(data stored in ACNUC7421 zone)

EMBL: CP000272

ID   CP000272; SV 1; circular; genomic DNA; STD; PRO; 1471779 BP.
XX
AC   CP000272; AAAJ03000000-AAAJ03000058;
XX
PR   Project:PRJNA254;
XX
DT   03-JUL-2006 (Rel. 88, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 8)
XX
DE   Paraburkholderia xenovorans LB400 chromosome 3, complete sequence.
XX
KW   .
XX
OS   Paraburkholderia xenovorans LB400
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Paraburkholderia.
XX
RN   [1]
RP   1-1471779
RX   DOI; 10.1073/pnas.0606924103.
RX   PUBMED; 17030797.
RA   Chain P.S., Denef V.J., Konstantinidis K.T., Vergez L.M., Agullo L.,
RA   Reyes V.L., Hauser L., Cordova M., Gomez L., Gonzalez M., Land M., Lao V.,
RA   Larimer F., LiPuma J.J., Mahenthiralingam E., Malfatti S.A., Marx C.J.,
RA   Parnell J.J., Ramette A., Richardson P., Seeger M., Smith D., Spilker T.,
RA   Sul W.J., Tsoi T.V., Ulrich L.E., Zhulin I.B., Tiedje J.M.;
RT   "Burkholderia xenovorans LB400 harbors a multi-replicon, 9.73-Mbp genome
RT   shaped for versatility";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(42):15280-15287(2006).
XX
RN   [2]
RP   1-1471779
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Lykidis A., Richardson P.;
RT   "Complete sequence of Chromosome 3 of Burkholderia xenovorans LB400";
RL   Unpublished.
XX
RN   [3]
RP   1-1471779
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (13-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b96439088653c49f7ee7fb9af31bc96c.
DR   BioSample; SAMN02598451.
DR   EuropePMC; PMC1847439; 17362501.
DR   EuropePMC; PMC1855727; 17172348.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2632904; 19056824.
DR   EuropePMC; PMC2892462; 20504315.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   StrainInfo; 374301; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351477
CC   Source DNA and bacteria available from Jim Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Contacts: Jim Tiedje (tiedjej@pilot.msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1471779
FT                   /organism="Paraburkholderia xenovorans LB400"
FT                   /chromosome="3"
FT                   /strain="LB400"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266265"
FT                   /type_material="type strain of Paraburkholderia xenovorans"
FT   gene            477..1370
FT                   /locus_tag="Bxe_C0001"
FT   CDS_pept        477..1370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0001"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35929"
FT                   /db_xref="GOA:Q13J10"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J10"
FT                   /protein_id="ABE35929.1"
FT                   /translation="MSCIAGLFGSAAQRSAGSAWLLFAGCGVLQVALSYLFCTPLERFW
FT                   PLLRWPVRQPMATDIVYTFIVRIVLFPLAAYFEYGLVKALVERWLLAHQWPVPSLLTRI
FT                   ADVAGTPLAGFLIGFVILDCADYWRHRISHRLGWWYGLHTLHHAELQMTFWSDDRSHLL
FT                   EDIITYVWLFVVAIAIGMPALQFPFVILGFRFVGSFAHANTRARYGWLGERLLISPQFH
FT                   RAHHCPEIARRKSCNFGTVLPWWDMLFGTANFTHDARETGDPTADQIIATGNWWQQHVG
FT                   GVRRMIQLARRRRPAH"
FT   gene            1472..2221
FT                   /locus_tag="Bxe_C0002"
FT   CDS_pept        1472..2221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0002"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35930"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J09"
FT                   /protein_id="ABE35930.1"
