324.1"
FT                   /translation="MSGEWKRRMKLFIQRFWQPTSACMTCMPGSWANVMSLAHWTIALQ
FT                   TGLLTGLLAVLLTFTPAARFYRHRYGSALIVGVLTTIGDFYSHESHYRIPYVEHFVTGA
FT                   ISGLLTLAASYLFEDRARRLRAAWARIFR"
FT   gene            412396..412815
FT                   /locus_tag="Bxe_B2668"
FT   CDS_pept        412396..412815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2668"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2668"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33325"
FT                   /db_xref="GOA:Q13RG4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG4"
FT                   /protein_id="ABE33325.1"
FT                   /translation="MSSGVQSGNDLPDKQELEAMSVFRYELRKFLRVSEEIANAAGITT
FT                   LQYQLLLHVRGFAGRRWATVGELAERLQAAPNGTAALVSRCESAGLVTRKADASDRRQV
FT                   QVHLTPKGERCLLELAAEHKAHYGSFGWVFGDSAK"
FT   gene            412871..414214
FT                   /locus_tag="Bxe_B2667"
FT   CDS_pept        412871..414214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2667"
FT                   /product="Putative chloride-channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2667"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33326"
FT                   /db_xref="GOA:Q13RG3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG3"
FT                   /protein_id="ABE33326.1"
FT                   /translation="MCFISLPRGYIPMRIHALADRRTILRIRRLWLHYGIFWLGAVATG
FT                   LVAVMYAKLIDFGYDTFLRYTTSHRWLPLLLTPAVAALGVWITRRWFVGAEGSGIPQVI
FT                   ATLHEGRELGPRLLSMRILIGKIGVSFLSILGGLTIGREGPTIHVGAALMFSLRRFYPA
FT                   RFRSIRGAALERNLALAGAAAGLSAAFNAPLAGVVFAIEELTRSFEQRTSGVLITAIIF
FT                   AGVVSLGLQGNYTYFGTIDIDGHFPDMLAIAAVMLGVVTGVAGGAFCWLLLNTNRWMPA
FT                   RLVVWRKDHPVAFGAACGLVIALIGVAAGGHTFGSGYAEARGMLEGNSQLGASYPILKM
FT                   ASMVGSYLPGAPGGLFAPSLAIGAGIGNALHLVFGQMQLPMLIALGMVGYLAAVTQSPI
FT                   TAFVIVIEMINGHALVLSLMTTALIASQVSRLFAPPLYEALSKRYVAG"
FT   gene            414297..415196
FT                   /locus_tag="Bxe_B2666"
FT   CDS_pept        414297..415196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2666"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2666"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33327"
FT                   /db_xref="GOA:Q13RG2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG2"
FT                   /protein_id="ABE33327.1"
FT                   /translation="MDRMAVMEAFVTVVDAGSFSAAARRLKLGQPAVSKSIAQLEEHLG
FT                   ARLLLRSTRGLTPTDAGQRFYEHARRAIDEADQAEQAVRESSGGLSGRLRIGAAVTFAR
FT                   LHVLPALKTFLDQHPKLSIDLILDDRSIDLLEQGVDVALRMGTLDDSTMTAKRIVRGRR
FT                   LVVGTPQYFAQAGIPTTPADLSRHQAIVYSLRGGGESWSFSRDDGAEIAVAVTGRVSVS
FT                   AAEGMRTAVLGHVGLAVASEWMFSPELADGTVQAVLTEWTLPSIDVWAVFPSGRMATTK
FT                   ARAFVAFVEHVLGVAPTV"
FT   gene            complement(415275..415946)
FT                   /locus_tag="Bxe_B2665"
FT   CDS_pept        complement(415275..415946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2665"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2665"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33328"
FT                   /db_xref="GOA:Q13RG1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG1"
FT                   /protein_id="ABE33328.1"
FT                   /translation="MTLQDRLDAFKADFKAGKPPYHAPPEIHPIMERATAELVASGQAS
FT                   RAIKAGDRAPLFTLKDQNGNDVSSAELLAQGPLVVTFYRGVWCPYCNIELHAINEALPQ
FT                   IRARGANVVAISPQTAVNSRKSVRDNSLNFPVLSDAKGETAAAFGLRFSLPDYLVDLYK
FT                   NLRNDLPAFNDDPNWTLPMPARYIIGHDGIVLYSEVNPDYTHRPDPAEMFAVLDKANAK
FT                   D"
FT   gene            416367..417134
FT                   /locus_tag="Bxe_B2664"
FT   CDS_pept        416367..417134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2664"
FT                   /product="Putative short-chain type
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2664"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33329"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG0"
FT                   /protein_id="ABE33329.1"
FT                   /translation="MTQALNGKLALVTGASRGIGAAIAARLARDGASVIVHYASSAERA
FT                   DAVVKAIREAGGEAEAVAANLSTQDGVAVLIDSLNGVFGGRFAGRLDILVNNAGTVEYG
FT                   PFLESSATSYDTHFNLNVRAPIELAKDAAKRMIATGWGRIINVGSAFGEAAPLPGVTLY
FT                   IASKFAVRGFTRGLSRELGKFGVTVNAVQPGPIDTELAPQPGTEAHATMTRLASVGRFG
FT                   KPEEIAAAVAYLASPEAGYTTGESLTVDGGWIA"
FT   gene            417255..417572
FT                   /locus_tag="Bxe_B2663"
FT   CDS_pept        417255..417572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2663"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2663"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33330"
FT                   /db_xref="GOA:Q13RF9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF9"
FT                   /protein_id="ABE33330.1"
FT                   /translation="MTAREMDEDNHMLALSVIAHRSRLAVFRMLAAAGPPGVAAGEISA
FT                   QLGIAPSSLSFHLKDMLRANLVSGRREGTFIYYSAALDVIQGVIDFLIENCLADAKRSG
FT                   E"
FT   gene            complement(417637..418296)
FT                   /locus_tag="Bxe_B2662"
FT   CDS_pept        complement(417637..418296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2662"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33331"
FT                   /db_xref="GOA:Q13RF8"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF8"
FT                   /protein_id="ABE33331.1"
FT                   /translation="MPMSQEIDYLNPALPAGLRRVSMSVVDATPATLDGFGCLVTDPSK
FT                   CSIEIVQWPAAGTRPIDPGTGDEAGTTEGTFVSEWRGDILYGRNEAVGGNYILAYAREP
FT                   EAARDDHANAPERMLLWHANYHPDGGQLFFPLDHRPFYVPLALPGDDITPEKFVCFRFD
FT                   GQQGLYIHPNIWHEGVFTLEGTQRFFDKQGAVHARVSVDFAREFGCLLEAPIAGDA"
FT   gene            418556..420418
FT                   /locus_tag="Bxe_B2661"
FT   CDS_pept        418556..420418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2661"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2661"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33332"
FT                   /db_xref="GOA:Q13RF7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF7"
FT                   /protein_id="ABE33332.1"
FT                   /translation="MPEYRSRTSTHGRNMAGARALWRATGMKDGDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGALVAKEIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVKSPKDGQVIA
FT                   KIDLIDAMIKAADSKVSDAEVAEIERSACPTCGSCSGMFTANSMNCLTEAIGLALPGNG
FT                   TIVATHAWRKDLFEQAGRLVVDLCRRYYQEEDTSVLPRSIASKQAFENAMALDVAMGGS
FT                   TNTVLHLLAAAQEAGVDFTMSDIDRISRKVPCLCKAAPATDKYHIEDVHRAGGILGILG
FT                   ELARADLLDLSCGNVHSGTLGDAIARWDIAGGAGEEAQKFFRAAPGGIPTTVAFSQEAT
FT                   FPSLDTDRKTGCIRSKQDAYSKDGGLAVLYGNLAEKGCIVKTAGVDESQWVFSGRARVF
FT                   ESQDDAVEAILGDKVVAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKTCALFTDG
FT                   RFSGGSSGLVIGHASPEAAEGGTIGLVEEGDVIEIDIPKRKMHLVVSDGELARRREAME
FT                   ARGDKAWMPAARERVVSQALQAYAALATSADRGAVRDISQLKRK"
FT   gene            complement(420542..420985)
FT                   /locus_tag="Bxe_B2660"
FT   CDS_pept        complement(420542..420985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2660"
FT                   /product="Conserved hypothetical protein"
FT                   /note="DNA-binding domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2660"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33333"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF6"
FT                   /protein_id="ABE33333.1"
FT                   /translation="MQAHPLRLFPGDDLRVALENVLHQSGLQAAFVIQGIGSLSVAQLR
FT                   FAGKEDPTELRDDLEILTLAGSISPDGAHLHMSVADPRGQVSGGHVARGCVIRTTAEIL
FT                   LVLLPDYRFSRERDPGSGFMELVIRNEPATDHARQLRADNLDE"
FT   gene            complement(420995..421939)
FT                   /locus_tag="Bxe_B2659"
FT   CDS_pept        complement(420995..421939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2659"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2659"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33334"
FT                   /db_xref="GOA:Q13RF5"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF5"
FT                   /protein_id="ABE33334.1"
FT                   /translation="MHVRGAHIAPRPAHLLTSIEMAKAQTKQEKRAPQSIESRIAECYD
FT                   ELSEIDQRLADVILSAPGQLAMQTATELAATAQVSKATTTRFFQKLGYASYDDARAIAR
FT                   AAQVGGSPLYLQDRGRKNASTKLDDVIQAHLQHEVENLASTYRSLDTRVLSEVVEAVAH
FT                   ARRVVIIGYRHSHTVATMIRRELIQVRSDVVLLPAPGDTLGEYLGDLSAKDVAIVVGLR
FT                   RRVPAVGLAATALAEAGVPIVYMSDVIAGKPARLARWVIRCHTDGLMLFDSNVGMTAVV
FT                   NLICSLVAERLLERGTNHLQRVEILHESLREFE"
FT   gene            422160..423008
FT                   /locus_tag="Bxe_B2658"
FT   CDS_pept        422160..423008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2658"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2658"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33335"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF4"
FT                   /protein_id="ABE33335.1"
FT                   /translation="MSKRRLSSLVLAALFPFGALIHPLAANADTLDDIKSRGTMTVAID
FT                   PTFAPYEYTDANNNIVGFDPAVMDAVARHLGVKIEYQRMSFSGIIPGLLAHSFDVEGSA
FT                   LNVTSERAKRLAYVVPTSKTVNGALVRSDFRKIPQPATIESLAGLTAAVKSASAPEQIL
FT                   KQFNETLKAKGLAPIQLISVDSVDQTVAALMTRRADFVFDDMTVLAGVIKQNPGKLKST
FT                   GELGPSQWIAWATRPDDTRLNKAISDQILAMKKSGELARLQKANLGVTFDTPTSDFIPA
FT                   Q"
FT   gene            423027..423641
FT                   /locus_tag="Bxe_B2657"
FT   CDS_pept        423027..423641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2657"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2657"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33336"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF3"
FT                   /protein_id="ABE33336.1"
FT                   /translation="MTDSAQMLTIKAGHGRTFEVKAGQRLTITDVEGQQAADFVAVVKS
FT                   NHDEKLSPTHTRRQLRTLFFNVGDALYSSLGRPLLRVLEDTVGIHDANVPACDDTRFTV
FT                   DFNVTGHRNCLDNMHAGLALYGLSPFDVPEPFNLFQNGPVTQDCRMQVTDPTSKPGDYI
FT                   TFDVLEDLVCAVSSCPQDIIPGNGLKVTDIAVSILPAASAA"
FT   gene            423653..424288
FT                   /locus_tag="Bxe_B2656"
FT   CDS_pept        423653..424288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2656"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33337"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF2"
FT                   /protein_id="ABE33337.1"
FT                   /translation="MLLLKEPPSRAPLCPQTVAVPAGESRAIDVKAGQILRIEAKEPGA
FT                   VASMFGFSRINDDVYMSVHHTRVFSNSYVLQAGMRIVSNRRRALMVLGKDSSGKHDLLL
FT                   PASTTAYLAEQGYAGLTGCIESVGAVIQSLGLKPPKMPDPINLFMHVTLHQDGRIEPLP
FT                   NTTRAGDFVACRVVTDMVFIVSACCTGIPGNDVPGALELSAAEELDQL"
FT   gene            424306..424989
FT                   /locus_tag="Bxe_B2655"
FT   CDS_pept        424306..424989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2655"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33338"
FT                   /db_xref="GOA:Q13RF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF1"
FT                   /protein_id="ABE33338.1"
FT                   /translation="MGFDPQVIHSLPTLIDGWLLTVELTLLGATGSLVFGHLALAMQLT
FT                   RIAPLRWAARLYISFMRGTPALVQLFVLFFALPLIGLGGRPMLAAALTLGLNSGAYTAE
FT                   ILRGNLRVITPGQYEAAIALGMAPSRIALRIAMPQMLKASLPALINEFTILLKTTPLAS
FT                   VVAVTELTYAGQMVIARTYTSAQVMLLVSVGYLAVALPVIYAARRAQRSPRMPGAGRVA
FT                   PGVAR"
FT   gene            424986..425660
FT                   /locus_tag="Bxe_B2654"
FT   CDS_pept        424986..425660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2654"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33339"
FT                   /db_xref="GOA:Q13RF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF0"
FT                   /protein_id="ABE33339.1"
FT                   /translation="MTFDLSVLSGYWPQLAAGFGSTVWLCAAGAAMSGVLGVLLTVGQR
FT                   RGGPWLAAVIRGYTALTLGLPLLVLLYVMFFVLPDFGVLLPAPLVGTVTLAIYYGPYVA
FT                   EVIGAAVAAVPAGTVEAGVAIGMSPVAIARRIVAPQALPLLLPTLTGLLIGLVKDSALL
FT                   SVISVHEFMFAAKAVVSDTYAPLEVYFVVALVYWAATSVVHFSTRHWERRLGRVHRVSL
FT                   PR"
FT   gene            425666..426469
FT                   /locus_tag="Bxe_B2653"
FT   CDS_pept        425666..426469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2653"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2653"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33340"
FT                   /db_xref="GOA:Q13RE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE9"
FT                   /protein_id="ABE33340.1"
FT                   /translation="MEPSDSTPLVALKASGIVKSFGANRILDGVDLTVARGETVCVLGP
FT                   SGSGKSTLLRCLNWLSPPDEGAVWIGDQRLGLRETPNGATSPRPEREIRAQRSRIGMVF
FT                   QSFNLWPHMTALENVMEGLLSVKRMNRLDATDLAVEALRQVGLGGKHTSMPANLSGGQQ
FT                   QRVGIARTLAMAPEVILFDEPTSALDPELVGEVLAVMRGLAANATTMIVVTHEIGFARD
FT                   VSDRVIFMDRGRIVEQGPPAQVLDAPSSPRLQQFLYRFTPENSRS"
FT   gene            426466..427134
FT                   /locus_tag="Bxe_B2652"
FT   CDS_pept        426466..427134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2652"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2652"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33341"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE8"
FT                   /protein_id="ABE33341.1"
FT                   /translation="MSYTNHPTATVPAGHGKAVRLKAGQAVRVINTHGTQVVDCWAWNA
FT                   YDLNEYMCMETTRVWNQRLNPVVGDSFVTNLRHPVLTVVEDTTPGVHDTFMAACDRKRY
FT                   ELLGVRGYHRNCCDNMFEGMFELGVTPPRQNLASFNIFMNIRVQPDGITLHTLPTVTKP
FT                   GEYITLRAEMDCFVAFSACPQDIVKIQGQGDNTPKPVDIAVLDDFLSDLPGTQPWVPEA
FT                   "
FT   gene            427176..428180
FT                   /locus_tag="Bxe_B2651"
FT   CDS_pept        427176..428180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2651"
FT                   /product="Allantoicase"
FT                   /EC_number="3.5.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2651"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33342"
FT                   /db_xref="GOA:Q13RE7"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE7"
FT                   /protein_id="ABE33342.1"
FT                   /translation="MAIPTFDPNAPDFARIGINLADPRLGAQAVLASDDFFAPMDRMLN
FT                   PEPAVFIPGKYDDNGKWMDGWESRRKRVTGHDFCVVKLSAAGKLMGVDIDTSHFTGNFP
FT                   PAASIDACRSDDDIPSADAQWTEVIPATELSGNAHHFRVIQAAGGALYTHVRLNIYPDG
FT                   GVARLRVFGRPHREIAPDAELDLASAMNGARIVAANNQHYGLASNLLLPTRAANIGEGW
FT                   ETRRRREPGCDWCIVELAVPGEISRVDVDTAHFKGNFADRCSLQGAFVTAGTDESLITQ
FT                   SMFWPVLLDEQKLEMDRLHSFAPERIAPVSHVRFNILPDGGVSRLRLIGRALP"
FT   gene            complement(428264..428851)
FT                   /locus_tag="Bxe_B2650"
FT   CDS_pept        complement(428264..428851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2650"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2650"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33343"
FT                   /db_xref="GOA:Q13RE6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE6"
FT                   /protein_id="ABE33343.1"
FT                   /translation="MTDRKRVAIVGAAIEEFLAAGYDATSMDRIAARANVSKRTVYNHF
FT                   PSKEALFAAILHQLWDASQRGDVSAYRADEPLRAQLLDLLGRKLRLLNDESFLSLARVA
FT                   IAAGIHSPERARDMVARLGEREEDLTVWVRAAAADGRLKTDDPLFAALQLQALVKGFAF
FT                   WPQVTMGQAPLGEREQRRIAESAADMFLARYA"
FT   gene            428973..430103
FT                   /locus_tag="Bxe_B2649"
FT   CDS_pept        428973..430103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2649"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33344"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE5"
FT                   /protein_id="ABE33344.1"
FT                   /translation="MTSLPAFVSRVLGVTAAQRGRALSSHSPQHDGERFRNVKPRPAEG
FT                   LRKTLGIVWNVLFNKPRGTVPTAALPIETLTRSQLDAAPDRSLYRLGHSTMLLKLRGQF
FT                   WLTDPVFAERASPFRHFGPKRFHAPPIALADLPPLRGVILSHDHYDHLDRETVLLLAQT
FT                   TGVFLTPLGVGDRLIEWGIDASKVRQFDWWQGTEVDGMQFTATPAQHFSGRSLFDGNST
FT                   LWASWVIVDDDLRVFFSGDTGYFDGFKTIGERLGPFDVTLVETGAYNEQWPYVHMQPEE
FT                   TVQAHIDLRGQWLVPIHNGTFDLAMHHWQEPFERVMGLALVHGVALSTPGMGERLDLSA
FT                   PHRGERWWRHAVEPAAAPKAAWRLCASRNVGDAKSS"
FT   gene            complement(430260..430655)
FT                   /locus_tag="Bxe_B2648"
FT   CDS_pept        complement(430260..430655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33345"
FT                   /db_xref="GOA:Q13RE4"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE4"
FT                   /protein_id="ABE33345.1"
FT                   /translation="MQDAAASAHHASLSAMVKAVVAAFVKAKTQNLDESRALYAVALEL
FT                   DSRSYVREVEARNRAALEAMLKTASDADFDDVPMTTFMFMGAMVGPIRLLLEAKSPQSM
FT                   IRKFRVQLESLCLGYLEREAYPKRSTD"
FT   gene            complement(430683..430907)
FT                   /locus_tag="Bxe_B2647"
FT   CDS_pept        complement(430683..430907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2647"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2647"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33346"
FT                   /db_xref="GOA:Q13RE3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE3"
FT                   /protein_id="ABE33346.1"
FT                   /translation="MRTSNGQGLNARKQPQQARSQATVDAIFDATIQVLLADGLQRLTT
FT                   IRVAERAGVSVGTLYQYFPQKQALLFAVL"
FT   gene            430997..431878
FT                   /locus_tag="Bxe_B2646"
FT   CDS_pept        430997..431878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2646"
FT                   /product="Putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33347"
FT                   /db_xref="GOA:Q13RE2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE2"
FT                   /protein_id="ABE33347.1"
FT                   /translation="MTDVTRAGIFQLGDLPVTRMGYGAMQLAGPHVFGPPKDRGAAIAV
FT                   LRAAIESGITHVDTSDFYGPHVTNQLIREALHPYPDALTIVTKVGASRGSDGSWNVASS
FT                   AAELESAVHDNLRNLGLDALDVVNFRAMFNVAAPTEGDIEEPLTALAELQAKGLIRHIG
FT                   LSNVTPTQVAQGRAITAIVCVQNMYNLAHRNDDALIDRLAEDGIAYVPFFPLGGFSPLQ
FT                   ADALSDAANRCDAAPMQVALAWLLQRAPNILLIPGTSSVGHLEQNIESVNLQLPEDVLA
FT                   SLDTIGAEKTQD"
FT   gene            complement(431935..432153)
FT                   /locus_tag="Bxe_B2645"
FT   CDS_pept        complement(431935..432153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2645"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2645"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33348"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE1"
FT                   /protein_id="ABE33348.1"
FT                   /translation="MFPEFRDLISRLKTEDAHFSRLFDRHNELDHQISNMETGVTPSDN
FT                   SAIEALKKEKLQLKDELYAVLKKASAA"
FT   gene            complement(432339..433970)
FT                   /locus_tag="Bxe_B2644"
FT   CDS_pept        complement(432339..433970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2644"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33349"
FT                   /db_xref="GOA:Q13RE0"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE0"
FT                   /protein_id="ABE33349.1"
FT                   /translation="MTALQPDTVQLWPDEVYLIGCAGAPRGNPDPAGASAEKVGFKAYN
FT                   LLRMAELGLPVPPAFVLGTHYCRDARAREIATASTVWEPGLQELERTTGQRFGDPRQPL
FT                   LLSVRSGAPVSMPGMMDTLLNVGLCDTTLAGMLRQTGNPRLVWDTYRRLVASYGELVAG
FT                   VPSSIFEAEYAAFAGTRDEHGLDFTELRELTHRCLAAYERAAGQPFPQDPQVQLANAIG
FT                   SVLASWQSDRACAYRKQCGISDAIGTAVTVQTMVFGNAGGRSGAGVGFTRDPVSGEPTL
FT                   WVDFLFNAQGEDVVSGRRSARGHEELAQAMPAAWKALQDAATRLEHALGDMQDVEFTVQ
FT                   DARLYMLQTRNGKRTPQAAARIALDLLDEGVISAEVARERTAALKPAALTRTRIVASGD
FT                   RPLTPLAHAASASNGVAAGEIAFDEARARMRHAAGASVVLVRRDAETDDIAALEVAAGL
FT                   LTQRGARTSHAAVVARQLGKVCLVGCTGLRLDESARTLQLGDTVLHEGDEVTLDGNDGA
FT                   IYAGTARTVIEPMAELQARLERLRAP"
FT   gene            complement(433967..435898)
FT                   /locus_tag="Bxe_B2643"
FT   CDS_pept        complement(433967..435898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2643"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33350"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD9"
FT                   /protein_id="ABE33350.1"
FT                   /translation="MGQRSLLLPGWIKAALSANDRLKLYLSVLQVAFAHAEHPDGELPD
FT                   LTAELVAAHVDAPWLRDMPASASLMDGTLLLPDLTRLVQRLAEDLETMARPLLQPDEPA
FT                   NALHARVQHWLDELGTLRGERLDRPQLQSLTRGQRTNGDDSLHLLVMDLHHALNQLAGT
FT                   ISSEEIDGAHVWQLQPDDRARVVAFMRGLNRTAPLKFDHPGLDTAATRDGERLLVQNDI
FT                   GTNDVHVLVVQIEGLTITLSYSDLHRPRFAFFQSLLVPYGAKWSDLQSKVNAALNEGDA
FT                   YTFGVARFDCADERALETTLEGIGSRIVFLIDWNRARKRLLSFVDKDHAIEVLREAVRL
FT                   EAGHMAWLKAGGEELIYAAMQAVGQGAFRIGDRLDTVLGATDAQAFMVEVLQMASHALL
FT                   GGQPVALVADQTRLLLARRVHQHSSAFELLEEHAGYCHALAQAVSDGLTHDIMSAPPAG
FT                   ESPTQALAARAKAWERRADHLVMRAREQAQRQPRWQPFKHLLELSDDIADALEDAAFLM
FT                   SLIADGHQQGWDRNVHESLSRLAQTVLMATQEHVKSLAIARCLGSASDTIDSDAFLAAS
FT                   WNVLRSERQCDELLRAARRAILAVVRDAAALMLANDLANTLELASDRLLVAGYALRDVA
FT                   FGETGANT"
FT   gene            436201..438879
FT                   /locus_tag="Bxe_B2642"
FT   CDS_pept        436201..438879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2642"
FT                   /product="Magnesium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33351"
FT                   /db_xref="GOA:Q13RD8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD8"
FT                   /protein_id="ABE33351.1"
FT                   /translation="MIFLGGKYDMRTMIPVLKTWLRRSPSPTGVHVSATCSETLTEFAR
FT                   VSPDEALQRLHSAASGLSADEVAERLRSTGSNQVAHEVRHTILGELANRSVNPLNLLLL
FT                   SLAGASYFLGDSRATIMIAVMVVLSVSLGFLQEHRSNKAADALRRMVRTTATVRRRATG
FT                   AEADHVDIPIEQLVPGDVVLLSAGDMIPADLRLISARDLFVNQSTLTGEAMPLEKVAHA
FT                   CGGAAETHFDLPNICFMGSAVVSGVGCGVVVLTGGRTAFGRVADLIAAQRVETSFDKGI
FT                   ARFTWLMMAFILVMVPLVFVINGLTKGNWFEALLFAVAVAVGLTPEMLPMIVTVNLAKG
FT                   AIAMSRKKVIVKRINAIQNFGAMDVLCTDKTGTLTQDRIILKRHLDLHGDESDQVLEYA
FT                   YLNSAHQSGLKNLLDVAVLKHVELHEQLKVHEQYTKIDEMPFDFERRRMSVVLARGDGA
FT                   HILICKGAVEEIFSVCTRYVINGDMGTLDERNFTAAKEATAALNADGFRVVAVAYKEMP
FT                   PQQATYTVGDEADLILLGYIAFLDPPKETAAAAIATLKERGVQVKILTGDNDIVTRKIC
FT                   HEVGLTVGRVVLGKELETLSPAQLADLAETASVFAKVSPSQKASIIDALHRKGHVVGFL
FT                   GDGVNDGPALKVADVGISVDSAVDIAKESADIILLEKSLAVLGEGVLEGRKVFGNITKY
FT                   IKMGASSNFGNMFSVLGASIILPFLPMAPIQVLTNNLLYDFSQTAIPTDNVDEEYLRVP
FT                   RRWDIGNIVKFMLLIGPISSIFDYVTYFMMLYVFGAWDKPSLFQTGWFVESLLTQTLII
FT                   HIIRTSKVPFLQSRASAALIATSLIIAAVGIAIPYTWLGTFLGFIPLPSAYWPALVLIL
FT                   LSYAVLTHLMKTWFVRRFGLD"
FT   gene            439420..440616
FT                   /locus_tag="Bxe_B2641"
FT   CDS_pept        439420..440616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2641"
FT                   /product="Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2641"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33352"
FT                   /db_xref="GOA:Q13RD7"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD7"
FT                   /protein_id="ABE33352.1"
FT                   /translation="MLSHSLAFLSGGLLALSWWQIVLATLVSTHITIVSVTVYLHRCQA
FT                   HRALDLHPLASHFFRFWLWMTTGIVTGKWAAVHRKHHAKCETQEDPHSPQFKGIWKVLL
FT                   GGAELYRTEAKNGETLRRFGHGTPVDWMERNVYEKYPDLGVSLLMVIDILLFGVVGVSV
FT                   WAIQMMWIPFWAGGVVNGLGHFWGYRNFGPPDASTNVFPIGILIGGEELHNNHHAYATS
FT                   AKMSNRWYEFDIGWMYICVLSALGLAKVRKVALRPHLVKGKSVLDDETLQAVLRNRCEV
FT                   MASYARTAEHAYRQELVRAKHMSRRERAALMRGVRKWFRDGQPAQDGARQPVPTELCDN
FT                   HAKLLVYVELREDLAAIWERSNRSREQLLCQLEAWCRRAEQSRIDALREFSLRLRHYG"
FT   gene            440705..441082
FT                   /locus_tag="Bxe_B2640"
FT   CDS_pept        440705..441082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2640"
FT                   /product="Putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2640"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33353"
FT                   /db_xref="GOA:Q13RD6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD6"
FT                   /protein_id="ABE33353.1"
FT                   /translation="MLDHIILSVSDVERSLAFYDAALKPLNIRYFMPYKGENGHPDLWG
FT                   FGDGQRAIFWLKQGKPYPEAIHWGFMAPDNNTVDEFYKAAILAGARDNISPRARLEYYS
FT                   GYYAADVFDPDGYSFEVVHKS"
FT   gene            441160..442707
FT                   /locus_tag="Bxe_B2639"
FT   CDS_pept        441160..442707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2639"
FT                   /product="Putative oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33354"
FT                   /db_xref="GOA:Q13RD5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD5"
FT                   /protein_id="ABE33354.1"
FT                   /translation="MIYDVVIAGGGPVGLFLACELRLAGLPVLVLEQAEDPGSPLKRLP
FT                   FGLRGLSAPTLEAFYRRGMLNEIAAPQRAKDDSGSSVPNAAHWMQQQRRPGGHFAGIQF
FT                   YYDNIDTSKWPYRLPGPAGTSMAVEMEHIESVLTARAIALGVEIRRGLSVDGFDQSEEG
FT                   VTVHAGSEIFRGRWLVGCDGGRSTVRRIGGFDFVGTDPEFTGYSVQVEMADPEKLKPGR
FT                   HYTPTGMYTYQKPGTIAMVDFDGGAFHRTQPITLDHVQAVLRHISNTDVTVTALQLATT
FT                   WTDRAYHATTYRKGRVLLAGDAAHIHSPLGGQGLNLGLGDAMNLGWKLAATVRDDAPAG
FT                   LLDSYTSERHPVGAQVLDWSRAQVAIMRPSRSSRALEAIMRDLIDTRDGATYFAERVWG
FT                   TALRYDLGSSHTLVGRSAPDFELIDGTRLGELFTKGRGLLLDFDALPSLQALASRWSDR
FT                   ITYVASDVKDRLGVSAVLVRPDGFVAWAGEASPNHDEATQAASQWFGKPEEEGRSPA"
FT   gene            443000..443839
FT                   /locus_tag="Bxe_B2638"
FT   CDS_pept        443000..443839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2638"
FT                   /product="ABC sulfonate transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2638"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33355"
FT                   /db_xref="GOA:Q13RD4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD4"
FT                   /protein_id="ABE33355.1"
FT                   /translation="MADVTYSRDSYVASTRSYLGLSKSAFYRWLSWIVPAVVVVLWQIA
FT                   SRVGLIAPQVLPAPSSVLTTALDLATHGDLFVHLGVSLLRAAAGFAIGGTIGLALGVLV
FT                   GFSPLAQALLDRSIQMVRAIPFLAMLPLVIVWFGVGEVAKIFLVALAVLFPIYINTMLG
FT                   IRQIDPKLMELAKVVGLDWPAVVRRIILPGAMPSILTGVRYALAHAWLALVIAETLATT
FT                   KGIGFLAMDAREFLQTNVILLTIIIYAIIGVVADALVRLLEAHFLTWHANYAKGARK"
FT   gene            443836..444579
FT                   /locus_tag="Bxe_B2637"
FT   CDS_pept        443836..444579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2637"
FT                   /product="ABC sulfonate transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33356"
FT                   /db_xref="GOA:Q13RD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RD3"
FT                   /protein_id="ABE33356.1"
FT                   /translation="MSIDFALPQDAAIPAAAEERVNRTPLAVSVRGLQRRYGARVVIDA
FT                   LDLDIREGEFVTLLGESGCGKTTLLRALAGLDQPDAGQIRAPERPSVVFQEHRLLPWAT
FT                   LWENVVLGHETTIGRVGATRALAEVGLSGREDDWPRNLSGGQAQRVALARGLVRDPALL
FT                   LLDEPFAALDALTRIKMHGLVKELVARHHPGVLLVTHDVDEALTLADRILVMRSGRIAA
FT                   SFHPKNHTPQALRPILLEELGVQSH"
FT   gene            444616..445620
FT                   /locus_tag="Bxe_B2636"
FT   CDS_pept        444616..445620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2636"
FT                   /product="ABC sulfonate transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33357"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD2"
FT                   /protein_id="ABE33357.1"
FT                   /translation="MNDSSLSRRQLLRAAGGLLAGAAASSLFPVRAAEPRKLTRNTDTV
FT                   RVGWGYGSLPDIARQRGVFEKTLAAKGIEVEWVGPFPNHAPSIQAVVGGSADFGFWGST
FT                   TPALAAMLAGSPLVFNAFDIYSPRSTAIIVKKTSGINSVADLVGRKVAINRSGLGEFLL
FT                   IAALEKNHIDRSKVEFVYLNPPDAAPAFAQGVVDAWSMWSPAVDIARYSNNAKDIFNEG
FT                   RDLDFLIDYSSLVTRRKFTEENSELIRAVIDAYYVEGAWQSAHSAESEQLVQREAKYPD
FT                   QVRDYLTSLKRVNQFHEPDDAAFIAQFQRAADWLAERKIINSRIKVADYSVKV"
FT   gene            445632..446846
FT                   /locus_tag="Bxe_B2635"
FT   CDS_pept        445632..446846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2635"
FT                   /product="Putative Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2635"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33358"
FT                   /db_xref="GOA:Q13RD1"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD1"
FT                   /protein_id="ABE33358.1"
FT                   /translation="MGTTLVSPLSATLGFAETIDHIASTAAERERNHRLPHEEIAMLKE
FT                   LGFGALRLPADAGGRGVSLSELFTVARDVAAADSNIAHAFRNHLWQVEAALRRRDHPFH
FT                   AHVLDLTSKNKTVGLSFTETDAVAAGARPSKVLSRLEWDEARRVYIGSGVKVYATGNLY
FT                   NDAFVGLAVESREGRTVQYVLDRGQGVSNDDDWQGFGQRLTGSGTAKFDAVTVPAAHVY
FT                   PTDPPRTDEAAPWGYSFHQVYLTNCIAGIVRRVALDAVEVLRARGRNFYHGDGAHPTDE
FT                   PVLQTLLGRIRAYAASVEATADRAVSTLQRAWDSYGTADEYDTTLAATLAAAEAKVVID
FT                   DLAPQIASWLIDLGSGSVVSRVGALDRHWRNIKVIASHNPRLYKERLLGQNLLTGQLPP
FT                   TGAFF"
FT   gene            complement(446889..447950)
FT                   /locus_tag="Bxe_B2634"
FT   CDS_pept        complement(446889..447950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2634"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2634"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33359"
FT                   /db_xref="GOA:Q13RD0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD0"
FT                   /protein_id="ABE33359.1"
FT                   /translation="MSAKLPRFGVWALVHGSRAALQDPAEPYDASWARNKALVLEAERL
FT                   GYDSVLVAQHTINPHDPSLDQLEAWTASAALAALTSRIEIITAIKPYLYHPVVLAKMAQ
FT                   QIEHISGGRFAINLVNAWNRPELERAGIGFPEHDERYAYGREWIEVVSALLRGEVLNHH
FT                   GDNFHIDEYQLRPADPFRARPRIYVGGESEPARELVAAHGDVWFINGQPHDDVARLIAD
FT                   VSARARPAGQDALRFGLSAFVIARETQAQAEAHLAHLFALAELDKPLRERQKANIDPKA
FT                   VMHQTFAQSPRVGSNGGTSAGLVGDYDTVAQRVAAFHRAGIELFMLQFQPFEADMRIFA
FT                   EEVVPRVKRLLSN"
FT   gene            complement(448829..449851)
FT                   /locus_tag="Bxe_B2633"
FT   CDS_pept        complement(448829..449851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2633"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2633"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33360"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC9"
FT                   /protein_id="ABE33360.1"
FT                   /translation="MEIRYAFWNNKGGTGKTSLAFQSIVRYAEKHPKKRVLAVDMCPQA
FT                   NLSELLLGGLNSKGSEKLLERQGLVPRCSVGGYFQLRLPAPYSPPAFDAQDFITLPHEY
FT                   NKGVAKNIHLVCGDPLLELQANAVNTLANNQIPGTNPWIAVVDWLKDFLAQVEDEYDTV
FT                   FLDCNPSFSLYTQIALAATDRIVLPVMADDSSRRAIQNAFSLIYGLKLPSEIYAAYAFA
FT                   TKLKAAGRPLPKVHLIVKNRITQYMGAASAYAAVLAAIETDITKLLKSNPEIFGFKTIP
FT                   KGFVEIRDFQTTGVVAFAKGLPFSKLQVGKQTINGHRVQVKDDYLENAKVAMDELVSRL
FT                   "
FT   gene            complement(450503..450799)
FT                   /locus_tag="Bxe_B2632"
FT   CDS_pept        complement(450503..450799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33361"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC8"
FT                   /protein_id="ABE33361.1"
FT                   /translation="MWREQLGALKGLIRQVSKSETDPMLEVDTVAEKNYYVRQEVKMRI
FT                   LDARSKLQLVDDKTGQDGGKESKLTVAPTAEGSAAKWRSFVECRGGFWSSSPA"
FT   gene            451060..451521
FT                   /locus_tag="Bxe_B2631"
FT   CDS_pept        451060..451521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33362"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC7"
FT                   /protein_id="ABE33362.1"
FT                   /translation="MSKTAKNQPASRPPVDALQYEKLALSAFDLCERQLGKLNTLITLA
FT                   SSMCRNPAVTSDERRRRQTMLELLVDTAEQYHQDLECERELFQVIALDAKGVPQARLTA
FT                   SHATRLLVEASRIANGSQATDNAPKRKRSPAKSVAIAKAHAQQSVAVQH"
FT   gene            complement(451579..452328)
FT                   /locus_tag="Bxe_B2630"
FT   CDS_pept        complement(451579..452328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2630"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33363"
FT                   /db_xref="GOA:Q13RC6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC6"
FT                   /protein_id="ABE33363.1"
FT                   /translation="MDHELLIALGKQSFVGDRPNHCAQCGIRELCLGSGLDLHQVSNLA