FT                   /translation="MAISPEAEKSKVISTPWTARILNVEASNSADLPAGWRDAYRSYRE
FT                   TLDRPDYPCFFGQAAERRGEMFYAFDGERPDVARMTMRRFVELGRDAALARHSLAMFCT
FT                   PDPALVSHAEFLRRFWYILRQLHEADDMPMRPADPDDPLWEFSFGGRKMFVVGTGPTYR
FT                   RRRSRVVGNGIVLLFQPRELFTDPTTGKPISAEVRRQIHARMLAYDAMPVHPDIGFYGD
FT                   PRNREWKQYCLPDDNTPVTGRCPFASR"
FT   gene            complement(2190..2561)
FT                   /locus_tag="Bxe_C0003"
FT   CDS_pept        complement(2190..2561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35931"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J08"
FT                   /protein_id="ABE35931.1"
FT                   /translation="MAISIFIGPPIRPTVPPASRREQGAWQAHPGGHGIRLQVGTVDEI
FT                   RLFRSGSGHLGPGCFSYGKQARNFWLIPIPWLPKATPAAIGAKAAFAFPLPRTFERPFC
FT                   QEKAILRHAISGWRTGNAR"
FT   gene            2708..6364
FT                   /locus_tag="Bxe_C0004"
FT   CDS_pept        2708..6364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0004"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35932"
FT                   /db_xref="GOA:Q13J07"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J07"
FT                   /protein_id="ABE35932.1"
FT                   /translation="MEARQNTNHREQVTSDKRWQFWVDRGGTFTDIVARKPDGQLVTHK
FT                   LLSENPGRYKDAVVQGIRDLLGLGDDEALPQERIEVVKMGTTVATNALLERKGARTLLA
FT                   ITRGFADQLRIGYQDRPDIFARHIELPTQMYERVVELDERIDAHGDVLTPLDEAAAGAA
FT                   LQEACKAGVTSIAIVLMHGYRYPQHELRVAELAREAGFTQISVSHQVSPLMKLVGRGDT
FT                   TVVDAYLSPVLRDYVDRVSQHTGNVPLMFMQSSGGLAEAARFRGKDAILSGPAGGIVGA
FT                   VKTCEAVGERKVIGFDMGGTSTDVAHYDGAYERIFETQVAGVRVRAPMMDIHTVAAGGG
FT                   SICSFENGRFKVGPESAGAYPGPACYRNGGPLTVTDCNVMLGRVQAEHFPYVFGPNGDQ
FT                   PLDADVVCRKFTELALQVRRETGREMSAEAVAEGFLTVAVDNMAQAIKTISVERGHDVS
FT                   GYAICAFGGAGGQHACAVAEALGMRRILLHPFAGVLSAFGMGLADLRVLRERAVEAPLD
FT                   AVSVASLAQPYDALEQDALGEILAQRIPRERAHVTRAARLKYQNTDSTLEVPFGDACVM
FT                   RDAFETLHRKRYGFVMANKSLIVESIVVEAVGLTESPTLQRAAPRVANTAPADAQVTMF
FT                   VGGRAKRVPLQVRRELAMGSRIDGPALITEEISTIVLQPGWSATVLEDGTLRLDRLADT
FT                   ATDAAQRAAQAITTARHPVHLEIFNNVFMSIAQQMGVTLEKTSYSVNMKERLDFSCAIF
FT                   DPAGGLIANAPHIPVHLGSMSDSVLSVIREHGATMQRGDVYMLNVPYNGGTHLPDITVV
FT                   MPVYGDDGALLFYVAARGHHGDVGGITPGSMPPNSTSIEEEGVLLDNVKIVEAGTFLEM
FT                   PVRALFSAGEYPSRNVDQNIADLTAQIAACECGATELLRTVSRYGADVVLAYMGHVQDN
FT                   AEEAVRAAIAALGDGEFAYEMDDGAVIRVKVSIDHARRQARVDFTGTSEQRVTNFNAPR
FT                   SVCKAAVLYVFRTLLTDGIPMNEGVLRPIDIVIPHGSMLNPVYPAAVVAGNVEVSQSIT
FT                   DALYGALKVMAGSQGTMNNFTFGDEAQQYYETIAGGSGAGRTHPGTSAVQTHMTNSRMT
FT                   DPEVIEWRFPVIVEEHAIRAGSGGSGRQPGGDGAVRRIRFRQTMTANILANRRRVAPFG
FT                   LAGGENGQVGRNWIVRANGNVELFGATHTTTVQPGDVFVIETPGGGGYGRVE"
FT   gene            6440..7225
FT                   /locus_tag="Bxe_C0005"
FT   CDS_pept        6440..7225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0005"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35933"
FT                   /db_xref="GOA:Q13J06"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J06"
FT                   /protein_id="ABE35933.1"
FT                   /translation="MQSAVNLYPLFGVVVIVAGFLLRFNPMLIVTVAAIITGLAAHFPV
FT                   DRILIAIGSGFVKTRVIPLIILFPLAVIGLLERHGLRERAQTWIGGIRAATPGRLLIAY