FT                   DVVVERRRVEQGEVLYEQGAPFTHLFAIASGSSKAVVRSVDGRAQIAALALRGDVVGFL
FT                   GAASGAQTVTVVALENSVFCVIPYRHLLRRISQNQLIGTQFHRLIARVMQQRQEAFLST
FT                   ASANAERRVCGFLLWFSDQLAARKQHFTEFSLPVSRTDIADFVGLRLETVSRAFTRLCD
FT                   LNLIEAKGRHIRIPDVQGLRRWFSASH"
FT   gene            452936..453286
FT                   /locus_tag="Bxe_B2629"
FT   CDS_pept        452936..453286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33364"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC5"
FT                   /protein_id="ABE33364.1"
FT                   /translation="MRDLWCLCVQSVDDCCLTLFDAWCERRAVIPLCYLLNVWPIVSAS
FT                   GSAICRLYAILDEILSNEAEGLMDRERKIINTILRNKCTLVEGLPAGVANAVCDVCSNR
FT                   RYEVTLFDGGVV"
FT   gene            453510..455057
FT                   /locus_tag="Bxe_B2628"
FT   CDS_pept        453510..455057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2628"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2628"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33365"
FT                   /db_xref="GOA:Q13RC4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC4"
FT                   /protein_id="ABE33365.1"
FT                   /translation="MKLSFSQKLWFPLVLSLLCLAGISIYNALEGREAQLEDRKRDLVH
FT                   ASDIALGIVKTYGDAVAAGSLTEAEAKKQAMNKIRAIRYGEEGYFAIIDSHATVLMHPT
FT                   RPEMDGKDASNYKDPNGVYVFRAAVDAIKRDGKGFNEYAFPRPGSSQASPKISYNVSYQ
FT                   PWDWILTTGVYVDDIDAAFRSMLYRSLGIMLVMVAALSTVVVLFNRSILRAMGGEPSYA
FT                   AELANQIAGNDLTAVVKTTRDDRSSLLFSMKSMQEQLTRTISGIKIAADSIATASHQIA
FT                   VGNQDLSQRTEEQAASLEQTAASMEQLISTVSQNAQNANEANQLAAQAVKVAEQGGAVV
FT                   TRVVETMDGINASSDRIADIVGMIESIAFQTNILALNAAVEAARAGEQGRGFAVVASEV
FT                   RSLAQRSSTASKEIRELIHDSVQRVRTGAGYAQEAGEAMDRITHEVRRVTDLMSEIAAS
FT                   SQEQSKGIGEVNEAVTQMDQVTQQNAALVEEAAAAASSLEMQADDLKAIVSTFRLDA"
FT   gene            455303..457474
FT                   /locus_tag="Bxe_B2627"
FT   CDS_pept        455303..457474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2627"
FT                   /product="GAF sensor diguanylate phosphsdiesterase (EAL
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33366"
FT                   /db_xref="GOA:Q13RC3"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC3"
FT                   /protein_id="ABE33366.1"
FT                   /translation="MAMSNDVSDATPDNDLMDDGSHLYSQARASALTSLTEVLRHNAVE
FT                   IVKRFYDGLIRLPKSKHTLAALSEHELQHLKTQQIQNLYALASPDLTAMDHRTMALRVG
FT                   RIHAIVGLEWEDLIRSRGILSAAIHDTLDTTVHGIALAVLGRRLTQDLAWQTEAYQRLQ
FT                   TSRQDVLMRVTQLAWEVESYTDLIGRVVQILGEHDEVTGCSVGRPDSDGVFRFESVSGK
FT                   SMERYLAELENSTERPVSNGDLPQGQGPVGRAWRSGNVERSINFATDPLMEPWRALALY
FT                   ENFRSSVAIPLRQPGHPPKAILSLYSAFPGGYSAADQMAFIMPLQTLLGLAIARIENQE
FT                   GRTHAVPYATRQHWAALLRSDALEMHYQPLLDLKTGHVTKVEALARLREGDRVLTPGEF
FT                   FPALSTDDFLELYVRGLAQVLSQRNRWLQVGVELKVSVNLPSSAMGDNRYFEATRQALT
FT                   EYFCRPDMLTLEILETDALPSGMDVSGELAKFKLLGINLAEDDLGSGHSSLNRLRELPF
FT                   DWIKIDRSIVSVAGQDASNVLRFVYQLTRLGRSLGKSVVVEGIEDAGMLEAIVILGADV
FT                   AQGYAIARPMNAQQLTAWMHKQPHVPRYLEARSALGKLAALLIWEERLHLICEDPRAFG
FT                   RLSDIVTVPVTPGVVPPAVPAPLDSACQVCPFSRFFSETDSILPKGLSDPTAQRALIAA
FT                   AVRHGPDSVAYRSARQRLVTAIMSETAEH"
FT   gene            457587..459362
FT                   /locus_tag="Bxe_B2626"
FT   CDS_pept        457587..459362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2626"
FT                   /product="periplasmic sensor diguanylate cyclase (GGDEF
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33367"
FT                   /db_xref="GOA:Q13RC2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC2"
FT                   /protein_id="ABE33367.1"
FT                   /translation="MIRKAFSAMSIDRRFGISVAAALLPVLLLCGRLVVHEWHAYMVAD
FT                   DALYAFQTYRAGLLAIESVSAERGPTNSVLGENLPIPEARRASLLRARGESDARIEKLL
FT                   EMLQSSRCPGCATELARIENARAELTGARANVDQLIGLPLAQRRERALSSAVDRMIKVI
FT                   PQFSPVIDALAANVVRGDTRALNCLILATLTADLREAAGQLGSHFTAALTARRALGEGD
FT                   QLAIERTEGRIDQLRELIDSHIRDRSMLESAPFDRMNRQYFGEGMAYITDVRSLATRPG
FT                   GVAISPAQLADHYVPMMRPITAFRDQVLDLADTEIRFHRSNALGLLAVSALAAFLLIMI
FT                   LLSMAMLFRRRVIRPLVDATHVIGAIANGDLTAEIPAARYRGEIKAMFNAIGVLKANSV
FT                   ERQQLERERGRLIQELKATAETDFLTHLLNRRAFESRARLSCAERNAAEPELALIMFDI
FT                   DHFKKINDTYGHATGDHALQLVARLCRETCRQADVVARWGGEEFAVLSRVQDAAQALAV
FT                   AERLRCRIRETRIPVSGGDGFNITASFGVAFASACDSRDVDRLFRRADRLLYQAKEAGR
FT                   DRIFADPTSVASDNA"
FT   gene            complement(459421..459723)
FT                   /locus_tag="Bxe_B2625"
FT   CDS_pept        complement(459421..459723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2625"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33368"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC1"
FT                   /protein_id="ABE33368.1"
FT                   /translation="MKSLIKAATLVVVLAVPLASFAQSEQPVTRAEVKAQLKQLEQAGY
FT                   NPAVATDAVYPADIQAAEARVSARNNAATAYGPSTAGSSETGSGVPAGNPNLQGQ"
FT   gene            complement(459897..461012)
FT                   /locus_tag="Bxe_B2624"
FT   CDS_pept        complement(459897..461012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2624"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2624"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33369"
FT                   /db_xref="GOA:Q13RC0"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC0"
FT                   /protein_id="ABE33369.1"
FT                   /translation="MPLPFYSTDDMISIAQVSSEPWGTLHGGDSVRLFTLRNAHGMKVA
FT                   ISDLGATLVSWHAPDRAGVLGDILLGHDTPAEYVAATTYMGALIGRWANRIADARFTLD
FT                   GIEYTLDRNDGTNLLHGGTTGFHRALWEAGEDNGALLMRLESPEGDAGFPGNVTAQVRY
FT                   SLDDDGTLTIAYEAITDAATPLNLTSHPYFNLTGRPGADIRGHMLSIDADRFFEVDATM
FT                   IPCKLAEVAGNAFDFRRSAPIGARLDWPHAQLATAGGFDHCYVLRDTRDTGMNGATPPM
FT                   REVACAYDPGSGRELTVSTDQRGLQFYTGNSLNGDTGRGGIAYQPHAGLCLEAGGFPNQ
FT                   VNMAEQDEVIVRAGSTYRQVTAYRVDVRKGI"
FT   gene            complement(461015..462232)
FT                   /locus_tag="Bxe_B2623"
FT   CDS_pept        complement(461015..462232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2623"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33370"
FT                   /db_xref="GOA:Q13RB9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB9"
FT                   /protein_id="ABE33370.1"
FT                   /translation="MTRPQTPQTSHRIALLFNANKVYDREIITGIGNYLLSTRVAWDLF
FT                   LEEDFRCRLTGIERFDGDGIIADFDDPAVGEALRDCPLPVVAVGSSFEDPAHYPPDLPY
FT                   IATDNSKLVSLAYTHLIGAGLEHFALYSLPQAQENRWAQQRELAFAHLRSADGRSTAQI
FT                   DGEIYRGLSTSAPSWNQATEQLTAWLRDLPKPVGIIAVTDARARHLLQACLIAGIPVPE
FT                   EVAIIGIDNDPLTRTLTRIPLSSVIQGTEEMGRTAAHLLHQMLHGARFPGRRILVPPVG
FT                   INVLESTRHQPLASPYVMRARHFIRQYACQGIRTEQVADYVGVSRSSLEEYFRRERQCT
FT                   VHQEILRHKLDVAKALLAKRDASSAEVAIRCGFTSLQYMYAVFRRELGCTPREYQERVN
FT                   STPAPG"
FT   gene            462463..463785
FT                   /locus_tag="Bxe_B2622"
FT   CDS_pept        462463..463785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2622"
FT                   /product="D-xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33371"
FT                   /db_xref="GOA:Q13RB8"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RB8"
FT                   /protein_id="ABE33371.1"
FT                   /translation="MSYFEHIPEIRYEGPQSDNPLAYRHYDKSKKVLGKTLEEHLRIAV
FT                   CYWHTFVWPGVDIFGQGTFRRPWQQAGDAMERARQKADSAFEFFSKLGTPYYTFHDTDV
FT                   SPEGSSLKEYSENFLRITDYLARKQEDTGIKLLWGTANLFSHPRYAAGAATSPDPEVFA
FT                   FAATQVRHALDATQRLGGDNYVLWGGREGYDTLLNTDLMRERDQLARFLHMVVDHAHKI
FT                   GFKGSLLIEPKPQEPTKHQYDYDVATVHGFLLQHGLEKEIRVNIEANHATLAGHSFHHE
FT                   IATAYALGIFGSVDANRGDPQNGWDTDQFPNSVEELTLAFYEILKHGGFTTGGMNFDSK
FT                   VRRQSVDPEDLFYGHIGAIDNLALAVERAAVLIENDRLDQFKRQRYAGWDADFGRKILS
FT                   GDYSLSTLATDALARGLNPQHASGHQELMENIVNQAIYSGR"
FT   gene            463955..464983
FT                   /locus_tag="Bxe_B2621"
FT   CDS_pept        463955..464983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2621"
FT                   /product="xylose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33372"
FT                   /db_xref="GOA:Q13RB7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB7"
FT                   /protein_id="ABE33372.1"
FT                   /translation="MKFATRRSVLSSLVCGAVLASLSLAAPLAHASKDHPEIGFCIDDL
FT                   RVERWSRDRDYFVAAAEKLGAKVSVQSADASEERQISQIENLISRGVDVIVIVPFNSKT
FT                   LGNVVAEAKKAGIKVVSYDRLILDADVDAYISFDNEKVGELQAQGVYNAQPKGNYFLLG
FT                   GAPTDNNAKMLREGQLKILKPAMDKGDIKVVGQQWVPEWSASTALRIVEDALTANNNKI
FT                   DAIVASNDGTAGGAIQALAAQHLAGKVPVSGQDADLAAVKRVIAGTQTMTVYKPLKLIA
FT                   SEAAKLSVALAKGQKPGYNAQYDNGKKKVDTVLLQPTLLTKTNVDVVVKDGFYTQAQLA
FT                   SQ"
FT   gene            465063..466622
FT                   /locus_tag="Bxe_B2620"
FT   CDS_pept        465063..466622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2620"
FT                   /product="xylose ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33373"
FT                   /db_xref="GOA:Q13RB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RB6"
FT                   /protein_id="ABE33373.1"
FT                   /translation="MTQPLMTMRGIVKTFSGVKALDGIDLTIAPGECVGLCGENGAGKS
FT                   TLMKVLSGVYPWGTWDGEIIWEGAPLKAASVRDTERAGIIIIHQELMLVPELSVAENIF
FT                   LGNEITLPGGRMNYAAMYQRADELLRELGISGINAAQPVMNYGGGHQQLIEIAKALNKR
FT                   AKLLILDEPSSSLTASEISILLDIVRDLKRRGVACVYISHKLDEVAAVCDTISVIRDGR
FT                   HVATEPMRALTTDRIISLMVGREIKNLFPREPHPIGDVIFEARHVTCFDVTNPRRKRVN
FT                   DVSFALRRGEILGVAGLVGAGRTELMQAIFGAYPGVSEATVVMEGKPLKIRAPVDAIRA
FT                   GIGMVPEDRKRHGIVPGLSVGHNITLAVLGRFASAGRIDSAAELDTIHTEMKRLSVRAA
FT                   HPMLSIASLSGGNQQKAVLTRMLLTNPKVLILDEPTRGVDVGAKYEIYKLIFQLAQRGM
FT                   SIVMVSSELPEVLGISDRVLVIGEGELRGDFVNDGLTQEDILSAAIRPVQRSPNPTVAS
FT                   AA"
FT   gene            466619..467818
FT                   /locus_tag="Bxe_B2619"
FT   CDS_pept        466619..467818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2619"
FT                   /product="xylose ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33374"
FT                   /db_xref="GOA:Q13RB5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB5"
FT                   /protein_id="ABE33374.1"
FT                   /translation="MTPDVTSQRADEALPRGAFGGPQRLQQLFARYKILALLIAVAAIW
FT                   IFFSVLTHGAFVTPRNLSNLLRQMSITGMLACGMVFVIIAGEIDLSVGSLLGLLGGVAA
FT                   ILDVNRHWPLAVTLPVVMLLGVLIGMFNGWWSTYRRVPSFIVGLGGMLAYRGILLGVTG
FT                   GSTIAPVSDGFVFVGQGYLPRLAGDTLAVVLFVLLAFLTIRQRRNRERYQLRVVPVWQD
FT                   VVKVVGAGVILAGFVATLDRYGGIPVPVLLLLALLGIFTWIATQTVFGRRIYAVGSNLE
FT                   ATRLSGVNTNRVKLAIFALMGLMCAFGGIVNTARLAAGSPSAGSMGELDAIAACFIGGT
FT                   SMRGGSGTVYGALIGALVMASLDNGMSMLDVDAYWQMIVKGSILVLAVWIDVVSGSNRR
FT                   "
FT   gene            complement(467845..469737)
FT                   /locus_tag="Bxe_B2618"
FT   CDS_pept        complement(467845..469737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2618"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Tetratricopeptide repeat present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33375"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB4"
FT                   /protein_id="ABE33375.1"
FT                   /translation="MHLRRSYAAQMHNFTHKRSWLSLKMPDATAHHSYVVDIDALIARA
FT                   DADYSALRMRDAESGYQRALALSPLNVHALHRMGLVCVHLKKIAEADTYLERALNADPA
FT                   RADLWEHAGLIAAIKGEYIRSEAFYRRALGLSGSTATLHRNLADCLRLSGRLADAKVQY
FT                   KKALSIEPDLHHAIRAIARLSAELGETDDAADYWLSAWALDSSSLQDGFDLIHALAKAN
FT                   RTVRVNEAVAQISKREADNPEALQALCLALYRVDSFANMLNVARQAIRMDPQRVALHHY
FT                   AAHALSVRGRVAEALVYSSEAVRLAPDDPVMQCQLACLELSQGDFKSGWARRNMTYAMP
FT                   LARATLVFPDFPVWNGEPVSGSSFLLVGEQGRGDEIQFIRFAEWLHQQGAVVDVLVSQP
FT                   VARIAASMTGVRSVFTKLPAGPYDYWSHMLRMPEHMKLDLPMLPVAMPYISASPLHVDQ
FT                   WRSRINAASPSTAYKKTARIGVVWAGGAHTALDRFRSISMEALKPLLEHPGTTWFSLQK
FT                   GEHERDSERLAGKFDLHTLGPVIEDFADTLAILETLDLLITVDTAVAHLAGAANLPVWV
FT                   LLPAYSELRWLTGRTDSPWYPSMRLFRQRELGEWNTVVEEMREALTDWCRTGPI"
FT   gene            470345..472615
FT                   /locus_tag="Bxe_B2617"
FT   CDS_pept        470345..472615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2617"
FT                   /product="Putative isoquinoline 1-oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33376"
FT                   /db_xref="GOA:Q13RB3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB3"
FT                   /protein_id="ABE33376.1"
FT                   /translation="MLKRRTFLLGGAGAVGALLVGWSVLPPGQRLTTSMPLPAQGTQVA
FT                   LNGWVKIAADNSVTIMMCKAEMGQGIHTGLAMLLAEELDADWSQVRVEDSPIDRIYNSV
FT                   QNIIDDLPFRPDDDSAIKRATVWMTRKVVSEAGTMMTGGSSSINDLWTPMREAGASARA
FT                   MLIGAAAAQWKVPAGECRAEGGHVLHPSGHKASFGELSSMAAQQPLPRQVALKDPAGFK
FT                   LIGKPLRRIEAASKINGTARFGIDALPDGLLYASVVMCPTLGGSVARFDATAAGKMPGF
FT                   IKAFAVAPYNGGTGGVAVIADNPFRAMNAVTAVEVDWHDGPAAKLSNADVDRHLAQALD
FT                   DGDGHAYYRLGDVDAALSRAARTVSAEYRAPYLAHGAVEPPNCTVQVTDGSAAVWVSTQ
FT                   MPALARHHVAKVLDLDADKVDVQTLLLGGAFGRRLELDFIAQAAAIAREGGGRPVQTIW
FT                   SRAQDFTHDFYRPACVSRLKAGFDNDGKLVAWQATSASQAIVPESLARYYGVPRIPIDK
FT                   TTCEGAFDQPYEWPAARVAHKIVELPVPVGFWRSVGHSHQAFFTEGFTDELAVAAGQDP
FT                   IAFRAALLAQHPRHLAVLRRVAVLSDWGHPLTHAADGAPRARGVALHEAFGSVVAQVAE
FT                   VSIGPDKGIRVHRVVCVIDCGMPVNPNLIRQQMESAIVFGLSTALQDEISLVNGQVQQK
FT                   NFVDFPVVRINDCPVIDTDIMPSQMHPQGVGEPGVPPVAPAVANAVFALTGQRLRSLPL
FT                   KLA"
FT   gene            472667..473128
FT                   /locus_tag="Bxe_B2616"
FT   CDS_pept        472667..473128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2616"
FT                   /product="Putative isoquinoline 1-oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33377"
FT                   /db_xref="GOA:Q13RB2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB2"
FT                   /protein_id="ABE33377.1"
FT                   /translation="MGSLNINGRAVAVQADPDMPLLWVLRCELGMTGTKFGCGLGICGA
FT                   CMIHVDGEASFACQTLMSSLHTQKITTIEGLQGAEAQALKAAWIDLDVVQCGYCQSAQL
FT                   MAACALLKHNPKPTDADIDTAMCHIVCRCGTYPRVRAAIHQAAAKRRSA"
FT   gene            complement(473504..475036)
FT                   /locus_tag="Bxe_B2615"
FT   CDS_pept        complement(473504..475036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2615"
FT                   /product="aromatic acid efflux system, outer membrane
FT                   lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2615"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33378"
FT                   /db_xref="GOA:Q13RB1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB1"
FT                   /protein_id="ABE33378.1"
FT                   /translation="MKLSRALPLLPLLPLLPLAAALDGCMNVGPNYALPQQALVNAPLA
FT                   NTPIEGADAALTTRRNVPPVWWKLYDDPVLNGLVDEALQSNTDLRVAAANLARSREALG
FT                   VAQAQGGFSGKTSALIERAQESAEQYLLTEKLPVANEGDIGISVSYEIDLFGKLRRGVE
FT                   AAQADSESVQAAADLARITVVADVVRSYVEQCSAADELRIAQQSLSLQKQRVDVSRRLR
FT                   DAGRGNQPDVTRGQTQVDTLSADIPRYTARRKIAQYRLAALLARAPSDLPPAVLACDTL
FT                   PQIRQPIPIGDGAALLKRRPDVREAERQLAASTARIGVATGALYPTVSIGASAGLTGIL
FT                   EDLGTSPTARWGFGPLISWTFPANGARGRVGEAQASSQVALAKFDGVVLTALRETETSL
FT                   ATYASDYARADALRAAVKSAAASADETHRLYLAGRESFISDLDATRTLTSTKSQAAAAE
FT                   GQVAIDQVNLFLALGGGWEMDPPNASGSPAPAAAAMPVKAAPTAAAASAKAP"
FT   gene            complement(475033..476037)
FT                   /locus_tag="Bxe_B2614"
FT   CDS_pept        complement(475033..476037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2614"
FT                   /product="aromatic acid efflux pump, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33379"
FT                   /db_xref="GOA:Q13RB0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB0"
FT                   /protein_id="ABE33379.1"
FT                   /translation="MKKTWFSVGQILLTLIVVVAAALVLWKLVDYYMFAPWTRDGHVRA
FT                   DVIQVAPDISGLISSVEVVDNQQVRQGQVLFVIDQARYTLALRQAQATAQQRRATLDQA
FT                   RREDARNRKLGNLVAAEVSEESRSRVEQGEAALADANVAIDTAKLNLQRATIVSPVDGY
FT                   LNDRAPRAGEFVAAGRAVVSVVDMHSFRVDGYFEETKLRGIGIGQPVDIKVMGEPDVLR
FT                   GHVQSIVAGIEDRDRSQGTNLLPNVNPAFSWVRLAQRIPVRVALDEVPADFRMIAGRTA
FT                   TVSVRDLAPGGKTRPGADAVGAVGAVGASASSSTLATSTVPAASAAVISGASQ"
FT   gene            complement(476034..476243)
FT                   /locus_tag="Bxe_B2613"
FT   CDS_pept        complement(476034..476243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2613"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33380"
FT                   /db_xref="GOA:Q13RA9"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA9"
FT                   /protein_id="ABE33380.1"
FT                   /translation="MIGEIDIFGVFVPAVLVLMLIAYLVNLAIRTVLARVGFYRFVWHR
FT                   SIFDLGIYVLVLGLVVVVSHRLIT"
FT   gene            complement(476299..478401)
FT                   /locus_tag="Bxe_B2612"
FT   CDS_pept        complement(476299..478401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2612"
FT                   /product="aromatic acid exporter, ArAE family"
FT                   /function="Fusaric acid resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2612"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33381"
FT                   /db_xref="GOA:Q13RA8"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA8"
FT                   /protein_id="ABE33381.1"
FT                   /translation="MVYPSLRDWLFSVKTFAAAMTALYIGLALELPRPYWAMATVYIVS
FT                   NPFVGATRSKALYRALGTMLGASAAVLLVPPFVESPYLFSVIVALWTGTLLYLAVSDRT
FT                   ARSYVFLLAGYTMPIIALPSVTNPTGVFDLAVSRTEEITLGIVCASIVGSALFPSRLAP
FT                   TIIERTDAWFRDAAFYATETLSGRIAGSAVSGARQRIAATINGLELLLSQLAYDHTRPD
FT                   VLARAHELRGRQQLLLPIMSALADPLIALYNSSRQTWPEGLESLLADLIEWFNEPMPAV
FT                   SEGYHPDPTADALRERIAALQPPPSALASWDGALLSNALWRMKQVIDVWQDCRSLRIII
FT                   TREEGSWRPRFRHWRLGGTERFYDHGIMLFSTGSAAAAVVLACSLWIGSGWNDGASAVT
FT                   LAAVACCFFAALDEPAPFVFRFFVATAISVVAAGVYLFAVLPHVHDFPMLVVMFAAPFI
FT                   FVGTLIPRPQFNLATVLVAVNTATFISIQDAYDANFFVFLNSNLAGLAGLLYAYVWTRV
FT                   TRPFGAELAAARLLRSSWADVALTASTRPIDDPRNLAARMVDRLMQLIPRLAATDDHRH
FT                   PSIESFRDLRIAFNALDLRRLTRKLGGEAPAAIDHVLDDVRRYYESCVARRKREPVPDS
FT                   LMSSIDAAVARVTVQGLANAGAPSATSQTSARQLRDALHALVGLRLALFPATLIIPTPP
FT                   EPEAAA"
FT   gene            complement(478408..479016)
FT                   /locus_tag="Bxe_B2611"
FT   CDS_pept        complement(478408..479016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2611"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2611"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33382"
FT                   /db_xref="GOA:Q13RA7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA7"
FT                   /protein_id="ABE33382.1"
FT                   /translation="MPNLDTLRRTVSSTLVVAARKWRRTSHGVLAAFNVSEACATPLLT
FT                   ASRLGSAVRQVTLADHIGIEGPSLVRLLDQLCAAGLMRRDEDPEDRRAKTVVLTEEGRA
FT                   VTAKMEEELVTLRAQALKDVSRSDLEATLRVLAAFTGETAEPAGQSSEPGAEEGSRADQ
FT                   RTAGEAAQTGGQLRQAARENRSHKGKAEPAAPHETGDPA"
FT   gene            complement(479102..480760)
FT                   /locus_tag="Bxe_B2610"
FT   CDS_pept        complement(479102..480760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2610"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33383"
FT                   /db_xref="GOA:Q13RA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA6"
FT                   /protein_id="ABE33383.1"
FT                   /translation="MEQRVLILAPFGRDADVIAEVLRKDDRMCVACHDADALTTALDAG
FT                   AGAALIAEEALAGDHAMRLFNWLEQQPAWSDFPFTLLAAPRVGHRSERGLEVLERLGNV
FT                   VVLERPLNSETLRRAVASSLRARARQYETRRHLAERIQAQDALVQLNDSLESRIAERTH
FT                   ELASANNRLMMEIHERAKVQAVLVQSQKMEALGQLTGGIAHDFNNLLNVIMVNAELIAR
FT                   VSSDERLRGMAATVKRATERGAKLTGQLLTFSRNSNLDLKAVDVVTLLQGMRDIITVSL
FT                   GSSIRYTNEFDGAELWTEADANQLELAILNLAINARDAMPAGGQLGIRVKEREAPDQTL
FT                   EAGPYVVIEVADTGSGVPPEVVSRVFDPFFTTKPIGKGTGLGLSQVYGIATQAGGTARL
FT                   FSEEGVGTTVEIWLPLRERVVPQAEATSNAEANAVGEKRVLVVEDDGEVRAMLVESLRM
FT                   LGYTVTEAADGRAGLNRLQDDKPDLLMVDFAMPGMNGIDVIAEARKLREDLPVILATGY
FT                   ADVDISGLAVKRCTILRKPFQLDDLARTVRLGLAA"
FT   gene            complement(480765..482282)
FT                   /locus_tag="Bxe_B2609"
FT   CDS_pept        complement(480765..482282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2609"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Weak similarity to circadian clock proteins
FT                   ofCyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33384"
FT                   /db_xref="GOA:Q13RA5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA5"
FT                   /protein_id="ABE33384.1"
FT                   /translation="MSNRHDADTPARLSSGIDGIDDILGGGLTPHRMYLVEGAPGTGKT
FT                   TLALQFLLKGVEEGQGGLYITLSETRPELIAVAESHGWDISRFTILELLSDEGLDPQYE
FT                   QTVLHPAEVELGETVRNVIQHVDELKPARIVLDSLSELRLLSQNPLRYRRQILALKRYF
FT                   ATRECTVLLLDDNSSDPGDVQLHSIAHGVISLDNLVHDYGGNRRRARVAKMRGIKFREG
FT                   YHDFTLDTGGIHVYPRLVAAEHHADFSTEVVSTGTAGLDALLGGGLIPGTNALMIGPSG
FT                   VGKTTTVVSCLIAALERGERCVYYVFDETLTTLMTRCATLGIYLAPHVESGLLTLRQID
FT                   PAEISPGEFASDVRRSVEKKGVRYVAIDSLNAYLQAMPGERYLLLQMHELLGYLNQQGI
FT                   VTMLVLGQHGIIGEVQNDIDISYLSDVVVLFRYFEHHGEVLTAITAVKSRANAHERSIR
FT                   QFRLGVNGVEVGDALRDFEGVLSGLPAYRGSTALLGATNRVIETPGK"
FT   gene            complement(482380..483282)
FT                   /locus_tag="Bxe_B2608"
FT   CDS_pept        complement(482380..483282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2608"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33385"
FT                   /db_xref="GOA:Q13RA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA4"
FT                   /protein_id="ABE33385.1"
FT                   /translation="MELRHLRYFLAVAEEGQFTRAAERLAMQQPPLSQQIRALEEEIGF
FT                   ELFVRMPRGVTLTPAGQAFAEDAQRLLQDLQQSVEKASRIARGELGTVSIGLTSSAAFH
FT                   PFTTEAIRAFRAVCPEVAVELAELNAAEIIERLAAGQIQAAFLRKPVEAREGVAFELLL
FT                   DEPMVVVLPVGHPLLKGRKRPQVPLKALAHEDFILVRRPGAPGMYADILAACRQAGFVP
FT                   RIAREVPRMVSGINLVAAGLGVTLVPASMQRYDQVGTVYCTLANPSKLSAPLHLAYPTA
FT                   LHNSAATRFIQLVTARAAL"
FT   gene            483410..484501
FT                   /locus_tag="Bxe_B2607"
FT   CDS_pept        483410..484501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2607"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2607"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33386"
FT                   /db_xref="GOA:Q13RA3"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA3"
FT                   /protein_id="ABE33386.1"
FT                   /translation="MNAKYNKIRQETSVKKQYAVAALAVVSCAGAHAQASVTLYGVIDT
FT                   NLEFLNHAGASGGSLVRENSGGLSNSRFGFRGAEDLGGGNKAFFILEAGFNGNDGTNAS
FT                   AGVLFNRTAAVGLSNAYGALSAGLQYTAMYDTLIKYDPMVFGQQYTWMPTTGSVDGFSF
FT                   KARVNNSVKYVGRFGGLTATADYSFGGSADSFQSSAAYGGALDYDTGSFAAAVAYDYRN
FT                   GAINSTGMWTKSRNWSASAREQLGNVTLMGGYEHYLYDPTKGKSVSSALWFGGVRYLIA
FT                   PDFRVTAAAYYQSNKADNVSNSLMGVLGADYILSKRTDVYATVAYAAATHYANDEYTPV
FT                   GLTSDTAFGPNQTGVTLGIRHRF"
FT   gene            484588..485664
FT                   /locus_tag="Bxe_B2606"
FT   CDS_pept        484588..485664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2606"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33387"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA2"
FT                   /protein_id="ABE33387.1"
FT                   /translation="MTFNLSRRLAVLCAATGAALLMTLAQPAFAVHAYEPHLKPVATVS
FT                   DTRFTLDTPQGHAEFPLYLSKDWSVAQPQVTRAVIVIHGKLRNADVYFRTAQKARDAAH
FT                   ADPDATLLIAPQFLATLDTRVHDEPADLLRWSGDAWMGGDAAQAPLPISSYEVLDAIVA
FT                   RLADRKLFPNLRHVVFAGHSGGGQVVQRYAVAGRNIAALTDEGIDVRYVVASPSTYAYF
FT                   DAQRPNAQGVAAPFDAAQCPDFNQWKYGMDNRPPYLGDRTPAQLEATYAARRIDYLVGG
FT                   ADDDPQQNALDKTCAAEAQGPQRVARAEAYYRYIQSRHPHGLKQRFHIVPGVGHNGSRM
FT                   LTSVCALAAMFDTQGCEQ"
FT   gene            485661..487019
FT                   /locus_tag="Bxe_B2605"
FT   CDS_pept        485661..487019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2605"
FT                   /product="major facilitator superfamily (MFS)metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2605"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33388"
FT                   /db_xref="GOA:Q13RA1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA1"
FT                   /protein_id="ABE33388.1"
FT                   /translation="MSEAILNQRDGAASGADASNTLSPAMVRRAIFASVLGNGLEWFDF
FT                   LIYGYFAKIIAQVFFPGGGGFVSIMLTLATFAVGFIVRPIGGILLGIYADRAGRRKALS
FT                   LLIISMAASTLLMGLTPGYASIGIAAPLLVVLARLLQGLSVGGQFATASAMLVEYAPPH
FT                   KKMFYGSFNMSAQAFALLLSSGVGYLLTTQLTHEQLVAWGWRLPFLFGALAGPFGFYIR
FT                   HRVAESPEFERLLDHKDKPPRVTIRQFFRDNGDAAICAMGVIIIGAATNYVWHSYLSVY
FT                   VERQLHLPLSTALLGAFVSGVLNLFLFPLSGKLADRYGAYKLFYPIVIAWMVCVYPLYH
FT                   FVVTNPTPGHLFIAQMIATVFLAAMSGAHPGMLATLFPVRSRSAGVALSYNIAVTLFGG
FT                   MAPLTITGLTRVTGSSLTPAFYLIFAGFVSLAMVYFTRAGRISGGAAARPATH"
FT   gene            487039..488052
FT                   /locus_tag="Bxe_B2604"
FT   CDS_pept        487039..488052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2604"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33389"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA0"
FT                   /protein_id="ABE33389.1"
FT                   /translation="MTQPLITDDERAPNERPVAVVASRHLSVTTRAGSGTVPVFANGDW
FT                   LAPTREVRRAVILIHGRLRNGDTYYDLAERSCALAGGSAADTLLIVPQFLATADVEAHE
FT                   LPPSTLHWDWTSWMGGENAEGPAPISSFEVLDAILLTLASREQFASLAEVVIAGHSGGG
FT                   QVVQRYAVVAHSEAPLTARGVAVRYVVANPSSYVYFDAMRPVASGEFAAFDRAMCPSFN
FT                   RWKYGLEDLPAYASDPDSAACAAALEARYVQRDVTVLLGGEDCDPLHPALDRSCAAQSQ
FT                   GSHRLGRGLAYARYMAARHPEGLPTHRTFVVDGVGHDAKGIFSSAYGLAALFGAGL"
FT   gene            488066..488614
FT                   /locus_tag="Bxe_B2603"
FT   CDS_pept        488066..488614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R99"
FT                   /protein_id="ABE33390.1"
FT                   /translation="MVHGVMHSAHIGTKRAAALDACLMLPVCHFEDRADMNRIRLVATV
FT                   LAAASLGALLPCSGAYADDAPSPCTSLKRIVAAAPGGLASLTPDDGKGIAQPYGDDAQC
FT                   SASHGSYQCTWTPHHDAGSNADALQAVAADVASCLPDATHDQNSPGRQHFYLGAKGKRT
FT                   GITLTPTGANKLRLVVSGK"
FT   gene            complement(488652..489245)
FT                   /locus_tag="Bxe_B2602"
FT   CDS_pept        complement(488652..489245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2602"
FT                   /product="Putative phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2602"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33391"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R98"
FT                   /protein_id="ABE33391.1"
FT                   /translation="MDTRLLMISHASTAAQRAGRFPADDPLDARGLAEAHAYAARITPA
FT                   IGQGAAAYVSPAVCARDTAAALGLAASVDVGLAEMNYGTWQGRRLADLAVEAPQDLAAW
FT                   TRDPDAAPHGGESFSNLVKRIGEWLDALRRVADPASKHTRNVIAVTHAPVLRAAIVSAL
FT                   GASPVVFSRIEIAPLSTIELRRSSRGWTWWPASQ"
FT   gene            489497..489730
FT                   /locus_tag="Bxe_B2601"
FT   CDS_pept        489497..489730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2601"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33392"
FT                   /db_xref="GOA:Q13R97"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R97"
FT                   /protein_id="ABE33392.1"
FT                   /translation="MTEAVFNSASRPASQPVAQPTPIPLRELLPWLVFGGLLLLLALYF
FT                   VGAEQGATSLVPGMYVHEFVHDGRHLLGFPCH"
FT   gene            489742..490482
FT                   /locus_tag="Bxe_B2600"
FT   CDS_pept        489742..490482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2600"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33393"
FT                   /db_xref="GOA:Q13R96"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R96"
FT                   /protein_id="ABE33393.1"
FT                   /translation="MVGKLLVRGMLAGIAAGLLTFGFARVVGEPQVNQAISFEEKADAA
FT                   KGEAPEPELVSRDTQRGLGLLTGVVVYGAAFGGLFSLVFAYAYGRVGALSARALSAWLA
FT                   LGAFIALAVVPNLKYPANPPSVGDPDTIGMRTGLFFLMIAISLAAMVFSLKVRRRAAAK
FT                   LGAWNGSIVAGLVFVVIIAAVQLSMPAINEVPEAFPAVLLWKFRVAALGMQAIMWTTIG
FT                   LLFGALVERGAFMRVGGGSAVESA"
FT   gene            491039..491179
FT                   /locus_tag="Bxe_B2599"
FT   CDS_pept        491039..491179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33394"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R95"
FT                   /protein_id="ABE33394.1"
FT                   /translation="MSHVMEGQDTTRWKYFFDTLRIAETPATLTLEAVRTGIGWERKEK
FT                   S"
FT   gene            491547..493955
FT                   /locus_tag="Bxe_B2598"
FT   CDS_pept        491547..493955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2598"
FT                   /product="YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33395"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R94"
FT                   /protein_id="ABE33395.1"
FT                   /translation="MCAPNVSNNKPIGIRTKKSRLHGETAGFAGRLLAAFSLLIFAFSA
FT                   NAVDCFSLYAQSGATPGSKTCKLDVTSNTPGGMGNYACINDLALIDQWCNSTETPPDDT
FT                   CPVADPVFPANGIVTFSETDFASGDASPLVFSRTYLSKPFDKAQVAMGGYWASNWQRRL
FT                   DLTSVNASTPKITAYRSNGQPLIFKWVNGGWAVPGTSGLSLLKAGDGYFYLKDERLGTT
FT                   ETYSVSTGLFHSETTRTGMYREVEYVGQQIDSIAQWPVDRTGQAASRLTLSLTYDSNGR
FT                   ILSVVPPSGNATHYAYDAKGNLVSVTAPIGYVRQYLYEDARFPNAMTGIKDESGSRIAT
FT                   WTYDSSGRAISVTHPDTTRNVSFSYGANTTTVSNMSGNSTYSFNVGDTSRPGSIVTPGG
FT                   AVSRTWDTSGNLNQTITPDGNTQYTWDGANRPTKAVATVSGNRTVTTIEYSDSTSLRPH
FT                   LVATPGKIRAFVYDQAGNVTGYAETETSDLTGDQGMQAVGTGNQWTVGARYDSASRLLS
FT                   AAITRNGSKREDWTYTYDVRGNVESVQDAVSGWSMRTLSRNAENRATQIAGNSGQASIG
FT                   YDERGRVKSFQYSEPASSLNGGLARVLAVDYRYGPDGSVSSRTAQVSTNGAWWKPISDA
FT                   ELGVWLTNWELGNDPVAPPANLTGLQSDAPAFVPDMCVECYMAWKALPTGKLFGHELGE
FT                   TLPAWREATELMVSDQAQVPYPVLVPDLTSSAKRSTLYSTLFGGGSGDGGMVKCGGSGN
FT                   NEWREADCHAKYMYDMQICNSLGTIMGKSRGRALCKQQAFEDYQECRGH"
FT   gene            493952..494230
FT                   /locus_tag="Bxe_B2597"
FT   CDS_pept        493952..494230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R93"
FT                   /protein_id="ABE33396.1"
FT                   /translation="MMTSYPPRSVVVTYDEDSQQIVLQLVDPAKLAPLLARTLKAPILL
FT                   EEFDFRLDDEFVRRLGGGLLNLIALGQPEIKQYTTYTQHPIDELPEG"
FT   gene            495392..497317
FT                   /locus_tag="Bxe_B2596"
FT   CDS_pept        495392..497317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2596"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33397"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R92"
FT                   /protein_id="ABE33397.1"
FT                   /translation="MASMDPELPAYYQGELHYIHELFQEFAQQHPKIARRLGAQAGEAG
FT                   DPYVERLLQSFAITAARSQMRIDRFSLDIPLRKLDGVDLNLTAPLPSLGVARFYPDAEA
FT                   PHSPQGLTLARGTRLTVHAAEDATECAFLTSQPLRLWPVAITRAKPTGIPADVPALYRY
FT                   VHDGQDASRVRGALRLSLATVNGMAFRGLEALDELPVYLCGEEKMASQLFELIHTSVVG
FT                   IVMGVPGEFEKGGLYGAKLPGMPYMQVKHAGLEPHESLLRPVAAKFHGHRLVHEFFALP
FT                   SRFGFFTITGLAAGLKHIGGPEVEIVLLLAREAATLDQQIGVRDFALYCTPIVNLYPAT
FT                   SERLTMHPEKHEHPLTPVAERPGDYEVHSVDRVRGQLEEESEKFLFQPLDAALPDDTRR
FT                   NSRYFTLRREQQLVADNERRYDTHREFVRTLTSITLLDENRKPDETGMRFLTFDAWLTN
FT                   GDLPCVQPRNGVNDLTMADAKAVESVGFVRGPTAPRPPLALGARGDAAWELVRQFHLEL
FT                   AVFDDEFDEPNPGEGLRLMLRPYLAAGDPAMARVLDSLVGATAGAVNDMHCWGGELHLA
FT                   RGIAVTLTFDESRLDGWSPFAFALVLERYVARHVSAHCFTRTTVRTTQRGEIFTFPTRG
FT                   GTRGVF"
FT   gene            497330..500068
FT                   /locus_tag="Bxe_B2595"
FT   CDS_pept        497330..500068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2595"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33398"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R91"
FT                   /protein_id="ABE33398.1"
FT                   /translation="MTWNTQSRTLEIVSDAIPEHCGKKIFEPVRCKGTDKLGRLFDYRI
FT                   DVQTIEANGLHVNDMDRLVDVSKLVGKRLTVKIAIEGSGTQESDEQNIGADVRVITGVI
FT                   AEVKCVGADDRRMFYRLRLRCLLWLASLNRDNRHFRDRTVREISDEILKKYPFSVRWNL
FT                   IGAGNGSRNFPKRDYQRQFWESDFSCLNRLWQEWGITFYWDDDTLVLMDNAGYPAHGPA
FT                   CKTVRYLERGGQRIDEEHIHKLEYSRGLTTGKVAGIDYDYTRATNRQFKRRISNHRDAA
FT                   HDNAEEYTWLDYAQPQQGAMGLNAEPNDYEFEGDHLARVRVDAHRNKSLVIKATGNLRG
FT                   VMTGHQLTVAGHPFAPVNRKYIVTGTKIEIVNNDSVTQGGTLQREYTCRTKFTAIPNDH
FT                   YYRTPQKAKKPRAFAEKAVVTGHDKKGVHTDAMARIRVKFIWDRVSQADEEASCWIPLM
FT                   QVWQGQRYGMNFVPRVGDHVYIGFLNMDPDRPFILGSHTTDRNEAPWDLYANHALSGWR
FT                   SQDLDGYGKGSNTVVTDDTPGQLQVQVTSDHANSRFVAGCNVRIDGNTGRSQARGEGIE
FT                   IATDANAVMRANRGMLITTEARDGATAPMKDMGETIARLDEARTLHDRLAGEAQANGAQ
FT                   DSGGDQKAVASAIRAQNRALAGKAGAGKFPEFAQPHVTLASPAGIESTTAGSTHVASGE
FT                   HLAMTSGADVAIAAGGSFFGTFGNKLRMTVQKAGMRLVAVSGDIDLRALKDSINLLARL
FT                   NVTVTAEKITISAKQEVEIRGGGSFTRWSNGKIYHGTPGQFEIHSAGRLFTGPDSASLP
FT                   TLPESAPGQQELHFALGALANGAAHRYVEEPYELYQGNALIDSGVTDSYGRVVVKDHQP
FT                   ETTEYCVKLCYGGQFRLKVKDALNADADHIDQRSNRGDRAV"
FT   gene            500102..502156
FT                   /locus_tag="Bxe_B2594"
FT   CDS_pept        500102..502156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2594"
FT                   /product="Putative phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33399"
FT                   /db_xref="GOA:Q13R90"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R90"
FT                   /protein_id="ABE33399.1"
FT                   /translation="MSNLKTQNPVDVAITEVGGQAQGSVQWLLEKKTCPDAPEITEGND
FT                   LQFFICGQEGFGQLSKDLRAAKSTVDIVCWGFDPGMEVERTGEAWPRDLRYGDLLEQLA
FT                   KAEVRVRLLLWFDPRASRKQNSMPGYTDVPVSLATSPIQRMVQGDDPYGNPVRHDWCKA
FT                   WWKRHGLENDRIDPRKALYPDHLQIVLRGIEKQAVKGLLAADIAEEDRPDSSWLSPVDE
FT                   SALLWNYPTHHQKPVLIDYAHDGGSKAVGFVMGLNSVTDFWDTAEHKIETGLRETGARS
FT                   TWEGEIDHEYRSDFGGGDPGEAQKVAAIHGGNYTSIRPYQDYACRVVGPALRRLHENFE
FT                   NGWNAFAPSQWKTSAKDGDSLPPKIPTLAKDPAQRVQIVRTQAAEGEKTIKKLYFQATS
FT                   IARNYIYIENQYFFYPEFARHLKNERRKFCRAWARLAKKPMTAVPNLHLFIVIPHPEDD
FT                   GMVPRTFDTLTELGKSDAMPAQAGYVDEGKADQQYGNHSTQATYTTTFTDESGEPVSIA
FT                   RTHPVLDRPSLETLERTLGLKVSVARLCTSDSVEGKMAYREIYIHSKLMIIDDVFLTLG
FT                   SANLNQRSMSVDSEINIAATGAEHAARLRGDVFGLHSGGDIKGDGGREAMPSVFGDWES
FT                   YMQKNYNKCKEGNEKLKGFLVKFEDKRSTSTKHAMNTVAPSTNGQTALT"
FT   gene            502153..503517
FT                   /locus_tag="Bxe_B2593"
FT   CDS_pept        502153..503517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2593"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2593"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33400"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R89"
FT                   /protein_id="ABE33400.1"
FT                   /translation="MKFARARYLIGAWLLFVMTQAAVAVSPIHYLTTAMSGSDLPRYTK
FT                   LPLFAPHRKDFTCVYQEQHLPPVDPQAELWFQQALASELDPNIYWEDKDWRKIYQLYQQ
FT                   AAERNHWKAMLNLAALILSGYPVPVRDPEMAIRWVEKAMQLEVPDAWDTMGVYHMKGIV
FT                   KGGDATSAYAFFQKAADMGSPSAQSFLGAALDAGWDNPGSGFWANLPVGVKMLECAVGQ
FT                   GYGDAAHELGFVYARPNTPEARLRALRVLHDGVKLGSGQCANYLGSQFRGMDLTEGENL
FT                   AGYIDKARADRYTKLSDILKWYEGTLKLPNLDKVLPLPPAPLPKWDGDVQTLIDAAKAV
FT                   TPPPTSPAHPSQSEPHAALTKAGLLRQLADRPEPLRCNGGLKCPQSGIWEARVAAAHPL
FT                   AALYNRWDRQAFVEKEASFPDPRQQHLDISAHDVRWTWLGSPNQLRVADVYDIAL"
FT   gene            503793..505064
FT                   /locus_tag="Bxe_B2592"
FT   CDS_pept        503793..505064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2592"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2592"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33401"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R88"
FT                   /protein_id="ABE33401.1"
FT                   /translation="MTAMSSSDLPRYTKLPLFAPHRKDFTCVYQEQHLPPVDPQAELWF
FT                   QQALASELDPNIYWKDKDWRKIYQLYQQAAERNHWKAMLNLASLILSDYPIPVRDPDMA
FT                   ISWVEKAMQLGVPDAWDTMGVYHMNGIVKGGDATSAYAFFQKAADMGSPLAQAFLGAAL
FT                   DAGWDNPGNGFWANLPVGVKMLECAVAQGYGDAADELGLVYARPHTPEANLRALKVLHE
FT                   GVKLGSAKCAKSLGVEFSGFSLSSGDNIAGYVDMERSKRYRKIGDVLKWYEGTLKLPNL
FT                   DKVLPLPPAALPKWDGDAQTLIDAAKAVTPPPTSPAHPSQSEPHAALTKAGLLRQLADR
FT                   PESLRCNGGLKCPQSGIWEARVAAAHPLAALYNRWDRQAFVEKEASFPDPRQQHLDISA
FT                   HDVRWTWLGSPNQLRVADVYDIAL"
FT   gene            505213..506610
FT                   /locus_tag="Bxe_B2591"
FT   CDS_pept        505213..506610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33402"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R87"
FT                   /protein_id="ABE33402.1"
FT                   /translation="MKLERCLSHTYMKFARVRYLFSLWLLFAMTQAALAESPIHQLMTA
FT                   MSSSDSPRYTKLPLFAPHRKDFTCVYQEQHLPPVDPQAELWFQQALASELDPNIYWEDK
FT                   DWRKIYQLYQQAAERNHWKAMLNLAALILSGYPVPVRDPEMAIRWVEKAMQLEVPDAWD
FT                   TMGVYHMKGIVKGGDATSAYAFFQKAADMGSPSAQTFLGAALNAGWDNPGSGFWANISV
FT                   ATKMLECSLAQGYGDAADELEFIYAAPRTPEARLRAVTVLQEGAKLGSAKCASLLGSQF
FT                   RGMGLSDGKSLVGYVDKARAERYSKISDILEWYEGTLKLPNLDKVLPLPPAALPKWDGD
FT                   VQTLIDAAKAVTPPPTSPAHPSQSEPHAALTKAGLLRQLADRPEPLRCNGGLKCPQSGI
FT                   WEARVAAAHPLAALYNRWDRQAFVEKEASFPDPRQQHLDISAHDVRWTWLGSPNQLRVA
FT                   DVYDIAL"
FT   gene            506760..508031
FT                   /locus_tag="Bxe_B2590"
FT   CDS_pept        506760..508031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2590"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33403"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R86"
FT                   /protein_id="ABE33403.1"
FT                   /translation="MKFERWLSRTYMKFARVRYLFGLWLLFVVAQTALAESPIHQLMTA
FT                   MSSSDLPRYTKLPLFAPHRKDFTCVYQEQHLPPVDPQAELWFQQALASELDPNIYWKDK
FT                   DWRKIYQLYQQAAERNHWKAMLNLASLILSDYPIPVRDPDMAISWVEKAMQLGVPDAWD
FT                   TMGVYHMNGIVKGGDATSAYAFFQKAADMGSPLAQAFLGAALDAGWDNPGNGFWANLPV
FT                   GVKMLECAVAQGYGDAADELGLVYARPHTPEANLRALKVLHEGVKLGSAKCAKSLGVEF
FT                   SGFSLSSGDNIAGYVDMERSKRYRKIGDVLKWYEGTLKLPNLDKVLPLPPAALPKWDGD
FT                   AQTLIDAAKAVTPPPTSPAHPSQSEPHAALTKTGLPPQPAARPQPMRCDSGRKCPESGI
FT                   REARVATRHPHAPLHNRLDRHAFA"
FT   gene            508125..508388
FT                   /locus_tag="Bxe_B2589"
FT   CDS_pept        508125..508388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2589"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33404"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R85"
FT                   /protein_id="ABE33404.1"
FT                   /translation="MTRQIIVTGDTLAPFGGEVIEGSEMDNIDGRKIARKSDRVYCAEH
FT                   GVNPIAEGDDSTLVDDRPVALEGHRASCGCTLVSRQQTLSVA"
FT   gene            508531..509589
FT                   /locus_tag="Bxe_B2588"
FT   CDS_pept        508531..509589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2588"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33405"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R84"
FT                   /protein_id="ABE33405.1"
FT                   /translation="MKRAAPNVAMSVNLLDDLVATPWRHGFIALMRRINADPAIAPVGT
FT                   ALLPYSEPFRIGQKPSLVFAPSEVAEARIKDNRLHIRLHSLGMLGPNGPLPIHVTEIAR
FT                   EREALRGDTTLSNFLDVFHHRSLALLYRAWASAQAAASLDRPDHDRFSFYVGCVSGTSP
FT                   GRDRTVRLPSHARLASGAHLVHEARNPDALAMTVAHRFHVPARIDEWSLHWTVLPPKLQ
FT                   CRVGQERMSAILGGGAVLGEQVPGRMHRFCLVLGPLDIETYHRLTPRGADLLRLIALVR
FT                   AHMGLEYEWLLELQIRPQDATCASLGDNQQLGWSGWLGEPPAGEPVVGMRFEPELYVKQ
FT                   LVRNMQHTRRQA"
FT   gene            complement(509754..511670)
FT                   /locus_tag="Bxe_B2587"
FT   CDS_pept        complement(509754..511670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2587"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33406"
FT                   /db_xref="GOA:Q13R83"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R83"
FT                   /protein_id="ABE33406.1"
FT                   /translation="MIAAAFSRVADRLLAADPGLVRLHTALRVALACLLTGVASIAWTA
FT                   SRHHPITLAAPGILFAMVAPLFVRDARRPAWFGTLVCLYLCACACFAAASVLSRFPLAG
FT                   DAGFLVVMFVGMLCQACGPRALGCAMLGVVCFYLGLYLHPSTTHLVQSLLLSAFGPLMV
FT                   ALVGRVIVPTRAATSLRLAVHTVTLRASRVLHAPVAAHLSALNEAALSLEEQLALLNPS
FT                   DAETIRERIAEVEVAAGQYAFASGHADGGVEANARVLRHAIARLRETAHQGNDARRAAF
FT                   APAGGAVALTASQRFADLRSKLCWLPATRATTAALLAMLIGHSLSPERWFWAVITTFVV
FT                   FLGTRSRADTVYRGAQRLVGTLGGALVSVSLVAPLQDSPVLLVAAMLLCVFGWAYFILN
FT                   AYAPGVFFITVLVGLVYGELGFAMGPLVELRIEEVLVGCVVSFAVAILMMPLAATRHVE
FT                   TRLASVLGALREVVRLTGSGALAADALPAMRKLDRSWHDLRIALRPLQTQRVVVWNPDV
FT                   ELATGSLLCCLHWARVLSDSARRGGLREKTALNAAEVGAAHVESIVARLDSLIARYNGV
FT                   ARAAGGDSDERASVTIDADIDVHKAPALAQLDGAVAQLFDRLMRPVSDARRVFNWTLRG
FT                   RSV"
FT   gene            complement(511986..512798)
FT                   /locus_tag="Bxe_B2586"
FT   CDS_pept        complement(511986..512798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2586"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33407"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R82"
FT                   /protein_id="ABE33407.1"
FT                   /translation="MDTIAKGRQSHSLELEFGAGATPKPDSKGSAAQADGSLAQRVGAI
FT                   DWFDVEQGLNAYGSAMLHNLLSAGECDALTALYRRESLFRSRVVMARHGFGRGEYKYFA
FT                   YPLPPLIAELRSTLYPCLAPVANRWNEVMDIGVRYPATHAEFIERCHAAGQTRPTPLML
FT                   QYAIDDYNCLHQDLYGEHVFPLQVAILLSEPGADFTGGEFVMTEQRPRMQSRTEVVPLG
FT                   KGDAVVFAVHHRPVQGTRGPYRVNLRHGVSRLRSGQRHTLGVIFHDAT"
FT   gene            513099..513941
FT                   /locus_tag="Bxe_B2585"
FT   CDS_pept        513099..513941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2585"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33408"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R81"
FT                   /protein_id="ABE33408.1"
FT                   /translation="MSAAPQKLEDWLGKEAVAQDDITAFPLAAMAATLDREENGGTVPP
FT                   LWHWLYFLPIAPMSEVGPDGHPKRGGFLPPVPLPRRMWAGGRLTFHAPLKVGERATRTS
FT                   IIANIEDKTGRSGRLVFVTVQHTIEAGGELKLEEEHDIVYRDAPHEGARPPQPQLAPEG
FT                   EMWRRTIDADPVLLFRYSALTFNGHRIHYDSPYVTQVEGYPGLVVHGPLIATLLVDLVR
FT                   REQPDATFQSFAFKAVRPTFAGQAFTVCGKPSADGKVIDLWAKDHEGCLTMRATAALA"
FT   gene            513970..515133
FT                   /locus_tag="Bxe_B2584"
FT   CDS_pept        513970..515133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2584"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33409"
FT                   /db_xref="GOA:Q13R80"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R80"
FT                   /protein_id="ABE33409.1"
FT                   /translation="MQTTQQDSFQDIREAVRDLCQQFAGEYFRKIDEARGYPEEFVDAL
FT                   TKAGWLAALIPQDFGGSGLGLTEASVIMEEINRAGGNSGACHGQMYNMGTLLRHGSEEQ
FT                   KQKYLPKIACGDLRLQSMGVTEPSTGTDTTKIKTTAERRGDRYVINGQKVWISRVQHSD
FT                   LMILLARTTPLAEVKKKSEGMSIFIVDLHEAIGHGMTVQPILNMVNHETNELFFDNLEI
FT                   PAENLIGEEGQGFRYILDGLNAERTLIAAECIGDGYWFVDKVTEYAKERIVFGRPIGQN
FT                   QGVQFPIARSFINVEAASLMRFEAARRFDAHQPCGAQANMAKLLAADASWEAANACLQF
FT                   HGGFGFACEYDVERKFRETRLYQVAPISTNLILSYVAEHILGLPRSF"
FT   gene            515153..516331
FT                   /locus_tag="Bxe_B2583"
FT   CDS_pept        515153..516331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2583"
FT                   /product="Putative CAIB/BAIF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33410"
FT                   /db_xref="GOA:Q13R79"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R79"
FT                   /protein_id="ABE33410.1"
FT                   /translation="MRPLDGIKVVTLEHAIAAPFCTRQLADLGARVIKIERPGVGDFAR
FT                   GYDERVHGLSSHFVWTNRSKESLSLDLKQPAAAEILDALVVDADVLVQNLAPGAADRLG
FT                   LGYDALSKKYPKLIVCDISGYGADGPYRDKKAYDLLIQSESGFLSITGSPGQPAKAGCS
FT                   IADIAAGMYAYSNILSALLLRGRTGHGCRIDVSMLESMVEWMGYPLYYAIDGQAPPALS
FT                   GAAHATIYPYGPFPAGDGKTVMLGLQNEREWKLFCERVLEQPELATDERFASNSKRTLA
FT                   REALREVIVAAFAKLSAAQVIERLDDAGIANAQMNTLADVWAHPQLKARERWHEVGTAA
FT                   GVVQALLPPGMPADFEPRMDPVPALGEHTDAILRELGYDSARIDALRAAGAI"
FT   gene            516400..517884
FT                   /locus_tag="Bxe_B2582"
FT   CDS_pept        516400..517884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2582"
FT                   /product="Putative MmgE/Prp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33411"
FT                   /db_xref="GOA:Q13R78"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R78"
FT                   /protein_id="ABE33411.1"
FT                   /translation="MNDHPSLTLATFAAQLDFNSIPPAVVERTVNLYVDWLGSALAGKG
FT                   ARPVETIARFAREASGASKDGACEVLIDRSRATPYFAAMINGAASHFAEQDDVHNGSVF
FT                   HPATVVFPVALALAQARRASGRDLIAAAVAGYEVGIRVGEFLGRSHYKVFHTTGTAGTV
FT                   AAAATAGRLLGLSPTQMLDAFGSAGTQASGLWEFLRDAADSKQLHTAMAAANGLMAAQL
FT                   AADGFKGATHILEGAQGMAAGMSSDADPARLVDRLGSRWATAETSFKYHAACRHTHPAA
FT                   DALLAVVQEHRLAPRDMAKVVAHVHQGALDVLGAVVTPRTVHQAKFNMGTVLGLVAYHG
FT                   YAGVTEFEQGFDADEIAAFRANVEMAFDAEVDAAYPARWIGKVTVTTTDGRTLAGRVDE
FT                   PKGDPGNTLSRDEIATKLHRLAAFSGAATEGEAARLLGNAWRIVGQAQVGSVFESQSNA
FT                   ESNAGSNAGANAGANAGANAGANAGANAGANAAAAA"
FT   gene            517881..518717
FT                   /locus_tag="Bxe_B2581"
FT   CDS_pept        517881..518717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2581"
FT                   /product="Putative citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33412"
FT                   /db_xref="GOA:Q13R77"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R77"
FT                   /protein_id="ABE33412.1"
FT                   /translation="MSAALPRSYLFVPGNRPERFEKAHASGADAVILDLEDAVPPDEKP
FT                   AARAVVLAAVSGDATGPAARPEARPAWVRINGADTSWFNEDIAALAGQAGVAGIVLPKA
FT                   ETREQIEAVLALAHSASSVLPIVETARGFANLAVLCAAPRVQRIVFGTLDFQIDLGIDG
FT                   DGEELHLFRSQIVLASRLAGIGAPVDGVSTTITDTDGIEAEARRGRRFGFGAKLCIHPR
FT                   QIDAVHRAYAWSEADKAWAQRVLAAVETSQGAAVAVDGKMVDMPVILKARRIAAGA"
FT   gene            complement(518827..519279)
FT                   /locus_tag="Bxe_B2580"
FT   CDS_pept        complement(518827..519279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2580"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33413"
FT                   /db_xref="GOA:Q13R76"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R76"
FT                   /protein_id="ABE33413.1"
FT                   /translation="MAILPAPLSRPGREHPRPGATDISGISKMSRVLLVDDQPEALSAL
FT                   RAVLVGRGYTVATAADGAEAFERLQRTRVSAVVCDWRMPNMDGAELIESMQARSELASV
FT                   PVILTSGSGEVPAFPVKGFLRKPFALDKLLSLLAECESDAATPAVC"
FT   gene            519503..520390
FT                   /locus_tag="Bxe_B2579"
FT   CDS_pept        519503..520390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2579"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2579"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33414"
FT                   /db_xref="GOA:Q13R75"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R75"
FT                   /protein_id="ABE33414.1"
FT                   /translation="MHFDFVDLRLLLNIADTQNLARAAERSHLSAPAASNRVKNLEEQL
FT                   GFKLLYRTSQGVTLTPAGEAFVHHARLVLERVEHLAGDMQEYGEGIKGHVRIWANTTAI
FT                   SEFMPAVLSHFLRDHPDVNIDLREVLSGEIVKGVADSATDIGIVAGNVHAEHLEMLPYR
FT                   DDRLVLVTSRDHPLARLASVDFSQVLAANFVSLPTSSAIHAFIMSAADALGARLKLRIQ
FT                   VGNFEAACRMIEAGVGIGIVPESVARRHRKTMQIATVGLNDPWAERKLKICVRSLKDLP
FT                   PFARVLVDRLMASV"
FT   gene            520730..522229
FT                   /locus_tag="Bxe_B2578"
FT   CDS_pept        520730..522229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2578"
FT                   /product="Putative aldehyde dehydrogenase family protein"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33415"
FT                   /db_xref="GOA:Q13R74"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R74"
FT                   /protein_id="ABE33415.1"
FT                   /translation="MDASTILADLGIAHAAQAGDIAVHSPITGELIGRVASNTVAEVDT
FT                   ALAQAKQAYTAWRNVPAPRRGELVRLLGNRLREKKQALGSIITLETGKILQEGMGEVQE
FT                   MIDICDFAVGLSRQLYGLTIASERPGHRMAETWHPVGTCVVISAFNFPAAVWSWNAALA
FT                   LVCGNAVIWKPSEKTPLTALAVNQILSEALQEFGDAPAGLTALINGGRDVGAKLVADPR
FT                   ASIVSATGSTEMGRTVGVEVAKRFGRSLLELGGNNAGIVTQTADHELAMRGILFSAVGT
FT                   AGQRCTSLRRLFVHESVYDKTIERLKQLYSKVPIGNPLEKGTLMGPLIDKQSYGRMQEA
FT                   LQQATAEGGKVFGGERVEVKGYEGGYYVRPAIVEMPSQTSVVLKETFAPILYVLRYTDF
FT                   ADAVEANNAAVHGLSSCVFTTDLREAERFLSDSGSDCGIANVNIGPSGAEIGGAFGGEK
FT                   ETGGGRESGSDAWKAYMRRATNTVNYSSALPLAQGIDFNIG"
FT   gene            522369..523541
FT                   /locus_tag="Bxe_B2577"
FT   CDS_pept        522369..523541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2577"
FT                   /product="Putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33416"
FT                   /db_xref="GOA:Q13R73"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R73"
FT                   /protein_id="ABE33416.1"
FT                   /translation="MSSKVVIVGGGVIGSSIAYFLRLSDPTVSVTVIERDPTYARSSSA
FT                   LSAASIRQQFSTPLSIQMSLFGIEFLRSIGERLEVNGAKPSIDLHEGGYLFLATPAGEA
FT                   TLRENHALQKSLGADISLLDKAALQTRFPWLNTEDLVAGAYGESGEGWFDGYGLVQALR
FT                   KKAQSLGARYVAADVTALQRDGKRVTHVQTANGEIYACDVVVNAAGAWARKVAQMAGID
FT                   IPVHARRRSIFNVTSPGQLEHCPLLIDPSGVYFRPEGKSFICGTSPSADNDPDDLPLDE
FT                   VDHALFDDVIWPTLAHRVPQFEALRVQNCWSGYYEYNVLDQNAIIGYHPDVDNCIFANG
FT                   FSGHGLQQGPATGRGISELILHGRYTTLDLGSLSFTRVLENRPIVEKNVV"
FT   gene            523664..524860
FT                   /locus_tag="Bxe_B2576"
FT   CDS_pept        523664..524860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2576"
FT                   /product="Putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33417"
FT                   /db_xref="GOA:Q13R72"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R72"
FT                   /protein_id="ABE33417.1"
FT                   /translation="MFTFNPAFAAPTGSPIRELFKYLAQPGMISFAGGYPASDLFDRDG
FT                   LDAAAARASQHPTLCLQYGPTDGLVVLKEQLAHLMTRRGTPCTPPELLVTTGSQQGFDL
FT                   LLRVMVAPGDVVLVEQPAYPATLQALKLQEADVVTIPVDQNGLDVDALAALLESGTLRR
FT                   APKLLYTVPTFANPTGATLSLERRVALLKLAVRHRFLIVEDDPYGDLRFSGAALPSLLA
FT                   LSAQVPGSRDWVVHFSSLSKIVAPGLRVGWMLAHAEILRRCVVAKQTVDLCSSPWTQAI
FT                   AAEYLASGALERHLPRIVDAYAVKCRTLCDALEAQLADHIVFHRPAGGMFVWARLKAGQ
FT                   NASDYLRGCIGRNVMFVPGVAFYKDNIDAAALRLSFAAPGVADIETGVQRMKQALEHF"
FT   gene            525342..527150
FT                   /locus_tag="Bxe_B2575"
FT   CDS_pept        525342..527150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2575"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33418"
FT                   /db_xref="InterPro:IPR018671"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R71"
FT                   /protein_id="ABE33418.1"
FT                   /translation="MKMSRKKIAILVVGLLVVAGVIIQAVWRPFAHRKAAGNGEIVLDI
FT                   HHPDAVIDSEALSRLPRDILSVPLLRDVLTQDFVDYYESDNTRLSAEGALRRLAFEHQL
FT                   DWRDELIRRVFDEPAHVLLWRSPDGRLGYWVMSMHRNGFAKLLQGVGNVATSDAQLSQV
FT                   AKLSGDVPVYALKLAVGRTLLFASKDDRLVVLSAPGVLLDEKGGLLGERADVVSGMLSS
FT                   GRDDAARAYQLDAPGESPKGHRLVVSANYLSFGYQAFFSGIDALRFDFSSTGNPAGGRG
FT                   VANWQTSALIVPDKLPQQWNSADLWRALPANPAACTSLPADWKEASGLLGKVAGGGADN
FT                   AAAIGDQLTGPAAVCWYAKSTLVAPVFVARVKKQDAADIAALKTALGKTFGDVIGAYEA
FT                   KAAKADGADSAGYRRLPVTTREQGADVTVWQRPVSARSGTALTSKASFASQLSAERYFP
FT                   VTLALAHGYLIFSPDGRLVDDTLAVLDKRYPALADTLAPQRLPRTILTLTPSSAAALIE
FT                   REAGAALPADQEAVFRNASRTHLVPKLHALAHYPPVSLTLPQNLPGSTGWVPVEWWFDR
FT                   ARAGAGSGSTEGAADTPADQPGTGGD"
FT   gene            527343..528116
FT                   /locus_tag="Bxe_B2574"
FT   CDS_pept        527343..528116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2574"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33419"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009558"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R70"
FT                   /protein_id="ABE33419.1"
FT                   /translation="MQSTHAAQSTHAAQSTHAAQSTTLAVHAATTSRRAWLASAACAFA
FT                   VASLTPYAHALTDTAASPDPDALSPQQSAAFRAWFVRIVDQQMRRGPTPRWTQRDCAGL
FT                   VRFAVGETLRPHDTRWLRANGMTSLADTSSMPPELQLSAAQRGIANRWTQLDGSTGAYA
FT                   SAIALIQRNSRFVSKDVNQALPGDLLFFDQGDDQHLMIWLDRYIAYHTGTVTLTDTGLR
FT                   AVSVSDLMQWKDSRWQPLDGNPNFVGVFRLDFLTP"
FT   gene            528122..532933
FT                   /locus_tag="Bxe_B2573"
FT   CDS_pept        528122..532933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2573"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33420"
FT                   /db_xref="GOA:Q13R69"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R69"
FT                   /protein_id="ABE33420.1"
FT                   /translation="MISVTPSSNWLGNARRRAAGTFAALLTVLLAAMTLAVSPAAYADD
FT                   DAASAAAAADANIAGNPTLQTAPSSNFSSQKVDGQPFFLLSDASFGSDQLAQVRLEAPG
FT                   RDFKDALQAYGGADIVVYRVPRPLDFLKAQKNLHRLNVAPNYQGEGLANTLTYLWDRWF
FT                   TEARRAWQRVLSFATRSKATEAAPQFKLGEQTGKQTQFEPSSQFAPLKGYDMVARFRYP
FT                   IWDAKVIQPPKGVNLAGSSSNFIEASAGNVMIPVGKLPPGLYIVEAVIGNYRAHTLLFV
FT                   SDTVAVVKAASSGMLVWTTRRDNGKPVANTEVSWTDGVGVLQSGATGGDGALVLQHVSP
FT                   ERSYVLGTDPQGGVFVSENFYYDSEIYNTKIYAVTDRPMYRPGDPVHVKFIGRTFQSAT
FT                   QSSAPAEADIRLDVLDPNGAPVASSKVHFASGTGADTAFTLPADATAGGYTLRFDYNGD
FT                   VYGSAFRVAEYVKPHFDVNLSMDKADYATGEALKGKIQLRYPDGKPVRDSKISVTLRAQ
FT                   KVTIVDGELRYAGLFPVKLDQQELKTDSDGNASLTLPAAKEPSRYALTLFAQDGAAYKV
FT                   RVTREVLIARGATPYRLNTAKSFSQPKDVVSFDLQALGAIDPASHAPSKYEWTRLESQT
FT                   HGEGALKSASAGGKLSFPVQFDEPGSYMLSVKDDLGNLLAATSHWVAGDGLKAIPGSVE
FT                   IVFDRDRYKIGDTAEALITFPMPVDDALLTLERDNVERRALLTAGGDWLQLQRVAPSQW
FT                   KARIKVGEDFAPNMTFSVLYVHAGEYVFQNAGIVVAQPQIELKVKSDKPVYGPGDTVTL
FT                   NLDSTLNGKPEAANLTVSVVDEMVYVLQPEIAPNIVDFFYHPRRNNVRTSSSLSFITYD
FT                   LARSPLKGAPGGPQRANYNERGVKVLERPRRDDQDTAAWEANLKTDANGHATMTFKMPD
FT                   SLARWRITVRAAAPDGMVGQRTAYVRSDKALYLKWSGPSHFRVNDQPAIDMIAFNQTDA
FT                   DMDAQWVVDGGGLSLNQKVTLKRGANYLRLPSGALKDGVINASLRSAGKDVDRLQTTIH
FT                   LDASGWLDLHQNTVALDGSNKPLSLPQDAQDVSVRFIGSAASQFMRVADDLIAYPYGCA
FT                   EQTSSRLIPLALAHDAIGRGVSGDGGASSAQGLEALLRNQRQRLAMLAGVGGTFGWWGD
FT                   TTGGSALITAYAYYADWLASRSLGISLPADNWQHAMDVYRDAGAKEPLLHRALALWLMQ
FT                   QMGLPVATPVSGVAADLMSDAAATASVPARNGTYGASDSIVFAQADSPRGKQMATLLIA
FT                   GMARSTSAQLPDGFDAAASAARAALSNDPAPLVQSLLVMSGGDGGAAADPSALLAKSSA
FT                   DYPTLDRALTLLWLRKALGGDVAATSLPSLQGAGWTRAATPTGTPLYRWTGATLPAALD
FT                   VGAARADVNALVSFRSHTSEDSRLNISVERRLYKLEPVEVAADPKKKDASAESQVGRAA
FT                   FTARLVKQGDAIDSNALYVDEVTLTPRSGNAYHYGLLDVPLPPGGDVEATSWGVSIDGL
FT                   PGAKEGASGPQPFQRVASYEMGELAYHQPVPLLDRPVTLRQLVRFALPGTFALPPARYF
FT                   RMYQPDAKAFEGGKSDHLTTLRIQ"
FT   gene            533100..534728
FT                   /locus_tag="Bxe_B2572"
FT   CDS_pept        533100..534728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2572"
FT                   /product="Signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33421"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR018748"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R68"
FT                   /protein_id="ABE33421.1"
FT                   /translation="MLRFAWLRDGRSQLWQVDGSGAAVGFSPQAAGALPRTLQTPLGSV
FT                   WKLFVYGYLVDRNVTTPDYACNGGDPEEVYCCMTGGHIDREHALVQSCGLFFEPARLQL
FT                   DSADWRKYWTAAHAPAWLRDLHTMTPAHRVPVTELLAALQAMPARPREAAASTLVSVLT
FT                   SGRGEGTVSLYGSVLRAKTWTMPDPARPGASIGGAAGWLADGTPVWLGGSGGSARVLTA
FT                   AAPRLAPLLAQISVPDDAACVLIDFFSRYPIREVVGDKGPAAAPKGPLRGNFRVGFVNG
FT                   NWARVTSRGELRLDRDAAGAPHVVGRFGMNDYVARVVEREGDTSEPEAAKALAVAARTY
FT                   VVQHGNHDHGCFRIDDSSSTQRVLPRAPTAAARHAADLTDALVLTGAPVQYHHDEAAPG
FT                   QMSWLAAKASAQTGLTFDAILARTWPQATLTSFQSPLSGDCIAVAGAQAWLQRNAPLWA
FT                   RRMDGAAGYETPDLPAVCAVREGRPYADAQRNRVYVYRLQTEEDRIALAHEYVHLAFQH
FT                   HPRGLDETFVERTARTLIRTDNPIQ"
FT   gene            534899..535711
FT                   /locus_tag="Bxe_B2571"
FT   CDS_pept        534899..535711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2571"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33422"
FT                   /db_xref="InterPro:IPR012039"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R67"
FT                   /protein_id="ABE33422.1"
FT                   /translation="MKMKVKTTGWTKASHRFLAVACLAGLQAAPAAYASDIDFAAPLNG
FT                   WRNTSGDSERYTQDVHYPAVSVSTPEGQSRFALIEGQIRNAPKKKGTTVGTLVVDGTPL
FT                   PQRVEEDGKFSRPYAFPAGSNGVELRAPDGSRKRVQFYDAYSGKTQPKLRVLLAWDTDG
FT                   TDLDLHVVSPDGAHTWYGERVAPNGGALDVDVTTGYGPEIYSSAAPLKGTYLVYVNYYG
FT                   SGNSGADMTVAQVTIITNENTPNEKSETIRVPMRKAGELTLVKTFVLP"
FT   gene            complement(536002..536478)
FT                   /locus_tag="Bxe_B2570"
FT   CDS_pept        complement(536002..536478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2570"
FT                   /product="Conserved hypothetical protein"
FT                   /note="PRC-barrel domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33423"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R66"
FT                   /protein_id="ABE33423.1"
FT                   /translation="MTTFNPQVPASAGAQGANIVGVGMGDGPGPDVMAASTLDGNKVMS
FT                   SDGEHVGKISDIMLDVRGGRIAYAVLSTGGFLGMGDTLHAIPWSALTLDTDDRCFVLDA
FT                   SADRIKNAPGFDKDNWPLMADTQWGTAVHEYYNRPPYWSATRGAVEERDVDSDL"
FT   gene            complement(536715..538712)
FT                   /locus_tag="Bxe_B2569"
FT   CDS_pept        complement(536715..538712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2569"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33424"
FT                   /db_xref="GOA:Q13R65"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R65"
FT                   /protein_id="ABE33424.1"
FT                   /translation="MNPFDREDSQHETAGYAAKAPSGRTAKGKGAGKAIPVAAELPPQQ
FT                   AEERQRQMRALIQLGKEQGYLTHAQINDHLPDNFAQTAAIDSIVSAFNDMGVQVYEQAP
FT                   DAETLLLNSNAPAVVSDDQADEETEVALSTVDSEFGRTTDPVRMYMREMGATELLTRAG
FT                   EIAIAKRIEDGLHEMVQAIAACPLAISAILASAQQVADGELRIDELVDGLNEDTIAAEE
FT                   DSASAEASAEVDADTDGDEDEDSDDDVGPADSSAADEARLKQLTSDCLEIFAQVGMLSD
FT                   QMNASHTRGDVTSKAYQRAREEIQQHLAKIRFTARTIDRLCGDVQQQVAQVRAIERNIL
FT                   QIVVSKSGMPREKFIESFAGHEADLGWTERAARGASAYGAALERHLPAIQSEQQKLIEI
FT                   EATVSLPLKHLKEINRQMVAAESKMRKAKSEMIEANLRLVISIAKKYVNRGMLFLDLIQ
FT                   EGNIGLMKAVDKFEYRRGWKFSTYATWWVRQAVTRSLADQARTIRVPVHMIETINKLNR
FT                   ISREILQQTGQEAHPSVLAERMELSEEKVRGILKIAKQPVSMETPVGDDGDATLGDMIE
FT                   DSAASSPADAAMQADLRAAIDDALDSLSPREAKVLRMRYGINTKSDHTLEEVGKQFDVT
FT                   RERIRQIESKAMRKLMHPSRADRLKSFLDR"
FT   gene            539551..541040
FT                   /gene="rrsD"
FT                   /locus_tag="Bxe_BR0001"
FT   rRNA            539551..541040
FT                   /gene="rrsD"
FT                   /locus_tag="Bxe_BR0001"
FT                   /product="16S ribosomal RNA"
FT   gene            541113..541189
FT                   /locus_tag="Bxe_BR0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            541113..541189
FT                   /locus_tag="Bxe_BR0002"
FT                   /product="tRNA-Ile"
FT   gene            541271..541346
FT                   /locus_tag="Bxe_BR0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            541271..541346
FT                   /locus_tag="Bxe_BR0003"
FT                   /product="tRNA-Ala"
FT   gene            541641..544522
FT                   /gene="rrlD"
FT                   /locus_tag="Bxe_BR0004"
FT   rRNA            541641..544522
FT                   /gene="rrlD"
FT                   /locus_tag="Bxe_BR0004"
FT                   /product="23S ribosomal RNA"
FT   gene            544698..544811
FT                   /gene="rrfD"
FT                   /locus_tag="Bxe_BR0005"
FT   rRNA            544698..544811
FT                   /gene="rrfD"
FT                   /locus_tag="Bxe_BR0005"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(545155..545556)
FT                   /locus_tag="Bxe_B2568"
FT   CDS_pept        complement(545155..545556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2568"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33425"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R64"
FT                   /protein_id="ABE33425.1"
FT                   /translation="MLLPIARQTADDLALRVHLALDALRRGAGSMTDAQTLTQVMLLTG
FT                   FLAESGFGSATGEQLSAAERAVSAVFDIGRETGKWRLDEAGFSLFAMIATNYDRQLHSA
FT                   PLWAITDASERLDRFTAGMSYQTPVRKRA"
FT   gene            complement(546058..546903)
FT                   /locus_tag="Bxe_B2567"
FT   CDS_pept        complement(546058..546903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2567"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2567"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33426"
FT                   /db_xref="GOA:Q13R63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R63"
FT                   /protein_id="ABE33426.1"
FT                   /translation="MATDRAKAGVAIEIKQQKRGDLVAEEIKRLITEKDLKPGDRLPRE
FT                   VELQQLFSVSKSTIREALKSLEVQGLIKVTTGPSGGGMVVEVPLDRTLQLLQNYLFFKD
FT                   VSIDDIYTVRKLLEPELAAGAVPYLTEQDFEALDASIACCDRPASSHGGQDIVRQRQED
FT                   VNFHDILAAANPNPFLRFSCELINEMIRQLIEFRNDTPQAEHERFGQANVKIHKAITKA
FT                   ARERDAEKVRELMVIHMTEAPRYVKRMKGKLRGRLILDSEIRRRVRARSVMPADKGDDE
FT                   "
FT   gene            547193..548386
FT                   /locus_tag="Bxe_B2566"
FT   CDS_pept        547193..548386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2566"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33427"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R62"
FT                   /protein_id="ABE33427.1"
FT                   /translation="MLKLAALSAVPGTLGSLVARSAFAQAGTLQFACPVPMSGPFAANG
FT                   KYADLGMKLAIEQYGKVLGQPLAYTVLDTEGKPATAVRRVQEIAQQKNARFFAGGILSS
FT                   EALAMGKEVQKAGGIFITTAGADEITGKDCNDATFRWSVPTYGAIEQTVRPLIQTLPKA
FT                   KRWYTITPQYVFGDGLLSAAKAIFKEKGIEHVGNSYHSLNEKEFSGYLTNAVAAKPDVL
FT                   LILNFGSQSSDTLRQAVSFGMKNNCTILMAWASGLEQFESLGADLCEGVYFGAQYWHDI
FT                   DSPLNRDLVKRTNAAFKANPNYSLAGSYICTKILLDGIVKAGNVDPKKVIAALEGMKYD
FT                   GLTGPEEVRKGDHQVLKNYYLLKGKAKNKMKNADDYADIVSSGQSFLPLDKTGCKMV"
FT   gene            548485..549345
FT                   /locus_tag="Bxe_B2565"
FT   CDS_pept        548485..549345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2565"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33428"
FT                   /db_xref="GOA:Q13R61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R61"
FT                   /protein_id="ABE33428.1"
FT                   /translation="MNVYLLQIVNGIGVGMLYFLLAVGLSIVFGLLRFVNFAHGAFYLL
FT                   GAYFCYQAMQWSMSFWTALVVVPIVVGALAWVVEKLILRHVYAQQHEFHILVTVGLALV
FT                   VQECAILIWGPLGDNVAVPDMLNGVVIWGSFVYPKYRLFVIGFTAVLAALLWWVLEGTR
FT                   LGSAVRAGSESTEMVSLLGINVLRVFSLVFALGAATAALAGVLAAPIRGVDPFMGIEAL
FT                   SVAFVVVVVGGMGNFLGALVGGLLVGIVQSVMSTLWPEGARLMIYVAMAAVLLLRPNGL
FT                   LGRAA"
FT   gene            549342..550409
FT                   /locus_tag="Bxe_B2564"
FT   CDS_pept        549342..550409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2564"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33429"
FT                   /db_xref="GOA:Q13R60"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R60"
FT                   /protein_id="ABE33429.1"
FT                   /translation="MIDTSKPIAQSASSVRAQPGLKHSLHRYRFLLLALLVVCVLPLTL