FT                   LFVREITAALGLTGLGGHPQMVRPLVAPMAEGAALARFGKLRDPARFRLRAFAAATDNV
FT                   GLFFGEDIFVAFGAIVLMVTFLKETGIVVEPMRVALWGMPTALAAFLVHSFRLYRLDGW
FT                   LGRHAAADEDAASANEPSVDAPGNPRRDGVVGAGQGEQA"
FT   gene            7222..8178
FT                   /locus_tag="Bxe_C0006"
FT   CDS_pept        7222..8178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0006"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35934"
FT                   /db_xref="GOA:Q13J05"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J05"
FT                   /protein_id="ABE35934.1"
FT                   /translation="MILSLNVLFWLLGILLVVIGGLIVGDRAHPKRFFAGGFWIVYGLI
FT                   FLVGDRLPADVVGVLVVAMALVAGFGGVVGARPRLRSDDERRASAQRLGNQLFLPALTI
FT                   PFVTVIGTLLTPHLVFGGIALIDPKNATLVSFGVGCVVALVLACRLTRDTLGQAVKEAR
FT                   RLVDSLSWAVVLPQMLGMLGLVFADAGVGKAVAHLTTSYIDLDYRFVAVVVYCAGMALF
FT                   TIIMGNGFAAFPVMTGGVGVPVLIGVFHGNPAPMVAIGMFSGYCGTLLTPMAANYNIVP
FT                   AALLELPDKYGVIRAQVPTALVLLVINIFLLNTLMYI"
FT   gene            8232..9206
FT                   /locus_tag="Bxe_C0007"
FT   CDS_pept        8232..9206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0007"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35935"
FT                   /db_xref="GOA:Q13J04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J04"
FT                   /protein_id="ABE35935.1"
FT                   /translation="MSAFWPFRLTTGCNVNLKFLETFIWVAKLRSFSLAADKLHSTQAA
FT                   ISSRISVLEQELGAKLFTREPKGVALTRAGERVLQHAEQVNESMTRLYASLQDEKFAFG
FT                   TIRIGAMDSAIHSWFVNFVSDVMHYYPNLDIEVTSETALNLNEQLRRGMLDMVIQTDML
FT                   RDETIRSIEVLELSMGWVAAANSPIVSQEAYDTPTAALRGLGRERLITYSRHSRPHQDL
FT                   LRLMQSYGIGESRVSCVNSVAAMIQLTQAGFGVAAMPPALVPELLNSGVLRQLEGLEAP
FT                   PPLPFVIAWRSGTNWTERLVEVAVETVSKYAARLGQDAARLVV"
FT   gene            9459..10556
FT                   /locus_tag="Bxe_C0008"
FT   CDS_pept        9459..10556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0008"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35936"
FT                   /db_xref="GOA:Q13J03"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J03"
FT                   /protein_id="ABE35936.1"
FT                   /translation="MKKLIFGASVALMCSGAYAQSSVTLYGLIDEAIRFQTSGSGNTLG
FT                   MNEGAINGNRFGLKGKEDLGGGSYAIFQLESGFNVANGKFDQQSQLFGRFAWVGLQNDT
FT                   YGTLKAGRQYGGIYNFYAFNFDPIGGGNINATDWSLFLTGIRFDNTVEYDNRFGPVALQ
FT                   VQHSFGGQAGSASSGSTTTASLIYNFNGGKVGVDGAESKDGTGHKLLVGSAGGTYAWGP
FT                   VGLYLYGINARRDAGFSVAATNSGLPLSNTNLISNATTAFGPQTKARDDMFVRAGVTYQ
FT                   AAPQWKLTASYAYDHANNVAPGQNGTIQTVYGIVDYLLSKRTDVYLEVDHSHLAGASID
FT                   DPNGPLTFGGKANNFGAGLSLRTLF"
FT   gene            10717..12252
FT                   /locus_tag="Bxe_C0009"
FT   CDS_pept        10717..12252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0009"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35937"
FT                   /db_xref="GOA:Q13J02"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J02"
FT                   /protein_id="ABE35937.1"
FT                   /translation="MSQLPASLPDSISGLAPTVATAHAASARTLRTSNTARLWLAVRTA
FT                   LAPSTRMSGRRIRGLIEDLRMASTRIGVEAARLGQCIATTSGLVREQRELANAAETRSV
FT                   TVAQAVAGARRHVDTVCHETANNLLVIQDVHRDLTGVSTLNHTTSERLGDVVQGIGTLQ