FT                   RSGSLATEVLVFALAALGCNLLLGYTGLLSFGQGIFFGLGSYCAGLVLTRTALPVPAAL
FT                   FAAAIIGAAAAALVGWFSIRQRGTYFVMLTLAFGQLFYFLAYTTPDLTGGDNGLLDIPR
FT                   PALGLFGKTIVPLTSPWQYYGFVAVLFLVVFWLLMRVSHSVFGRTLLAIRDNEARAAAV
FT                   GYDVKRFKLMAFVISGAVTGLAGALHALMTGIAPLSNIDYHTSEMILVMTVIGGTGNLF
FT                   ASVLGAAFYVLFADWLSTLWPRWLLLLGIVLIAVSLFMQRGLWGLGERIWQSLRRRSST
FT                   DAGNGADNDADKEPI"
FT   gene            550406..551173
FT                   /locus_tag="Bxe_B2563"
FT   CDS_pept        550406..551173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2563"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33430"
FT                   /db_xref="GOA:Q13R59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R59"
FT                   /protein_id="ABE33430.1"
FT                   /translation="MSEAILRASGVVKRYGKFTALADVTLNIMPRTVHSVIGPNGAGKT
FT                   TLFHVLTGTLPITEGKIVFDGHDVTHEPDHKRVRRGVARSFQVTSLFANLSVRENLRLA
FT                   AQGVDAVRALNAWAPPHGALTHSDTVDSVLERLALQRFSEVSAGALSHGQQRRLEVGMA
FT                   LAARPKAIFLDEPTSGMGIDDLDDMKQLIRGLRDDYTVVLIEHNMGIVMDISDTITVMQ
FT                   QGRVLVEGRPDDIRGDERVRSAYLGNMITGGRA"
FT   gene            551170..551871
FT                   /locus_tag="Bxe_B2562"
FT   CDS_pept        551170..551871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2562"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33431"
FT                   /db_xref="GOA:Q13R58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R58"
FT                   /protein_id="ABE33431.1"
FT                   /translation="MILDVQQIHGFYGKSHILQGVSLQINEGETVTLLGRNGAGKSTTL
FT                   KAIAGVVAPQRGTVTFNGAEIGGLPPHKIASRGVCFVPEHRGIFRLLTVEENLRLGARK
FT                   DSPWQLGDIYRIFPRLQERRTNGGAQLSGGEQQMLAIGRALMNHPRLLMLDEPVEGLAP
FT                   VIVEEIVAQLKLIREAGVAILLVEQNLEVCTQLADRHYIIEQGVIVYSGDNASFSADDS
FT                   IKDRYLGVGVV"
FT   gene            551904..553184
FT                   /locus_tag="Bxe_B2561"
FT   CDS_pept        551904..553184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2561"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33432"
FT                   /db_xref="GOA:Q13R57"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R57"
FT                   /protein_id="ABE33432.1"
FT                   /translation="MQVHESTTVATFADLRVDGARLWDSLMQLARIGATDKGGVCRLAL
FT                   TELDREARDLFIAWAKEIGCTVRIDAIGNIFARRAGLRDDLAPVMTGSHIDTQPTGGKF
FT                   DGNYGVLAGLEVLRTLADANVRTLAPLEVAVWTNEEGSRFVPVMMGSGVFAGAFTLEHA
FT                   LEQRDREGVSVRDALSRIGYAGENEKPHAVGAYFEAHIEQGPVLEAHDKTIGVVQGALG
FT                   QRWYDVTVHGMEAHAGPTPMELRRDALLVAADLIHAVNRIALDHAPHGRGTVGWLDVHP
FT                   NSRNVIPGRVTLTVDLRAADDATLTAMDSALRAACSLAGEKAGITVDVEQVVYFPPQPF
FT                   AAELVGAVKQGADTLGFASMDVISGAGHDAVYLARVAPAAMIFVPCKDGISHNEIEDAR
FT                   ADHLEAGCNVLLQAMLNAAQKAGSADA"
FT   gene            553181..554671
FT                   /locus_tag="Bxe_B2560"
FT   CDS_pept        553181..554671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2560"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33433"
FT                   /db_xref="GOA:Q13R56"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R56"
FT                   /protein_id="ABE33433.1"
FT                   /translation="MKILIARMNHETNTFSPVATPLAAFGRNGPSYGEDAFTENKGMQT
FT                   AMAAFIDAAEKEHAEIVTPVSASANPSGPVEAAAYAAICESIVSAAAGCDAVMLDLHGA
FT                   MVAENSNDGEGDLLERVRALLPDAPIAVALDLHGNVTQKMIDNADVIVSFKTYPHVDMY
FT                   ETGAHAARLLFDLIHGKAKPVIAWRQPPLLTHTLRSATAEGAMKRAVDAARAAEADGML
FT                   AVSVLSGFSLADIAAPCISVVVVGNGERAEAEAVAERIARQIWDEREDFVYRSAPLADS
FT                   VAQAATLAVNADKPVLLLDHGDNCMSGGTCDTMDLLEEALKQKLDGIVSGPLCDPQAVA
FT                   ALMAAGVGSTVTVTIGNKIASDALKPRSPLAVTGVVRALTDGEYVISGPTYTGQRAFMG
FT                   RAAVLDTGAVKLVITERTHEPWDLGVFESVGIDPRRARFLLLKSRMYCRPVFVPIAAAL
FT                   VECDSRGVTSSDYGLFAFAHVKRPVYPLDTQTEWAVTN"
FT   gene            554750..554826
FT                   /locus_tag="Bxe_BR0006"
FT                   /note="tRNA-Val1"
FT   tRNA            554750..554826
FT                   /locus_tag="Bxe_BR0006"
FT                   /product="tRNA-Val"
FT   gene            555131..556834
FT                   /locus_tag="Bxe_B2559"
FT   CDS_pept        555131..556834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2559"
FT                   /product="homodimeric dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33434"
FT                   /db_xref="GOA:Q13R55"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R55"
FT                   /protein_id="ABE33434.1"
FT                   /translation="MKKLINEVSAVVPDMLDGLAALNPHLSLLQGSTIIVRADAEAAAA
FT                   RGEVALISGGGSGHEPAHGGYVGPGMLSAAVAGEVFTSPSTDAVLDAIRAVAGAAGALL
FT                   IVKNYTGDRFNFGLAAEIARAEGIPTEMVIVADDVALTASGDHAGRRGLAGTVLVHKIA
FT                   GAAAASGRPLAEVAQIARDVAASLGTMGVALTACTVPAAGKPGFELADGEVEWGLGIHG
FT                   EPGVERGALEPAAAVVDKLLEKIVGDLSLQAGERVALLVNNLGGTPSSELNIVAGAALR
FT                   YLAERGIRTERAWAGTFLSALEMAGISLSLLRVDDQRLGWLDAAAQTSAWPALGGRIAR
FT                   TSARPAPAEPDRASGATLSREATLRRVIEAVCACLLKAEPTLTDMDQRVGDGDLGISLS
FT                   RGARAIIQELDGYPAETTPGAVLRNMSATLRRVVGGTSGPLYAVMLLRAALALEQSGGA
FT                   TPKQWAAAFSAGVDGLMALGGAQPGDRTMVDALKPAADALQAALARSDALDAALKAAVD
FT                   AATEGAAQTASMHPRRGRSSYVGERALGHADPGAHAVALWLAAIREALAE"
FT   gene            complement(556912..557046)
FT                   /locus_tag="Bxe_B2558"
FT   CDS_pept        complement(556912..557046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2558"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2558"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33435"
FT                   /db_xref="GOA:Q13R54"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R54"
FT                   /protein_id="ABE33435.1"
FT                   /translation="MKRIAAFSLTSWSAAGLLYFGQHSVALIVVSGVVALAGFDLLRP"
FT   gene            complement(557050..558105)
FT                   /locus_tag="Bxe_B2557"
FT   CDS_pept        complement(557050..558105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2557"
FT                   /product="conserved hypothetical membrane protein,
FT                   YraQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33436"
FT                   /db_xref="GOA:Q13R53"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R53"
FT                   /protein_id="ABE33436.1"
FT                   /translation="MQSTLRQPRVALGWIVFLLIAVVGLFYVKWFPYYNRAFVAASQHS
FT                   IGKSILMGTSASAPAASWQAAIDYALAYGKAIWQAMVLGLLLGSAVQALIPPQWVARAL
FT                   GRSDFSSVVKGGLMSLPGMMCTCCAAPVVAGLRARQAAPGAAIAFWLGNTALNPATLIF
FT                   MGFVLGWQWMGLRLALGIVMVFGLGYLVNRMVTPKEAEASREAMAQLITSDVPGTAFTR
FT                   WVKILGTMTLRLIPEYIVLVLILGAARTWLFPHVGPDIDNSLLWIVALSIAGTLFVIPT
FT                   AGEVPIIQAMLSFGMAAGPAGALLMTLPLISVPSMAMLARSFPRRVLTVVALAVVVCGV
FT                   VSGLLAVALGF"
FT   gene            complement(558130..559197)
FT                   /locus_tag="Bxe_B2556"
FT   CDS_pept        complement(558130..559197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2556"
FT                   /product="Putative ATP /GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33437"
FT                   /db_xref="GOA:Q13R52"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R52"
FT                   /protein_id="ABE33437.1"
FT                   /translation="MKNLLVSLEKAGDFDEIIDVRTPLEFAEDHIPGALNAPVLSNEER
FT                   VLVGTTYKQVSPFEATRIGAALVARNIAHHLETTFADRPRNWRPLIYCWRGGKRSGSVT
FT                   TLFNMIGWQARQLEGGYKTYRRATLDTLDSLPATFSYIALVGPTGSGKTRLLTALNAAG
FT                   AQTLDLEALASHRGSLLGAWAGVPQPSQKRFDTLLVTALRTLDAARPVFVEAESRRIGS
FT                   VALPLALLDTFHRGRCVEVLSSREDRAAFLLHDYAHLFDDPQSLKAQLQRLIGLHSRER
FT                   VTGWQRLVDDNRRAELARELIERHYDPAYARSSHEHFVQLPHALQFNFRPNDADAVDQA
FT                   SALLAQVEGSALAVI"
FT   gene            complement(559328..560392)
FT                   /locus_tag="Bxe_B2555"
FT   CDS_pept        complement(559328..560392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2555"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33438"
FT                   /db_xref="GOA:Q13R51"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13R51"
FT                   /protein_id="ABE33438.1"
FT                   /translation="MTDTSVPTSTSPRLTSLSHGGGCGCKIAPGLLADLLKRSAPLPFF
FT                   PDLLVGNDTADDAAVYKLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGK
FT                   PLMALAIVGMPINVLPHDVIAAVLKGGESVCAEAGIPLAGGHSIDSVEPIYGLVAIGVV
FT                   DPKRVKRNAGAQAGDVLILGKPLGVGILSAALKKDRLDAAGYAAMIAATTKLNRPGAEL
FT                   SRLDGVHALTDITGFGLLGHTLELARGSNLTARVRYADLPWLPDVVGLAEAGIFTGASG
FT                   RNWDAYGKSIGLPASLPATARTLLTDPQTSGGLLVSCAPQAVDEVLALFRADGFGEACV
FT                   IGEMVSGEGRVEVV"
FT   gene            561087..561731
FT                   /locus_tag="Bxe_B2554"
FT   CDS_pept        561087..561731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2554"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33439"
FT                   /db_xref="GOA:Q13R50"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R50"
FT                   /protein_id="ABE33439.1"
FT                   /translation="MPPSIIMISTPKKSRGHSMPHMSRRQFLKVSATTLAGSSLALMGF
FT                   SPTPALAEVRQYKLSRTTETRNTCPYCSVGCGILMYGLGDNAKNAKSSIIHIEGDPDHP
FT                   VNRGTLCPKGASLIDFIHSPSRLKYPEYRAAGSNEWKRISWEDALDRIAKLMKEDRDAN
FT                   FVETTEDGKKVNRWLTTGMLAASAGSNEVGYLTHKAVRSLGMLAFDNQARV"
FT   gene            561744..564209
FT                   /locus_tag="Bxe_B2553"
FT   CDS_pept        561744..564209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2553"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33440"
FT                   /db_xref="GOA:Q13R49"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R49"
FT                   /protein_id="ABE33440.1"
FT                   /translation="MAGLAPTFGRGAMTNHWVDIKNADVILVMGGNAAEAHPCGFKWVT
FT                   EAKAHRKARLIVVDPRFTRTASVADYYAQIRTGSDIVFLGGVINYLLTNDKIQHEYVKN
FT                   YTDMPFIVREDFSFTDGLYSGYNADKRKYDQSSWDYERGDDGFAKVDPTLQHPRCVYQL
FT                   MKQHYSRYTPEQVEKACGTPKEKFLKVCEMLASTAVPGRAGTVLYALGWTHHSIGAQII
FT                   RTGAMVQLLLGNIGIAGGGMNALRGHSNIQGLTDLGLMSNLLPGYMTLPLEAEQDFDAF
FT                   IKKRASQPLRPNQLSYWRNYRAFHVSFMKSWWGDNATAENNFGFDYLPKLDKSYDMLQV
FT                   FELMNQGKMTGYIAQGFNPLAAAPNKAKIGAGLAKLKWLVVMDPLATETSEFWKNFGEF
FT                   NDVDPASIQTEVFRLPTTCFAEERGSLVSSSRVLQWHWQGADGPGESRSDLEIMSGLWL
FT                   RIREAYRKNGGKYPDPILNMSWPYANPESPTPEEIAMEFNGKALADVTDATDKTKVLAK
FT                   KGEQLASFAQLRDDGSTASGCWIFCGSWTQAGNQMGRRDNSDPTGIGNTLNWAWAWPAN
FT                   RRILYNRASCDVSGKPFDPTRKLIAWNGKAWAGADIPDFKVDEPPENGMNPFIMNPEGV
FT                   ARFFSRDGLVEGPFPEHYEPFETPIGYNPLHPDNKLVVSSPAARVFPDDRAAFGTHENF
FT                   PHTATTYRLTEHFHYWTKHARLNAIVQPQQFVEIGEDLAKEVGVVAGDRVKVSSNRGHI
FT                   IAVALVTKRIKPLMIEGKKVQTVGLPLHWGFKGLTKPGYLVNTLTPSVGDGNSQTPEFK
FT                   SFLVKVEKA"
FT   gene            564219..565151
FT                   /locus_tag="Bxe_B2552"
FT   CDS_pept        564219..565151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2552"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   iron-sulfur subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33441"
FT                   /db_xref="GOA:Q13R48"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R48"
FT                   /protein_id="ABE33441.1"
FT                   /translation="MALQSLDIKRLSATTLPEPQVREPVTGTVAKLIDVSKCIGCKACQ
FT                   TACMEWNDLRDEIGTTTGIYDNPRDLSEHSWTVMRFSEYENTEGDLEWLIRKDGCMHCE
FT                   DPGCLKACPSPGAIVQYTNGIVDFHEENCIGCGYCVTGCPFNVPRISKKDNRAYKCTLC
FT                   SDRVAVGQEPACVKTCPTGAIMFGTKEDMKQQAADRVEDLKERGFQNAGLYDPAGVGGT
FT                   HVMYVLHHADKANLYHGLPQNPKISAMVGLWKGLAKPLALAGIAFAAVAGFFHYTRVGP
FT                   NEVSEAEEAEAQHEADEARRSREASNEAP"
FT   gene            565138..565794
FT                   /locus_tag="Bxe_B2551"
FT   CDS_pept        565138..565794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2551"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   cytochrome b subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33442"
FT                   /db_xref="GOA:Q13R47"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R47"
FT                   /protein_id="ABE33442.1"
FT                   /translation="MKHPEHTGLKDVKGNSLIVRYTPNERTNHWITAITFVLLALSGLA
FT                   MFHPAMSWLYAIFGGGQWTRILHPFVGCVMFLSFLILALRFWHHNYLNKADIQWMKQID
FT                   DVLNNREEKLPAIGKYNAGQKLLFFTMVICLLLLLASGIVIWRRYFSFYFPIGIIRLAA
FT                   LVHAAAAFVLIVGIVVHIYAALWIKGSIGAMTRGTVTYGWARKHHPNWFKEIIGK"
FT   gene            565904..566899
FT                   /locus_tag="Bxe_B2550"
FT   CDS_pept        565904..566899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2550"
FT                   /product="Formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33443"
FT                   /db_xref="GOA:Q13R46"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R46"
FT                   /protein_id="ABE33443.1"
FT                   /translation="MVQRILEAGDIESLDHSAIPRIRTPERLAVFSARAARLRQLAALN
FT                   NPIAGYLRLMAVLADAQQAVMAGFKARPPSPELIASAQQHSMPLIPALSGVRDPAWRDV
FT                   LRQLLDKVAAAGPLTPPLEALIDHLRTLDTAALEFQSDAIFAQRFEEVDPASAPFIVAA
FT                   LQVVWTDLAADIDKREVPYIETLGLCPVCGSHPVASIVRVGGAYDNYRYLQCGLCSTEW
FT                   HMVRAKCSNCDSTKGIAYHTVGSPDADEATRETESKNAALKAESCDECHTYRKIGIQSK
FT                   DYDFEPFADDLASLTLDLLMGAEGYRRASPHPWLWPEQAAGADELSGESD"
FT   gene            566943..568373
FT                   /locus_tag="Bxe_B2549"
FT   CDS_pept        566943..568373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2549"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33444"
FT                   /db_xref="GOA:Q13R45"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R45"
FT                   /protein_id="ABE33444.1"
FT                   /translation="MSDVSGSELRALMARVPSVEKVMASAEFTPLIGEYGRTQVLGAVR
FT                   EALDNWRTSAQSGAASVSALDAAQLKDSVEATLRQRNQSRLRSVFNLTGTVLHTNLGRA
FT                   LLPDEAVQSVMKALTQPANLEFDLDTGKRGDRDDLIDELICELTGAEAATVVNNNAAAV
FT                   LLALSALASKKEVIVSRGELVEIGGAFRIPDIMSRAGARLREVGTTNRTHLKDYEEAIG
FT                   PQTALLMKVHASNYAINGFTKEVGLDEIAPLAHARGLAVAVDLGSGTLVDLGQWGLPRE
FT                   PTVRETVKAGADLVTFSGDKLLGGPQAGLIVGRRDLIAKIKKHPLKRALRVGKLTLAAL
FT                   EPVLQLYRAPEKLTERLTTLRLLTRPADDIRLAAERVQPALQRALGERYAVAAEPMFSQ
FT                   IGSGALPVDVLPSYGLVVRTADGKRGGRQLLALEKLLREMARPVIGRIADDALRLDLRC
FT                   LEAADEAQLIGQLEGVRA"
FT   gene            568370..570283
FT                   /locus_tag="Bxe_B2548"
FT   CDS_pept        568370..570283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2548"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33445"
FT                   /db_xref="GOA:Q13R44"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R44"
FT                   /protein_id="ABE33445.1"
FT                   /translation="MIVGTAGHIDHGKTSLVKALSGVDTDRLKEEKARGISIELGYAYV
FT                   PLENGDVLGLIDVPGHEKLVHTMTAGASGIDFALLVIAADDGVMPQTREHLAIVELLGI
FT                   RRGAVALTKVDRVDAQRLQEVHDEVSAFLSGSVLQDAPVFETCATRSGDPGVAALKAHL
FT                   FAAATAWRMKRDDGLFRLAVDRVFTLAGQGTIVTGTVVSGRVTVGDTMLLAPKNLPVRV
FT                   RSIHAQNRAAQTGRAGERCALNLAGIEKSAIDRGDWVVDPRLSQASERVDVMLTLLADA
FT                   SLTLEHWAPLHVHLGTQHQVAHVALLDGEALHAGQRARVQLVFERPVCALPGDRFVVRN
FT                   AQATRTIGGGHVLDPFAPSRKRRSAERLAWLDALQVMLDTGTLDALFARAPHGLSRSLL
FT                   ERLTGMPAAALALPPGTRIVELPHEDALLVADALWQALNARLTTTLAEYHERSPDELGP
FT                   DVSRLRRIAAPLVDDALWRALVDDAALRGEIVKRGPWLHLPGHAVTLDDADRSLAATLL
FT                   PAVKAGRFDPPWVRDLATAHGVSEERVRQLMRKLARQGELFQVVRDLFYHQQVIRELAS
FT                   IAAAEAQKNAGTVAAAPFRDVTGLGRKRAIQLLEFFDRVGYTRFHRGLHLLRTDSRWLD
FT                   LL"
FT   gene            570311..570406
FT                   /locus_tag="Bxe_BR0086"
FT   tRNA            570311..570406
FT                   /locus_tag="Bxe_BR0086"
FT                   /product="tRNA-Sec"
FT   gene            570718..571491
FT                   /pseudo
FT                   /locus_tag="Bxe_B2547"
FT   gene            complement(571565..572461)
FT                   /locus_tag="Bxe_B2546"
FT   CDS_pept        complement(571565..572461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2546"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33446"
FT                   /db_xref="GOA:Q13R43"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R43"
FT                   /protein_id="ABE33446.1"
FT                   /translation="MLKVRHLEIFRAVVKAGSVSAAARLLYVSQPAVTKTLRMLEEEIG
FT                   LTLFLRVKGRLVCTPEAESILPEIERLFGSVQSIAETAREIRQGQRGSIRVSTVSMLAT
FT                   TIVARAVGEFRKTHPYVEFDVRALPTRHVVEYVNNNQADFGILDVAAPSGTLEVEEFCS
FT                   ADLRCVMRAAHPLASRKTITPRLLDNEALATFGEDTLTGWRLREAFRAQGRPFTSVFVS
FT                   NSTPVLCALVREADAVALVDPFALMSRSFPDLVSRRFSPSVPVQPRFLFAPGRPRSVIV
FT                   DQFVSQLRKTAGEMAMG"
FT   gene            572560..574095
FT                   /locus_tag="Bxe_B2545"
FT   CDS_pept        572560..574095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2545"
FT                   /product="gamma-glutamyl-gamma-aminobutyraldehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2545"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33447"
FT                   /db_xref="GOA:Q13R42"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R42"
FT                   /protein_id="ABE33447.1"
FT                   /translation="MRNTQFTQISRSFVVNIPDASVWRARAQEIRPEGRAFIDGNYVGA
FT                   LSGRTFATVNPATGQVIAQVAECGEEDVNLAVASARKAFESGVWSRRAPAERKAVMLRF
FT                   AQLMMEHREELALLESLDVGKPVANAYNGDIVSSATCIQWYGEAIDKLYGETAPAAPDM
FT                   TTMIVREPLGVVAAVVPWNYPLSMASWKLGPALAAGNSVVLKPAEQSPLSAIRIAALAM
FT                   EAGLPAGVLNVLPGYGETAGRALGLHMDVDAVGFTGSTAVGKLFMQYSGQSNIKRVGLE
FT                   CGGKSPHIVLDDCADLDAAARAVAAGIFGNSGQVCNAGSRLIVQAAVRDELLEKVAAIA
FT                   RELVPGDPLDPATKMGAIVSDVQHASIMSYIDAGRADGARVVAGGRAARPESGGYFIEP
FT                   TVFDGVNNDMRIAREEIFGPVLSAITVDSPEEAVRVANDTIYGLAAAVWTSNVTRAQQV
FT                   SRQLKAGVVWVNCFDRGTMSSPFGGFKQSGFGRDKSMHAFDKYMDWKAIWIAG"
FT   gene            574127..575239
FT                   /locus_tag="Bxe_B2544"
FT   CDS_pept        574127..575239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2544"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33448"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R41"
FT                   /protein_id="ABE33448.1"
FT                   /translation="MKAPLSHRCNKAVNDADADAATQADSSSRSRRAFLQRAGALAGAA
FT                   ILGAPAIVRAQSKSISVTCWGGAYEAAVRAAFAEPFTKETGIAVNLVNSADLARMKVQV
FT                   ESKNVSWDVFDSIGPQIVAGSRGGMWEKLDPAIVRTDGLITRTGADFVGTYSYAGGIGF
FT                   DPKRAGKHPLTYAEFWDVTAFPGRRGLRPRVSENLEMALLADGVAPDKLYPLDIERAFK
FT                   AMDRIKPAVRKWIETTPETVSLIASNELDFTYTYLSRVLPAQRAGTSIAMSMKQTLNSL
FT                   EYLAVPKYGKNTQAAMKYVAFCLRPDRQAAFCEKVEFAPNVAQALPLVSATAKARMPDM
FT                   HDPNSVIINDTWWGDHYDALQNRFTTWMLT"
FT   gene            575254..576087
FT                   /locus_tag="Bxe_B2543"
FT   CDS_pept        575254..576087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2543"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33449"
FT                   /db_xref="GOA:Q13R40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R40"
FT                   /protein_id="ABE33449.1"
FT                   /translation="MNYTLNLKAVVAMLLPLYGLLAVFFLWPLGVVGWSSVYEHAFTLR
FT                   GYEQALSSTLIHRVLGNTVIISVLATATSLVLGYIVALHLARMPAGKRAPYLVMVMLPF
FT                   WTSILVKSYAFTVVLGSAGIVAKLAGWLSGDAWHPDLMFSRTSVVIGMTNYLLPFMVLP
FT                   ILASLTTQNRNLKSAAELMGAGPAMIFTRITLPLSMPGVVAGVLMCLTLSMGMYITPAL
FT                   LGGPRDMMLANLIDFYTRQTLDWTLAAAIAMMLLVLSGALIGMLGRVQHGKEALV"
FT   gene            576084..576935
FT                   /locus_tag="Bxe_B2542"
FT   CDS_pept        576084..576935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2542"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33450"
FT                   /db_xref="GOA:Q13R39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R39"
FT                   /protein_id="ABE33450.1"
FT                   /translation="MMNTAAHVGKDLVQPEPKRRDRRAALRVLGSVGGWCGYLFLLLPS
FT                   LVIVPISFGGGSELTFPPRTFSFSLFQQFFADPAWWGACMTSVMVALLASAIAIAVGVP
FT                   GAYALARGHFPGKRVLETLAITPMLVPVVVLGLGIYKQFSALALVNTIGGLALAHAVLV
FT                   VPFVIIAVGSGLRHADASLEAVALVMGASRTRIFFQVVLPQIRASVAVSVLFAFLLSFD
FT                   EVVVAYFISGPQTTTLPVKMYSAIRWEVSPVLAAVSTLLTLISLLVCLGIMTLQRRDSD
FT                   TE"
FT   gene            576955..578547
FT                   /locus_tag="Bxe_B2541"
FT   CDS_pept        576955..578547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2541"
FT                   /product="Putative phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33451"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R38"
FT                   /protein_id="ABE33451.1"
FT                   /translation="MTNRYDAVIIGAGHNGLVCGAYLARKGFKVCLLERRELAGGAAVS
FT                   EAVWPGYRVSTASYTMALLQPRIIDELELAKYGYEIVVPPPMLHLYGDGRSLLFRPEGE
FT                   RLSADIARFSEADADAYGKYRAHMARLGKMVAGMLWETPPDPADSTLSARSRLLGFAWR
FT                   FRDMGEQFYDLYDVLTLSARDYLARWFESDEMIAALGFYASCGGAATSICSPGSAYVLL
FT                   RGFIRDHTTSAGPAGFVRGGMGSISEAIAASGKAYGMEVRCNAPVASVEISGERATGVR
FT                   LSSGELIEAGCVISNVATKVLFQQLVGAQNVPPEFLARVRQIRDRSTAFKVNLALRRLP
FT                   TFKDFDARSAGFAYPAQVRLAPSVEYLERAWDAAKYGEISPRPPLVVLTPSAVDPGVAP
FT                   KGKHLMSIFGQHAPYALRDGPWDDAQRERLYQITLDTLAAYAPDIRECIDDAQVLSPAD
FT                   LERIFALPGGHVHHGELSADQIFFRRPVQGAADYCTPVKGLYQCGASVHPGGGVTGVPG
FT                   YNAAHVVVRRERH"
FT   gene            578579..579673
FT                   /locus_tag="Bxe_B2540"
FT   CDS_pept        578579..579673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2540"
FT                   /product="ABC spermidine/putrescine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33452"
FT                   /db_xref="GOA:Q13R37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R37"
FT                   /protein_id="ABE33452.1"
FT                   /translation="MNMIELKQVSRRYGAVQALAPLDFSVKQGEFVTLLGPSGSGKTTL
FT                   LNVIAGMVNPSSGQIFVRGVDITKAPPSARGLGMVFQNYALMPHMTVFDNIAFPLRVRK
FT                   MPKDEIARKVKDVLDMVRLPDIAQRKPKELSGGQQQRVSLARCIVYNPALILLDEPLGA
FT                   LDKKLREQMQLEIRRLHAELGITMLNVTHDQDEALSMSDRIVLMNEGRVEQIATPDELY
FT                   RSPRTAFAASFIGTANLISGTVEHHAGERALVSTPLGMLRAAATACTASRGESVTLLVR
FT                   PESVRMGPASDSPTGDGADGLRHAGTLEDSIMLGSVVRHHVRLTGGMQMVVQQQDSRRR
FT                   PAPERGAPVLLDWAPEDCQMILQD"
FT   gene            579729..581369
FT                   /locus_tag="Bxe_B2539"
FT   CDS_pept        579729..581369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2539"
FT                   /product="Putative acyl-CoA synthetase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2539"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33453"
FT                   /db_xref="GOA:Q13R36"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R36"
FT                   /protein_id="ABE33453.1"
FT                   /translation="MRTQSPTVEDELVRRKRQEQLALPESLGQFVREQAALHGERIAAV
FT                   WFDRGISMTYAQIDSMASQLADSLVKRGIRKGCHVALMLKNAPEFVITWIALGRIGAVM
FT                   VPVNTSYTQDELVFVLTDADAQYLVIDAEFLPRLAAAPALPGLLAWERVIVCGESEHPL
FT                   RWAALLEAGSADFTAPSAVSRHDLLNLQYTSGTTGFPKGCMLSHDYWMIHCHGAARHRR
FT                   GPEAGIENVLIWAPFFYMDPMWQFLMTMKLGGTAYIAERMSLTRFMSWLIDYRIHYCIF
FT                   PEPALSQHPRGPRDAEVHLKYISIYGWTRSAREEVQARFGVIAREGFGMTEVGTGALVP
FT                   AWAHDKALERTCGLPAPFRELQIRREDGSVAEVDEVGELWIRGRGILWGYYKRPEANAE
FT                   SFDGDWFRTGDLFRRDAQGFYFIVGRIKEMIKRAGENVSATEVETVLRGMDAIDEAAVV
FT                   AVPDPLRREEVKAYLKLREGLTQGDVPPAAVFEHCARHLAPFKVPRYLQYIEGDFPRTP
FT                   SRKIAKKRLIAETVDPFADTFDRQESRWR"
FT   gene            581393..582244
FT                   /locus_tag="Bxe_B2538"
FT   CDS_pept        581393..582244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2538"
FT                   /product="Putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33454"
FT                   /db_xref="GOA:Q13R35"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R35"
FT                   /protein_id="ABE33454.1"
FT                   /translation="MFVDFSSRPPSLQFDGPASHLTNYRRVYQGTERQVADAGCADPLA
FT                   GYLATYERLNARHVVLKARDLTSTFGVKIANEDVAAFCRTNGERYIGFAGVDPHKGEAA
FT                   VAEFEYAVRDLGLRGLNVQGFEHRLPIDDPLLFPLYRKCVELGMPVNIHCGTNFSTQTS
FT                   MMYGHPAALDRVMMALPELRVCASPPGWPWVQELLAVAWRHPNLWIGTVAVRPRLLATA
FT                   HSGYEPLLQYGRTVLKKRMIFGSAFPMMPVEQALSEFDALPLKDAVREDWRCNNALEFL
FT                   GL"
FT   gene            complement(582313..582609)
FT                   /pseudo
FT                   /locus_tag="Bxe_B2537"
FT   gene            complement(582747..583682)
FT                   /locus_tag="Bxe_B2536"
FT   CDS_pept        complement(582747..583682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2536"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33455"
FT                   /db_xref="GOA:Q13R34"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R34"
FT                   /protein_id="ABE33455.1"
FT                   /translation="MNLSLKQLKVFLGVANTSSFTKTAQSVHLSQAALSAIIRELETQL
FT                   SCRLLERTTRTVSLTEAGRVFYPTAMKIVETLEKSVIELNELGRQKQSSLLLGCTPMIA
FT                   ASLMPPVLVRFSRMYPDSQIELVDRAPSELLQMVEEGHLDAAFGVFFSQLSGIDRVPIF
FT                   PTHLVAISAVDDMPEKNGGRSAAGIRWTSLEGRPLITLPKDNPLQRLIEATLSKEEVNV
FT                   SRRIVVGHMQTAVAMAQEGLGTAVMPSFCEHICRRYRVRIDPIRPEVPLSFYRITRTGR
FT                   DTLTALDQFTEMFTEAAQERPVMLAADELD"
FT   gene            complement(583789..585372)
FT                   /locus_tag="Bxe_B2535"
FT   CDS_pept        complement(583789..585372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2535"
FT                   /product="Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33456"
FT                   /db_xref="GOA:Q13R33"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R33"
FT                   /protein_id="ABE33456.1"
FT                   /translation="MRKEPRLRPKTAIPSTNDGTPAPDLEQFRLRRFLESLDDSELERH
FT                   EAPVDLADVAAIMEGNPRAVWFGRVSGSTASLAGSVAASRTRLAQAFGTTPQRLLDTVR
FT                   ERLRTKGRLVEVSREEAPVQQIVLTGDDCDFTALPVHLQHELDGAPYISASIDFAIDPD
FT                   TGWTNVGIRRLMLRGRRTAGIDLVAPSDLRAIAIGHAKRGERTPIAFAVGTHPIDHVGA
FT                   TMRIPADELELVAALRGTAMGVVKCITNDLLVPADAEFILEGYLDERGHAEPEGPYGEF
FT                   LGYYGGVKTNPVFHLTAITHRRDAVFQTCTIGGRSMACTDTAQLAALRTEVTVWRALET
FT                   AVREVNAVYANPATGGMFNVRIAMQQRVPGEARNAIAAVFASLANVKHVFVVDPDIDVF
FT                   SDEQMDWALATRFQADRDLVLQDGMRAMPLDPSLLGATKTAKAGFDLTLPLLAPGAQRD
FT                   LEHRVPTPPAYQGARFDSLEAALEDGPKRFSELMAAAGTRDGREVVRWLEDIAPRRAIA
FT                   RDAEGRYTFA"
FT   gene            complement(585464..586189)
FT                   /locus_tag="Bxe_B2534"
FT   CDS_pept        complement(585464..586189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2534"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33457"
FT                   /db_xref="GOA:Q13R32"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R32"
FT                   /protein_id="ABE33457.1"
FT                   /translation="MPTPFVAINRDGPLVDVMLDCPDNGNLIDSAMSEAIIEAVTTLDD
FT                   DVKVVRILSSGPDFCKGRQSPMPPKDAKPSAEMLRRVVAAPPLALYDALKAVRVPVVSV
FT                   VRGEALGVGCALAGVCDVALAADDAVFQIPEMERDIPPTLVMSALIGRVPVKTVAHMVL
FT                   SRLRLSAAQALQAGLVSRVVPAASLDAEAEALTQTLLGCSAVTLRAVKQFLHLAPEMSA
FT                   TGASGFAAHLAATALSARF"
FT   gene            complement(586231..588567)
FT                   /locus_tag="Bxe_B2533"
FT   CDS_pept        complement(586231..588567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2533"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33458"
FT                   /db_xref="GOA:Q13R31"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R31"
FT                   /protein_id="ABE33458.1"
FT                   /translation="MIGQPLPRVEDRRFVTGNGKYTDDLQIEGQTYAAFLRSPHAHAGL
FT                   LSVDISAALDAPGVIAVLIGQDYLEDGYQGVDHVPNPIDAVDATKKAFLTSLTGQIFNQ
FT                   RHIPLPVDRVRYVGEPIAMVIAQTPLAARNATEMIEVEYDVLDAVVNAADAMQDGAPQM
FT                   WDGAPGNLCFQAQIGERDEARRIIAGAPLVVQREFHHSRVVNCQMEPRSAIGAYDGETG
FT                   VYTLISGSQGAVRQKLCLADALKVPPAQVRVVCPDTGGGFGPRSFIYVEQLAVVWAARR
FT                   IGRPVRWTSDRSEAFLSDYQGRDAIVRATFGFSKDGRILAIDNEWLGNVGAHTVSYVPM
FT                   SNGTRIMTTVYDVPVAAVHISAVMTNTVPTAPYRGAGRPEATHVIERMLDLAAAELGLD
FT                   RAEIRRRNLIAHEKLPYRSPMGLTYDSGEFARNMTRALELAEWNSFSERRAAARANGRL
FT                   RGIGLANYIESPVGAPRERIELTVLPEGRIDIVAGTQSTGQGHETTFAQVIAQHLGVPM
FT                   ASVTLRTGDTAFVSVGGGSHSDRSMRLGGMLLVDTAAQIVATGRQVAAALFDASPERVA
FT                   FADGGFADPASDRRIGLFEVAARIASDGVPGDPAQRKLYAHAEVNTRVPAHPTGAAVCE
FT                   LEVDPDTGVVELVNYTSVDDVGQPINPLIVEGQVHGGLAQGIGQALSETCYLDRATGQV
FT                   LTGSYMDYGMPRAGAIPPLRVELTEDPTHGNPLRVKGGGESGITPATATIFNALADALK
FT                   EFGNEELAMPATPKVVWEYIHRRAG"
FT   gene            complement(588564..589073)
FT                   /locus_tag="Bxe_B2532"
FT   CDS_pept        complement(588564..589073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2532"
FT                   /product="Carbon-monoxide dehydrogenase small subunit"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33459"
FT                   /db_xref="GOA:Q13R30"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R30"
FT                   /protein_id="ABE33459.1"
FT                   /translation="MAEVQLRVNGVDVERDVPDQTLLVEFLRETLRLTGTHVGCDTSQC
FT                   GACTVNLDGVSVKSCTVLAAQASGGAVTTVEGLRADQDAPLHPVQNAFVQCHGLQCGFC
FT                   TPGMIMSVDFYLRRPPKLDEESICHALEGNICRCTGYVNIIEAVRHAAHDLYPALAGAT
FT                   AEGSQS"
FT   gene            complement(589114..589599)
FT                   /locus_tag="Bxe_B2531"
FT   CDS_pept        complement(589114..589599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2531"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33460"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R29"
FT                   /protein_id="ABE33460.1"
FT                   /translation="MEFTGSQTIAATREQVWKGLNDAAVLQACVPGCEEFIAQNEDEYK
FT                   AVVVASVGPVKARFKGTLALSERNGPNGYRIAGQGEGGIAGFGKMTATVTLADADQGGT
FT                   LLTYVAEAQVGGKLAQIGSRLVTSVANKLAAEFFKRFNATMSAGPDATEAANAGTAH"
FT   gene            complement(589621..590439)
FT                   /locus_tag="Bxe_B2530"
FT   CDS_pept        complement(589621..590439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2530"
FT                   /product="Putative carbon monoxide dehydrogenase, middle
FT                   subunit"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33461"
FT                   /db_xref="GOA:Q13R28"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R28"
FT                   /protein_id="ABE33461.1"
FT                   /translation="MYETTYLRAASLDEAVAWLREHEEARPLSGGMTLIPTLKQRLAAP
FT                   SHLVDLTRIDALRGVSVEGNVLRVGALTRHAEVAASPVVASAIPALAQLAGVIADPQVR
FT                   NRGTMGGSVANNDPAADYPCAVLALGAQVITSQRRLAADDFFVDTFETALDAGELVVGF
FT                   EYPIPLRGAYAKFRQPASGYAVVGVFIAQFADAVRVAVTGAGASVFRWSEAEAALGADL
FT                   SDAALANLKMDDLALPDDDNGSAAYRAHLIETYTRRALQSLLAQPLRQPA"
FT   gene            complement(590521..591288)
FT                   /locus_tag="Bxe_B2529"
FT   CDS_pept        complement(590521..591288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2529"
FT                   /product="Putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33462"
FT                   /db_xref="GOA:Q13R27"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R27"
FT                   /protein_id="ABE33462.1"
FT                   /translation="MTRALNGYVKVGNGPRKVLAMSGWFGSAEDWQPLVPSLDTDEFTY
FT                   VFFDYRGYGRSRERDGAFTFEEAAQDVLALADHLDWDRFSLIGHSMGGVAIQRVLLAAP
FT                   ARIERMAGVCAVPACGSRMDETRLAAFRAAVDDVERRAAIIAFSTGNRLSPRWSAHLAR
FT                   ESQRVSRADAFAAYLPHWAASDFSTELRDHAVPVKLFIGEHDPTLTAELMARTWLAWYP
FT                   RATFETLRNAGHYPMYEVPVALATALEDWLKQS"
FT   gene            complement(591285..592637)
FT                   /locus_tag="Bxe_B2528"
FT   CDS_pept        complement(591285..592637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2528"
FT                   /product="fumarylacetoacetate hydrolase"
FT                   /EC_number="3.7.1.2"
FT                   /note="Homogentisate pathway; Citation: Environ Microbiol.
FT                   2002 Dec;4(12):824- 41.J. Bacteriol. 186 (15), 5062-5077
FT                   (2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33463"
FT                   /db_xref="GOA:Q13R26"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R26"
FT                   /protein_id="ABE33463.1"
FT                   /translation="MTALNFTHDPVRRSWIESANLPDADFPIQNLPFGAFERNGEARTG
FT                   VAIGEHVVDLRALRDSGLVEAGSDAALACEAASGATLNRLMAMGPRYSGALRAALSELL
FT                   KSDAPQRANVQRQAEALLPRIDEIALRLPCEVGDYSDFLTSLHHTERHGRYKGLADPLP
FT                   PAFKSLPIAYHGRASSLRASGGEVRRPHGQYRDASGQIVFGPAPALDFELELAAWIGHG
FT                   NAFTQPIPIDAAHEHIFGYSLLNDWSAKSIQWFEQVLGPFLGKSFHSSVSPWIVTAEAL
FT                   APFRKAPVPRAQDDPPLMPHLRGAFDQQQGGLHLALYADLSTSRLRDAGAGPVRITRTH
FT                   LDNLYWTFAQMVAHHTSNGCDLRTGDLLGSGTISGADDAARACITELTNAGKDPLRLPN
FT                   GETRTALEDGDEIVLSARATKSGAVSIGFGECRGRIAPALAVAGRREEIAA"
FT   gene            complement(592634..593164)
FT                   /locus_tag="Bxe_B2527"
FT   CDS_pept        complement(592634..593164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2527"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33464"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R25"
FT                   /protein_id="ABE33464.1"
FT                   /translation="MSAVPPILGLHHFAWRCRNAEETRHFYEDILGLPLVHLIRLDRVP
FT                   STGEYCPYVHLFFEMADGANIAFFDLGDDTAAEPSPNTPPWVNHIALRLATLEQLEAMK
FT                   QRLVEHGVDVLGVTDHHFVRSIYFFDPNGFRLELTVPVAPAETLECYKMQARPALDAWA
FT                   EERKKAVSETPVA"
FT   gene            complement(593195..594385)
FT                   /locus_tag="Bxe_B2526"
FT   CDS_pept        complement(593195..594385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2526"
FT                   /product="Salicylate 1-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33465"
FT                   /db_xref="GOA:Q13R24"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R24"
FT                   /protein_id="ABE33465.1"
FT                   /translation="MKIVIAGAGIGGLTAGAALLRKGFDVTILEQAKVLKEIGAGVQLS
FT                   PNATRVLYQIGVGERLEGLACEPPGKRVRLWNSGQTWPLFDLGAASREIYGYPYLTVHR
FT                   ADLHEALVDAVRALSADAIRLDEKVEGVVQKGGKVEVQTVSGGIYEADLLIGADGVHSR
FT                   VRRALFGPDEPVYSGVMAWRGVIDAEKLPEHLRTPYGTNWVGPGAHVIHYPLRGHKLVN
FT                   FVGAVERDGWQVESWSESGTIEECLADFTGWHEDVRAMISAIDVPYKWALMIREPMTRW
FT                   SSGRATLLGDACHPTLPFLAQGAGMALEDGYLIARCLAQYGENDLQRALERYESLRLDR
FT                   TSRIVRGAAANTTRFHNPALAHAEGAADYVDREWSEERVKERYNWLFEYNVDTVEV"
FT   gene            complement(594575..595153)
FT                   /locus_tag="Bxe_B2525"
FT   CDS_pept        complement(594575..595153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2525"
FT                   /product="Putative aromatic acid decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2525"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33466"
FT                   /db_xref="GOA:Q13R23"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R23"
FT                   /protein_id="ABE33466.1"
FT                   /translation="MHFSAVPPRRLVVGISGASGVVYGVRLLQLLRQLDIESHLVMSRS
FT                   AQVTLAHESPYSVAEVRALATVTYPNTDIGAAISSGSFPVMGMIVAPCSIRTLSEISTG
FT                   VTSGLLSRAADVTLKERRRLVLMVRETPLHLGHLRSMTNVTEAGAIVYPPVPAFYANPE
FT                   SLDDMVDHTLGRVLDLFGIETPVVHRWGM"
FT   gene            595446..596534
FT                   /locus_tag="Bxe_B2524"
FT   CDS_pept        595446..596534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2524"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33467"
FT                   /db_xref="GOA:Q13R22"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R22"
FT                   /protein_id="ABE33467.1"
FT                   /translation="MRTGLLVGGCAAILAAPVWAQSSVTLYGSIDVGLDFVSNTQGKHL
FT                   YQESSGKRQPDRWGLLIKENLGGGNTAFARLESGFVTNTGAQINPTSFFNREAFVGLSN
FT                   DRLGALSFGNINDYIYQYVGRLNNSIPGISSFYTPGNLDGLANNHALNNAVKYETINFH
FT                   GFQAGAMNAFGNQAGNFSEGRQYSLGAQYANDMVRFGIAYTMSHNRTADVFGTFSLSSL
FT                   LGQPLKQGTMFNASRYSTLAVGGSVKIGYFTPHLTYSGVKLENGQGSATLNNYQTGVNI
FT                   DLSGKGFYILGLSWDHSTFQSLAINQYNLFLTDYLSKSTQIYAGVGLQRAAGPGARAAQ
FT                   FGYQPSSSGSQTIARIGVNHMF"
FT   gene            596755..598140
FT                   /locus_tag="Bxe_B2523"
FT   CDS_pept        596755..598140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2523"
FT                   /product="major facilitator superfamily (MFS) aromatic
FT                   acid/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2523"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33468"
FT                   /db_xref="GOA:Q13R21"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R21"
FT                   /protein_id="ABE33468.1"
FT                   /translation="MQADRTFNIATLIEEQKTGRFAVGLLFWCFLIMLMDGYDQTAVSF
FT                   AAPAIIKDWHVARGGFGPVFGAGLFGTLVGSFIFGYLGDRLGRKKAIVIGSLFFGVLTW
FT                   ASVWATSLQELMLLRFLAGIGMGGVVPNSVALVAEYAPKRLRATWVTLMFSGFSIGAGS
FT                   GGLVSSALIHRFGWPVMFAVGGGGSLLVAVLLIFTLPESARLLVVRQRGEETVRALVAR
FT                   LRPDLNIPADAQFVPGEVREKQRFVFRLIFSDGLASITLLLWIVFIANSMALYFLQNWL
FT                   PILIEGMGVDPRGAGLITTMFSAGGVIGGLILCRFVDRHGVLAIISLPAIGFPVVALLG
FT                   HGSSQTWLMVAVFAAGFCVVGAQYGLYAVAGMIYPTSFRSAGVGSAISVGKIGSVSGPV
FT                   VGGLLLSMHLPITQLFYSASLLFVVAAVFSTVLALLYRARFGAQHAAQAAMEPMRRSLA
FT                   RDS"
FT   gene            598390..599823
FT                   /locus_tag="Bxe_B2522"
FT   CDS_pept        598390..599823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2522"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33469"
FT                   /db_xref="GOA:Q13R20"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R20"
FT                   /protein_id="ABE33469.1"
FT                   /translation="MTQPRTLYDRIFDAHVVRTDADGTTLLYIDRHLLNEVTSPQAFES
FT                   LRREGRPVWRPQANLAVADHNVPTTDRRLGIADPVSRIQVDVLRENCERSGIVHYGMDD
FT                   ARQGIVHVVGPELGCTLPGMTIVCGDSHTSTHGALGALAFGIGTSEIEHVLGTQTLITR
FT                   RSRTMRMTLDGVLPPGCTAKDVALAVIGALGTAGGTGYAIEFAGPVVRALSMEGRMTLC
FT                   NMSIEAGARAGLIAVDETTLDYCRTRPHAPQGETWELSARVWRALRSDDDARFDAECSL
FT                   DVSTLAPQVTWGTSPEMVTGIDGRVPDPLDIHDAGRRASWQRALDYMGLDAGTRIDTIA
FT                   IDKVFIGSCTNGRLEDLRAAADILRATGGRIASNVRLALAVPGSQQVKRDAEAEGLHDV
FT                   FIAAGFEWREPGCSMCLAMNPDRLEPGERVASTSNRNFEGRQGAGGRSHLVSPAMAAAA
FT                   ALAGRFADVRPFASGMGGL"
FT   gene            599823..600455
FT                   /locus_tag="Bxe_B2521"
FT   CDS_pept        599823..600455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2521"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33470"
FT                   /db_xref="GOA:Q13R19"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R19"
FT                   /protein_id="ABE33470.1"
FT                   /translation="MEPLVCHEGLVVPLDRDNVDTDAIIPKQFMKSIARTGFGPYLFDE
FT                   WRYRDPGHYGKPAAERTPEPGFALNQQRYAGASVLLTRRNFGCGSSREHAPWALHQFGF
FT                   RVLVAESFADIFFNNCCKNGLLPVRLDAALIGRLMETVEAAHGYRLRVDLAAQTLTAPD
FT                   GECWRFDIPPALRTLLLEGLDETGATLAFADAIRAFEAVQLERSPWL"
FT   gene            600544..602172
FT                   /locus_tag="Bxe_B2520"
FT   CDS_pept        600544..602172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2520"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2520"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33471"
FT                   /db_xref="GOA:Q13R18"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R18"
FT                   /protein_id="ABE33471.1"
FT                   /translation="MNPTLAADAVVSTDPFASPGAAAMRPAPAAQRRTVSLQARIGLTI
FT                   ALLTVLMTAIGVLGLAGVWRANRANQDTYQNKLTAAVYIGNAELLIARTRLVLGGAMAQ
FT                   PDSARAQEQIGHASEFFRQSDEAWRQFVEEPHEIGEVPLIEAAGKRRDTMRDAMRAFID
FT                   ALKSGDRDAAQKIGMSRLSPLFNDMSDTNDRLKSALYANAKRSYENAERYSRLFLAASL
FT                   AMIVFGIVAAAFSWVTLRRAIMAPLNEALAHFEAIAAGDLQRTIGRYRADEMGHLLDGL
FT                   RNMQAQLARTVTAVRDGCRSIGIPIGEIAAGTLDLSSRTEEQAASLEQTAASMSELTET
FT                   VRQNASRAREAHAIADDASTAANGGSGAIGRVSNTMLRIEASARKIADITGIIEGIAFQ
FT                   TNILALNAAVEAARAGVHGRGFAVVAAEVRSLAQHASSAAKEIGELVGDAVGAASDGTM
FT                   MVAEAEQAIDHILDAARRFTDMMGSIAAAADEQRTGIEQVDAAISLMDSITQQNAALVE
FT                   EASAAAQALDQQSRELDRQVAMFRV"
FT   gene            602330..603688
FT                   /locus_tag="Bxe_B2519"
FT   CDS_pept        602330..603688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2519"
FT                   /product="major facilitator superfamily (MFS) aromatic
FT                   acid/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33472"
FT                   /db_xref="GOA:Q13R17"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R17"
FT                   /protein_id="ABE33472.1"
FT                   /translation="MTTSTLSTASVNVSALIERQKLGGFALGLIAWCFLIVLIDGYDQV
FT                   AAAFAAPALIHAWHTNAAGFGRVFGVGLFGVLIGSLLLGFSGDRFGRRPTIICGTLWFG
FT                   ILTILCGYATSLEQLTVLRFLAGIGMGGVVPNTVALVSEYAPKARRATWITLMFSGFSI
FT                   GASGGGAVASWLLPRFGWPVLFELGGAAAVVVALASLALLPESVRFLIVSGRGARRIAR
FT                   IAKRLGGVDSDAVRYVVDDEVRLRVRPAALFQNDLAYVTPLLWALFVLNSLALHFLQNW
FT                   LPILFGMGTLEPAHAAQAAMMFPAGGTVGALMLSRWVDRYGIGVILLLAVIGCPVAASL
FT                   GMPMPVAWLFVAVFVSGACVIGSQFALYAVSGMVYPTALRSTGVGSAIGIGKFGSILGS
FT                   VLGGILLAMHLPVAKLFVDLASVFVFIALLAIWLGRNRRVSERQAAVGQTGAS"
FT   gene            604119..605102
FT                   /locus_tag="Bxe_B2518"
FT   CDS_pept        604119..605102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2518"
FT                   /product="Putative zinc-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33473"
FT                   /db_xref="GOA:Q13R16"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R16"
FT                   /protein_id="ABE33473.1"
FT                   /translation="MKVIALQQHGGMDQLKHDSWPVPAPAAHQALIEVKACGLNYMDVF
FT                   VMRGMPDMKTEMPRIPGGDIAGIVREVGSEVSKEWLGKRVVLFPRFPEGGVLGENGNGG
FT                   LCEFIAADQRQLIAIPDGVDFDDAAALPIAYGTAHRMLFTRGKISKGEKILILGASGGV
FT                   GVACLQFAKMAGLEVFVCTSTEEKGRKLKELGADHVVNYVENPDFAKAVWAASGKKGVD
FT                   VAVNFTGGDTWIPTQRCMAVGGRILTCGSTAGHICEVDVRFIWHREVDIIGSRAYVPTD
FT                   IEACLDYVASGELKPIIETKFPLAQAGLGIGLLEDRRIFGKVIVNP"
FT   gene            605099..606640
FT                   /locus_tag="Bxe_B2517"
FT   CDS_pept        605099..606640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2517"
FT                   /product="Putative long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33474"
FT                   /db_xref="GOA:Q13R15"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R15"
FT                   /protein_id="ABE33474.1"
FT                   /translation="MSQPLKNLGSIGDEFRNEDRPVIIDLWDSENPREVDYPTFHASCD
FT                   AIARGFVARGYGKGTRIGIFCSNRLEFLEVFYGAMRAGVIPVPMGILLPKDTIEWIIRD
FT                   AELKLVFCDSELRAKLPSNTPHIVVESEEYEAFKVPGPFEAIVPTGDDVAFQPYTSGST
FT                   GRPKGVVLSHRAHVWVAETISKDRGFCRTDRMIVAAPLYHKHAMNAIKSVFVGGSTVVL
FT                   MKKFEPRAYLDAVSRYRVSVLSGVPTIFAMILQQRDLIEGKDFSFVRLATMGGAPASDE
FT                   LIDAVAKILPNADIISIFGITETSAALFGSHPGNLTRPRHSVGWPIAGNEFKLIGGPDE
FT                   NFGVLHVRGPGMMNGYHNNPVEMERRLKDGWFNTGDVLRKDADGWYYFIGRSDDMFVCS
FT                   GNNIYPGEVELMLERHPDIEQAVIVPVPDEIRHQIPYAYVVRRKGSALSEKDVKEHALT
FT                   NAPPYQYPRKVIFVDQLLLNGVGKIDRKALQAQALEICRTERAVAADVADRPEGK"
FT   gene            606637..607044
FT                   /locus_tag="Bxe_B2516"
FT   CDS_pept        606637..607044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2516"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33475"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R14"
FT                   /protein_id="ABE33475.1"
FT                   /translation="MTIDEAQQLVSRGPYLNWLGLEVLDLGADTITVKAKWRPEWVANP
FT                   TLGQTHGGILAALIDFAADFSLLNSLGHPVPTIDMRVDYHRLTKQCDLIAKGRVIKLGR
FT                   QFSICEAQIFDGSNLLIASGRGAYITAPKES"
FT   gene            607122..607604
FT                   /locus_tag="Bxe_B2515"
FT   CDS_pept        607122..607604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2515"
FT                   /product="putative tripartite tricarboxylate
FT                   transporter(TTT) family, TctB (4TM) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33476"
FT                   /db_xref="GOA:Q13R13"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R13"
FT                   /protein_id="ABE33476.1"
FT                   /translation="MSNGRERRFVTEYTRDYYGGALMLLVGLAAAFQGSRYGIGSMTHM
FT                   KAGFYPVVLGVILAILGVIIAGSATRVPSGDTEDEAQPSEWRGWICIVSSILAFLLLGK
FT                   FGGLLPASFAIVFISALGDRDNSVRAALIVATAISAVSVVLFWWALQLQFPLFSWG"
FT   gene            607607..609202
FT                   /locus_tag="Bxe_B2514"
FT   CDS_pept        607607..609202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2514"
FT                   /product="putative tripartite tricarboxylate
FT                   transporter(TTT) family, TctA (12TM) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33477"
FT                   /db_xref="GOA:Q13R12"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R12"
FT                   /protein_id="ABE33477.1"
FT                   /translation="MVVQSLTDLWQGFGVALEWHNLMWSFFGVVVGNLIGVLPGMGPLS
FT                   AISLLLPLTYSMHPVPAILMLAGVFYGSQYGGAIGAILLNLPCHPPHAVTCLDGYPLTR
FT                   QGKGGTALGITMISSFFAASVGIIVMIFLSPVLVNVAFKFGPSELFSIMLLGLLAGGTM
FT                   SSGSSVKGVAMTVFGMLIGVAGIDINSGAIRFTFGFPELADGVQLVALALGLFGVAEFL
FT                   RNVNRMHVVGSTAKVRLRDMRPSRAELKQSFWPMVRGTGIGTLFGAMPGTGPTITTFIA
FT                   YAVEKRISNSPERFGKGALEGVAAPEASSHSKTQVDFIPTMSLGIPGDPIMALLLGALL
FT                   IHGIQPGPLLISKHADIFWGLVASFWIGNVLLVLLNVPLIQLWVKVLQVPYRFLYPSAL
FT                   LFIAVGVYSTDNSLFEVGEVLLFGVVGAVLLALEFPVAPILLGYVLGPMIEENFRRTLL
FT                   LSHGHLSAFILHPISAVFIAASAILIAAQVYFAVLARIRKRKLRELLPEPPNMEQSQSA
FT                   RERELLRGDANQHS"
FT   gene            609359..610342
FT                   /locus_tag="Bxe_B2513"
FT   CDS_pept        609359..610342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2513"
FT                   /product="4,5-dihydroxyphthalate decarboxylase"
FT                   /EC_number="4.1.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2513"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33478"
FT                   /db_xref="GOA:Q13R11"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R11"
FT                   /protein_id="ABE33478.1"
FT                   /translation="MKKIQLTLAVGDYEITRPLKDGTVQAEGIDLTVLTSMDSITRHWR
FT                   FLRNNEFDIAEVSASSYIVSRDRDMPFRAIPVFLHRRFRHGFIYINKNKGITKPSDLIG
FT                   KKIGVKAYQVTAVLWLRGMLEHEYDVPHKSIDWYSDLDEDIDFTPPEGVRLTRVRDDQS
FT                   VEKMLAEGELDALLHPDIIDPILNKDPRVGRLFEDTKAAEIDYYKRTGIFPIMHMMGIK
FT                   KEVVEQYPWVPRSLFKAFEQAKAMGMKRMRNPRVAPLAWYQDALEEQERLLGPDPWQYG
FT                   LSAENVKNIETLMGYSHEQGLISRMIPMNELFLDLSEGAKRGTFRT"
FT   gene            610977..611966
FT                   /locus_tag="Bxe_B2512"
FT   CDS_pept        610977..611966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2512"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33479"
FT                   /db_xref="GOA:Q13R10"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R10"
FT                   /protein_id="ABE33479.1"
FT                   /translation="MVALPVYAQSGVTLYGILDEALQFNTNSQNVVHGRNVGGRQWNLN
FT                   SLSGPSGSRWGMRGAEELGSGLSAVFTLESGINLNSGAFGQGGTAFGRQAFVGLRSREA
FT                   GSVFMGRQYDSINDYVARLSFTLSGYGGIDHPGDLDNMGHQSHINNTIKYVSPNLRGLT
FT                   FGGTLSAGGVAGSIAQNSGFSVGARYAQGPLKLGVAYEIYRNPSNIGAALNSNANAVSP
FT                   TSTSIFESLNSGYLTGANPATTWQVGAVGGTYDFGAATLGLVWSNVRYGNIGRYNGATA
FT                   TFNDMEVHGIYRFGPALSAALDYNYLKGNAVSGDIGDQTYHQAIFRGS"
FT   gene            612055..613245
FT                   /locus_tag="Bxe_B2511"
FT   CDS_pept        612055..613245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2511"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2511"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33480"
FT                   /db_xref="GOA:Q13R09"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R09"
FT                   /protein_id="ABE33480.1"
FT                   /translation="MRKKSVAIAALGALALPAYAQSTVSLYGVIDEGLQFNTNNKNNVG
FT                   GHNVGGRQWNLDSLAGPSGSRWGMKGAEDLGGGLSAVFTLESGVNLNSGSFGQGGTAFG
FT                   RQAFVGLSSRQFGSVLLGRQYDSINDYIGYMTFGLAGYGSGLAHPGDIDNTTHESRVNN
FT                   TVKYVSPNLRGLTFGGTVTTGGVAGSVSQNSGFSAGLGYKQGPATFGLVYELFKNPSNA
FT                   GAVLNSNSNAVAPTSTTIYGSLNSAYLTGANPATSWQVIAAAGSYNFGAVTVAGAWSNV
FT                   RYGNIGRFNGASATFNDAEVNGMYQVNPAVFVSLAYNYLKGNAVSRDIGDQTYHQISAM
FT                   ADYLLSKRTDVYVTVTYQIASGTNSTGAPAVADISLVGDSSNNRQALFRVGMRHRF"
FT   gene            613299..613658
FT                   /locus_tag="Bxe_B2510"
FT   CDS_pept        613299..613658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2510"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33481"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R08"
FT                   /protein_id="ABE33481.1"
FT                   /translation="MNRVDLDVLKSSYRWLADGCRVLLVTVVGTWGSSPRPGGAMPAVR
FT                   ADGRVAGSVSGGCIEDDLIEQVRRNGIEQTRPQLAGYGVSVEKTRYVAASLVKVSGSGW
FT                   STGNVSGARAAPADA"
FT   gene            complement(613730..614674)
FT                   /locus_tag="Bxe_B2509"
FT   CDS_pept        complement(613730..614674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2509"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33482"
FT                   /db_xref="GOA:Q13R07"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R07"
FT                   /protein_id="ABE33482.1"
FT                   /translation="MRKISLRHLRCFAAVADTGSFTLAAARLYQTQSSLTATIQQFEEE
FT                   VGLKLFDRTTRRVVMTEDAARFKPIADRVLQDFDTAIGDLKAISLSHRGHVRIASVPSM
FT                   IEHVLAPALASFRRAYPDITISVSDGSADKVERAVLAGEADFGMASRLNNFPDLTYLPI
FT                   LGDRFGVLYPDDHPLAKIRQPLRWADLSEFEHIALANDTGIGAFLDSHPALGFHQKASL
FT                   HDRASSTNSLFAMLNLGGRISVLPELSVLASPLKKFTFRELSEPVITREVCLITRQLRS
FT                   FSPNTQRLVDALMENIAEDYHWDGPRQDQGKAA"
FT   gene            615562..616524
FT                   /locus_tag="Bxe_B2508"
FT   CDS_pept        615562..616524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2508"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33483"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R06"
FT                   /protein_id="ABE33483.1"
FT                   /translation="MAASSMLFQPRYAVANGVDSYPDKPVRMVVAYGVGGVADNIGRVL
FT                   AAGLTKALGRSVFVDNRGGGGGTIGATLVAKAAPDGYTILLTSPPMIAVAPLLLPDIYY
FT                   NPTRDFTPIGTFVTTPNILVVNNSLPVKTLADLVSYARGPARGDVSFASGGTGSTGDLS
FT                   GQILKRTANIDLIAVPYKSSALGFPDVIAGRVSMLFDSVPSTLGFIRAGQVRPIVVMSD
FT                   KRSPLLPAVPTAVEEGYPAATMQFWMGIEGPANMPPVIVARLNAALRTAMATPEVAKSM
FT                   ESLGAQPFLTSPQEFSALQDRDIAKYKPLIREIGLGAGD"
FT   gene            616598..616861
FT                   /locus_tag="Bxe_B2507"
FT   CDS_pept        616598..616861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33484"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R05"
FT                   /protein_id="ABE33484.1"
FT                   /translation="MNEIRKHPLMNSVGNALGARRLPTAWLIRGAQRSAQRRARALMNE
FT                   SCYSLMFDWFAGLTAWGAVWESVVCPDESAQLMQHEVSEAFL"
FT   gene            616858..617388
FT                   /locus_tag="Bxe_B2506"
FT   CDS_pept        616858..617388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2506"
FT                   /product="Putative oxidoreductase, alpha subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33485"
FT                   /db_xref="GOA:Q13R04"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R04"
FT                   /protein_id="ABE33485.1"
FT                   /translation="MTTGITITVNGRQHAVQADPETPLVYVLRNELGLYATKFGCGVAQ
FT                   CGVCSVLLDGQEIRSCIMPVSMAAGHEITTLEGLGELWEQRKRTPGTSLHREPETTDLH
FT                   PIQEAWIKLQVPQCGYCQSGMMIQAVSLLNTNPQPTRSDIVASMQGHICRCGTHMRIIS
FT                   AIEQAADHMSKEG"
FT   gene            617392..619662
FT                   /locus_tag="Bxe_B2505"
FT   CDS_pept        617392..619662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2505"
FT                   /product="Putative oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33486"
FT                   /db_xref="GOA:Q13R03"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R03"
FT                   /protein_id="ABE33486.1"
FT                   /translation="MPRENLPSSPAGNVVSPGRRGFLKAGGALVVTFCIPVISSSATRA
FT                   DTFGKVPPEQLDSWIAVQQDGSVSAFTGRIDMGTGVETVFVQAVAEELDVPVSSVTFVM
FT                   GDTARTVDQGKSTASNNIARNLPPLRQAAAEARLALMDLAAARLGVPSQKLVVKDGVVS
FT                   VSGGGQSVSYGELVGGKRFDIRLGVKGDGNRTQLTGRAKLKDPKEFKVLGTSVPRVDIP
FT                   AKVQGKFKYVHDVVVDGMAHGTVVLPPARGMKLVSVNGFAQPVPGVVKVVTRGNFVGIV
FT                   AETEQAAVRARNALNVTWAPGTNENFDDMYGTIRKTPVIKDEIEGVVGNVRTAFANAAT
FT                   VVEGTYYLPVNSHGMMGPSCAVADFREGSLTLWSGSQWPDGTRRDVAGMLGMPIDKVRL
FT                   IWVQGSGSYGRLGVDDAAGDAALLSQAVGRPVRVQWQRADENQWSPFCPAAVIHVKAGL
FT                   DAQGKITAWEFENWTPGHSTAEQGNILAWRALGTNPGHKRLSGGADSPSYDIANINVVT
FT                   HYTHEIVRAIYMRSVAGIQNAFAIESMMDDLAAKAGMDPIAFRLKHTTNKRSRIVLETV
FT                   ARKAGWKPLQKPVIDGDLIESRGIGALCAGDGKLANHGAWGNLATIVDIVLNKRTGVIR
FT                   VKRVFVAFDAGRVANPDGLRNQAEGGTIMGISRALKEQVLFRGAAVASADWLTYPVLQF
FT                   SDVPESIDVTLIDSDHAPLGAGEVPNVTPACAIGNAVFAATGVRIRELPLTPDRVKAAL
FT                   TVA"
FT   gene            619768..621072
FT                   /locus_tag="Bxe_B2504"
FT   CDS_pept        619768..621072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2504"
FT                   /product="Putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2504"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33487"
FT                   /db_xref="GOA:Q13R02"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R02"
FT                   /protein_id="ABE33487.1"
FT                   /translation="MKHLNLATAAALCAPIALAMVSSPAFSQSRPESNGAYLARAADCV
FT                   ACHSVPNGKPFAGGLKMGTPLGNIFSTNITPDKATGIGNYTLADFDRAVRKGVAKDGRH
FT                   LYPAMPYPSYAKISDNDLSALYGYFMHEVAPVRQQNRPVEIKWPLNMRWPLAIWNTAFV
FT                   NTQPYAVNRAHDAQWNRGAYLVQGLGHCGACHTPRGFAFQEQALDDRDGRFLGGATLDG
FT                   WTASNLREDPATGLGWWSEADIVTFLKEGSNGHASVFGPMTDAYNNSTQFMSDYDLKAI
FT                   ASYLKSLSAADANEPVYAYDDATTKALQRGDLRDPGAEVFRTQCASCHAVNGKGLGDRL
FT                   PALAGNPNVLAKDPSSVINLILNGAQRVVRQGMPDTYRMAPFRLQLSDREIADVATWIR
FT                   HSWGNKASAVSASEVEKLRASTDISSDRVIVLRMK"
FT   gene            complement(621298..622512)
FT                   /locus_tag="Bxe_B2503"
FT   CDS_pept        complement(621298..622512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2503"
FT                   /product="Putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33488"
FT                   /db_xref="GOA:Q13R01"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R01"
FT                   /protein_id="ABE33488.1"
FT                   /translation="MKPLDDLIHDATRLAGDGISAAAQPLHFRTRADILQGDLTGSEAE
FT                   VARVMQICNSCRYCEGFCAVFPAMNRRLEFGKADVHYLANLCHNCGACLHACQYAAPHE
FT                   FAVNVPQAMAKVRGETYVDFAWPAPLGKLYQRNGLTLSLAVAAGLALFLSLTARIDGGL
FT                   LHAPTGGNFYAIFPHNVLALMFGVVFLFAMVALGTGVSRFWRNVSPGSASGAAVADATY
FT                   DALRLKYLDGGHGKGCNNEDDAFTLSRRRFHHFTFYGFMLCFAATCIATLYHYLLDYHA
FT                   PYPLFSLPVILGSLGGIGLLVGPAGLLWLNLRRDPKQGDVAQRPMDRGFIALLLLTSAT
FT                   GLLLLALRDSRAMSLLLAVHLGVVMGLFLTLPYGKFAHGIFRSAALLKYAIEKRQPGNL
FT                   QLKGD"
FT   gene            complement(622499..623917)
FT                   /locus_tag="Bxe_B2502"
FT   CDS_pept        complement(622499..623917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2502"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33489"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR012831"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R00"
FT                   /protein_id="ABE33489.1"
FT                   /translation="MIDVLVIGGGNAALCAALTAREAGASVTLLEAAPREWRGGNSQHT
FT                   RNLRCMHDEPQDVLVDAYPEEEFWQDLLKVTGGITDEHLARLVIRHSSSCRDWMRRHGV
FT                   NFQPPLSGTLHLSRTNAFFMGGGKALVNAYYRSARQLGVEIRYETPVDSLELDDNGNFI
FT                   AAHTSSGRIEARSCVLACGGFESNREWLREAWGQNERGEWPGENFLIRGTRFNQGVLLK
FT                   FLMQHGADIIGDPSQGHCVAIDARAPLYDGGICTRIDCVSLGIVVNRDAVRFYDEGEDF
FT                   WPKRYAIWGRLTALQPGQIAYSIIDAKAIGRFMPPVFPGIQADTLPELARKIGLDEAQF
FT                   VQTVETYNAACRIGTFDHTVLDDCHTENLQPAKTHWARPIDTGPFYAFAVRPGITFTYL
FT                   GLKVDETAAVRFNGRPSENLFVAGEMMAGNVLGKGYTAGVGMSIGTAFGRIAGTQAAKA
FT                   ALQRHQTGALHEAA"
FT   gene            complement(623996..624922)
FT                   /locus_tag="Bxe_B2501"
FT   CDS_pept        complement(623996..624922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2501"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33490"
FT                   /db_xref="GOA:Q13QZ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ9"
FT                   /protein_id="ABE33490.1"
FT                   /translation="MELRQLRYFIKVAEHGSMGRAAADLGVVTSALSQQISRLEGELAA
FT                   RLLTRTATGVTPTDAGIAFLRQAQLALRHADSAAHAARQARLTGHVSVGMAATTASVLA
FT                   MPFLRAMRERYPDVRVHLVEALSGHLSSMLNSRRLDLAVLFRSEAAQRWSVLPLIDERL
FT                   FLIAKPGMKGLPAAGPVRLRDLAGLSFVLPSSSHGLRALLDAAFVRARVTPEVSVEIDG
FT                   LSVLMDLVQDGFGATIQPGAATARLSGQPLEVREIRDRFLHRPNLLVSLSDDELSPAAL
FT                   AARVLLSRVASAQVTSGNWPGATLHES"
FT   gene            625217..625750
FT                   /locus_tag="Bxe_B2500"
FT   CDS_pept        625217..625750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2500"
FT                   /product="Putative decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33491"
FT                   /db_xref="GOA:Q13QZ8"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ8"
FT                   /protein_id="ABE33491.1"
FT                   /translation="MSVETPVKTWADVVVQALKSNEVRLVTYVPDNVLRPLIDAVHADP
FT                   YFTVICPAREEEAVGITVGAYMAGMRGITLMQTSGFATLPNALASLVRPYQLPLVMLIS
FT                   ERGTLGDFQLGQAVVCRTMRPVLTSLGIEHFAIERLDDVEFVVDRMIKQAFSTQEPAAI
FT                   ILSPLLTKKSNTSQ"
FT   gene            625765..626373
FT                   /locus_tag="Bxe_B2499"
FT   CDS_pept        625765..626373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2499"
FT                   /product="Decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33492"
FT                   /db_xref="GOA:Q13QZ7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ7"
FT                   /protein_id="ABE33492.1"
FT                   /translation="MTSSEKNAVVRSAAKVMNRSDMTRRLVAKLKSGEAVIGGIGNNNF
FT                   DLWASGQRPQNFYMLGSMGLAIPIALGVATAQPHRQVVALEGDGSLLMQLGALGTVATR
FT                   APKNLLMVVWDNGVYQITGSQKTLTSGTVDLVAIARGAGIEQSAWAADEAHFDALVDSA
FT                   LAGNGPAFIAVHTDNAKPAGVTERDPAKIRLRFMEGIAV"
FT   gene            626395..627807
FT                   /locus_tag="Bxe_B2498"
FT   CDS_pept        626395..627807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2498"
FT                   /product="Putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33493"
FT                   /db_xref="GOA:Q13QZ6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ6"
FT                   /protein_id="ABE33493.1"
FT                   /translation="MSQLLIDGKWVDGESAQSLTDKYHGNEYGRMAVASAAQVTQAVDG
FT                   ALAGFRASTLSPYERFRILMEAARIVESRMPMLIDLMRDEAGFTHADGENEVRRCVQTF
FT                   ELSAEEGKHLAGELVPMEAAAGVRNRMGFTIRVPRGVVCAITPFNSPLNTLAHKVGPAI
FT                   AGGNAVVIKPSNVTPLSAVELCKVLIDAGLPANLLALVHGSGSAIGRQLLADPRIAFYA
FT                   FTGSTQVGREIQQAAGLRGMQLELGSIASTIVCEDADIDLAIPKIVNAGFRKAGQVCTS
FT                   VQRLFVARGIADEFIPRFVAAVKATPYGDPADPKTILGPMISVQHAQRAAAWVREALDG
FT                   GARLLTGGKCEGALFEPTVLHGVDATMKVVCQEVFAPVVSIIEFDDIGEAVAGANASDF
FT                   GLAAGLFTSDLKTAFRTARELAFGGVHINEASSARIDVMPFGGVKDSGFGREGPAYAIR
FT                   EMTEERLITVAY"
FT   gene            627807..629966
FT                   /locus_tag="Bxe_B2497"
FT   CDS_pept        627807..629966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2497"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2497"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33494"
FT                   /db_xref="GOA:Q13QZ5"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ5"
FT                   /protein_id="ABE33494.1"
FT                   /translation="MRRQASHRTDLEYNILSQSISTSNVLRIAVDIGGTFTDGVATLSP
FT                   LGRIWVGKTPTTPDDPGEAVSTVALNLLRQVTASMGASAPKLAEVVHGTTLITNTLIER
FT                   KGARTGLITTSGMRDALDIGREWRYDIYDLDIVLPTPLVPADLRVEVDERLDATGEVLT
FT                   PLDEAALDRMVNDLAALGVESVAVSLLHAYVNDGHEKRIEARLKEALPNLAVSISSDLA
FT                   REIKEFERTSTAVANAYVKPIVAEYLHELENRIARIQDGIPLRVMVSSGGFTSAKAGAE
FT                   SPILLLESGPAAGVLSALNTAYQNDVRQVLAFDMGGTTAKACVAVGGEAPVAHSFECAR
FT                   VERFKRGSGLPILIPSIELIEIGAGGGSIAYCNRLGLLNIGPESAGSVPGPACYARGGT
FT                   DATVTDADLLLGYLNPSNFLGGEMELDTGLARAAMQRLADRLGMAATDVAWGIYNMVNE
FT                   NMASAARIHIAENGHDPRDFAMVATGGAGPVHAVEVARKLRIPRVLIPIAAGAGSCLGM
FT                   LAAPARVDRAFSSPQLLADTDWPQVAFNLGKLRQEGEVELDSAGATDVEWRIGAEMRYY
FT                   GQGADVSVSIPYEAVTHATGAKVLASFEEQYEKLYGRLVPNARPQVVTWRLTGRARTAG
FT                   HHFEWGDDRVKTTDARRGTRQIYLPLRGEYHEVPVYDRYSVPPGRTLEGPLILEEREST
FT                   IVVAVRSDVTVLADLTTSVTIKEFE"
FT   gene            629967..631532
FT                   /locus_tag="Bxe_B2496"
FT   CDS_pept        629967..631532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2496"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33495"
FT                   /db_xref="GOA:Q13QZ4"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ4"
FT                   /protein_id="ABE33495.1"
FT                   /translation="MSQLSRTPAARASRFDPIELEILWKRLISVVDEASAAFVRTCFST
FT                   LVRDGNDFAIVLTDAQGRSLAQSTMSLPGFIGCLPATVRHFLEKYPAATMKEGDVYITN
FT                   DPWKGSGHIHDVTTVTPIFRDGELVAFAAVVSHLVDIGGKLRSNSSREIYEEGLQIPMM
FT                   KLLDQGKPNDVLIEMIMQNVRAPEQGMGDIWAQVSACRMMGERLQGLLDTVDLDALGAE
FT                   VRQRSENAMRDAIRKIPDGVYESVVLHDGFEKPIELKCRLTVTDDRIDIDYAGTSPQLA
FT                   RALNVVPIYTFAYTVYGIKTLLCPDIPNNEGSFVPITTTAPLGSLLNPTYPAASGGRSA
FT                   IGHLLPACVFRALGDVLPEKVWAAGSPNSSMTMSGEYRGKRFAVVNFLNAGQGANSRRD
FT                   GFSALSFPGNLGNTPVEMMESLAPIKVLRREIRRGSGGAGKHPGGCGISFEFELLPEAA
FT                   NVTASFLMTQLKSSPPGLAGGGAGQPGRLMINGQITDPTEPRVLNAGDRVLMETAGGGA
FT                   YGAA"
FT   gene            631581..631931
FT                   /locus_tag="Bxe_B2495"
FT   CDS_pept        631581..631931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2495"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33496"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ3"
FT                   /protein_id="ABE33496.1"
FT                   /translation="MNDIVRIDQNARRSRALIHNGLLYISGQVPDERKGGVADQTRQVL
FT                   AKIDDLLKEAGTSKDRLLSAQIWLKTMDDFAEMNAVWDAWVIPGKTPTRCCGKVELNDP
FT                   HCLVEIVAVAAC"
FT   gene            632198..633742
FT                   /locus_tag="Bxe_B2494"
FT   CDS_pept        632198..633742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2494"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2494"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33497"
FT                   /db_xref="GOA:Q13QZ2"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR004091"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ2"
FT                   /protein_id="ABE33497.1"
FT                   /translation="MLSRLSISARLWATVALLGILIVLTGLLGQLGMKRANDELAYAYS
FT                   NQLTASIAAGEANLSLTVARLSLDRALLHPDSPDVPDLIARTQRHLRDSDRAWRDYAAL
FT                   PHEGEERVLADRVNAARTALLQLGVQPSIEALAKGEHERADAIVMKTMSPLSLALTNSA
FT                   DALDTWQKAHGRQAFADAQRLHDRLSVAGLSLIVFGLVICVLCAYGLRRSISMPLVDIL
FT                   AALRRIAAGDLTMLLEVRSNDEMGQLIGGLKTMQGELARTVRQVTHGSETIAAATKQIA
FT                   AGNSDLSQRTEEQAAALQQTAASMEQLTATVKQNSDSARTAQTLADSAHEVVARGARVV
FT                   GDVVQTMGEIDRSSQKIADIIGVIEGIAFQTNILALNAAVEAARAGDQGRGFAVVAGEV
FT                   RSLAQRAGTAAKEIKALIGDSVTRVESGAKLVHTAGETMDEIRSSIARVTTIMKEIALA
FT                   SDEQREGIEQVSLAVSQMDEVSQQNAALVEQAAAAAASLDQQAEGLHSAVAVFRLV"
FT   gene            633747..634112
FT                   /locus_tag="Bxe_B2493"
FT   CDS_pept        633747..634112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33498"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ1"
FT                   /protein_id="ABE33498.1"
FT                   /translation="MMSWGCVIGCAADFSRLFQCPKHMKLVIIRHRLLPGAAETALARI
FT                   NVLSERMRTQPGYCFRHVGTEAGDESCITSVTAWATASDCAAWEAHLAASPLPKVERLY
FT                   SSVEHISVDADGTSPHG"
FT   gene            complement(634228..635271)
FT                   /locus_tag="Bxe_B2492"
FT   CDS_pept        complement(634228..635271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2492"
FT                   /product="Putative asparaginase/glutaminase"
FT                   /EC_number="3.5.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33499"
FT                   /db_xref="GOA:Q13QZ0"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ0"
FT                   /protein_id="ABE33499.1"
FT                   /translation="MLRERGVRFLMNTTVDGLRRSPHGVEAFSGGAALPADHVVLASGA
FT                   GAARLLKPIGIRAAIYPIKGYSLTFELQAQSTAPHVSITDSGRKVVYARLELLARNDVD
FT                   GVVVTHGTDTIEETSYFLHLTLKSAKPVVVVGSMRPPSAMSSDAALNLYDALAVAAHPS
FT                   SRGLGALVVANSEIHTARDVVKSNSFKLDAFRSPYGALGIVIEGTPRYYRRPARAHTLD
FT                   TPWSIDTLRTLPKVDIVYAYGALESSAVAAIAKNARGLVFAGTGNGNVAGHLIGPLRDA
FT                   ARRGVRVVRASRTGNGVVLHNAAQPDDEYGWLTVDDQAPLKARLLLTLALTQTDDTNAL
FT                   QAVFERY"
FT   gene            635621..635926
FT                   /locus_tag="Bxe_B2491"
FT   CDS_pept        635621..635926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33500"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY9"
FT                   /protein_id="ABE33500.1"
FT                   /translation="MTPLTFDQFKTQLESMLRDIPYGTSADLTGFAIAFWDGGKVVYAF
FT                   LSADGCGVIEDEFELTDYEWQHWQDDLAAWINEPMFSVRPEINKRAWTAPAGSGGR"
FT   gene            complement(635948..637612)
FT                   /locus_tag="Bxe_B2490"
FT   CDS_pept        complement(635948..637612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2490"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33501"
FT                   /db_xref="GOA:Q13QY8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY8"
FT                   /protein_id="ABE33501.1"
FT                   /translation="MRHRILATPVSSNLSLVAVRDRSRQIGELFGLDNLQRTRFITAVS
FT                   EIARNAVQFAGGGMLTFFVGDATDAGDTQCVVAQISDKGPGIARLDAVLADASHRPGAA
FT                   GVGILGSQRMADGFFVESQPGQGTIVTIEMFLPRGTARLSVRALGELVEQITHRKPQSP
FT                   VEELEKQNREMLLALEELRRKRAELEEADIRKNEFLAMLAHELRNPLAAISLSLELAAQ
FT                   ADRSRSGQAFAVIGRQTAQLSRMVEDLLDVSRLTRGKVELQTEVVRVDTLIEGGIEIAA
FT                   AEIRRRGHTVRVTCPPEQLSVRVDVARLKQVFNNIIHNAARYTPQPDTIDITVTNSHSE
FT                   VVVAITDRGIGIDPVILPHIFDLFTQAAGGIGRQEAGLGIGLTVVQRLVQDHGGSVEAF
FT                   SDGIGKGSKIVVTLPVAHEEMARDDAEIFVETAQTGVIHKVLVVDDNRDSADALAALLD
FT                   MHGHECRVAYDGASALELAEQFAATVGIVDLGLPDMPGFEVARALLERPRPAPLTLIAL
FT                   TGYSSAGFRASATQAGFHHFFVKPVSVDELLRYLENR"
FT   gene            complement(637614..638606)
FT                   /locus_tag="Bxe_B2489"
FT   CDS_pept        complement(637614..638606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2489"
FT                   /product="Anti-Sigma regulatory factor (Ser/Thr protein
FT                   kinase and phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33502"
FT                   /db_xref="GOA:Q13QY7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY7"
FT                   /protein_id="ABE33502.1"
FT                   /translation="METTLSLADKSGVAHARRRAVEMAQALGLPDRSQADAALVVTEAA
FT                   TNILKYAGHGEIVLKSTDDAGASSLDVIALDRGPGIANLGAACSDGFSTGGSLGAGLGT
FT                   IARHSAVFDIYSIQGCGTALFARVGEKAAAEHPRFLVGAKSTPKRGQDINGDAWSVRHA
FT                   GGNLWLTLLDGLGHGPLAAEASRRAVDVFMRADPAALPQEVLRDVHSGIKATRGAVMAI
FT                   ARFDPVNAILSFAGVGNIVGIVNAGETTQHLLSTDGTVGYNMRSVRPTEARWAPGSVFI
FT                   ATTDGLTTRWNLNRHPGLISRHPSLIASVLHRDFARDSDDATIVVVKAL"
FT   gene            complement(638591..638980)
FT                   /locus_tag="Bxe_B2488"
FT   CDS_pept        complement(638591..638980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2488"
FT                   /product="Putative Anti-Sigma regulatory factor (Ser/Thr
FT                   protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33503"
FT                   /db_xref="GOA:Q13QY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY6"
FT                   /protein_id="ABE33503.1"
FT                   /translation="MLEIRSADQVNLARKTVQDWATRLAFGTLDRTKFVTAASELARNT
FT                   LVHGRGGTLTISEIERDGRTGIKLVFEDTGPGIPDIEKALQDGFSTARSMGLGLGGARR
FT                   LVNEFEISSTVDVGTKVSIIQWKRR"
FT   gene            complement(639001..639372)
FT                   /locus_tag="Bxe_B2487"
FT   CDS_pept        complement(639001..639372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2487"
FT                   /product="Anti-Sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33504"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY5"
FT                   /protein_id="ABE33504.1"
FT                   /translation="MEQIPVLKLGEFLLVSIQVELHDELVLSLQDDLTSRIERTRAKGV
FT                   LIDISALEIVDSFIGRTLGHIAAMARVMDAATVLVGMRPAVAITLVELGMSLHGIRTAL
FT                   DVDKGMALLRKSLEEGGES"
FT   gene            complement(639374..640258)
FT                   /locus_tag="Bxe_B2486"
FT   CDS_pept        complement(639374..640258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2486"