FT                   RRTTRIRDVVQLIEGVSAQTKLLAINASIEAARAGVAGRGFAVVAAEVKLLAQRVQDAN
FT                   RSISDIAKQTMTDIDVLRGQIEHVHTDSGNCTQVIERSVRHFVEVVKALESTDHNMALV
FT                   GRAFEEIYHANIALSSQIRDINLRSAGVVDAMTTAQTSSGVLRDETENLHGIGSTLPVR
FT                   GSAHDSLLADVEAFRDRVQRYLDDAARSGLDVFDQCYREVPGTSPQKYTTSYDEAVEAE
FT                   LQRLFDAMLEARPELIFAVAYDSNCYMAAHHRRFSAPLTGDPQTDLRASRHKRIFADDT
FT                   GKRSATFRGHHLLQTYLRDTGEVACVFSMPITIGGRHWGCVRVAFEPQLLLDA"
FT   gene            complement(12370..13275)
FT                   /locus_tag="Bxe_C0010"
FT   CDS_pept        complement(12370..13275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0010"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35938"
FT                   /db_xref="GOA:Q13J01"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J01"
FT                   /protein_id="ABE35938.1"
FT                   /translation="MKRILPPLNALRAFEAAGRLGSFKEAAAELHVTHGAVSQHVRLLE
FT                   EWLGASLFDRYNRRVTLTPAAKVYLEEIGPLFERLSQATARYGVAETVSRTLSVNAPAT
FT                   FTLRWLVPRLAKFRAAHPDVDVNVETSNRPLESLKEDYDIVIRGGPDTFYGYSMRPFLS
FT                   EERLPVCSPALLQRVPLRSPGDLQQHTLLHTSSLPRLWPDWLASAQIPALRPAATLTFD
FT                   HFYLTLQAAIDGIGIAMGPTALVSADLAAGRLAAPFAGPRLPSRSYCTYVPDAKFGDER
FT                   VMLFRSWLEREGTCRRFADS"
FT   gene            13396..14238
FT                   /locus_tag="Bxe_C0011"
FT   CDS_pept        13396..14238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0011"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35939"
FT                   /db_xref="GOA:Q13J00"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J00"
FT                   /protein_id="ABE35939.1"
FT                   /translation="MLSYTGGTVLFAALLHASWNAMLHGNRDRFLSMTWMSIAIAVVAT
FT                   LVVLSTPWPASAAWPCIVASGLVHILYNVSLVRSYRRNNLAQAYPIARGSSPLLVTLGA
FT                   ALFAHEAIGPLHALGIAMISGGIIAIALQGRRVSRAGALTALTTGATIALYTVIDGIGV
FT                   RLSNGQPLTYTAWMFLFYWLMPVLFVAVRGLAPLWTPVRAEPLSVGSSLVGGLVSIAAY
FT                   GIVIWALQSGAMGAVSALRETSVVFAVLIGRVFLREAVSGTRWLACMVVAAGAVCLGL"
FT   gene            14332..15093
FT                   /locus_tag="Bxe_C0012"
FT   CDS_pept        14332..15093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0012"
FT                   /product="Putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35940"
FT                   /db_xref="GOA:Q13IZ9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ9"
FT                   /protein_id="ABE35940.1"
FT                   /translation="MDTVSQAPLILITGGGRGIGAATARLAAAQGYDVAISFVSNESAA
FT                   LAVAADVEAVGRRALPMRADSADPEQVAQLFAALDRQFGRLDVLVNNAAIIAQQSRLED
FT                   LGFERLQRIFAVNSIGPILCAQQAVKRMSRRHNGRGGAVINISSASAQLGSPNEYVDYA
FT                   ASKGALETFTTGFAKEVARDGIRVNCIRAGHIYTDMHASGGEPGRVDRVKDSIPMGRGG
FT                   QPEEVARAILWLAGAEASFITGTFLDVTGGK"
FT   gene            15595..17154
FT                   /locus_tag="Bxe_C0013"
FT   CDS_pept        15595..17154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0013"
FT                   /product="Putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35941"
FT                   /db_xref="GOA:Q13IZ8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ8"
FT                   /protein_id="ABE35941.1"
FT                   /translation="MHSHHQHIYDVVIAGAGPVGLFLACELRLLDLSVLVLERAEDPHS
FT                   PLKRLPFGMRGLSAATLEAFYRRGLLVELIAAQRANDGAGKTGAAAHWMHQPRRPAGHF