FT                   /product="Anti-Sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33505"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY4"
FT                   /protein_id="ABE33505.1"
FT                   /translation="MKEWTLSEQNELATILEKDGDTVLNAWVAGQLSGGIRQGVISEAE
FT                   LRESARSFLAVFARAVKTNYNAQLAGETWDSVRTHLVSLSRERVIQGFSPVETAMFVFS
FT                   LKEPLFEALRKSLGKNPEAFGDALWKLTQTLDSLGLITIEAYQASRQQIIERQQQELLD
FT                   LTTPVVRLWDSVVALPLIGTLDSERTQVVMESLLDSIVENEAAIAIIDITGVPTVDTLV
FT                   AQHLLKTVAAARLMGAECIISGIRPQIAQTIVHLGVDLGDVVTKATLAEALKIALRRVG
FT                   MTVTKIATAKQGD"
FT   gene            640460..640816
FT                   /locus_tag="Bxe_B2485"
FT   CDS_pept        640460..640816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33506"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY3"
FT                   /protein_id="ABE33506.1"
FT                   /translation="MGIHCSAIAQGLPSAVASEDRISAAIDPWLTIAASEMPPVILLFR
FT                   PAFLEIGCAVTRIHLNRPWKGLHVPPLIWAAEVNFDPGSVALVLASDVYNEADYVRDYD
FT                   DYLALMKELTQKQV"
FT   gene            640821..642395
FT                   /locus_tag="Bxe_B2484"
FT   CDS_pept        640821..642395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33507"
FT                   /db_xref="GOA:Q13QY2"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY2"
FT                   /protein_id="ABE33507.1"
FT                   /translation="MDRVVRLTSEPKSETHRQRVGMVAAALFVVLVIVVLRLAVIGGYP
FT                   STDEGIYEYYALIIHDRLSQDLRLPNDGMLMLYPLLTSFVYSLKVNPIFALRLIDVVPD
FT                   ALAAVLMLRISVRLSGSLIASALITALFFLLLNHPTFIQYGFKNSFFIALCPLLYAVIL
FT                   FLSGQQAGPGRFFAMGVLVALGVLLRETLLLFAVLGAVSIFVERGTRALKYFVAGGLAT
FT                   GSLVLIVAIGLRGPGGVSSLISGYVDTGVGYGAFGDLRWKLFKSSGQLAAQAAVAGLVM
FT                   SLAATVCIVVASIRGRTKEYFKPFVFWAAAALIPLVEPLSKLGLPYHFSWSLIGLCSIT
FT                   SLGWRACRFSGRVQKLIGSGVCIGVSLLLVWSQLQFQRGLFWGLTYPAFKETHGKYWAE
FT                   ESIQRSNYLLMADQIKRIAPANATLSSSAAMLILYPLTGLRPPCYGVSNLTVTAVTLHF
FT                   NVEAMRRAIESCPADVVVVTRRDLPGSSTVVQAIRELPQYRRVGTVDVSTARDYGTSSA
FT                   ELFVLQR"
FT   gene            642948..644918
FT                   /locus_tag="Bxe_B2483"
FT   CDS_pept        642948..644918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33508"
FT                   /db_xref="InterPro:IPR021884"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY1"
FT                   /protein_id="ABE33508.1"
FT                   /translation="MNHIPRFAKRLSWLSAVFLIVLAAGCGGSSDNVSNGGDQPASAPG
FT                   GTQDTTRPAVSAAVPAPGATGVGVTTKIAVTFSKDMNPATISASSFTVSGPGATPIAGT
FT                   VNYTVGSRAAVFTSTNASLPAGTVLTATITTAAKDVSGNALQNNFVWTFTTAAAPDVTP
FT                   PTVSLSVPAAGATNAALNTHIAATFSEDMDPSTITATSFTLTGPGGAPVAGTVSYAAGA
FT                   KSAIFTPTSPAVLSAATAYTATITTAAKDLSGNALVSKFAWTFTTGTTTDTTPPSIVSA
FT                   NPANGVTGVCTNKSVNVTFSEAMDPSTLTGATFTVAASSTPATLLSGTVAYDVPSKVAT
FT                   FTTTSPLAANTSYTATVTTGVKDLAGNALALASVTTFTTNSSLCTTAPALGGAQPFGSF
FT                   GGNASVTNAGLNSVIHGDLGVNAASTKITGLTDSSGTHFTTTTSNNGLVTGLVYTLTAP
FT                   ANSVPGLAVTQASLDATTAFNSLSPASLPGGINVASLAQCPSCGGAGGGADELAGRTLP
FT                   PGVYLSSTGTFDIGGVGRTTANLTLDAGGDANAVWVFQTAAGTGTLNVGLTGPATPAVP
FT                   IQVLLVNGAQAKNVFWYVPAGAVIGTGSTMTGTMLANASITLSTVGGTPPTAVITTLNG
FT                   RAIALTAAVTMVNTVINLPSQ"
FT   gene            complement(645215..646384)
FT                   /locus_tag="Bxe_B2482"
FT   CDS_pept        complement(645215..646384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2482"
FT                   /product="Putative zinc-containing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2482"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33509"
FT                   /db_xref="GOA:Q13QY0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY0"
FT                   /protein_id="ABE33509.1"
FT                   /translation="MRALRWHGKHDIRCDTVPDPIIEEGRDAIIKVSTCAICGSDLHLF
FT                   DGFMPTMESGDIMGHEFMGEVVEVGKDNKALSVGDRVVIPFTIFCGECDQCKRGNFSVC
FT                   ERSNRNKEKADKVFGHATAGLFGYSHLTGGYAGGQAEYVRVPMADTTHVKIPDGLTDEQ
FT                   VLFLGDIFPTGWQAAVNCDIQPEDTVAIWGAGPVGQMAIRSAVLLGARQVVVIDRVPER
FT                   LVMARAGGAITINFDEESVLDRLKELTNGKGPEKCIDAVGMESHATRSFDAMYDRVKQA
FT                   VMLETDRPHVLREMIYVCRPAGILSVPGVYGGLIDKIPFGASMNKGLTWKMGQTHVNRW
FT                   TDDLLHRIQEGQIDPSFVITHTVSLEQGPDMYKTFRDKEDGCIKVVMKP"
FT   gene            646607..647581
FT                   /locus_tag="Bxe_B2481"
FT   CDS_pept        646607..647581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2481"
FT                   /product="Ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33510"
FT                   /db_xref="GOA:Q13QX9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX9"
FT                   /protein_id="ABE33510.1"
FT                   /translation="MQRTRRRLPHAVQMSRRTKVSRSIRPEAPARRRSGSIFHIAVEAV
FT                   SRFASDRCTTLAASISFYAAFSLAPTLLIVLTVTGWFFGEAAARGKLFAQVHDILGNDA
FT                   AGAMQAVVESAHRASGGGLAALLSIVLLVIGASATFSSLNTALDVVFAAKPKAGLAGLA
FT                   LLVRARLISFGLVLGVGFLLVVSLVLDTAITFVGQRLFGESPLVIAAQIAQTVFGIVVL
FT                   SAAFTAMLRWLPDTHVPFRHAMTGAIVSAVLFSVGRRLFGLYLAHAGTANSFGAAGSLA
FT                   VLMLWLYFSAAVFLLGAEVASAMDGERQTPDGKKPVTVGQPRN"
FT   gene            647706..648239
FT                   /locus_tag="Bxe_B2480"
FT   CDS_pept        647706..648239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33511"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX8"
FT                   /protein_id="ABE33511.1"
FT                   /translation="MQATKENQTDTRTGTTDALAFLEADHRAVEKLFTAFKKADDDLEA
FT                   KAALAQRACEELTIHAMLEEELLYPAAQEALPDSDKVDVEEAYVEHYLVKSLIAKFETL
FT                   KAGDKGFDATFKVMSEMVDHHVEEEEQELFPELRKSKCDLRTLGEKLAKRKAELQAKLD
FT                   AVGSRAVGDKTATL"
FT   gene            complement(648381..649067)
FT                   /locus_tag="Bxe_B2479"
FT   CDS_pept        complement(648381..649067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2479"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33512"
FT                   /db_xref="GOA:Q13QX7"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX7"
FT                   /protein_id="ABE33512.1"
FT                   /translation="MRSMQSKAVLVDLDGTMVDTAPDIVEAVSHMLDEFNAARLPFATV
FT                   SGFIGKGVPNLVRRSLEAAGLDRRVDVDHALNVFHRHYVQTNGRLGRVFPHVEAGLAEL
FT                   QRRGYRLACVTNKPEELAARLLLMTGLARYLDVLVAGDSIARMKPDPEPLWHACRLLDV
FT                   EPENSVLVGDSPVDVSAARAAGLPVFIVRYGYAGPHGSAALACDGLIDSLMAMPAILES
FT                   RGARAG"
FT   gene            complement(649093..649857)
FT                   /locus_tag="Bxe_B2478"
FT   CDS_pept        complement(649093..649857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2478"
FT                   /product="HAD-superfamily hydrolase, subfamily IA,
FT                   variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33513"
FT                   /db_xref="GOA:Q13QX6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX6"
FT                   /protein_id="ABE33513.1"
FT                   /translation="MQALIFDVDGTLADTETAHLQAFNAAFAEVGLDWFWDEPLYTRLL
FT                   KVAGGKERLRHYWHVADLEEADGTRINDVIDAVHAIKTRHYAARVSNGGLPLRPGIARL
FT                   IAEAQAAAIPVAIATTTTPANLDALLQTPFGPAWRTRFAAICDAGTTHVKKPSPDVYLD
FT                   VLRQLGLKGPDCVAFEDSANGLRAARAAGVPTIVTPTAYTSQDDFDGALAVLPHLGEPH
FT                   APIPSSVPDERAGWVDLATLRQWHRHASAALA"
FT   gene            complement(650005..650427)
FT                   /locus_tag="Bxe_B2477"
FT   CDS_pept        complement(650005..650427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2477"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33514"
FT                   /db_xref="GOA:Q13QX5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX5"
FT                   /protein_id="ABE33514.1"
FT                   /translation="MAMTPFSDDEDSGLMNEINMTPLVDVMLVLLIIFLVTIPAMQHAV
FT                   KIDLPQASSQPDNVKPAHLDVAVRADGSILWDGHPVADDVLRARIAEAARAKPQPELHL
FT                   RADRKVPYERVADVMSAAQAGGLTKIGFVTDPRAKK"
FT   gene            complement(650418..651206)
FT                   /locus_tag="Bxe_B2476"
FT   CDS_pept        complement(650418..651206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2476"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33515"
FT                   /db_xref="GOA:Q13QX4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX4"
FT                   /protein_id="ABE33515.1"
FT                   /translation="MQHYGLANVWESGDIVTRCILGTLLIMSVLSWTVILVKLWTIVRI
FT                   RRVTRQAEAQFWRADRFEDGLKSLGAEASKSVRDNPLLALALAGEEAAAHHRQTQSHLH
FT                   DRIDVSDWITRRLQDTMDDAIARMQSGLAVLASIGSTAPFVGLFGTVWGIYHALILIGE
FT                   TGQTSIDHVAGPVGESLIMTAFGLFVAIPAVLGYNGLTRANKSVVTRLKRFAHGLHAYF
FT                   VTGSQLPSSTGPDMRIVPRAVPAANGKANDATNDGALKWQ"
FT   gene            complement(651234..651926)
FT                   /locus_tag="Bxe_B2475"
FT   CDS_pept        complement(651234..651926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2475"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33516"
FT                   /db_xref="GOA:Q13QX3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX3"
FT                   /protein_id="ABE33516.1"
FT                   /translation="MALGAVVAAHVGLLAWVSATLDRTVERTVEAPAIVAMLLRNEPET
FT                   AAPITPVARAVPAPAAVVAAPQAAQPPARSKLAPPRLKAPRSSVAPAPGAPGAPDVPAT
FT                   PSPSRDAARSPEPTAPAVAAAPSPAAPATNAPATPKSVAHVDCDIPKPDYPDISKRRSE
FT                   SGTAIVRFVVGLSGHIETAQLQKSSGYPRLDDAALSAVHAGACQPYRENGEAVRAAYSE
FT                   SFVFGLTE"
FT   gene            652196..653290
FT                   /locus_tag="Bxe_B2474"
FT   CDS_pept        652196..653290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2474"
FT                   /product="WD-40 repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33517"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX2"
FT                   /protein_id="ABE33517.1"
FT                   /translation="MLETRFRNTTPTRSLAFAVATLATAATAFALAASTAYAAAPMAYV
FT                   TSEKAGVGVIDLDQMTLTKTFPVGADGPRGLSLNTDGTRLLVANKNTGDLAVIDTASGQ
FT                   VVQRVKIGKNPEYVRVHNGFAYVTYEPGEDGGPPAANAKPGADDDDANKPPAQIAIVDM
FT                   KTWRVIRSVTSGHETEGIEFSRDGNMMLVTNEGDDTVSVYHVRTGAPVRTVKLVAGGRP
FT                   RGIRLSPDGKDYVVTLESLSKFVVIDARTYQVTKTVDTKLGPYGVAFGPDGKRLFVAAA
FT                   RDRTVQVFDGHSYEHLADVPVGQRCWHFSFTPDGAKLLVACGRSDAVYVLDAQSYQPIK
FT                   QIGELPLAWGIVTYPHSDGSIESH"
FT   gene            complement(653377..655743)
FT                   /locus_tag="Bxe_B2473"
FT   CDS_pept        complement(653377..655743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2473"
FT                   /product="Putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33518"
FT                   /db_xref="GOA:Q13QX1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX1"
FT                   /protein_id="ABE33518.1"
FT                   /translation="MNMPLSAHRASRLPDLPRLRRRAGLTLCFGSALASLSVPVWAQAE
FT                   TATPAAAASSAAPAGASPDADTVKLAPIVVVGTTPLLGIGTPLSQVPANVQTVHAQDLE
FT                   QQHRSTLTDYFAKNLPSVDIADAQGNPYQVNLNYRGFTASPLLGTPQGLSVFVDGVRVN
FT                   EPFGDVVNWDLLPQQAIDTIQLIPGSNPTYGLNTLGGALAITTKNGKTSPGGEAEVQVG
FT                   SWGRKTAQIEQGGTIGQNLDYYVTGSMANDNGWAEQNASRVRQAFGKLRYTDADTTLSF
FT                   SAGGADNDLHGTQTIPRSFLGNPKQPYTYPDQNLNTAAYATLSGDHYFNDHVELSGNVY
FT                   YRHFRNDNVSSNTNSDFGSVDDDGNVDTTQATNEKSIVSTDSYGASLQLTLLGKLGGME
FT                   NQFVAGVSADIANSRYTQSSQDAVFTASRATIGIGDFEQETAAKTHNGNYGIYLQDTLS
FT                   LTKQWTLTLAGRYNWADATIGDSSGTQPQLDGHHTFSRFNPAVGINWNPTSAFTAYATY
FT                   NEGMRSPTAIELACADPSAPCSLPNDFVSDPSLQPVISKTFEIGARGRIGQATTWSAAA
FT                   YSTTLDNDIEFISTNGATSNQGFFQNVGRTRRQGVELSGHSQFGPLAVTASYSYVDATY
FT                   RSSWTESSPSNSSADQNGNITVKPGDHIPSIPANTVKLQLDYAATAKWNVGTNLTWRGS
FT                   VYAQGDENNQDVNGKIAGYLLIDLDTSYQVTKQLQVFASVTNLLDKRYASFGALGENFF
FT                   NGANHTFDGANPINEQFVGPGAPRGFWVGLRYAWK"
FT   gene            655948..656958
FT                   /locus_tag="Bxe_B2472"
FT   CDS_pept        655948..656958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2472"
FT                   /product="Periplasmic Sensor signal transduction Histidine
FT                   Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33519"
FT                   /db_xref="GOA:Q13QX0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX0"
FT                   /protein_id="ABE33519.1"
FT                   /translation="MASDPSNPSSARPVPPHSTVRRDLAWVLALTVLAAVLSARFDFSE
FT                   HAYRWTRGLERFQLDELPGTLCVLSIGLAWFAWRRYREARRELIRRCALEEQAERLLAE
FT                   NRRLANQALQAQELERRHLARELHDELGQYLNAISLDAARIRDLSSAREPEVHRVSLGL
FT                   IQSASHVYRQIGGMIRRLRPIGLDEFGLPSALEHCVDGWRERLPDASFSLTIEGDFTGL
FT                   SDALTITLYRLVQEGLTNVSKFARTARVEVFMVRAPREARERQDGRLVDEIVVTMADDG
FT                   PGADLDKPRGGLGLIGMRERVEALGGEFHVASRPEGGFLFCARVPAHAGLAEPVN"
FT   gene            complement(656928..657590)
FT                   /locus_tag="Bxe_B2471"
FT   CDS_pept        complement(656928..657590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2471"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2471"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33520"
FT                   /db_xref="GOA:Q13QW9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW9"
FT                   /protein_id="ABE33520.1"
FT                   /translation="MTAGDISVLLVDDHAVVREGYRRLLELNADVHVCGEAADAAQAYQ
FT                   RFCALRPDVVVMDVSLPGASGIEAMRRMLAREPDARVLIFSVHEEAIFVRRALDAGALG
FT                   YVTKASAPDVLVEAVRTIARRAGYLSPDISQALALRNAFSEGPPGRQLSAREFEVLRLL
FT                   VQGYTLPSIAEKLGLSQKTVANHQSVIRQKFGADNGVQLAQMASRLGLQFTGSASPA"
FT   gene            complement(657593..658816)
FT                   /gene="pqqE"
FT                   /locus_tag="Bxe_B2470"
FT   CDS_pept        complement(657593..658816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="Bxe_B2470"
FT                   /product="Pyrroloquinoline quinone synthesis E"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2470"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33521"
FT                   /db_xref="GOA:Q13QW8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW8"
FT                   /protein_id="ABE33521.1"
FT                   /translation="MTDLSQPGGAAQPQATPDGVAPPLWLLAELTYRCPLHCAFCYNPV
FT                   DYTDHSRELSTEQWIGVLREARALGAAQLGFSGGEPLVRDDLEVLVGEARKLGFYTNLI
FT                   TSGVGLTDRRLGDLKAAGLDHIQLSFQDSTQELNDFLSSTRTFDLKQRVAASIKRHGFP
FT                   MVLNCVLHRYNLPHVDKIIDMALAMGAEYLELANTQYYGWAHQNEAQLMPTREQLEEAE
FT                   AVVERYRRTQGERCKIFFVVPDYFERRPKRCMNGWGAVFLGVAPDGAALPCHAARSLPG
FT                   LVLPNVKETPLREIWYESDAFNRFRGLAWMKEPCRSCDEKERDLGGCRCQAYLLTGDAA
FT                   NADPVCDKSPAHDTVVSVVNMARRAAAAGEAREQPILFRNDTNSRKLASALSTAASGDT
FT                   CGHGGTGG"
FT   gene            complement(658821..659111)
FT                   /gene="pqqD"
FT                   /locus_tag="Bxe_B2469"
FT   CDS_pept        complement(658821..659111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqD"
FT                   /locus_tag="Bxe_B2469"
FT                   /product="Pyrroloquinoline quinone synthesis D"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33522"
FT                   /db_xref="GOA:Q13QW7"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW7"
FT                   /protein_id="ABE33522.1"
FT                   /translation="MNDLPRAGGATQTADRPTISKLFRLQWEPAQNAHVLLYPEGMVKL
FT                   NQSAAEILKRCDGTRDMNTLIADLEQAFSTTGLGPDVRAFVADAQLRGWLE"
FT   gene            complement(659108..659860)
FT                   /gene="pqqC"
FT                   /locus_tag="Bxe_B2468"
FT   CDS_pept        complement(659108..659860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqC"
FT                   /locus_tag="Bxe_B2468"
FT                   /product="Pyrroloquinoline quinone synthesis C"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33523"
FT                   /db_xref="GOA:Q13QW6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW6"
FT                   /protein_id="ABE33523.1"
FT                   /translation="MNAKDTLGTAPRQNAQTNGGDERPAWTREEFEAQLRAKGAAYHIH
FT                   HPFNVKMNSGGCSREQIRGWVANRFYYQINIPLKDAAVLSNCPDRETRRRWVLRILDHD
FT                   GCGDEEGGIETWARLGDAVGLSRDDLWSLKQVAPGVRFAVDAYVNFARRAPWQESVCSS
FT                   LTEMFAPQVHRDRLASWPEHYPWIESSGLAYFRSRISLAQRDVEHGLAVTLDHFTRREQ
FT                   QERALEILQFKLDILWTMLDSIEKAFPQ"
FT   gene            complement(659943..660863)
FT                   /gene="pqqB"
FT                   /locus_tag="Bxe_B2467"
FT   CDS_pept        complement(659943..660863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqB"
FT                   /locus_tag="Bxe_B2467"
FT                   /product="Pyrroloquinoline quinone biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33524"
FT                   /db_xref="GOA:Q13QW5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW5"
FT                   /protein_id="ABE33524.1"
FT                   /translation="MKIKVLGSSAGGGFPQWNCNCRNCDGVRRGTIKATRRTQSSIAVS
FT                   ANGEDWLLVNASPDLLAQIAANPELQPARRARDSGIAAVLVIDAQIDHVTGLLMLRERD
FT                   TPLPLYATNAVWQDLCSGFPVAPILSHYCGVEHRRIALDGAPLAIDALGGVQIDALPLS
FT                   SKAPPYSPHRNAPERGDNIGLVITNRQTGKRVFYAPGLGAIEAHVLAAMREADLLLVDG
FT                   TLWTADEMIRLELSKKTAADMGHLQQSGPGGMIEVLDSLGAHNARKVLIHINNTNPILV
FT                   EDGPERRILTEHGIEVAYDGMTFEI"
FT   gene            complement(660860..661900)
FT                   /locus_tag="Bxe_B2466"
FT   CDS_pept        complement(660860..661900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2466"
FT                   /product="prolyl aminopeptidase, Serine peptidase, MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33525"
FT                   /db_xref="GOA:Q13QW4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW4"
FT                   /protein_id="ABE33525.1"
FT                   /translation="MMRHASKSGSRPGARQASPQAPLTVDALRTRDGHRVSFSVAGAAD
FT                   GVPVVVLHGGPGSGSQPGALGLFDLTRFRVVLIDQRGTGASTPHGSVRHNRTDRLIEDI
FT                   EAIRVRLGVERWGVLGGSWGAALALAYAGRHPQSVTGVVMRGLFLTSSREVRGLFVTAR
FT                   KRAPRAWSQLCAAAQCDRPAALLARCHARLQRGANANQAQQHALALAWRGYENAVLASA
FT                   TSRRSRSPTRSSRQDTRKLIGKYRIQAHYLMHRCWLGETRLLSLARGAAAAGVPLAAVH
FT                   GSRDPVCPPDNLRRLARAVSAARVEYVRAGHLASDPKLHERVAAALAMMFLPTAHDEGR
FT                   VLRRAA"
FT   gene            complement(661897..662463)
FT                   /locus_tag="Bxe_B2465"
FT   CDS_pept        complement(661897..662463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2465"
FT                   /product="Putative cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33526"
FT                   /db_xref="GOA:Q13QW3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW3"
FT                   /protein_id="ABE33526.1"
FT                   /translation="MTMAHSSHLTPGAEAPAPRYAGVMIALHWLIALCIIGLLALGLYM
FT                   VGLPKGLPLKAALLNLHKSVGLTVFLLVLLRIMARAAFNRPPLPPMRPWQRAAARTTQG
FT                   LLYVAMVAMPVCGYLGSSFNRYGTRFWGVPLPKWGWDDAGLRELFFGLHQAIGYALIAL
FT                   IALHVAGALKHQLIDRDNLLARMLP"
FT   gene            complement(662540..663385)
FT                   /gene="fhcC"
FT                   /locus_tag="Bxe_B2464"
FT   CDS_pept        complement(662540..663385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcC"
FT                   /locus_tag="Bxe_B2464"
FT                   /product="formylmethanofuran dehydrogenase, subunit C"
FT                   /EC_number="1.2.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33527"
FT                   /db_xref="GOA:Q13QW2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW2"
FT                   /protein_id="ABE33527.1"
FT                   /translation="MSQRTTLRVKTPPGFRVDASSLLPMPLAAMSVADIEGMVLPAGND
FT                   RCIVGDIFDVSRHEAADVPEAPHAGATLVVENAEPWLDRIGARMTDGHLVVHGSTGDYS
FT                   GFQMAGGRLHIEGDAGHFTACEMRGGRLTVTGHSGDFAAGALAGDMEGMTGGTLTIHGN
FT                   AGARLADRMRRGLVLVGGNAGDFAASRLVAGTVGIAGQLGAHYAYGMRRGTLLLAQQPA
FT                   HLPPTFTEGGRGFDVFWALLVRSLATEIAPFSQWRAASLPTRHAGDLAVDGRGEILVVS
FT                   "
FT   gene            complement(663382..664341)
FT                   /gene="fhcD"
FT                   /locus_tag="Bxe_B2463"
FT   CDS_pept        complement(663382..664341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcD"
FT                   /locus_tag="Bxe_B2463"
FT                   /product="formylmethanofuran-tetrahydromethanopterin
FT                   formyltransferase"
FT                   /EC_number="2.3.1.101"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33528"
FT                   /db_xref="GOA:Q13QW1"
FT                   /db_xref="InterPro:IPR002770"
FT                   /db_xref="InterPro:IPR014053"
FT                   /db_xref="InterPro:IPR022667"
FT                   /db_xref="InterPro:IPR023447"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW1"
FT                   /protein_id="ABE33528.1"
FT                   /translation="MSEPATLQINGTTIDATFAEAFPMKATRLVITAHTPAWAMHAANS
FT                   LTGFATSVIGCGCEAGVERMLPAGQTPDGRPGVTVLLFAVSSKELAKQIERRVGQCVLT
FT                   CPTTAVYGGIDAGTSRAPLSDRAPLGSALRFFGDGWQISKMLGDTRYWRVPVMDGEFVC
FT                   EDTALTVKAVGGGNLILLARDIDAALAAAEAAVAAMRRLPNVIMPFPGGVVRSGSKVGS
FT                   KYKGASASTNDAFCPTLTGLSARSELGAEVGCVLEIVIDGLTDTDVGAAMTAGIGAAAE
FT                   SGRAAGLLRISAGNYGGKLGPYHFYLHSLAAGLDGSRA"
FT   gene            complement(664362..666062)
FT                   /gene="fhcA"
FT                   /locus_tag="Bxe_B2462"
FT   CDS_pept        complement(664362..666062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcA"
FT                   /locus_tag="Bxe_B2462"
FT                   /product="formylmethanofuran dehydrogenase, subunit A"
FT                   /EC_number="1.2.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33529"
FT                   /db_xref="GOA:Q13QW0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW0"
FT                   /protein_id="ABE33529.1"
FT                   /translation="MSLIRLKGGTLFDPTHGVNGERRDLAIRDGRIVEVPAATPADHEY
FT                   DATGMIVMAGGIDMHSHIGGGKTNLSRLLLPEDHRDDRVRDAAYESVQDANGRYLRLPS
FT                   CGVCTPGTLATGYRYAEMGYTAAFEPAMMPSNARHTHLEMGDTPIIDHGAYVMLGNDEL
FT                   FLQMLAARDDFERLRDYIGWTIHASKALGVKVVNPGGISAFKFNQRSLNVDEPHVHYGI
FT                   TPREVLHTLSRALTELRVPHPLHVHASNLGVPGNIDSTIATMDAAGGLPIHLTHIQFHS
FT                   YGTEGPQKFSSGARQIAEAVNARPNVSIDVGQIIFGQTVTASGDTMMQFRNTPLARPHK
FT                   WVIGDIECDAGCGVVPFRYREQSYVNALQWIIGLEIFLLIDDPWRVAMTTDHPNGGPFT
FT                   SYPHLIRLLMDKSFRDEQLAKLNADAQVASALPQLQREFSLYEIAIITRAGPARLLGLR
FT                   DRGHLGVGAAADIAVYRDDADRERMFTSPAYVFKDGELVARDGTLVATPTGGIHFVSPD
FT                   FDRGIEKTLRAYSDANLANNFAHAAIGDDEICHCCRGGRLLPVECLSNG"
FT   gene            complement(666059..667459)
FT                   /gene="fhcB"
FT                   /locus_tag="Bxe_B2461"
FT   CDS_pept        complement(666059..667459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcB"
FT                   /locus_tag="Bxe_B2461"
FT                   /product="formylmethanofuran dehydrogenase, subunit B"
FT                   /EC_number="1.2.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33530"
FT                   /db_xref="GOA:Q13QV9"
FT                   /db_xref="InterPro:IPR016457"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV9"
FT                   /protein_id="ABE33530.1"
FT                   /translation="MELAKSAAMHLSSIDPSSTSPSAANSAPASPVTRDWICPFCPLLC
FT                   DDLVVESREDATLAVPDTECPRLAQALACYGSADAQCGNSVDGHDADLDTALASAARIL
FT                   SSARRPLFGALTTDVAGTRALYTLAAGCGAILDHLHGDAMSAATLPLQDRGSFFTTLSE
FT                   VRSRADLLVFFGCRPSQRYPRFFARTLEGTQQQRELVFVGCAPDPAASGLANTRIEALL
FT                   PDADPFDTLALWSALSEGREPGALQDDGTGAAEALAELQARIAAAHYTVLVYEPAALPG
FT                   PHAALLIEALNRIVKAANRTVRAGCLALGGDDGALTVNQTVTWLSGLPLRTRVSTPARI
FT                   AGTAPLDYDPYRYRTARLLAEGEIDALLWVASFAPPAWPQALAEDVPAIVLGHPALAQA
FT                   AKSRGGATVFIPVATPGIDSGGHLFRVDGSVVLPLAAARGAALPSVAAIASQLAERLHA
FT                   QPAAQVQP"
FT   gene            complement(667722..668492)
FT                   /gene="orf17"
FT                   /locus_tag="Bxe_B2460"
FT   CDS_pept        complement(667722..668492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf17"
FT                   /locus_tag="Bxe_B2460"
FT                   /product="putative phosphoribosylformimino-5-aminoimidazole
FT                   carboxamideribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="Required for methylotrophy"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33531"
FT                   /db_xref="GOA:Q13QV8"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV8"
FT                   /protein_id="ABE33531.1"
FT                   /translation="MQVIPVLDLLDGHVVRAVRGERTAYRPIRSLLAAGSEPLHIARAL
FT                   LAASGARTLYIADLGAILQQGAHVETLAALRAALPGTVIWLDAGYADYTAMHALFERIE
FT                   AACKRNSSSQPTPYDPHAPHDLASLVPVFGTESLRDIDALRTAEAAGLSPILSLDHRAG
FT                   QLVTATAFERTSAWWPRSVIAMTLDQVGSYDGPDLATIERIRATAPAHTAVIGAGGIRH
FT                   RDDVAAAARSGASAWLVASALHDRQIGAPLIEST"
FT   gene            668507..669562
FT                   /locus_tag="Bxe_B2459"
FT   CDS_pept        668507..669562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2459"
FT                   /product="Conserved hypothetical protein (orf1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33532"
FT                   /db_xref="GOA:Q13QV7"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR024710"
FT                   /db_xref="InterPro:IPR040803"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV7"
FT                   /protein_id="ABE33532.1"
FT                   /translation="MTKIFVYEYLTGGGIDPAHAGAASLADLSALIVEGRVMRDALVSE
FT                   LRELDGVDVSFASSRFETVDPALAHCRAAQGESMTAFVARVAREHDYAWVIAPECDGLL
FT                   LQLYDAVGAARWLGCAKEAIRVASSKSATAALLAAQGVATTPAIEPGQSDVQRGERWVV
FT                   KPDDGAGGLDTFVFDSFADACAEYDARAAAARNPVLQAWVDGEPLSLSLICRADGVELI
FT                   SINRQQISLSANDTSQRQPRIVEFDGVTVNQIDLAGDQGRLLGALAQRVAKAMPGLRGF
FT                   VGIDVVWHPQRGPVVIEVNPRLTVAYAGLSAGARGGDLARTLLAAHGVRVGRSGPAARS
FT                   RGAQSACGARP"
FT   gene            669559..670692
FT                   /gene="orf9"
FT                   /locus_tag="Bxe_B2458"
FT   CDS_pept        669559..670692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf9"
FT                   /locus_tag="Bxe_B2458"
FT                   /product="tetrahydromethanopterin biosynthesis protein,
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33533"
FT                   /db_xref="GOA:Q13QV6"
FT                   /db_xref="InterPro:IPR002756"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV6"
FT                   /protein_id="ABE33533.1"
FT                   /translation="MSTAHVTHASSATLDSGPVFGWDVGGAHVKVSMADASGVVLDIAQ
FT                   WACPLWQGLDHLERTIDLVFERWPLAHTGAAQHAVTMTGEMVDLFEDRAQGVRAIAAAL
FT                   AERLGPRLCFYAGDAGWLTAQACAAGWRSVASANWLATARWVATRVPDALLIDIGSTTT
FT                   DIIPLAGGRVVARAATDAGRLATGELVYQGVVRTPLCGVAQRIEFAGTAVNVMNEWFAT
FT                   TADVYRLTGELAPQYDLYPCADQGPKTENASRTRLARMIGRDAHETDPAEWRRFALRWR
FT                   ELQLREIGVNLARVTAAHPELATAPLVGAGCGRFLAAALAREEARGYIDFGTLASVPAS
FT                   RSDWAATCAPSVAVALLAAARGGEAADENRSAASRAA"
FT   gene            670818..671408
FT                   /gene="orf21"
FT                   /locus_tag="Bxe_B2457"
FT   CDS_pept        670818..671408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf21"
FT                   /locus_tag="Bxe_B2457"
FT                   /product="tetrahydromethanopterin biosynthesis protein,
FT                   putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33534"
FT                   /db_xref="GOA:Q13QV5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV5"
FT                   /protein_id="ABE33534.1"
FT                   /translation="MWVVKIGGSLSHEPTLRHWLTELCEVGGGRVVIVPGGGDFADKVR
FT                   QYQSEWRFDDLAAHNMCLLAMTQYAILMQGVLPELVLASSEAKIRRALRDGHVAVWVPT
FT                   ALMRDTPDAMSNWDTTSDSLAAWLSTMLNAERLIVVKSCPIAEDERLETLAASGVVDRC
FT                   FVDYVNEANYVVELFNKDNVALMRDRLLNTPVS"
FT   gene            complement(671485..672228)
FT                   /gene="orf22"
FT                   /locus_tag="Bxe_B2456"
FT   CDS_pept        complement(671485..672228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf22"
FT                   /locus_tag="Bxe_B2456"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33535"
FT                   /db_xref="GOA:Q13QV4"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV4"
FT                   /protein_id="ABE33535.1"
FT                   /translation="MTALLASVRSDEEAFDAAQAGAELIDLKEPNAGALGGLSIGDITQ
FT                   IARRLRAHYPVKPISATIGDVPADALDEITTRVIEVSDAGIDYVKVGVTPGPAARRCLE
FT                   QLANLPAAVVPVLLCDGGMDGELVAYAATLDFVGVMFDTAGKDGSTLFDHVDSDTLAQW
FT                   LRITRERGAMSGIAGSLGWAQFEQIRALAPDVAGFRTALCVDGRRSRLDPQRVAQWAAA
FT                   LHRPSGEVSGAVAAADTRASGTARF"
FT   gene            complement(672255..672854)
FT                   /gene="orf19"
FT                   /locus_tag="Bxe_B2455"
FT   CDS_pept        complement(672255..672854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf19"
FT                   /locus_tag="Bxe_B2455"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33536"
FT                   /db_xref="GOA:Q13QV3"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV3"
FT                   /protein_id="ABE33536.1"
FT                   /translation="MIHETIVTTAACDGRPHIAPMGARYEGDFVILSPFRPSVTLDNIV
FT                   ASRAAVLNFTTDVRIFAGCVTHCATDWPTLAASRVASVRLAESLAHAELELDDLRDDKE
FT                   RPVLRMKCVHRENHAPFGGFNRAQAAVVEGAILVSRLFMLPADKVDREMAYLQIAIDKT
FT                   AGEAELTAWHWLTAAIARHRENLAASGGPAAELVSH"
FT   gene            673033..673431
FT                   /locus_tag="Bxe_B2454"
FT   CDS_pept        673033..673431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2454"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33537"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV2"
FT                   /protein_id="ABE33537.1"
FT                   /translation="MFPPGIDTALRRRPGVMPDFIGVGYYASSMPDVRRHGVGSAPARR
FT                   NTAFAELRRRGHRARGTMRLHRALFRECSKVFHDGQRLPLLSRNACNSYANHSLPIASA
FT                   CVENFASWPAFSRSAFSVIDNGSVKSAK"
FT   gene            673526..675025
FT                   /locus_tag="Bxe_B2453"
FT   CDS_pept        673526..675025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2453"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33538"
FT                   /db_xref="GOA:Q13QV1"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13QV1"
FT                   /protein_id="ABE33538.1"
FT                   /translation="MNDFSQPVIDSIHKPRDAANPRERYAAGVMKYREMGYWQPDYAPK
FT                   DTDVIALFRITPQPGVDPEEAAAAVAGESSTATWTVVWTDRLTACDIYRAKAYRVDPVP
FT                   ASNAAEPQYFAYIAYELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKT
FT                   FQGPPTGIVVERERLDKYGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENI
FT                   NSQAFMHWRDRFLFAMEAVNRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIV
FT                   MIDLVIGWTAIQSMARWARRNDMILHLHRAGHSTYTRQRNHGISFRVIAKWLRMAGVDH
FT                   AHAGTAVGKLEGDPLSVQGYYNVCRESHNEVDLSRGIFFDQPWAGLRKVMPVASGGIHA
FT                   GQMHQLLDLFGDDAILQFGGGTIGHPAGIQAGAVANRVALEAMVKARNEGRDIVHEGPD
FT                   ILEAAARWCTPLKQALDTWRDVTFNYASTDTPDFAATPTAA"
FT   gene            675134..675562
FT                   /locus_tag="Bxe_B2452"
FT   CDS_pept        675134..675562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2452"
FT                   /product="ribulose 1,5-bisphosphate carboxylase small
FT                   subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33539"
FT                   /db_xref="GOA:Q13QV0"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV0"
FT                   /protein_id="ABE33539.1"
FT                   /translation="MRITQGTFSFLPELTDEEIRLQIDYALSQGWACSVEYTDDPHPRN
FT                   TYWEMWGLPMFDLRDAAGVLQEVKACRAAQPQHYIKVNAFDSVRGFETMRLSFIVNRPD
FT                   EEPGFRLTRQDGPGRVQRYGLSGYAGDRPSGERYGPAR"
FT   gene            675618..676667
FT                   /locus_tag="Bxe_B2451"
FT   CDS_pept        675618..676667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2451"
FT                   /product="CbbX-like protein, putative AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33540"
FT                   /db_xref="GOA:Q13QU9"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU9"
FT                   /protein_id="ABE33540.1"
FT                   /translation="MTEAAAIDANALCSDGRDAAALQDSQDSRAQAPQVDLAALYRDSG
FT                   IGDVLAELDRDLVGLAPVKTRIREIAAHLLVERARDSLGLAGGAPTLHMCFSGNPGTGK
FT                   TTVALRMAEVLHRLGYIRRNHLVSVTRDDLVGQYIGHTAPKTRDVLKRAMGGVLFIDEA
FT                   YYLYRPENERDYGQEAIEILLQTMENQRDDLVVILAGYAARMEVFFESNPGFRSRIAHH
FT                   ITFPDYDGAELLDIAERMLATMHYRFDADSRRAFADYLALRTRQANFANARSVRNALDR
FT                   SRLRQANRLFATAMQGGAPIDAAALTLIAAADVRASRVFTESEALAANAGAPASSHATA
FT                   TRAVTAPPG"
FT   gene            676694..677830
FT                   /locus_tag="Bxe_B2450"
FT   CDS_pept        676694..677830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2450"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33541"
FT                   /db_xref="GOA:Q13QU8"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13QU8"
FT                   /protein_id="ABE33541.1"
FT                   /translation="MQDGRTTLSKFLIDTLDRQPCSTETARNAGLSALLIDVAAAIKSI
FT                   SAMLTKGALGGNYGSAQSINTHGEEQKKLDVATNEIFVQQCEWDGLLAAMVSEEMESVY
FT                   AIPPGYPRGDYLLAFDPLDGSSNIDINGVVGSIFSVLRNGEGNGNANEKNGSDPRGTVG
FT                   ESAFLRPGCEQVAAGYAVYGPSTMLVLSVGNGTHGFTLEREIGNFVLTHSNIRIPEDTV
FT                   EFAINASNERFWEPPVRRYVQECKDGRSGCRASDFNMRWIASMVAEVHRILMRGGVFMY
FT                   PRDSKTPAMEGRLRLLYEANPMSFLVEQAGGLSITGRERILDVVPRALHGRVPVILGSK
FT                   HEVERIGRYHGEYDRGEDQPFTSPLFSRRSLFLPGFTA"
FT   gene            677895..678767
FT                   /locus_tag="Bxe_B2449"
FT   CDS_pept        677895..678767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2449"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33542"
FT                   /db_xref="GOA:Q13QU7"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU7"
FT                   /protein_id="ABE33542.1"
FT                   /translation="MSVKHPIIAVTGSSGAGTTTVMKSFTHIFRREKINAQIVEGDAFH
FT                   RYDRNGMREAMKQHERDGAPNFSHFGPEANLLEDLETLFASYGENGTGRLRHYVHDEGE
FT                   TRLYKQDAGTFTPWEEVTPDTDLMFYEGLHGAAVTDDIDIARHADLLIGVVPIINLEWI
FT                   QKLHRDQTMRGYSHEAVVDTILRRMPDYVNYICPQFSRTHVNFQRVPTVDTSNPFIARE
FT                   IPQPDESFVVIRFARPKGIDFQYLLTMLHDSFMSRPNVIVVPGGKMGLAMQLIFTPMIL
FT                   QLIDRRARA"
FT   gene            678814..680856
FT                   /locus_tag="Bxe_B2448"
FT   CDS_pept        678814..680856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2448"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33543"
FT                   /db_xref="GOA:Q13QU6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU6"
FT                   /protein_id="ABE33543.1"
FT                   /translation="MSAVAESVAIPATRLMADALRMLAIDAVEAAKSGHPGMPLGMAEI
FT                   AVALWDRHLKHNPRNPAWPDRDRFVLSNGHGAMLLYGLLHLTGYDLPIDELRRFRQLYS
FT                   RTPGHPEVGVTPGVETTTGPLGQGLANAVGMALAEALLAREFNRPGHSIVDHRTYVFVG
FT                   DGCMMEGISHEAASLAGTLKLDKLTVLYDDNGISIDGHVSQWFSDDTPARFAAYGWHVV
FT                   REVDGHDVDAVDRALSRARAAGRPTLICCRTVIGKGSPSKAGTHDVHGAPLGADEVANT
FT                   RRALGWPHAPFAMPAEVRTLWDASERGAATEADWNTRFEAYRKHYPHEAAEFERRTQRT
FT                   LPVQWRDTVRAMVSDADHAGESIATRKASQQAIAVLARALPELLGGSADLTGSNLTNWK
FT                   TAVDVHADDSGLQGGNYLHFGVREFGMSAVMNGIALHRGHIPFGGTFLTFSDYSRSALR
FT                   MAALMKTRAIFVFTHDSIGLGEDGPTHQSVEHAASLRLIPGLDVWRPCDTVETAQAWAS
FT                   AVERDGPSCLLLSRQNLPFAARSAEQIDAIERGGYVLRDWPAERAQTRIVLIATGSEVS
FT                   LALDAVAPLAQAGIAARVVSMPSTSVFDRQPAAWRDAVLPPRVPRVAVEAGVRAFWRQY
FT                   VGLEGGVVGIDTFGESAPAAALFEHFGLTARAVVDEARRVAQLAR"
FT   gene            680916..681953
FT                   /locus_tag="Bxe_B2447"
FT   CDS_pept        680916..681953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2447"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33544"
FT                   /db_xref="GOA:Q13QU5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU5"
FT                   /protein_id="ABE33544.1"
FT                   /translation="MAFIALRQLLDHAAEHGYGVPAFNVNNMEQIHAIMQAAEATSSPV
FT                   ILQASAGARKYAGEPYLRHLVLAALEAHPDIPLVLHQDHGASPAVCQQAIRSGFTSVMM
FT                   DGSLLPDQKTPAAYEYNVDVSRRVVEAAHAVGVSVEGELGCLGSLETGTAGDEDGVGAE
FT                   GQLSRDDLLTDPREAQIFVEATGVDALAIAIGTSHGAYKFSRQPTGDILAIDRIVEIHE
FT                   RIPNTHLVMHGSSSVPQEWLAVIREYGGEIPTTYGVPVEEIQRGIAHGVRKVNIDTDIR
FT                   LAMSGAMRKSMANARAEFDPRAALKAATAAASAICVERFEAFGCAGQASRIKPLPLDAM
FT                   ARRYH"
FT   gene            681983..682702
FT                   /locus_tag="Bxe_B2446"
FT   CDS_pept        681983..682702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2446"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33545"
FT                   /db_xref="GOA:Q13QU4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU4"
FT                   /protein_id="ABE33545.1"
FT                   /translation="MRDFLIAPSLLSADFARLADEIRDVTAAGADWIHLDVMDNHYVPN
FT                   LTVGPLVCAAIRPHTSVPIDVHLMTMPVDSLVAGFAEAGANTISFHPEASLHVHRTIEL
FT                   IKSSGARAGLALNPATPLAVLDHVIERLDVVLVMSVNPGFGGQAFIPETLDKLRALRER
FT                   VDATMQRTGRLLLIEVDGGVKAANIARIAASGADVFVAGSAVFGADDYAQAIGEMRDEL
FT                   ERVSDESEGAGVLAVVR"
FT   gene            complement(682764..683690)
FT                   /locus_tag="Bxe_B2445"
FT   CDS_pept        complement(682764..683690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2445"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33546"
FT                   /db_xref="GOA:Q13QU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU3"