FT                   AGIQFYHDDIDSSKWPYRLPSPADTSMAVELETLETVLARRASAMGAEIRRGFSVDDFL
FT                   ASDADVTVRAGGETFRGRWLVGCDGGRSTIRNAGGFEFFGTDPEFTGYSAEVEMADPQA
FT                   LRAGRHYTPTGTYTYTRPGTIAMVEFDGGAFHRIQPITLEHVQAVLRRVSGIDLTLTGL
FT                   HLATTWTDRACQATAYRKGRVLLAGDAAHIHSPLGGQGLNLGLGDALNLGWKLASTIRG
FT                   DAPAGLLDSYQVERHPVGAQVLDWSRAQVALMRPTQSTRALEAIVRDLIQTRDGATYFA
FT                   GRVWGISLRYELGGSHPLAGRSVPDFEFADGTNCGNLLREGKGLLLDFDTNASLQSLAN
FT                   HWRDRVTYAAGEVRDRLGLRAVLVRPDGFVAWASEATPDNEEAAQIISRWFGEPEDRVG
FT                   SA"
FT   gene            complement(17213..17641)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0014"
FT   gene            17726..20269
FT                   /locus_tag="Bxe_C0015"
FT   CDS_pept        17726..20269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0015"
FT                   /product="Putative diguanylate cyclase(GGDEF)/
FT                   phosphodiesterase(EAL) with PAS/PAC and GAF sensors"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35942"
FT                   /db_xref="GOA:Q13IZ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ7"
FT                   /protein_id="ABE35942.1"
FT                   /translation="MAQAQIAGTLVQVLAQIPDAVVLVDEDGAIGFFNPAAEALWGLTA
FT                   AAVLGADAGMLLPRGIQPAGHGVQTGNVDGPGLALQIERNDGVMRRGQMSIHGFEVAGR
FT                   RFRAAFIRDITDQHRQCEEWQQLLRVVNGSDNAIIVASLDGSISFINSGVTRMLGYAAA
FT                   EVQGLRLVEPFAGVHTNMAAVERIQSAAREPSTPDHPFRQDLLVYTKGGRPLWVNVGIT
FT                   VITDNAGAPVNLLAVLTDITLTRMREELQQKVLDAMARELPATEVAGILCREVERIAPE
FT                   VVATFLRVDDGRLFTLAAPRLPVTVTRAMDGESIGPCAGSCGTAAWRGTPVVVTDIASD
FT                   PLWTGYRDLVLPLGLAACWSYPVKGADGSVLGTFAFYYRENHGPVAFHQSLVDMGLSLC
FT                   ALLLEREKARMRIHQLAFHDTLTGLPNRNMFETQAQQLLNDARRTERELALVFIDLDHF
FT                   KRVNDTRGHATGDEVLCETGRRFKSVLRDGDLLGRLAGDEFVAILPHCGVHQATGIVER
FT                   LLAATAPPVVVAGAPIHASASIGIAMYPADGEHVPTLLRQADIAMYHAKARGRGHFCFF
FT                   REEMSRNIQEQAMLEADLRVALKHDLLDLWYQPQFDAANGHVLSGVEALLRWNHATLGS
FT                   VPPVRFVVLAEECGLIGELGKWVTQRACRQLADWRARGVEIPRVSINLSASDFRDSTLA
FT                   ERVARTLLAHGLQPHDLTLEMTESVMLGDEPGVLSMIDELHRLGIQLSLDDFGTGYSSL
FT                   GYLHRLPLDELKLDRSFVRDLDHSDSARALTSTVLRIGESLNIKVVAEGVETDTQRQFL
FT                   VEHGCPVLQGYLLARPMAPHLLEEWLRAAHAGSRI"
FT   gene            20514..21803
FT                   /locus_tag="Bxe_C0016"
FT   CDS_pept        20514..21803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0016"
FT                   /product="Putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35943"
FT                   /db_xref="GOA:Q13IZ6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ6"
FT                   /protein_id="ABE35943.1"
FT                   /translation="MKSVFDRTKQRHSRPALPAFVTSRVERYYRERVQETWGGGHIMRG
FT                   RIAGPDALHLSSNDYLAIARHPDIIGSMAATLLENGNGLLMSGIFLHGDCPQLQFENRL
FT                   ATFMQAEAGVLCQSGYAANTGLIQSIASEQTPVYIDMMAHMSLWEGVRSAGAVPVAFRH
FT                   NDAAHLEQQIGRYGQGIVLVDSVYSTTGSVCRLVSLADVCERHACVFVVDESHSLGTHG
FT                   PRGAGLVVELGLQSRVAFRTASLAKAFAGRAGFISCPVDFQEYFKFESNPAIFSSTLLP
FT                   HEISGLDATLSVIECADRRRTRLASSAAWLRQRLTELGYNLNGSRSQIIALEAGTEQRT
FT                   IVLRDALESRGIFGSVFCAPATARNRALIRLSIHAALSDAQVEKIASVCRDIRSEVELD
FT                   KWPSTRRLGDELSARRRQRETASEETAVTA"
FT   gene            complement(21847..22848)
FT                   /locus_tag="Bxe_C0017"