FT                   /protein_id="ABE33546.1"
FT                   /translation="MLLYSVGVLFSVSGARYVVATIIHHGVHGHLTRKPIVNQALCEVL
FT                   STLLIVQPYESYRRFHVYEHHGRDFSTLNDKDLAAIYKLGFTPGKSKGALYRNLVITLL
FT                   NPAFHLTFFWGRLKSNLVSVRLYRLCMSVLWLISLAVFAAHFGTLFFVAIVVVPYVVVY
FT                   QAASLLHLLTEHVWLLRLPPESVRESHVRNSLGRFCGSACPAGWGIVHLVPWLKWSIAH
FT                   LFFHLPCRMLIVQGSLVCHDWHHRFGSTRQWHDYAALREADAVKLVAEGRYDYTEIWGF
FT                   DHCLDHVFERLSASDAVHVGNLNYRLN"
FT   gene            complement(683951..684262)
FT                   /locus_tag="Bxe_B2444"
FT   CDS_pept        complement(683951..684262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2444"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33547"
FT                   /db_xref="GOA:Q13QU2"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU2"
FT                   /protein_id="ABE33547.1"
FT                   /translation="MSWWLILTLAAVVFFNRYVFLEPKVPVKLPRLLSNALEYSAPCLL
FT                   TAICAPIILMDKGLLRSFPGNPYFLGAAFSVVFALVIRSVVLSVVMSLAVFYLLARFL"
FT   gene            complement(684259..684999)
FT                   /locus_tag="Bxe_B2443"
FT   CDS_pept        complement(684259..684999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2443"
FT                   /product="Putative branched-chain amino acid exporter,
FT                   LIV-E family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33548"
FT                   /db_xref="GOA:Q13QU1"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU1"
FT                   /protein_id="ABE33548.1"
FT                   /translation="MTRNKNTLECASGAHERDLAHGGAFLGALNMLPLCLSVLPWGILA
FT                   GSMAVQSGLTLWQSIGMSAIVFAGAAQLVTLGLHMSGASALTIIVSVFLITAQHFLYGL
FT                   NLRGYVSTLRKRHRLPIGFLLTDELFALSSASKIKSQLTPGYLIGAGLAFYLSWNLFSL
FT                   LGIFTAASVPDLSRYHLDFSIVATFAAIVIPMIRKISVLSGVLFSLLTSMLLSYFHVGG
FT                   AIVIAGVSGMFFSSFVARLRKEAP"
FT   gene            complement(685146..685982)
FT                   /locus_tag="Bxe_B2442"
FT   CDS_pept        complement(685146..685982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2442"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33549"
FT                   /db_xref="GOA:Q13QU0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU0"
FT                   /protein_id="ABE33549.1"
FT                   /translation="METREQAKFFHLDEFSGLSLLQASYHRQRFARHVHETFCIGVIEE
FT                   GVQRFYRTGGEHVAPKGDIILVNADEIHTGSPGVETGWAYRAIYPHPDLMLLLSRDLIN
FT                   ANGTVPWFPEAVVHDPGLAEQFRLVFNLLTRDGDRLLKESLLLSSIASLVMRHGRTPAF
FT                   ARELPSVGQPLRIIKDLIASCPEEDYSLTQLAEMAHLSPWHFLRQFKKQVGLPPHAWLI
FT                   QARLKRARQLLRRGLPIPVVAARCRFSDQSHFNRHFKSSFGITPGEFIRTLPSLSA"
FT   gene            complement(686188..687570)
FT                   /gene="orf20"
FT                   /locus_tag="Bxe_B2441"
FT   CDS_pept        complement(686188..687570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf20"
FT                   /locus_tag="Bxe_B2441"
FT                   /product="tetrahydromethanopterin biosynthesis protein"
FT                   /function="Putativedihydropterin-
FT                   ribofuranosylaminobenzene- 5-phosphatesynthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33550"
FT                   /db_xref="GOA:Q13QT9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT9"
FT                   /protein_id="ABE33550.1"
FT                   /translation="MDHIVFLTGRLAEKSLLRVLESMAPTPFTWEIREIGLQVAALMTA
FT                   DLIRRRVPAPLAAQRVIVPGRCRGDLAALTEHYGVPFERGPEEVKDLPQFFGREAQPFD
FT                   LTRYETDIFAEIIDAPRLDLDGIAARAREYAAQGADVIDIGCLPETPFPHLEDAVRLLK
FT                   DEGYRVSVDSMSGDELLRGGRAGADYLLSLNLDTLWIADEVPSTPVLVAREPGDPASLD
FT                   AAIDLLAARGRAFLADPILDPIPFGLAASIARYVRLRERYPDVAIMMGIGNVTELTEAD
FT                   TSGINAVLLGIAAELRVSAVLTTSVSLHARRAVREADVARRVMHAAREAQVLPKGIDSD
FT                   LATVHAKRPFPYSAAEIDEFARDIRDPNFRVQISTDGIHVYNRDGHRKGHDPFALYPAL
FT                   HLEADGGHAFYMGVQLARAEIAWRLGKRFDQDQPLDWGCALDRNEQDLMVWREPGETRK
FT                   KG"
FT   gene            complement(687649..688227)
FT                   /locus_tag="Bxe_B2440"
FT   CDS_pept        complement(687649..688227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2440"
FT                   /product="Putative dihydromethanopterin reductase (afpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33551"
FT                   /db_xref="GOA:Q13QT8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="PDB:3WIS"
FT                   /db_xref="PDB:4MWG"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT8"
FT                   /protein_id="ABE33551.1"
FT                   /translation="MTQAPARNLADFKPDARFAWCVTGSGHLLDESIALALELPRADLF
FT                   LSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAK
FT                   CAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVTQSPNEWVELRPRAIELDNVERL
FT                   SRFEYTTLVRSLDELKAALGERLSTLDLA"
FT   gene            complement(688224..690101)
FT                   /locus_tag="Bxe_B2439"
FT   CDS_pept        complement(688224..690101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2439"
FT                   /product="Sigma54 specific transcriptional regulator with
FT                   GAF sensor, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33552"
FT                   /db_xref="GOA:Q13QT7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT7"
FT                   /protein_id="ABE33552.1"
FT                   /translation="MGDLIACSKLEMTTLYQQLADPELAVVLVDAGGMIVHQVSSVPFA
FT                   EAVAADGFRVGALWSEREAGTNGMGTCLAERDCIAVCQHEHFYPRYTSLTCSAAPIFDD
FT                   RGEIAGVLDVTSRSKLLQQHSLVLVGMSRQMIENRLLDARYRHANMIHFHSRPEFVGTL
FT                   HGGKLAVADDSTVLAANRSALFQLGFRTLGELRGRRIEEAFNASLEDMIARSIRGSFHP
FT                   VTVYSANATNRFFLVAQTPQNSAERGTRVAITAPGARASAADKRPAPARLDEIAHLEFG
FT                   DPRMASQIQLAARVVQRKIPIILRGQTGTGKEVFAQALHSISPHAAGPFVPVNCASLPE
FT                   NLIESELFGYRAGAFTGAQREGRRGKIVQANGGTLFLDEIGDMPLSLQARLLRVIEEHE
FT                   VTPLGAETTIKVDFQLISASHRNLLELVHGGQFREDLYYRLKGVELNLPPLSERIDKLA
FT                   LIHHLLENESDNDPPELTPEAEHALLTYAWPGNIRQLRHVLQMAIALCDGQPIRCEDLP
FT                   AEITQRGPETGLLAVSRTAAADFEPHPADEADLSSLNAIQLNERGTVLTLLDEHRWNVS
FT                   NVAKALSISRNTLYRKMRRLHIRLSHDGSAPDGLPPDDSPSEESPPFSA"
FT   gene            690844..691263
FT                   /locus_tag="Bxe_B2438"
FT   CDS_pept        690844..691263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2438"
FT                   /product="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33553"
FT                   /db_xref="GOA:Q13QT6"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT6"
FT                   /protein_id="ABE33553.1"
FT                   /translation="MDIVFIENFVGQTIIGIDSSEQHVLQPVRMNLAIGVPSIRACTTD
FT                   RIEDTINYAAVRSALHALLASHGVRLLEALAEAVARLLITDFGAHWVRVALAKPAKFDD
FT                   VSAVGVQIERQRSDMQQAAAGLADYASLGAGLIPN"
FT   gene            complement(691332..691739)
FT                   /locus_tag="Bxe_B2437"
FT   CDS_pept        complement(691332..691739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2437"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33554"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT5"
FT                   /protein_id="ABE33554.1"
FT                   /translation="MTIRCRALAACACFALATTLAWADGDAPTAPAPAGGYNYPTQGRV
FT                   EYVLSCMDDNGHDFVNVYKCSCVIDKMATALSYDDFVAQSTFSKYATLGGEGGSEFRVD
FT                   HAKAQTKKFRTLQTQAYHSCGLGPDKTASAK"
FT   gene            complement(691827..692336)
FT                   /gene="fae"
FT                   /locus_tag="Bxe_B2436"
FT   CDS_pept        complement(691827..692336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fae"
FT                   /locus_tag="Bxe_B2436"
FT                   /product="Formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33555"
FT                   /db_xref="GOA:Q13QT4"
FT                   /db_xref="InterPro:IPR014826"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR037075"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT4"
FT                   /protein_id="ABE33555.1"
FT                   /translation="MAKINRVLIGESLVGDGNEVAHIDLLIGPRGSAAETAFCNALTNN
FT                   KDGFTSLLAVIAPNLLTKPNTILFNKVTIKGAKQAVQMFGPAQHAVALAVADSVEDGTI
FT                   PKDEADDLFLCVGVFIHWQADDDKKIQEFNYKATREAIQRAVAGEPSAAEVVAKKGSVA
FT                   HPFAPN"
FT   gene            complement(692438..693376)
FT                   /gene="orf7"
FT                   /locus_tag="Bxe_B2435"
FT   CDS_pept        complement(692438..693376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf7"
FT                   /locus_tag="Bxe_B2435"
FT                   /product="putative triphosphoribosyl-dephospho-CoA
FT                   synthetase"
FT                   /note="Required for methylotrophy"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33556"
FT                   /db_xref="GOA:Q13QT3"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT3"
FT                   /protein_id="ABE33556.1"
FT                   /translation="MAEPHGCVAFEQVHAAFLAACRLDVETPKPGNVSVQSEGHGMRAA
FT                   QFIASSEVTVDALLTRGAPVGQRVLDAVTRTRDAAGCNTNLGILLLVAPLAAALEDSAR
FT                   PLSADAWRVATERVLKRLDIDDARLAYRAIALANPGGLGEAPEQPVHSAPTVNLRDAMT
FT                   LAAARDSIARQYAEGFRDVFETGLAAFREMPANQPRSATLNVFLTFLANWPDSHIVRKQ
FT                   GIAVAQSVTLAARERHAQWRHALAQNRLDEAAQPLDAWDAELKASAINPGTSADLTVAT
FT                   LFVAGCLAPACNAGPIPPRTREPRTGTDPVS"
FT   gene            complement(693369..694403)
FT                   /gene="orf5"
FT                   /locus_tag="Bxe_B2434"
FT   CDS_pept        complement(693369..694403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf5"
FT                   /locus_tag="Bxe_B2434"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33557"
FT                   /db_xref="GOA:Q13QT2"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT2"
FT                   /protein_id="ABE33557.1"
FT                   /translation="MSFPVPGAEPADSRATLRIAIMTDETGWHTGRLKKAFRARGAQAR
FT                   CIDLADCRIDTTWEPHGLVLPGFGHTLPDAVFVRGIAGGTFEQVTLRLGILHALRESGV
FT                   PVYNDARAIERSVDKSMTSFLLHRNGVPTPATWAGESAAFAQRVLMREAAAGRQVVLKP
FT                   LFGSQGHGLKRLGAGGAHPGALAPLPSLKAYRQVAYLQRYIEGGRPGFDWRVLVIGGRA
FT                   VAAMRRVGGKGWIHNFAQGAACEAAELDLPLAQTAVRATEALGLDYAGVDLIPDPRDAA
FT                   RPLVLEVNGVAAWRGLQSVTSIDIAAALADDLLLRKLPAQRRALSESAETREAAVVALH
FT                   GRHG"
FT   gene            complement(694400..695431)
FT                   /gene="mch"
FT                   /locus_tag="Bxe_B2433"
FT   CDS_pept        complement(694400..695431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mch"
FT                   /locus_tag="Bxe_B2433"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="Function confirmed by biochemical assay; Citation: J
FT                   Bacteriol, 186:2173-2178"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33558"
FT                   /db_xref="GOA:Q13QT1"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT1"
FT                   /protein_id="ABE33558.1"
FT                   /translation="MPSSNATPDAPRPPLAGAAALSVNALSERLVSRLVDDAARFGAAV
FT                   SHAQNGTVLVDAGVMAPGSVAAGVLIARICMGGLGHVTVRENLDAQPLWPSMIEVRTSW
FT                   PVLACLGSQYAGWSLSATKEQTGGKKFFSLGSGPARALAVKEPLFAELGYRDTHERGVL
FT                   VLEVDRLPPQVVIDKVLHDCGLAPERLTLVTTPTHSVAGTVQVVARVVEVALHKTHVLG
FT                   VALDEVVEGGGSAPLPPPAPDGIQAMGRTNDAILYGGRVHLTVKHDAVARRLAAELPAS
FT                   TSRDYGRPFADIFTSFNYDFYQIDPALFAPAEVWVSSLESGATYHGGRVDTALLHDQWS
FT                   GKP"
FT   gene            complement(695406..696614)
FT                   /gene="orfY"
FT                   /locus_tag="Bxe_B2432"
FT   CDS_pept        complement(695406..696614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfY"
FT                   /locus_tag="Bxe_B2432"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Required for methylotrophy"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33559"
FT                   /db_xref="GOA:Q13QT0"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016677"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT0"
FT                   /protein_id="ABE33559.1"
FT                   /translation="MKPRPSLPSAPFVAVAGLSARMLAQSAARAGLRVAALDVFGDRDT
FT                   REASELWFDIGGGPLSIDAERLVAALERTARLPGLIGWIDGSGLEPFVARLCGMPRLPR
FT                   FIGNPVEASAAVREPRRFFALLDALEIAHPPVVFAPPAVAHGWLVKRADGCGGTHIEPA
FT                   AAFGDPRIPAQIYFQRRRGGRSLSALFIAAFGHARVLGFAEQLTCEMGNLPFVHAGSIG
FT                   PIDLPLTVQARVHAAIAALCAQTRLTGINSCDFLLDGDAFELLEINTRPSSTMTLYETA
FT                   SPHAWPRGLLACHIEACRLGRLPAAPTPAAAPWRAGQQVLFAPHPFTVSQSFSDACLHD
FT                   PRCRDVPMPGTRIETGQPVCTLLVRAASVDAVRYALDAQRAFVLQRIDTCHEPDYAFIQ
FT                   CHS"
FT   gene            complement(696694..697635)
FT                   /gene="mtdB"
FT                   /locus_tag="Bxe_B2431"
FT   CDS_pept        complement(696694..697635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtdB"
FT                   /locus_tag="Bxe_B2431"
FT                   /product="Methylene-tetrahydromethanopterin
FT                   dehydrogenase(NAD+/NADP+) (mtdB)"
FT                   /EC_number="1.5.1.-"
FT                   /note="Function confirmed by biochemical assay &
FT                   mutantanalysis; Citation: J Bacteriol, 186:2173-2178"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33560"
FT                   /db_xref="GOA:Q13QS9"
FT                   /db_xref="InterPro:IPR015259"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037089"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS9"
FT                   /protein_id="ABE33560.1"
FT                   /translation="MSDTTEKPAERPYILHMFTATPQMSPFDVNMAADAGYQIIVPYCG
FT                   VEAGMVANLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLDSARKAMVPPFEVSVFAD
FT                   PSGSYTTAAALVALVERHLAKAFGMELGGKRVLILGGTGAVGRVAAAMAASLGADVSIA
FT                   SHTDQARAAHVSDDINRRFGIVTKGVSTATPADLRAALGEAEIVLATAIAGVQVVRTDD
FT                   LAHARHLLIAADVNAVPPEGIAGVNVMNDGKPIEGAPTAGGAIGIGALAIGNVKYQVEH
FT                   RLFIRMRTGGKPVYLGFPQAFDEARAVAAGLG"
FT   gene            complement(697759..698787)
FT                   /gene="mptG"
FT                   /locus_tag="Bxe_B2430"
FT   CDS_pept        complement(697759..698787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mptG"
FT                   /locus_tag="Bxe_B2430"
FT                   /product="beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33561"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS8"
FT                   /protein_id="ABE33561.1"
FT                   /translation="MQLHVRRLPPQATVTVDAPARLHLGFLDPNASLGRAFGSLGLVID
FT                   GAGTRVEARLAERDRIDGAVTEAERERIAICLERLHAAYDPTPVAIEVVRTPRAHSGLG
FT                   SGTQLSLAVGSAFVRLLGHVATSAELASLLGRGARSGIGVLGFDSGGLLVDGGPAGGLH
FT                   PGVPPLLARQPFPESWRVLLVSDNAREGLHGAEERRGLAALAPFPQQLAAHLCHLVLMK
FT                   ILPGAAERNIVPFAHGLTEMQQTIGEYFAPVQGGVFASPDVERALRAVAAERTAGIGQT
FT                   SWGPTGFAIVADAREAEAALATARAATRGLPHIECTVVAGRNRGATVRSAEARQPQRID
FT                   AA"
FT   gene            complement(698936..699334)
FT                   /gene="pcbD"
FT                   /locus_tag="Bxe_B2429"
FT   CDS_pept        complement(698936..699334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcbD"
FT                   /locus_tag="Bxe_B2429"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33562"
FT                   /db_xref="GOA:Q13QS7"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS7"
FT                   /protein_id="ABE33562.1"
FT                   /translation="MANAERVYSDEEIQQRLVGPLQHWYLEEGWLRRKYRTEGWKGTLM
FT                   VVNAVGHLAEAAWHHPDLTVSYAFVTVKLKTHSAKGITDKDFALASKIESFIQWQPATE
FT                   GGPLEGTPTDDQRFRYIKYDKPKDPGSD"
FT   gene            699388..699711
FT                   /locus_tag="Bxe_B2428"
FT   CDS_pept        699388..699711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2428"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33563"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS6"
FT                   /protein_id="ABE33563.1"
FT                   /translation="MTGQSGARAAGAGVLLLPAARRTRFVPASDTVCPTCRGAAVTVVT
FT                   RTRRVPRRAARAGELLSVNDAHGGSIPAWNMRWPSCAIKPGNDRETALIVTRIRGGAPD
FT                   ATR"
FT   gene            699757..701574
FT                   /locus_tag="Bxe_B2427"
FT   CDS_pept        699757..701574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2427"
FT                   /product="Methanol dehydrogenase-like protein (xoxF)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33564"
FT                   /db_xref="GOA:Q13QS5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS5"
FT                   /protein_id="ABE33564.1"
FT                   /translation="MNLRTTVLGLAILASAALSSFVAQADSQLDGLMKNPSNWAAQAGD
FT                   YANHRYSPLKQINENNVGKLQVAWTMSTGVLRGHEGAPLVIGDTMYIHSPFPNKVIAIN
FT                   LKDQTFIWQYLPKQDDQVVSVMCCDTVNRGLAYGDGKIFLQQADTKLVALNAKTGDVVW
FT                   TAQNGNPKAGETNTNAPHVFGDKVLTGISGGEFGVRGRLIAYDIKTGKPAWTAYSTGPD
FT                   KDMLIDPDKTTTYADGKMVPVGADSSLKSWKGDQWKLGGGTTWGWYAWDPKLNLVYYGT
FT                   GNPGTWNPTQRPGDNKWSMSIFARDLNTGQARWVYQMTPHDEWDYDGVNEMILSDLSID
FT                   GKKVPAIVHFDRNGFGYTLNRETGQLLVAQKFDPAVNWADHVDMKSGKPIRNAAYSTQA
FT                   AGSDHNVKGICPAALGSKDQQPAAYDPGSSLFLVPTNHVCMDYEPFDVDYVSGQPYVGA
FT                   TLSMYPGPNDNNSMGNFIAWDASKGKIVWSKPERFSVWSGVLATAGGVAFYGTLEGYIK
FT                   AVRIKDGKELWRFKTPSGIIGNVFTYEYQGKQFIGVYSGIGGWAGIGMAAGLEKSTEGL
FT                   GAVGGYRELAKYTALGGTLFVFAIPGGNS"
FT   gene            701756..702175
FT                   /locus_tag="Bxe_B2426"
FT   CDS_pept        701756..702175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2426"
FT                   /product="Putative methanol dehydrogenase-like protein,
FT                   cytochrome cL (xoxG)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33565"
FT                   /db_xref="GOA:Q13QS4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS4"
FT                   /protein_id="ABE33565.1"
FT                   /translation="MKGRSILLRAALPAVFVVLPAAFAQTNPAIAQVAYKVVDGSKVDP
FT                   NTLQGWKTWRALACERCHGAQQQGMVGPSLVDAFKTLDKTEFHRTVFGGRVDKGMPDFS
FT                   SSQMMQKNWENLYAYLKGRSDGQIKPGDLQAIDSK"
FT   gene            702206..703117
FT                   /locus_tag="Bxe_B2425"
FT   CDS_pept        702206..703117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2425"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33566"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS3"
FT                   /protein_id="ABE33566.1"
FT                   /translation="MRHGKRMPTHVAIVTAALCYAAIASGAVRAQGEAMPNNDGADGVL
FT                   RVCADPNNMPLSNNKGEGYENRIASQMASDFGYKLEYTYFPQRMGFVRHTLREKVPDTE
FT                   RYKCDLIIGVPKGYDMTSTTQPYLRSTYAMVFTKRPELAGINTPDDLLKLPPDQLHKLR
FT                   FGIFTQTPAVDWLLSHDLIDQAVSYQVQSGDPQEYPGQMIEKDLQAGNVDVVFLWGPIA
FT                   GYFAKRSGDTVKLVPFPATPGIRFDYTISMGVRYGEKAWKDKVDQWIGANHDKIDNILT
FT                   SYEVPLLKPVDTPAGKPADGSP"
FT   gene            703183..703887
FT                   /locus_tag="Bxe_B2424"
FT   CDS_pept        703183..703887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33567"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS2"
FT                   /protein_id="ABE33567.1"
FT                   /translation="MCATHSAAFAAGADEISAAERLIFTTDHLHGIQQQTELDYAFLST
FT                   DQPAHSTDVVKVLVVSPDNAKGDAQVSDHSGAVPLPNAGLQCNPVIIYFLERDIAEMEH
FT                   LTGGQRRYFQQRLRLALAAGPKIETVTSQVGGKPVKARQIVVQPYLGDPNSERFAQYIG
FT                   KRYTFLIADTVPGEVALIRTDVPGANNDFAHPLQTQTLSFQAALRKLPPPPNAPNAPNV
FT                   PLKPSDAPRASR"
FT   gene            703903..704865
FT                   /locus_tag="Bxe_B2423"
FT   CDS_pept        703903..704865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2423"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33568"
FT                   /db_xref="GOA:Q13QS1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS1"
FT                   /protein_id="ABE33568.1"
FT                   /translation="MNFIRSLTLRQLQIFVVASRYTSFARAAEELHLTQPAVSMQIHQL
FT                   EEAVGLRLFERIARKLALTEAGEMLSHHASRILGEIKDAEDAMTSLKQADSGSIAVGIV
FT                   SSATYFAPKLLAMYSHLYPKVDVHFSVGNRDALLRLLQDNAIDLAIMGRPPPELDTTTE
FT                   PLAWHPQVVIAPLDHPLCGARRFDLQELRGDTFLLREPGSGTRMAAEEMFRQHLFTPAK
FT                   VVTLGSNETIKQAVMAGMGVSLISLHTLLLELRTKEIALLDVNGTPIERTWQVVHLRAK
FT                   QLSPTCSAFRQFLLEQAAAYLEREYAAFVTLPAKSGVLK"
FT   gene            704862..705458
FT                   /locus_tag="Bxe_B2422"
FT   CDS_pept        704862..705458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2422"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33569"
FT                   /db_xref="InterPro:IPR021698"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS0"
FT                   /protein_id="ABE33569.1"
FT                   /translation="MNRAGGEVRGGYVRYGRYVGPIGMICVAFACSQALGAPTSIAVMD
FT                   CVLIDDNAAYNDAGTNRIQQARIGMVSEALREQLRESQRYRVADNAAAAGLIAQLGASQ
FT                   DLNACADCARQVGRKLGVEQIGLCWVQKVSNLILNINLHVEDVGSGATVFQRSVDIRGN
FT                   TDLSWRRGAAALAGLLAGGTAAGSAASSTERGASP"
FT   gene            705668..706687
FT                   /locus_tag="Bxe_B2421"
FT   CDS_pept        705668..706687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2421"
FT                   /product="Putative MxaR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33570"
FT                   /db_xref="GOA:Q13QR9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR9"
FT                   /protein_id="ABE33570.1"
FT                   /translation="MGAGELLQDWRVHALRIEDEVSRVVIGQPQTIRLITVALFARGHV
FT                   LLEGGVGVGKTTVLRAFARVVGGEFERVEGTIDLMPGDLVYHTYVDAEGRPRIDPGPLL
FT                   RHGERLTTFFFNEINRARPQVQSLLLRAMAERSVWAFDREYRFPHMTVFADRNKVEKEE
FT                   TFELASAARDRFLFELGMPTPTEPDVRRSLVFDAAFHDVDSLLARLPPAIVQWEQLNQV
FT                   GAAIQESVQSSETIERYVLDIWQATETPQRFGIALDGVDMDRLILAGASPRGMSALLRA
FT                   ARVVAWLAGRSHLVPEDIHAVLMPALGHRVFFTPIYELRRQELAEALMTQIMNRLAVP"
FT   gene            706691..707560
FT                   /locus_tag="Bxe_B2420"
FT   CDS_pept        706691..707560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2420"
FT                   /product="Putative MxaS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33571"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR8"
FT                   /protein_id="ABE33571.1"
FT                   /translation="MNGTAEFHYRLPMRAGGFRPGSHPGSSFGAGQEFAMHGRLFDYPD
FT                   PRRLDLRASVRAARSEWLVRVHLQRAAVPVQVIVDVSASMHFGKRRTKSQVAADFVEAL
FT                   GYSAFRVGDPLGMLAFDTRARDDLFMPARYGRGVGNLLATMLRESESASDAAGSGGIAG
FT                   LQRAASALAGRQALIFLVSDFHWPLAALPAVLDLLVHACVVPIVVWDAAEIAPPNGGSL
FT                   LAVNDAESARQRTLWLRGSVRERWREAVARRRAELANVFGKRGIQPFYVESAFDPEAMS
FT                   RYFLETIA"
FT   gene            707557..708516
FT                   /locus_tag="Bxe_B2418a"
FT   CDS_pept        707557..708516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2418a"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2418a"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33572"
FT                   /db_xref="GOA:Q13QR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR7"
FT                   /protein_id="ABE33572.1"
FT                   /translation="MRPDGRGVGRSGRSLCEASGATRFVSALALTLTLVLALAPAISVA
FT                   AGSGDVLQPTVQEPRAFGHLLGDIVTQRILLRAGDNDVGSVAPPSIGRTGAWLERRPAR
FT                   IETDAEGRRWMAIDYQIVNVAPTLTRIALPALTLTSASGATLQVAEWPLSIGPITSADA
FT                   FEAGDLQRMRPDRQAPLMPTAPLRRQAAFALGLLLLTLLSWAGWWLWRNWRESARLPFA
FT                   RAWRQMRRLDGPNADMSADAWLCLHRALNETAGHVVHAGSLPSLFARAPYLQPLHAQLE
FT                   QFYQQSGERFFTPAPALAPYPLRGLCRALYRAEQRHQR"
FT   gene            708513..709499
FT                   /locus_tag="Bxe_B2418"
FT   CDS_pept        708513..709499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2418"
FT                   /product="Putative MxaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33573"
FT                   /db_xref="GOA:Q13QR6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR6"
FT                   /protein_id="ABE33573.1"
FT                   /translation="MNTVFDFAYPWLLVLLPLAALPLLRRRGDALAFSWVAWLPDDRIG
FT                   QWIGLIGRGSAVLAMVAIVFGLAGPGRSQRQVLRTGSGAQILILMDRSASMDETMNSKG
FT                   VESPAGESKNKVARASLTNFVAQRPNDRLAFMMFGTSPVLAMPFTYDHRAIAAAIAGTA
FT                   VGRGMPDTQLDRGLLAAIGEFNGRASSGRRAIVLVSDGGARLDTQVRRLIQDGLTRNQI
FT                   ALYFIYLRSGTYSPDLNAAVPANESSAEAELHRYFLSLKTPYRLFQAGNARAMKDAMAE
FT                   INRQQNARTSFVERLPRQDLSPYCFAVALSACVLLLTLRLLQVRVWS"
FT   gene            709496..710137
FT                   /locus_tag="Bxe_B2417"
FT   CDS_pept        709496..710137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2417"
FT                   /product="Putative MxaK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33574"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR5"
FT                   /protein_id="ABE33574.1"
FT                   /translation="MKRTSIHVIFAAVALCCTGVAAYDWARLRHAQHVNQAVAAAAAET
FT                   GKAAAKSGAAGAPRNEHGERGNGNGNGNGNGNGNGNGNGDFREVRLARAIALSNAGAYD
FT                   AAGPLFEDLIRDDHLDEIGRAALFDLGNMYLRESLGNNPSGTVQSVAMIEEAKARYRTL
FT                   LRAAPDDWDARYNLERALWLAPETHASNDSPEVKSQHNVKVSDPQSKDLP"
FT   gene            710134..711087
FT                   /locus_tag="Bxe_B2416"
FT   CDS_pept        710134..711087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2416"
FT                   /product="Putative MxaL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33575"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR4"
FT                   /protein_id="ABE33575.1"
FT                   /translation="MSFREWTRGFSRGRHWATPAALLLLIAAVAMPRVVLPRNTFSYIV
FT                   TFDITQSMDVEDVALNGVPVSRLGFARSAMRDAIGRLPCGSKVGWSVFTGQRTLLLLPP
FT                   VEVCGNYDALLSSLDRIDWHMRWTNWSRIAEGGVYSAVRVAQDVGHGAAVVFVTDGQEA
FT                   PPVLPSDAPTRDINPARVTGWLIGVGGDQAAPIPHTDADGNRNGYWQADDVIQVPPQPG
FT                   SATQAESHEELSALHGHYLAAVAAQIGFGYRRLLGAEALSDAMLDVRFAHREPVPTDLR
FT                   WCPALLALLLLVWRFAPEFRWARGRVTGRSANSSYV"
FT   gene            711382..713115
FT                   /locus_tag="Bxe_B2415"
FT   CDS_pept        711382..713115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2415"
FT                   /product="Putative quinoprotein alcohol dehydrogenase"
FT                   /EC_number="1.1.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33576"
FT                   /db_xref="GOA:Q13QR3"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR3"
FT                   /protein_id="ABE33576.1"
FT                   /translation="MPFIRIPDAIGLSLLAIAFGLPAAYAADEVQNSSTTTSSPVPSTL
FT                   QPVSQEQLDRAATTSNDWLLSNGSYAQTRYYRGAQINKTNVSKLRPAFIFQTAVNESME
FT                   TAPIVSNGVMFITTSFNHVYAVDAVTGKEFWHYKHKMGAVTTFCCGPNNRGVAIAGDRL
FT                   YMGTLDAKLVALDAKTGSVLWQTQIADPDEGYSETMAPTVVDGKVLIGTNGGEYGIRGF
FT                   LKAFDANSGQLLWTFYTIPETGQEGVWATKDATGRDGKRDIDAEKKQLAEKGGDFYKTL
FT                   GGGVWMAPAIDRQTHTVFFVVGNPSPDLYGAIRPGDNLYTDSLVAIDLDTGKYKWHYQY
FT                   VPHDVWDLDAVSPPMLIDVRDNNGRMIPGVVHGGKTGHVYVHDRATGRLIRYSQAMIPQ
FT                   ENMWTLPTAAGARMLPGANGGVEWSPMAFDPHTRLVYAANLHQPMTYQVEDAAYPGGSK
FT                   LWLGGAFKTIASEQQWGKLSAVNVDTGKVAWDYKTEQPLIGGVLTTAGGLVFNGEGNGL
FT                   FRAFDSATGKKLWEFQCGAGVNAPAVSYMVHGKQYIAVAAGGNTQLDFKRGNTVLVFAL
FT                   P"
FT   gene            713112..713732
FT                   /locus_tag="Bxe_B2414"
FT   CDS_pept        713112..713732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2414"
FT                   /product="Putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33577"
FT                   /db_xref="GOA:Q13QR2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR2"
FT                   /protein_id="ABE33577.1"
FT                   /translation="MTMPMLRGTPGRARRSWTAVLCGWFAAAWLPLNAHADAEAGKAKA
FT                   QVCVACHGPMGNSTNPDYPILAGQTARYIYLELKDFKEGRRSDPRMSPMAANLSREDMQ
FT                   DLADYFAAQKAASVPFKSDNASIEAGRKKAAEVLCTMCHLGGFTGQNEIPRVSGQLYPY
FT                   IVKQLQDFRSHTRTNDAGNMTSVTRNLTDDDIRNLAAYINNLQ"
FT   gene            713748..714410
FT                   /locus_tag="Bxe_B2413"
FT   CDS_pept        713748..714410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2413"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33578"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR1"
FT                   /protein_id="ABE33578.1"
FT                   /translation="MKEILTRTVATVALLAGALGACVPAHAQGDGETNRQLLAAAKDGD
FT                   QPSALAALQRGAAVDAMNRIGDTALITACKRGDAATARMLIDHGANVRHANAPGVTPLM
FT                   AAAYGGFDEIVVLLLAHDADPLATDRIGKTAMEYAAGQGQTKVVNQLLDAGVDVNRTYR
FT                   NDLTALMWAAGYDRADTVRLLIARGANRALKDNRGMTAKDIAVQTKSDQVARLLSTG"
FT   gene            complement(714483..715298)
FT                   /locus_tag="Bxe_B2412"
FT   CDS_pept        complement(714483..715298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2412"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33579"
FT                   /db_xref="GOA:Q13QR0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR0"
FT                   /protein_id="ABE33579.1"
FT                   /translation="MATVTTSEGSAERREADSGALARGLNILSRLHEAARPLSLQDIAE
FT                   SVGLPTTTCHRLLQSLDVAGYVYREGSLYCPTPRAACPLPLEHPLNRLRRDTAPLMREL
FT                   QERHGPSVLLIAFLGDHRVTVECVAGNYSVTPYFDTTVTAPLHASVSGKILLSDRTDEQ
FT                   RDALLGQAPYSARTEWTIRDRAALYAELEEVRKRGWATNQNENVIGICAVGSRLAAPSG
FT                   RALGAIVLTGPSRFFAKGFDTMRDDLLQACQMLNSTSHAIRTMTQLLGV"
FT   gene            715695..716858
FT                   /locus_tag="Bxe_B2411"
FT   CDS_pept        715695..716858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2411"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33580"
FT                   /db_xref="GOA:Q13QQ9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ9"
FT                   /protein_id="ABE33580.1"
FT                   /translation="MSTLSPASFADSPLSRALSQPLMLGLFLPIQSGGWSMSTLPRTTD
FT                   WSFDYNARLTRKAEALGFDLVFGLAQWLGKDGHGGTTRYRRDSLDSFITIASLASITNR
FT                   ILLISTLHILYGGWHPLHLAKFGATLDHISGGRWGLNMVTGHSVDEAEMFGREGHFEHD
FT                   LRYEMAGEFVDLMEQLWSLDDNLTFDGKWYRTRNAFVSPKPRFGRPVLVNATSSAAGID
FT                   YAAQHSDLIFITSSAGAQIDAALEVLPAHTAQVQARAQAHGRQVSTLINPTIVCRPTER
FT                   EAHAYHDAILSHADFGAVDGFTGRRSDAKAWKGHQREQRVLGGNIQIIGSPEHVVEDLL
FT                   RLKAAGIDGVQLTFFDFEPDLAYFGEAVLPLLEQAGLRVPLPTAAFF"
FT   gene            716913..718580
FT                   /locus_tag="Bxe_B2410"
FT   CDS_pept        716913..718580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2410"
FT                   /product="putative rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33581"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ8"
FT                   /protein_id="ABE33581.1"
FT                   /translation="MSHSTIPLITPAALRAALADRRELAILDVREEGVSARRRLFYSSI
FT                   AAVGRLGLVVGQLVPRLTTPVVLVDEAGEYASRAAALLASFGYTHVSILEGGVSGWEAA
FT                   GFEVFSGTNVPGKAFGEVIEHRLHTPNIDAPTLRQLQDAGEDLVVLDSRPFPEYQTMNI
FT                   PGGVECAGAELVHRALAAAPSPDTLIVVNCAGRTRSILGAQSLVNAGIPNPVAALTGGS
FT                   MSWLLSGFELERGRISTAPRPDGAALASARTLAQRAAARAGVVEIDRATLARFESEAAT
FT                   HTLYRFDVRAPLEYEAGHRAGWRSAPGGQLVQATDEYVGTLHARVVLADDDGVRARMTA
FT                   SWLVQLGYLQVFVLADDDSSAAFETGPEPLPIFRTRGRTQWIEADQLAQTLEAGSAQVV
FT                   DVDSSLAFRRAHIAGARFVAASALEDLLERIDADASRQLVLTSSDGVLAGLLANQLRER
FT                   REGVAALLGGTQRWLALGLPQASGDEGNLTGDDDAWYSPYHYAPAQAAQQMEAYLAWEL
FT                   QLVGQLERDGIASINVIDFDTPTHRRSEERLAALRRAN"
FT   gene            718620..719984
FT                   /locus_tag="Bxe_B2409"
FT   CDS_pept        718620..719984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2409"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33582"
FT                   /db_xref="GOA:Q13QQ7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ7"
FT                   /protein_id="ABE33582.1"
FT                   /translation="MSAARTLHLNTNITGTGRHPAGWRTLDNPKSIIDLGFFTTIAQIA
FT                   ERGKLDAVFLSDAVALRGHAHGPAQSLEPTVLLTALAGVTRHVGLIGTASTTFNDPFNL
FT                   ARRFASVDHLSAGRVAWNAVTTYDPEAAANFSIAESPDKQARYARAEEFVEVVLKLWDS
FT                   WEDNALIADRASGRYADPARVHAIAHAGRHFQVRGPLNLPRSPQGRPVLVQAGGSEAGV
FT                   ALAARHADAVFTAQTTFEGAQDFYRDIKARAVAHGRHPDHLLVLPGLYPVIGGTLAEAR
FT                   RRKADMDALLDRGAELAKFAGALGIDAAALQLDAPLPYDLIDKGDRTDVSRGFIRSTVL
FT                   LARGENLTVRDLLDRNPGAHRMIVGTPETIADDIERWFAGRAADGFNLNADVFPSGLAD
FT                   FVDHVVPLLQRKGIFRREYEGTTLRDHYGLARPSSRYADAATSAVADADALGAVS"
FT   gene            720048..720875
FT                   /locus_tag="Bxe_B2408"
FT   CDS_pept        720048..720875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2408"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33583"
FT                   /db_xref="GOA:Q13QQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ6"
FT                   /protein_id="ABE33583.1"
FT                   /translation="MSTRESTFTAAPAPAPAATASRLATLREPLLRAAIPVLLIALWQL
FT                   ASTLGVVSEFVLPAPASVLTAYRELWQSGDLQDALKISLARAALGLLIGGGAGLLLGVA
FT                   AGLSKSAERGFDTVLQMLRTIPFIALVPIFVVWFGIGELSKVALIVGAAISPMYLSTYH
FT                   AIRGIDPKLLELGRTFRLTRGHQIRLIILPTALPGILVGVRYSAAISLLALVAAEQINA
FT                   SAGIGFILNNANQFQRTDIIIAGILVYAALGIAVDALLRFIERKALVWRGAHV"
FT   gene            720868..721605
FT                   /locus_tag="Bxe_B2407"
FT   CDS_pept        720868..721605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2407"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33584"
FT                   /db_xref="GOA:Q13QQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ5"
FT                   /protein_id="ABE33584.1"
FT                   /translation="MSELAYQPDYDAAPVVARLSGARKRYGENTVLDNVDFTVRKGECV
FT                   ALVGPSGTGKTTLLRLLAGLESVSGGRTEVTQNTSVVFQEPRLIQALRVWKNVLLDDAH
FT                   KPDAKARARVALQDVGLEDKLESWPVSLSGGQAQRVAVARALYRSPELMLLDEPFSALD
FT                   AFTRRSMQSLVLKLWAKYRFGLVIVTHDLDEALILADRIVILSKGRICHETQVDLPRER
FT                   DVTSPEFNALKRDLLKQFSLSLS"
FT   gene            721636..722682
FT                   /locus_tag="Bxe_B2406"
FT   CDS_pept        721636..722682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2406"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33585"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ4"
FT                   /protein_id="ABE33585.1"
FT                   /translation="MSLKKSLFAGMAVFLAAATLTLSGTAAAQTTPDLKGTKLVIAYQD
FT                   PAFPALIRKSGVVNGTPYQIEWVLLTGPAANLSALYANRIDLGHMGDTSLTIEQANART
FT                   EWTKESTPLRIVAGWRNFYSKDYPPVVTAVRTSAGINTVQEIKGHKVGYNYGGYNHSQY
FT                   LATLVKAGLTEKDIQPIKFADGATSAAGFNAGEVDVYAGALGPILPTIKSGAGRILLLD
FT                   RDTQIPALNVWTTTSTVLKDPTKVAALRDYFSRLSGYWQWHDTHKDEVIGVLKDTLKVS
FT                   DERAAFEYEVRSGSFVKFDSGLIGQEQKIADILYDGHAIRKKVDVAVEYDPQFNAVQKA
FT                   VWPIKVKN"
FT   gene            722776..724392
FT                   /locus_tag="Bxe_B2405"
FT   CDS_pept        722776..724392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2405"
FT                   /product="putative rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33586"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ3"
FT                   /protein_id="ABE33586.1"
FT                   /translation="MDVRKMPKGIDAATLKRWLHDGSEIALFDVREHGQYGEGHPFYAV
FT                   PLPYSVLERDVGRLAPNRRVRVVVYDSGDGDDGPAARAAARLETLGYASVHVLEGGTRA
FT                   WQDAGFVLFKGVNVPSKAFGELVEQVAHTPHISAQTLLQWQQSDTPPVVLDGRPLGEYR
FT                   TMNIPGASCCPNGELAYRIDAFVPDAQTPIVINCAGRTRSIIGAQTLLDLGIRNPVYAL
FT                   ENGTQGWFLADLPLERGQQRGYPADLRPQPARVAAARALAERAGVEWVHADTVRDWTKA
FT                   DDRTLYLCDVRTPEEFAANTLPGAQHAPGGQLQQATDQYIGVRNARIVLFDDDGIRAPV
FT                   TASWLRQLGHEAWVLEGGLHSGLALADTRIPEPAALPLVDGDTLAQRLAAGSQSVVDLR
FT                   TSAAWLAAHIPGSVWSIRPRLAATLAQCEQAVTFVVDDPRIAAWAVSDLAGGEGHTFSV
FT                   LDGGFAAWPAGGWRVETDAVADVLPPSARIDYLFFTHDRHAGNKAASREYLSWELGLLG
FT                   QLDELERSAFRPLTRVVAAPE"
FT   gene            724701..724943
FT                   /locus_tag="Bxe_B2404"
FT   CDS_pept        724701..724943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33587"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ2"
FT                   /protein_id="ABE33587.1"
FT                   /translation="MHVFQWVGRGEGAARLAGYGFTPGLSNSPRARSPLLVVTGFQKRQ
FT                   SGDAGAKSAATALRKILPRDVASRGDAAAHASMSH"
FT   gene            725139..725828
FT                   /locus_tag="Bxe_B2403"
FT   CDS_pept        725139..725828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33588"
FT                   /db_xref="GOA:Q13QQ1"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ1"
FT                   /protein_id="ABE33588.1"
FT                   /translation="MAKVMVVGQGRPAKRKVDPWFPEIRSHYLASFLNRGEFNRMRDVI
FT                   RAFVATRVPNRRRLEARLFESGIMMRAINLFFLLFFTCTAVYSSESIYGSAFDYKKAKP
FT                   ANIYFSGKTQAEIKIYCEKVASATIDLSVCAQFRFEGVAQELDRKFREIEKEIVIGDKD
FT                   RRAIGEPEATPYLKKAQANWKRYRDNQCYARTYEVGQASLRFVEFWDCMARVTRNRLNE
FT                   LTTANEE"
FT   gene            725973..726230
FT                   /locus_tag="Bxe_B2402"
FT   CDS_pept        725973..726230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33589"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ0"
FT                   /protein_id="ABE33589.1"
FT                   /translation="MRREICSRTGVMIRVIKAIISAIGFVFATAVFADVACEKHEKTCD
FT                   DFLKCSQIDADKILSDSKKLYLKVREFAKGDKRAALDRNY"
FT   gene            726466..726768
FT                   /locus_tag="Bxe_B2401"
FT   CDS_pept        726466..726768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33590"
FT                   /db_xref="GOA:Q13QP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP9"
FT                   /protein_id="ABE33590.1"
FT                   /translation="MTRRFSLIAFLLAFLYEASVEAVLLWSLPLKPTGWGAIIASLTTN