FT   CDS_pept        complement(21847..22848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0017"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35944"
FT                   /db_xref="GOA:Q13IZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ5"
FT                   /protein_id="ABE35944.1"
FT                   /translation="MHTIKPFYFPTTVTFVDDSAAFLSNLCLQLDPQLAFRLFSSPGEA
FT                   LEFVNSRPRPGPSDEPLFAPFRDRTDEDLAHQVIALSVNTVRKQVHNAQRFLATSVVVV
FT                   DYDMPGMNGLEFCRRMTDPAVRKIMLTGKADEHIAVQSFNEGIIHRFIRKQDASAVPAL
FT                   NRAVRDLQNAYFDDVCQSILDTLAVSEYAFLRDEALAARVAELAASLGIVEHYLSYCPG
FT                   GLLMLDSAGKSYLLIVHTDETLRGLREIAVEQEAPAEFLAALDSRRSLPYFWQTEGHYP
FT                   ADCTAWENYMHPATQFSGRQNYVYAVIPNPPGLDLSQVLSYDRYLERLDRDL"
FT   gene            complement(22851..24080)
FT                   /locus_tag="Bxe_C0018"
FT   CDS_pept        complement(22851..24080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0018"
FT                   /product="seriplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35945"
FT                   /db_xref="GOA:Q13IZ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ4"
FT                   /protein_id="ABE35945.1"
FT                   /translation="MRPFAMVAIVGFPLYFYVWHALFPQPYENLPLRLVGSALFIPILF
FT                   SDRWPARTRKFLPYYWYATIFYSLPFFFTFMLLKNNGSNVWIESALIAAFVMVLLLDWF
FT                   MLLLNFVTGIGVAYLAYWLTTDPVVLHAAYAAHLAIFSFAVAIGVVANYDMDRIRIEQE
FT                   RAMLATASSIAHELRTPLLAIRAGASGLGHYLPSLLETYSIAQQSDLPVPKIRLVHLQS
FT                   MDGVLSRIEQEAIHSNAIIDMLLANARFTGGYTHGAAVCSIAQSVRTALERYPFREGER
FT                   ERVLTDLAMDFTFHGSEMLMVHVLFNLLKNALRGMASVDSALISIRLVSGPRTNQLLFR
FT                   DTGAGIAPDVLPHIFTRFYTSSAGIDDASIGTGIGLAFCRDVMRGVGGAIDCKSVEGMF
FT                   TEFVLTFPRP"
FT   gene            24930..26252
FT                   /locus_tag="Bxe_C0019"
FT   CDS_pept        24930..26252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0019"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35946"
FT                   /db_xref="GOA:Q13IZ3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ3"
FT                   /protein_id="ABE35946.1"
FT                   /translation="MGPKAPVTEKDLFRHPLREQINLKHPLVRLAGLINWERLSASMSA
FT                   SFVSGKGRPASSPRLIAGLLYLQHAFDLSDEDVVWQWVENPYWQVFTGETYLQTEPPID
FT                   PSSLTRWRKRLGEAGVEELLAETIDAAKRAGVIKASSAKRVIVDTTVMPKAIAHPTDSR
FT                   LLERCREHLVKAAARHGLKLRQNYNREAPRLATQISRYAHAKQYRRMRKAVRTLRSRVG
FT                   RVMRDVERQLDTVVDNRRADLQELIARTKRILTQKTKDKNKLYALHAPEVECLAKGKAR
FT                   TPYEFGVKVSITTTHREGLVVGARSMPGNPYDGHTLEEALEQAAILSDVKPEIAIVDRG
FT                   YRGAEPDGVKVYHPGLRRGITRTLRAMIRRRSAIEPAIGHMKADGKLDRNWLKGALGDA
FT                   INAVLCGAGHNLRMILRKLRRFYVLVLAALLNRSAASASTP"
FT   gene            26316..27263
FT                   /locus_tag="Bxe_C0020"
FT   CDS_pept        26316..27263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0020"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35947"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ2"
FT                   /protein_id="ABE35947.1"
FT                   /translation="MAFGASSSRAFAQELALYTGPLTGEHSHSYSWSIDYTEGFGRYFA
FT                   SSITWLNEGHIPDHHRDGPVVQLWGRLPLMERRFVVALGVGPYRYFDTEAATQGAGYSN
FT                   THGWGVVYSARASWYSSQRWTANLQLNHVQVTNGASTTAVMFGVGYQLDAPGTPGARDF
FT                   ALPRASKVTNNEITLMAGATILNSLESQTSTAQAIEYRRGLTNYLDATLGYLHEGNGLS
FT                   ARRDGATAQLWLTRAFLNDHLALGVGVGAYAAIHHGDSSDNRDTGDGILSGLVSISASY
FT                   RITQHWSARLTWNRVMTRYSRDTDVILGGVGYRF"
FT   gene            complement(27563..28561)
FT                   /locus_tag="Bxe_C0021"
FT   CDS_pept        complement(27563..28561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0021"
FT                   /product="Putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35948"
FT                   /db_xref="GOA:Q13IZ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ1"
FT                   /protein_id="ABE35948.1"
FT                   /translation="MMQIHPQARTTPVVRAEIARSTEPTSVVARRYGISAETVRKWRKR
FT                   GEQACQDRSSRPKRLRWRASEEERAIICAVRRATGFPLDDLGFVLGHFLPHLNRDSIYR
FT                   VLKSEGLNRRPPKPTSLPEKGQGRFKEYDLGYVHIDVKHLPKLRTADGEVRKRYLYVAI
FT                   DRCSRFVHLAVYDAENTTNAIAFLAQARKAFPFRITHVLTDRGSCFTADDFERACAKLK
FT                   VTRRVTKPYTPQTNGMVERFNGRVASEVLGINIAGHADLEVLLKSFNRAYNRRRQRVLK
FT                   GSSPIDKVDQRLKLNGCLANPLYKPPADQEYLLSKVDRILVYANEVSQPDR"
FT   gene            28889..29749
FT                   /locus_tag="Bxe_C0022"
FT   CDS_pept        28889..29749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0022"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35949"
FT                   /db_xref="GOA:Q13IZ0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ0"
FT                   /protein_id="ABE35949.1"
FT                   /translation="MNDRQDIAPDSTAARVALWRALHVELDPPPHVMEDEIGLQLLAPG
FT                   EDWRHRGDMDPRFTRPFRASIVARARFVEDLVVEQAGRGLTQYVILGAGLDSFAQRRPE
FT                   IASRLRVFEIDRPGPQAWKRQRLVELGFGMPDWLRFVPVDFGAGQGWRGGLATAGFDDS
FT                   KPAIVVSTGLSMYLTRDANAATLREVAALAPGSTLAMTFLLPLERADPELRPALEMAEK
FT                   GARAGGTPFLSFFTPAELVALAHQSGFGEARHVSAADLTRRYFADRTDGLRPPNNAEEL
FT                   LVAKT"
FT   gene            complement(30007..30768)
FT                   /locus_tag="Bxe_C0023"
FT   CDS_pept        complement(30007..30768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0023"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35950"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY9"
FT                   /protein_id="ABE35950.1"
FT                   /translation="MTTHLTGTREQWLAARRELLKAEKEWTRRGDELARQRQALPWVQV
FT                   DQTYRFETDEGDASLAGLFKGRSQLLIYHFMFGPDFQAGCPSCSAIADGFDGFAVHLAN
FT                   HDVMLWAVSRAPLAKLLAYKRRMGWTFPWASSVGDFNFDFNVSFTDEQQRNGDIEYNYE
FT                   RGGHAMDTTPAPQPVVEFAAMSGTDAATYSRERPGVSAFALEEGVVYHTYSAYARGVDA
FT                   LWGMYQWLDRAPKGRNESGIWWRRHDEYDGR"
FT   gene            30904..32124
FT                   /locus_tag="Bxe_C0024"
FT   CDS_pept        30904..32124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0024"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35951"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY8"
FT                   /protein_id="ABE35951.1"
FT                   /translation="MDSLITAAARALAAGDPLGALDRIALRDDAPALALRGIAMAQLGD
FT                   LVRAKALVRSAARAFGADGAVARARCIVAEAEIALASRELGWPAKALDAARATLEAHGD
FT                   RLNAAHARYLEVRRLALVNRLREAEQTLAGLAPALLPPALRAVHELAVAELALRRLRTK
FT                   AARTALARAARAARRAGIPALTAEVEHASLVLSTPAARLIAHGEERLLLLDEVEALLAS
FT                   RGLVVDACRHAVRDADTVISLASRPVLFALARALGEAWPDDVPRDTLVARAFRARRADE
FT                   SYRARLRVEIGRLRAELGTLAGVSATRRGFALTPRGPAEVVVLAPLVEGEHAQVLAFLA