FT                   PLAFVYAMKRRKWAFDLLKWIAAFSIVWTVSGFVRKETAKYNPLAILYLLSLIRE"
FT   gene            complement(726849..728021)
FT                   /locus_tag="Bxe_B2400"
FT   CDS_pept        complement(726849..728021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2400"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33591"
FT                   /db_xref="GOA:Q13QP8"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP8"
FT                   /protein_id="ABE33591.1"
FT                   /translation="MKKISTVCAISGLMAASAVHAQSSVTLYGLIDAGLMYTNNVSKSG
FT                   SSGALVQATSGNINGSRFGVRGAEDLGGGLKAIFVLENGFNVQNGKLGQDGRMFGRQAY
FT                   VGLSTSQFGTVTLGRQYDSLVDFVAPLSGTAGTFGDTGFAHPFDNDNLNHSVRMSNAVK
FT                   YTSTNYAGLTFGGLYAFSNSTSFAVNRAYSAGASYAYGPFTAAAGYLQINGSTNTTSGS
FT                   AGAVDIVESTANGTGGFNLGADVQRTVGAGLSYKVGPAVVGFVYTHSQFQGTTSFGQTN
FT                   VGNSGTMRFDNYELNAKYALTPAINLGIADTYTDGHVGNGNNTTYGNDPKWNQVNLQAV
FT                   YLLSKRTDVYVEGMYQHAIGQRYVAFINTSGGASSTSNQVVATVGLRTRF"
FT   gene            complement(728259..728681)
FT                   /locus_tag="Bxe_B2399"
FT   CDS_pept        complement(728259..728681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33592"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP7"
FT                   /protein_id="ABE33592.1"
FT                   /translation="MEFDSDWLTLGRHRVRLRSPRGFPTEGMRTAVDVMRLAIENNMSA
FT                   RARLVDVAVREEKSYDVSVGTTFAEDRLCVPQLEAAIAVVLGLLPGQIRIFVTVVTQEE
FT                   VDLHFGVYERMLAEKIGGLAPISQAYSANASNASDG"
FT   gene            728934..729377
FT                   /locus_tag="Bxe_B2398"
FT   CDS_pept        728934..729377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2398"
FT                   /product="Putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33593"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP6"
FT                   /protein_id="ABE33593.1"
FT                   /translation="MSDLYFTTDLFSQFDRLHQQMATLFGGYPSSIRSDRLSAFPQINI
FT                   GTTDDTIDIVAFAPGIDPKQLEVSIDKGLLTIAGERAAVTPDASDEAARHYARERFSGA
FT                   FRRVIELPQHADPDKVEARYVNGCLCITVGKRESSRPRAITVQ"
FT   gene            729403..729810
FT                   /locus_tag="Bxe_B2397"
FT   CDS_pept        729403..729810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2397"
FT                   /product="Putative heat shock Hsp20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33594"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP5"
FT                   /protein_id="ABE33594.1"
FT                   /translation="MNDTTQLARRDSNTVSRAEPERTEQRVTLSPAVDVIENAHGVTLW
FT                   ADLPGVPRENLEIRVQDGNLRIEASANIPTREGLRLQHAEVRVPHFARSFTLGPEFDTS
FT                   KIEAKLQDGVLKLSIPRREEARPRRIEVAVG"
FT   gene            complement(730006..730416)
FT                   /pseudo
FT                   /locus_tag="Bxe_B2396"
FT   gene            complement(730441..730566)
FT                   /pseudo
FT                   /locus_tag="Bxe_B2395"
FT   gene            730668..730991
FT                   /locus_tag="Bxe_B2394"
FT   CDS_pept        730668..730991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33595"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP4"
FT                   /protein_id="ABE33595.1"
FT                   /translation="MMRLRCLLARLGGLCRGSDSRYNRPRRSRTGRPASWLRAMRGRHR
FT                   NAVGQTRSREVIAAGQARKGEDSDSFASRRASFRCSSVQMNDGASQRIAGPAKYPEAAL
FT                   KRC"
FT   gene            complement(731035..732249)
FT                   /locus_tag="Bxe_B2393"
FT   CDS_pept        complement(731035..732249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2393"
FT                   /product="Major facilitator superfamily (MFS) efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33596"
FT                   /db_xref="GOA:Q13QP3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP3"
FT                   /protein_id="ABE33596.1"
FT                   /translation="MSTEVSTTTAGSNPVKLTRGLIALFAFCCGAIVANLYYAQPITEL
FT                   IAPAIHMSGGTASLIVSLTQIGYAFGLFFLVPLGDLLENRKLMITTALVSIASLAAASF
FT                   ARQPGVFLGISLLVGFSSVAVQILIPLAAHLAPDESRGKVVGTIMGGLLLGILLSRPIS
FT                   SVVAGHFGWRAVFGSAAVLMAIVTSVLALTIPRRQPDHQATYFALIGSLGHLVRTMPVL
FT                   RHRSFYQALMFASFSLFWTAIPVELTRQFGLSQTGIGIFALVGAIGATSAPVAGRLADA
FT                   GHTVRATLIALVVGAFAYTPALIHPAWGVIGLAATGIVLDFAVQMNMVLGQREIYALHA
FT                   PSRNRLNALYMTSIFVGGAFGSALASPLYEHGGWPLVAAVATAFPLVALAHYLVIGRPY
FT                   AARHA"
FT   gene            complement(732287..733435)
FT                   /locus_tag="Bxe_B2392"
FT   CDS_pept        complement(732287..733435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2392"
FT                   /product="Putative monooxygenase"
FT                   /EC_number="1.14.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33597"
FT                   /db_xref="GOA:Q13QP2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP2"
FT                   /protein_id="ABE33597.1"
FT                   /translation="MRSLEKPRAVVIGGSLGGLLTANTLRAAGWDVDVFEASPNQLESR
FT                   GGGVVLQPDVLDALAFAGVELPDPPGVASGDRLYLDREDRVVEQLYMPQMQTSWSLLYR
FT                   AMKNALPASNLHAGETFVDFRMEGEQIVAQFASGRGEQADLLVGADGIRSTLRQRLLPE
FT                   VVPQYAGYVAWRGLVEEADLPLHAADMLRERFAFQQGDRHSGLAYLIPGENDSTVAGQR
FT                   RFNWVWYRKYSAARLDELLVDRHGIRRAFSLPPGSTKGIDIVQLRKDAQAWLGPTFRAL
FT                   VDATDDPFMQPIVDLRSPKMVFGRAVLLGDAASVPRPHTAGSTAKAAANAHALALALSS
FT                   TWQSGATIDSALKRWENQQLQRGRLMTDLGISLGDRVMNLAR"
FT   gene            complement(733432..734085)
FT                   /locus_tag="Bxe_B2391"
FT   CDS_pept        complement(733432..734085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2391"
FT                   /product="Putative DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33598"
FT                   /db_xref="GOA:Q13QP1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP1"
FT                   /protein_id="ABE33598.1"
FT                   /translation="MQAIQVEVNYDFICPWCWIGQRNLAAALAETGAHAAVSIRYVPFE
FT                   LNPAMPAEGMDRRAYRSRKFGSWARSQIMDAQVTAAGLAAGVHFNYDKVLRTPSTRLAH
FT                   RLMQFAQQRNDPQATAALYQAIYAAYFSEGRDIGSLDTLVAITAEHAFDADAVRASLQG
FT                   SAGNEAIEAARARAGSLGIQAVPTIRIDGDVISGAQPPAVFINALRAAAQRKAA"
FT   gene            734153..735124
FT                   /locus_tag="Bxe_B2390"
FT   CDS_pept        734153..735124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2390"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33599"
FT                   /db_xref="GOA:Q13QP0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP0"
FT                   /protein_id="ABE33599.1"
FT                   /translation="MQAGVALIATKLPMGPHMDKFLAIKTLLEVADAGGFSKAAQRLGV
FT                   ATSSVTRLMDSLEASLGTALLTRTPRKVSLTDAGIAYVEQVAKVLDDLAEADESVFDSG
FT                   ASPVGALRISVPSTYSRLCLAPHLAAFLCENPRVFLDVVVADHFADLALDRIDVAIRIG
FT                   LADRDASLIVKKLADNPRYVVASHDYLERSGTPQTPQDLADHECLRFAYGGGYRTHQTW
FT                   TFQREGAGQRVDVRGHLLSNNLDILLEAVMAGRGIALLPEWQVEADIRAGRLLRLFEHF
FT                   DASPQAGDAVVYAAYLPNRRQSSKVRALVQFLETRLRGALEG"
FT   gene            735303..735938
FT                   /locus_tag="Bxe_B2389"
FT   CDS_pept        735303..735938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2389"
FT                   /product="Putative isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33600"
FT                   /db_xref="GOA:Q13QN9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN9"
FT                   /protein_id="ABE33600.1"
FT                   /translation="MSRELLTPDTCAVALIDYQPQMFFGTMSHERTNILHNVQAIAKAA
FT                   KLFKVPTILTTVAAKSFSGDMVPEVQSVFPEYVPVDRTSMNSWEDVNFRKAIEATGRKK
FT                   IVISGLWTEVCVSFPTIQMIAEGYEIYVPTDACGDVSQEAHERAVQRIIQAGAVPMTSL
FT                   QFMFELQRDWARSETYEGCMDILKAHSSYGIGVRYAKAILGEHASEAG"
FT   gene            736048..737928
FT                   /locus_tag="Bxe_B2388"
FT   CDS_pept        736048..737928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2388"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33601"
FT                   /db_xref="GOA:Q13QN8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN8"
FT                   /protein_id="ABE33601.1"
FT                   /translation="MRFAMNSSTSGLTPAEVVFFNGKIATQDDRRSFADSLAVANGRVL
FT                   AAGSRETVMRHANDNTRHVDLKGRTVIPGLNDSHLHIIRGGLNFNMELRWDGVPSLADA
FT                   LDMLRKQVARTPAPQWVRVVGGWNEFQFAERRGPTLEEINAIAPDTPVFILHLYDSALL
FT                   NAAALRAVGYTKDTPNPPGGEIQRDKRGNPTGMLIARPNAGLLYATLAKGPKLAPEDQR
FT                   NSTRHFMRELNRLGVTSAIDAGGGYQAYPDDYAVIVEMAKHSELTVRIAYNLFTQNAKK
FT                   EIEDFAKWVKMTRPGEGDDFLRVNGAGEMLVFSAADFEDFLEPRPDLPESLETELEAVV
FT                   RLLVANRWPFRLHATYNESIERFLNVFERVNAEIPFNGLRWFFDHCETITQQNIERVKA
FT                   LGGGIAIQHRMAYQGEYFIHQYGEEAVKRTPPVRHMLDAGLPVGAGTDATRVASFNPFV
FT                   SLYWMVSGKTVGGTAMYGSENRLDRMEALRRYTVGSAWFSNEEEKKGALVPGQFADFAV
FT                   LSEDFFSIDESRIKYLTSNMTVVGGKVVYADDEFAPLAPPDLPVSPSWSPVAEFGGYSR
FT                   YKPTAVACVDGCVNLCGVHAHAHGWAWRKNVPVSDSNGFWGALGCSCFAF"
FT   gene            737968..739440
FT                   /locus_tag="Bxe_B2387"
FT   CDS_pept        737968..739440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2387"
FT                   /product="cyclic nucleotide-regulated small
FT                   mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33602"
FT                   /db_xref="GOA:Q13QN7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016846"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN7"
FT                   /protein_id="ABE33602.1"
FT                   /translation="MPTLTDGVLFGLAILVLDFLAWRFMSRKSDQTRLVFRALMFALSS
FT                   YVLFSYGMNPLRAAPWPAEPLRHLLAQVLEIVWWLQGARLVTILLDRVVLPEAWHKERL
FT                   FQDVFGALVFLAATVGAIAFVLQLPVRGLLATSGALAVVLGLAIQSTLNDVFSGVVLNA
FT                   TEPFRLGDWVTIGDVEGKVVESNWRATSLLNGQGNIVVIPNSVAARAHIVNANEPSHTH
FT                   GISVVLPVKPSVRPALVLAALASAAQSSRDVLDDPKPVVSVRRATNDAIEYEIVCYVSE
FT                   LGKKIAVRNDLFDLAHRHLLSRGVVLRPLSVPEPVTGGTADEKLRLLRNVLIFQTLARD
FT                   ELAELAGKLTQHEFDAGDTVYAATDESGHELHILAQGVAKVIVTKDGGEIELRRLAPGD
FT                   SIGQSGILAGVRTAVVVRALTRATVFRLDKSALTPVLTRRPEVVKEMCRLLSEHHATEE
FT                   MLLASPASLDENTGGLLQWIRDGVRRFHELTL"
FT   gene            739632..740273
FT                   /locus_tag="Bxe_B2386"
FT   CDS_pept        739632..740273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2386"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33603"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN6"
FT                   /protein_id="ABE33603.1"
FT                   /translation="MKKTIAGVDIPDGVMAQAATDLIRGTESELMFHHALRAFLFAALT
FT                   GYRENLTFDAQLLYVGAMFHNVGLNAKYERSPYRFEVDGANAARDFLRRHGVAEREIEE
FT                   VWVGIALHTTPGIPEHLSALVALISAGVQMDVRGARYDEFTAHQRDEIVQAYPRESGFK
FT                   KKLIEAYAHGMEHRPETTFGTVNADVLDRWDPNYRRLNFCGLVLGSDWPN"
FT   gene            740302..740544
FT                   /locus_tag="Bxe_B2385"
FT   CDS_pept        740302..740544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2385"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33604"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN5"
FT                   /protein_id="ABE33604.1"
FT                   /translation="MGYIISLGVGFGIGLLYWLLKVQSPAPPLIALAGLLGMVLGEHAI
FT                   PVVKAQFFAQTTTAQVAGQTKDAAVQKPDASKEGG"
FT   gene            740617..741576
FT                   /locus_tag="Bxe_B2384"
FT   CDS_pept        740617..741576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33605"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN4"
FT                   /protein_id="ABE33605.1"
FT                   /translation="MDIQMFKSLHRYRAIALVSAALLIGSTAASSAFADAGPPEVSSGK
FT                   TALVKHPDVSVGAQYDTTHVYVASADLDAFVNSFLATFGGKASPRAVFTVTPTPSKTAS
FT                   QYVQTPVGMLSVFGFETPIPYPFGNERTGYLVTDIDQGVKAARAAGADVLVESFDDPIG
FT                   KDAIIQWPGGLTMQLYWHTKAPNYAPLQSVPDNRVYVSRYEANNFVRRWLHFSHGKVVS
FT                   DNPRADAGVIGRPGETIREIRIASGFGRMIVFVTDGKLPFPFGRETTGYNVDDVAQTLE
FT                   RAQAAGAKVLYPAYAVGSGKTAMLEFPGGYIAEVHDGK"
FT   gene            741584..743092
FT                   /locus_tag="Bxe_B2383"
FT   CDS_pept        741584..743092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33606"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN3"
FT                   /protein_id="ABE33606.1"
FT                   /translation="MVPSFTLRRARRRARHAIRALLLSTGLAAALPAAAADTALGGADD
FT                   TSTTGSPAAATTAAGAAAASCARPAIMFNRWQENWSVLANPCVPKKPFDSLKYIPLFGN
FT                   PDAYISLGMVLRERLEINDAPLFGLGAQHDDTYLLQRLEVHADVRLGPHVQIFTQFEDA
FT                   QPYGKDVVTPVDKNPLDLRQAFVAITEPLGPGTVKFRVGRQEMAFDLQRFVSVRDGPNV
FT                   RQAFDAIWADYETGPWRWIAYATQPVQYRDNSDFDDVSNRDLTFSGVRVERKNVGPGDL
FT                   SAYYSRYNRSNAKFLDASGDEHRDVFDARYAGNVAPIDWDVEAMYQSGHVGNKTIGAWA
FT                   VGSLAGYTLASLPWTPRLGIQIDAASGDSHPGDGRIGTFNPLFPNGYYFALAGYTGYTN
FT                   LVHVKPTLILKPSSKLTLLAGVGLQWRQTTADAVYGQGSAVVPGTAGHGSPWTGFYTQL
FT                   RADYAVTANLAAALEAVHFQVGPSLRDLGARNADYVGAELKFGW"
FT   gene            743166..744887
FT                   /locus_tag="Bxe_B2382"
FT   CDS_pept        743166..744887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2382"
FT                   /product="Cyclic nucleotide-regulated FAD-dependent
FT                   pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33607"
FT                   /db_xref="GOA:Q13QN2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN2"
FT                   /protein_id="ABE33607.1"
FT                   /translation="MSTPDTSVDAATPSELEIPFSSLEYRRHQMFPRLCAAEIASLRRF
FT                   ARPMSFKAGELIFETGQVALGLFVLLHGRVRIESRDSFGRSTVVTEHDDGHFMAEMAQL
FT                   SGKPALIDGIALTDVETLVIEPERLRALIVADAQLGEHIMRALILRRLGLIEQGLGPVI
FT                   VGNGDDARLIRLQGFLRRNAYPAMVIDARTDPDAIKLLGGMTTGPGDFPLVFCPNGYVL
FT                   RAPDEAQLASCLGLVPTFEQSHVYDVAIVGAGPAGLAASVYAATEGLSVAVFDQRAPGG
FT                   QAGASSRIENYLGFPTGISGQALAARAFQQALKFGAHLAIPGKVMDVSRHEDIFTLTLQ
FT                   DGQRISARTVVVASGAAYRKPTVPGFDRFEGRGTFYWASTIEARLVKGLDIVLMGGGNS
FT                   AGQAVVFLANFARSIRVLIRGADLNASMSKYLIDRIGSLPNVSLCTRCVLRGLEGDESG
FT                   LSGLHIHHEDEGADEIIPTRHLFLFIGADPKTDWLAASDVELDNRGFVVTGFARSEQGF
FT                   SASSARYPLETSVPGMFAVGDVRSESAKRVAAAVGDGAAVVSQIHAYLSQFAKAIA"
FT   gene            745051..745872
FT                   /locus_tag="Bxe_B2381"
FT   CDS_pept        745051..745872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2381"
FT                   /product="Putative non-heme chloroperoxidase"
FT                   /EC_number="1.11.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33608"
FT                   /db_xref="GOA:Q13QN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN1"
FT                   /protein_id="ABE33608.1"
FT                   /translation="MAYITTKDGTQIYYKDWGTGQPITFSHGWPLDADAWDAQMLFLAE
FT                   RGYRVIAHDRRGHGRSSQPWNGNEMDTYADDLAELIEALDLTNIVMVGHSTGGGEVVRY
FT                   IGRHGTKRVARAVLIAAVPPIMLKTGANPGGLPISAFDGIREGVRNNRSQFFKDLAVPF
FT                   YGFNRPDAKVSQGTIDSFWQIGMLGSIKGLYDCVKAFSETDFNEDLKKVTVPALVLQGD
FT                   ADQIVPLDDSGKLSAKIMPNATLKIYEGAPHGLCTTHADRVNADLLAFIKS"
FT   gene            complement(745862..747718)
FT                   /locus_tag="Bxe_B2380"
FT   CDS_pept        complement(745862..747718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2380"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33609"
FT                   /db_xref="GOA:Q13QN0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN0"
FT                   /protein_id="ABE33609.1"
FT                   /translation="MMEIGRFQIDLEMRNLRRDGEVVRLGSRAFDILAVVASAAGRLVT
FT                   KDELMNAVWPDTIVEENNIQVHLSALRKVLGPDRDLILTVPGRGYQLLQRKKNALPGEA
FT                   NSQVSLARRLPPPKSGLLPRAAEVELIRAMLRHAHVLTLAGAGGIGKTQLAIEAARHSA
FT                   AQFADPVCFVELAALTTHESVLCAIAESCGLVLPGTQTDVTRVAAALAGKPRLLLLDNA
FT                   EHVVGAVAQIADALVAGNERLRVLVTSREPLRIMAETVFRVDPLDVPPPDASDEEILAC
FT                   SAVNLFLLRANSLQETVATGSAELRLVGEICRRLDGMPLAIELAAARVVALGVEGVYRR
FT                   LDDRMAILAGGYRTALPRHQTLRATFDWSFALLDPVTRAVFRRLALFSGTFCFESMCAV
FT                   VCDEEHTMANAIGGITELVAKSLVSVQFVGAAAKYRLSESTRAYALEQLKAEGELREIV
FT                   ARNARYVSRCVQARLSGDRRDSENQAAGAHDLQPTLDDARVAFDWVFSADGDPRTGIEL
FT                   ASNLADALLDAGLFEECCARAAQAVDALERQPSGTVSAASEQRVRAALDAASRAVREPL
FT                   PALALTQRAPNPVPKKQEKHEPHEPHAPAVAAMAPPACFITT"
FT   gene            complement(747996..748910)
FT                   /locus_tag="Bxe_B2379"
FT   CDS_pept        complement(747996..748910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2379"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33610"
FT                   /db_xref="GOA:Q13QM9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM9"
FT                   /protein_id="ABE33610.1"
FT                   /translation="MFNQTEIAPLTAARKKDSLGCLSNQLHKDIELEAGDFTFYRKCRR
FT                   QEKTSEVATPASDRGVLIGVSLSAGHRRRIISGNRSAMHEFDKDSVYIRNFEEDYRADL
FT                   HGAFDFVLVEFSRAFITNTGYERSGSHMTGFSAQPGGKDPIFGHLAQVLALALDRESQA
FT                   SPLFIEQLGVTIGTHLVDHYGGAPAQSVKPGRRLSSLHETRAKDMLLAKTQDNVSLEEI
FT                   ASACNLSRSYFIRAFRETTNRTPHQWLLEQRIERSRHLLRSSDASLSEIAIACGFSDQS
FT                   HFTRTFTQLVGTPPGSWRRLARS"
FT   gene            749195..750187
FT                   /locus_tag="Bxe_B2378"
FT   CDS_pept        749195..750187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2378"
FT                   /product="Putative metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33611"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM8"
FT                   /protein_id="ABE33611.1"
FT                   /translation="MSELIQRRWLMHLGLWCALFLSVSAGLGPRAALAAAPQVRTQGAG
FT                   FYRIMVGDFEVTALLDGTHPFPIDTVVQGVPKSEIAQDLSRDFLPAPVQGSINAFLINT
FT                   GAKLILIDSGAGVLYGDCCGRLAGNLRAAGYQPEQVDEVLLTHLHKDHVGGVIANGAMA
FT                   FPNAMVRVSQVESDYWLNPANKSAAPAFLDSFFDAAIASVAPYVAAGRFKPFSGDVELD
FT                   PGIRAVALPGHTPGHTAYLVQSDSKDLLVWGDVIHVAAIQLRNPTASVEYDTDAAAAQR
FT                   SRRYALKFAADKHYLVGAAHIAFPGLGHIRKNGSAYDWVPVNYEAEPGH"
FT   gene            750442..750939
FT                   /locus_tag="Bxe_B2377"
FT   CDS_pept        750442..750939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33612"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM7"
FT                   /protein_id="ABE33612.1"
FT                   /translation="MHSETCLTPRGEASREACCAPREPADASPDGLRSSVWDHVIHALL
FT                   PGYRGESGESGEASRERRTPRMAACVPSPHIQVEVIERLSETSVAVLWQDATRCRYDDQ
FT                   VWISCRARQKGYCALSGAVIRRDDLIYKPRVRASMPANAAAMILASVVEQMSALTTADD
FT                   AR"
FT   gene            751252..754257
FT                   /locus_tag="Bxe_B2376"
FT   CDS_pept        751252..754257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2376"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33613"
FT                   /db_xref="GOA:Q13QM6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM6"
FT                   /protein_id="ABE33613.1"
FT                   /translation="MICIGPLQVNIDRREVFLDGAPVRIGGRAFDMLAVLIAANGGLVS
FT                   KNEMLRRVWPNAIVEENNLQVHMSTLRKLLGESRGLIQTVSGRGYRLVQSASAPAASGE
FT                   PRAAGSNAADGPVDLPQGAGVQNNLPVHFSPLIGRDKALGDVSQALAATRQVTLVGSGG
FT                   IGKTRLAVEVARGLLARFPDGVYLVPLASTFDAGSVLAAFAASVGVNPAIGPLTLARVG
FT                   KELGERRVLFVLDNCEHVLGPAAELAETLLGVGPEICVLATSREPLRIMNEHLYWVASL
FT                   QVPGQDDQSQAVLQCSAVELFLARARAIDARFSSDEKSIHLTGTVCRRLDGIPLAIELA
FT                   AARAAILGIETLAGHLDDRFNMLTGGNRTALPRHQTLKATLDWSHALLDDAERTTLRRL
FT                   GVFVSSFTMEAAIAVAGDGALHEIDVVAAVSGLVEKSLVVTRMERGRATYRLLETTRAY
FT                   AMQKLDDNGERRFVTLQHARYFLGVLEVDAPRRIDPALALSDGWHDRMRAVLDDLRAAL
FT                   TWALSPKGDEALGETLAVKFVFLLYELSLVDECRAWAQRALDTVAAAQQGSRSTRHLRV
FT                   RMQLHAALAAALVYVNGPNRETFGIWSEILASAIALGDHVFEARALWGMWNASQSSGAA
FT                   RNAQAFARRFALLAAEVGDVAGTILAHRLLGTAAHYSGDQQQARASLEQLLQHGGELQH
FT                   GLPLGQSVDQRLVGHATLARVLWLQGLRDQALRLAQDSVSAACDQQQAIVTCYVLVEAL
FT                   VPLMLLSGKWERAAQAIALLRDTSARAGLSVAQACCRCFDEYLRSVQDGGAQHLQAFRA
FT                   ALDDLESLDFGAPRAMLAGQYSLALGRAGRREEGIATVAGVLARCDETGDHWYAAELQR
FT                   IHGELLFMRQADMPQSEMVMRDAEACLVAALEVSLVQGCRSLQLRASTSLGGLWQMRGR
FT                   SADAAKLLQSACARVTEGLDWDDYQAAAHLLRIATSDSEARVAVPMICASASRRAAETL
FT                   DAVPPRRIRSAG"
FT   gene            complement(754265..755185)
FT                   /locus_tag="Bxe_B2375"
FT   CDS_pept        complement(754265..755185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2375"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33614"
FT                   /db_xref="GOA:Q13QM5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM5"
FT                   /protein_id="ABE33614.1"
FT                   /translation="MNLSFEVLQVLDAIDRTGTFANAAEQLHKVPSSLSYLVQKLELDL
FT                   GVKLFDRSGRRAILTHAGRVVVEEGRRLLEAAEDLECKAKRIQHGWESELHVAIDEIIP
FT                   FDLLWDHVDAFYKLKLDTRLHLSKEVLGGSWDALLTRRADLVVGAAGEPPPIPNLIAKP
FT                   IGSLRHVFVVAPHHPLAAALGPLTLEMVARHRAVAIGDTSRKLAPRTIALAANQEVMTV
FT                   PTLEAKLAAQIKGLAAGTIPECLAAEPLSRGELVQKEVLGMRNVTHFFLAWRSDETGKA
FT                   LRWWVDQLDRPDLIDEVAQQRMLHG"
FT   gene            755493..757214
FT                   /locus_tag="Bxe_B2374"
FT   CDS_pept        755493..757214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2374"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33615"
FT                   /db_xref="GOA:Q13QM4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM4"
FT                   /protein_id="ABE33615.1"
FT                   /translation="MASNTIAAYLARTLAAAGVQRIWGVTGDSLNGLAYSLDQVGSIRW
FT                   MHTRHEEAAAFAAGADAASSGRLAVCAGSCGPGNLHLINGLFDCHRNHQPVLAIAAHIP
FT                   SSEIGLGYFQETHPQELFKECSHYVELVSSAAQFPRVLARAMRTAVEERGVAVIVLPGD
FT                   VALSEGPSEAPSWTESAPPRIVPAEADLDRLAALLNASDAVTIMCGSGTQGAHDEVVAL
FT                   ADTLGAPVVHALRGKQFIEYDNPYDVGMTGLIGFSSGYHAMMSCDTLLLLGCDFPYRPF
FT                   YPPDAKIIQIDWKGSQLGHRAPLALGLVGTVKETVAATLPKLQRKTDRGFIDNARKHYA
FT                   SARKGLDDLATPAGAGRPIHPQYLAKMIDESASDDAIFTADVGTPTVWAARYLTMNGKR
FT                   QLHGSFNHGSMANAMPQALGAQGAHPGRQVVSLSGDGGLSMLLGDLLTARQLDLPIKVV
FT                   VFNNSLLGFVSMELKAGGYLDTNVDLAKTDFAAIAKGAGIFGLRVEESEDVAGALRQVF
FT                   DHPGPALLDVVTSKHELAMPPTIELAQAKGFSLYMMRAILNGRGDEIVELARTNLR"
FT   gene            757413..757850
FT                   /locus_tag="Bxe_B2373"
FT   CDS_pept        757413..757850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33616"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM3"
FT                   /protein_id="ABE33616.1"
FT                   /translation="MKAKWTLVFLAASAFGAVCQQATAQVAGAQPIGITVEQAQLVVEG
FT                   WSVKKSLLGKSIYNDSGEKVGVLHDIIVAPDNAVSFGIVAAHQFLGVSQHDVAVPMSQL
FT                   DYANGKLVWAGATREVVKSLPVFIYSKVRTVPIARKDYGHH"
FT   gene            complement(757936..759030)
FT                   /locus_tag="Bxe_B2372"
FT   CDS_pept        complement(757936..759030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2372"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33617"
FT                   /db_xref="GOA:Q13QM2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM2"
FT                   /protein_id="ABE33617.1"
FT                   /translation="MKRGPLSGVRVIEFSALGPVPFCTMLLADMGADIVQIARPGMRTD
FT                   ADDFMQRGRRIVPLDLKVPADRDTALELVGHADIVLEGSRPGVMEKLGLGPDVCLARNP
FT                   RLVFGRMTGWGQTGPLAATAGHDINYIALAGALDAIGPAHGAPVAPLNLIGDYGGGAMF
FT                   LAFGALCALWEARNSGQGQVIDAAMVDGTATLMSLLCKLRGLGQWHDSRGTNLLDGGAP
FT                   WYGTYRTLDDRYVAVGAIEEPFWQLLLTQLDISSDSLPPRSDRARWPVIRAALAECFSS
FT                   RTRDAWAAHFRNSDACVSPVLSLDEAARHEHMAARRSYRIDSGMLRPAPAPRLSRTPAV
FT                   PAKISEVSSAKIVLEGWRDAMAQR"
FT   gene            complement(759042..760385)
FT                   /locus_tag="Bxe_B2371"
FT   CDS_pept        complement(759042..760385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2371"
FT                   /product="Major facilitator superfamily (MFS)metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33618"
FT                   /db_xref="GOA:Q13QM1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM1"
FT                   /protein_id="ABE33618.1"
FT                   /translation="MSLSSQSPIAPSAPGVAALADAADVDGTRVVSRVGRRLMWYLIAL
FT                   YVVSVLDRGNLSFASFSMNKELGLTPQMYAVGVGILFLGYSLFEVPSNLALARFGARIT
FT                   LTRIAILFGLVTMSMAFVTGPRSFYTVRALLGIAEAGLTPGVFLFLSYWIPQQHRARYN
FT                   AMFSYSIPAAYVVSSLVSGAIMQLDGAWGVPGWKWLFLLEGLPAVMLGIFGAFYLTDRP
FT                   HQATWLSADEKSWLAKQLESGDAPSAHGVPAGVMTLLRRPEMWVLTLGYVGIFSGNATV
FT                   GAWLPQILHHTGVPLSIIGFVTALPPLAGIVGMTFLSRRSDRSKERVLHTVAAMLIAAV
FT                   GYTTVAMSGTLAVALFGFALANIGVYASLAIFWSIPQTYLPARAKPAVIAVISSFGAIL
FT                   GGWVVPMMIGRVQQQAHSLAAGMIVVAILFVLSSVCVFFAGRRLASRA"
FT   gene            760705..762027
FT                   /locus_tag="Bxe_B2370"
FT   CDS_pept        760705..762027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2370"
FT                   /product="Putative phthalate 4,5-dioxygenase oxygenase
FT                   subunit (OhpA2)"
FT                   /note="Citation: J. Bacteriol. 180 (24), 6529-6537 (1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33619"
FT                   /db_xref="GOA:Q13QM0"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM0"
FT                   /protein_id="ABE33619.1"
FT                   /translation="MLSHEDNETLVRVGPGTPTGQFMRLYWLPFLPSSDLTVDGQPQRV
FT                   RLLGEDLIAFRDSEGRVGLVDHVCPHRGAPLVFGRNENCGLRCVYHGWQFGVDGQVIDT
FT                   PAEPAESRLKDKVRIRSYPCRERNGIVWAYMGEADANALPPLPNLEWNMVPLENVHFSF
FT                   RVQECNWLQAVEGEIDSAHAPILHGRIDSQGAINEWTAKRDLRPVFECQRREFGISIAS
FT                   RRVLDDSHHYWRVNQFLFPFYTLVPPQSKYPELSGHAWVPVDDENTLCLMFSYTPAAPL
FT                   YEKTRKLFEDGHAGRETGHASAHAFAPRPVTQPYAKYWTRFNLESAFQFDYDAQTKTWF
FT                   SGLPGLWVQDAACQSGVAPIYDRRKENLGISDTGVAMTRRLLLENVRKLASERVSPVRV
FT                   DDPDLWMVRAVSLTLPAGAPWQSDGAEHMRARLGADFGYTP"
FT   gene            762054..763016
FT                   /locus_tag="Bxe_B2369"
FT   CDS_pept        762054..763016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2369"
FT                   /product="Putative phthalate 4,5-dioxygenase reductase
FT                   subunit (OhpA1)"
FT                   /note="Citation: J. Bacteriol. 180 (24), 6529-6537 (1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33620"
FT                   /db_xref="GOA:Q13QL9"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL9"
FT                   /protein_id="ABE33620.1"
FT                   /translation="MSQHNADRIDVRLTQIRLEADDVASYEFRPIGTPVLPAFEAGAHI
FT                   DLYLPENRVRSYSLVNAPHERHRYVIAVQREAAGRGGSAWMHRTPRVGDRFTIGAPMND
FT                   FPLCEAARQSVFICGGIGITPIVSMIRRLERTGASWQLHYAARERSRAAYADDLAQIDE
FT                   AGSRITMHLESEGGRLDLRRVVERAPADAHLYCCGPRGMVDAFIEACASRPRAQVHFER
FT                   FAAANESATAGGFDVVLGRDGRRIPVAPGKTILDTLLDHGVDVQYACSAGVCGTCRTGV
FT                   IDGVPDHRDDYLTDEEKAGNRAVMVCCSGSLSPTLVLDL"
FT   gene            763078..764385
FT                   /locus_tag="Bxe_B2368"
FT   CDS_pept        763078..764385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2368"
FT                   /product="Putative L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33621"
FT                   /db_xref="GOA:Q13QL8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL8"
FT                   /protein_id="ABE33621.1"
FT                   /translation="MLSRLVNEFPEHEPRPANAPKALAGIRVVDFTHFIAGPFATMMLA
FT                   DMGAEVIKIEAPGRGDEFRYYPPAHPEDASIGGPYLWANRNKRSIALDLKSAEGRRIAR
FT                   ELVATADIVAENFSTGVMERLGLSYEACRELNPQVIYCSVSAYGREGAFADRLGFDPIA
FT                   QAESGFVSMNGYPDRLGVRALSPVMDISTAMMASNAMLGALVARERTGKGQAVEVSLFD
FT                   NAVLMTGYATVQHLFTGEEPRRHGNTSPDTCPSGVFKAADKAFYINCGNDKIFHRLANQ
FT                   VLEMPELAADPVLADRNGRIARRDELFRILDEAFIRHPWAHWQQRMRAASIPCGEVRTV
FT                   GEALRSPEARERKLVSRLEHPELGWLPNINLPFRFSETPIDDPSPAPRVGEHSRSILTE
FT                   VLGYSGEGADALLRSGSVYSCDQVVAAAGGAEVSAS"
FT   gene            764382..765563
FT                   /locus_tag="Bxe_B2367"
FT   CDS_pept        764382..765563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2367"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33622"
FT                   /db_xref="GOA:Q13QL7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL7"
FT                   /protein_id="ABE33622.1"
FT                   /translation="MTERTLRGQVAVVGVGESEYYRAGHAPDPEFRLLLKAVLAACRDA
FT                   DIDPADIDGFASFADDRNDAVRIATALGVKRLRSTTMQWGGGGGGCAAAVANGAAAIMS
FT                   GMAQCVLVYRGLAQGQFGRFGQAAPRASISGEMAYQMPYGVLAPPQKFAMKVQRFMHEH
FT                   GVRREALRAIALASYQHAQANPRAVMHGKPLTAEAYDASRWIVEPFRLFDCCMENDGAG
FT                   ALLLVAAERAKDFPHRPVYLLGAASGGDWRAAASPHNAPHYASANYSGVSGDLYRMARV
FT                   SPADVGVVQSYENFTGGVAMALSEHGFFHPDEANDFLTPENLVAPSGKLPLNTSGGNLG
FT                   ECYVHGFELVIEAARQVRGESTSQAARHDVALVIGGPMVTPASSLLFGSAATL"
FT   gene            765560..766018
FT                   /locus_tag="Bxe_B2366"
FT   CDS_pept        765560..766018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33623"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL6"
FT                   /protein_id="ABE33623.1"
FT                   /translation="MTDSSASPTYLPAGLPAPVPEPDGLSAPYWAGLREEKLRVQRCAH
FT                   CRTWQFGPEWICHGCRTFDPAWHEVAPRGRIFSWERVWHPSHPALAQATPYLVVLVELP
FT                   HAGHVRMLGNLLGDPRQQVEMGAAVTGVFEHHAEAATPYSLLQWRLST"
FT   gene            766097..766852
FT                   /locus_tag="Bxe_B2365"
FT   CDS_pept        766097..766852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2365"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33624"
FT                   /db_xref="GOA:Q13QL5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL5"
FT                   /protein_id="ABE33624.1"
FT                   /translation="MQLTPPATRESTSRSELVGKMLAFFKERGYESGERLPSERALAER
FT                   FGVGRNALREALSTLSALRVIESRPNSGIYLRRMSTDSSFETIVMLTEMGSEPSMKEVK
FT                   ETLEVRWALEMRTVQLACERRTEGDLDSLASVIDATQAVLSNKGNISVQDTAFHMALAR
FT                   CTHNEVLVRLLNSFYRISESRRFALFADPERGEISAVQHAKLYEAVKKRDVKKAIALME
FT                   THFSRAVEAWNEILGEEPVSGTKRTGKTK"
FT   gene            complement(766944..768173)
FT                   /locus_tag="Bxe_B2364"
FT   CDS_pept        complement(766944..768173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2364"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33625"
FT                   /db_xref="GOA:Q13QL4"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL4"
FT                   /protein_id="ABE33625.1"
FT                   /translation="MKKPMLLAIAIAGTTASAAHAQSSVTLYGLIDQGFNYVSNVQTGR
FT                   AGGALAGKHQYAMSDGATGIGGSRWGLRGSEDLGGGLRAIFTLENGFNINTGGLAQGGL
FT                   EFGRQAYVGLANPFGQVTFGRQYSIVSDMLAPLSEAGEVPGHMGANPDDFDDLGHSIRI
FT                   DNTVKFRSTPYAGVTLGGMYAVGGVAGATARNQVWALAASYANGPFAAAAGYLNARDPN
FT                   LSYFGTAGNSGGNTANNLGSFGSATAGQSNPIYAGFASAATLQLLIAGAKYHIGPASIG
FT                   ATISHAGFGGLGDTSAGPNTLHYAGSAVFNNGEVNASYAFTPAFSVNAAYSYTRKASVG
FT                   VYDGATYQQGTLSSAYFLSKRTELYALAIYQKASGTDSLGQTAVASITQLTPSASDHQL
FT                   LVRLGILHTF"
FT   gene            768758..770140
FT                   /locus_tag="Bxe_B2363"
FT   CDS_pept        768758..770140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2363"
FT                   /product="Putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33626"
FT                   /db_xref="GOA:Q13QL3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL3"
FT                   /protein_id="ABE33626.1"
FT                   /translation="MAYASINPNSGETLKRFDPLTDAQLEQSLASAQACSQTWKQTTYA
FT                   QRAGILNKAAALLRTHVDEFAKLATLEMGKRINEARGEVNFSADILAYYAKHAEAFLAP
FT                   IRLEPKIGEAHMESSPFGVLFCVEPWNFPYYQLARVAGPQLMAGNVLVVKHAACVPQCA
FT                   IAFEKLLIDAGAPKGAYTNLLISHEQAQRVIDDPRIKGVALTGSAAAGKSVAARAGQNL
FT                   KKTSMELGGSDAFIVLDDADLEKTIPWAVWGRMYNGGQTCCAAKRFIVLDSIADRFLEK
FT                   FKAALSELRPGDPMDEKTTHGPLSSESALVQLLKQVDDAVANGATLLMGGKRIDRPGSF
FT                   MEITILTDIKPDNPAFRDEFFGPVVSFFRVKDEAAAIALANDSDFGLGGSVFTEDIVRG
FT                   KRVASSVETGMMFINNIDWSDAELPFGGIKDSGYGRELGNMGIQEFVNKKLVRTAHLDA
FT                   PV"
FT   gene            complement(770320..770634)
FT                   /locus_tag="Bxe_B2362"
FT   CDS_pept        complement(770320..770634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33627"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL2"
FT                   /protein_id="ABE33627.1"
FT                   /translation="MSIYILNEVCKKRVLVRCSRLTSKRSTVDFRTTKKRSTTNISGHP
FT                   KRGMLTFSPRVACPSSSFFSARCRKGRLAAGNLPAWEDRRAEWVAGDLLCEYCLGARGA
FT                   "
FT   gene            770698..771747
FT                   /locus_tag="Bxe_B2361"
FT   CDS_pept        770698..771747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2361"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33628"
FT                   /db_xref="GOA:Q13QL1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL1"
FT                   /protein_id="ABE33628.1"
FT                   /translation="MRKMALACSAALVALGTVTVTPARAEVTLYGILDTYLGYTNAGGK
FT                   GAQTAMQSGGLSASRVGIRGSEDLGGGLRATFDLENGILTNSGAATDSTLAFSRSAWVG
FT                   LGTPYGEFRFGRQNSVLLLMHSKFDAFSGGTYGSFLHNASTFVFRYDNMITYWSPNIAG
FT                   FTFSAGASLGGQTSPHDALNAYVGSIDYQRGPLYLGVSHAEQNGANGKINTKTTFAGGS
FT                   YQFGSLTGYFGYYRGNNLGSNISTNVEGKYHSVYSLSTTYSVTPALRLAAGVGYAQDSS
FT                   GQHNNAGEVSVGAFYSFSKRTLVYGTLERLVNRHGATYALIANGPITPNTPTRGEGVTG
FT                   AQLGILHSF"
FT   gene            771940..772683
FT                   /locus_tag="Bxe_B2360"
FT   CDS_pept        771940..772683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2360"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33629"
FT                   /db_xref="GOA:Q13QL0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL0"
FT                   /protein_id="ABE33629.1"
FT                   /translation="MKDPAAPTVELIDCSNEAKLLSERACSAIRQDILSCVIEPAATLT
FT                   ESALTARYGIGKATCRVALQRLAQEGFVRIVPRQGYVVTPITLKDVEEVFALRLELEPL
FT                   SARLAAGKADIDLLNRLERACRNDDTSLGIGSRIGIFMDANAAFHMAIAECSGNGRLVR
FT                   MLGGLLNDMARLVSLGFGVQNTKPEIRHDHTAMISALASGDGKRAEQIAHRHVATFRDM
FT                   TMEKVMASLRDTHAGAPIVPLRGAR"
FT   gene            772680..773459
FT                   /locus_tag="Bxe_B2359"
FT   CDS_pept        772680..773459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2359"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33630"
FT                   /db_xref="GOA:Q13QK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QK9"
FT                   /protein_id="ABE33630.1"
FT                   /translation="MNAVTTQAMFEKAATTRNAVEVEHVSKHYGKLAVLEDISLTAPSG
FT                   SVLAIVGASGCGKSTLLNIIAGLVQADQGDVRIDGVAGEPTHDTRVVSYMFQEDRLLPW
FT                   RTIVANTEFGLEAGSLNAERRRERALAALKMTGLEGFEHAYPHELSGGMRSRVALARSL
FT                   VVKPYILLMDEPFSKLDPQMRSQMHAELLRIREQLKMTVVFVTHDVEEAIVLADKVVVL
FT                   RPRPGRVRDTLTIDLPRPRDPLAAEVAETVRRVRALI"
FT   gene            773470..774279
FT                   /locus_tag="Bxe_B2358"
FT   CDS_pept        773470..774279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2358"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33631"
FT                   /db_xref="GOA:Q13QK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QK8"
FT                   /protein_id="ABE33631.1"
FT                   /translation="MSSVSTASSVFPARFGRLTRFARVAGQRLSLLAIFLILWWVAAQR
FT                   VPAFILPGPGKTWNALLDLIATGTFAEDLGITLYRVVAGFLLAALVGTPLGILLGANRR
FT                   LGSFCEPVLSVVNTVSAAIWAIFALIWFGISNGTTIFVVFMEAMPLILTNVWQGAQSVN
FT                   AEYVELARSFQMSRSKVMTKIYLPTVLPYFFSGARLAFGFGWRVSLVAETIGSSNGVGY
FT                   RLRQAADLVQTDQVFAWTLTMVVLMVVLEYGILKPLENHLFRWKKRA"
FT   gene            774387..775400
FT                   /locus_tag="Bxe_B2357"
FT   CDS_pept        774387..775400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2357"
FT                   /product="Putative zinc-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33632"
FT                   /db_xref="GOA:Q13QK7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QK7"
FT                   /protein_id="ABE33632.1"
FT                   /translation="MSSTMKALILSEHGDVDKLHVGEMPMPKAVPGHVVIRVRASSFNY
FT                   HDVFTVKGMPGIKVPLPVVIGLDMAGEITEVGDNVENWSVGARVLVNPLNKKKGLMGEM
FT                   LDGGMAQYCLVSADQLIAMPEGVTFEEAASLPVAYGTAHRMLVTHNTIKPGDRVVILGA
FT                   SGGVGTGCVTLAKMLGAEVIAAAGSADKAERLKAMGADHVINYRDTDFSKWVIEKYGKP
FT                   QRRSYEGGADVVINFTGGDTWVPSLKCIKRGGSLLVCGATAGHDPKEDLRYIWSFEIRV
FT                   IGSNSFYDDNLSALMELIRTKKIAVQIDKVLPLEQAAEGLRMIRDREVLGKIVVTP"
FT   gene            775417..775851
FT                   /locus_tag="Bxe_B2356"
FT   CDS_pept        775417..775851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2356"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2356"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33633"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QK6"
FT                   /protein_id="ABE33633.1"
FT                   /translation="MADNQQLTAEQVQAMLTRGPYHQWLGLRVLEVGDGSIEIAATWRE
FT                   EWVVNPERRYTHGGILAALVDLTADWALVSKTGRGVPTIDLRVDYHRAAMPGDLIARGK
FT                   VVKFGSAISVAEAYIYDQSGALLASGRGVYSTAPAPAPKA"
FT   gene            775848..776750
FT                   /locus_tag="Bxe_B2355"
FT   CDS_pept        775848..776750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33634"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QK5"
FT                   /protein_id="ABE33634.1"
FT                   /translation="MMNTATSMLDHVVVNAMFETDAAASCFEALGFALTPRGYHSLGSV
FT                   NHLMMFDGHYLELVGLPPGATTLRREILESRLGIDGLVFKTDDAQGTYARLIDAGVRAS
FT                   DPQSFTRPVDIDGVEQIARFRTTRLAAEE