FT                   DGESWSSSALALVLGASQRTVQRALDSLATAGKVQSFGRGRARRWITPPVPGFATTLLL
FT                   PTFLSDD"
FT   gene            32134..32820
FT                   /locus_tag="Bxe_C0025"
FT   CDS_pept        32134..32820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35952"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY7"
FT                   /protein_id="ABE35952.1"
FT                   /translation="MNRSAATIIREYGPFPGVDKVHGVTYDGQQVWIAGGDRLNAIDPA
FT                   SGETLRSIELAADAGTAFDGKHLFQIGGGRIQKIDPNTGRVLATIPAPGGGGDSGLTWA
FT                   EGTLWVGQYPARKIYQIDPETGAILRTIESNRFVTGVTWADGELWHGTWEDGASELRRV
FT                   DPRTGEVLESIGMPVGAGVSGLESDGGDGFFCGGGDSGKVRAVRRPTGEHAHSSGSGIP
FT                   VDSASD"
FT   gene            33148..33414
FT                   /locus_tag="Bxe_C0026"
FT   CDS_pept        33148..33414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35953"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY6"
FT                   /protein_id="ABE35953.1"
FT                   /translation="MATRTMGADRFAATLSWLERGAVRGVRWDRRIPADRISRNPVAEK
FT                   AKVSVAANGAPSAQERAAIGLVRELAGRYRETADAASTGPRWP"
FT   gene            33416..34015
FT                   /locus_tag="Bxe_C0027"
FT   CDS_pept        33416..34015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35954"
FT                   /db_xref="GOA:Q13IY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY5"
FT                   /protein_id="ABE35954.1"
FT                   /translation="MARTDLAVLAGVAILALACLVVCSMYVYWSSDRYRDRQRRLEPQA
FT                   TGTPTRARATGRNDARFSGVGATMGTQLSHRCKTSLYRAVLGGARHESIAFLMADSRDD
FT                   ARTRAISAVAAIHGIAPRDVPLCKLASFRELIDIGVSEDEELRIFEMAWKGMDVSGWAE
FT                   HPLFLTDDPSLLGKWAELYADLARQLATSAIDRARG"
FT   gene            complement(34233..35036)
FT                   /locus_tag="Bxe_C0028"
FT   CDS_pept        complement(34233..35036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0028"
FT                   /product="Transcriptional regulator, LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35955"
FT                   /db_xref="GOA:Q13IY4"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IY4"
FT                   /protein_id="ABE35955.1"
FT                   /translation="MKSSESAAATASERRAETFQHKLEQFNPGIVWLDPQGHVSAFNDV
FT                   ALHILGPAGEQSLGVAQDHLFGIDVVQLHPEKSRDKLRFLLQSRDAGGCPVRSPPPVAM
FT                   MINIPDRILMIKVSKMTGAAGTCGSCMIFYDVTDLTTEPSSQPAGASVPAPRRLFKIPV
FT                   YRKSRVILIDLKDIVRFQGDGHYTTIVTKDERYLSNLSLADLELRLDSSVYLRVHRSHI
FT                   VSLPYAVELVKLDESVNLVMDDAEQTQVPVSRSRTAQLKELLGVV"
FT   gene            35467..36333
FT                   /locus_tag="Bxe_C0029"
FT   CDS_pept        35467..36333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0029"
FT                   /product="Putative carbon monoxide dehydrogenase, medium
FT                   chain (CoxM)"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35956"
FT                   /db_xref="GOA:Q13IY3"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY3"
FT                   /protein_id="ABE35956.1"
FT                   /translation="MIPRPFEYHVPRTLPEALALLGEYGDEAKLLAGGHSLLPMMKLRF
FT                   AEPGHLIDLGKLAELKGIREADDEIRIGAMTTENELIWSELLQTRCPLIVEGARQISDP
FT                   QVRYRGTLGGDLSHGDPGNDHPALMMALGASFVLAGEQGERVVSAASFFVSTYTTLLEP
FT                   GEIMTEIRIPTPPAGTGYCYAKLKRKTGDFATAAAAVTLRIGTAAVGEVRIALTNVAET
FT                   AIRATAAEQYLQGKPLDEPAIAEAARLAMAVCAPVADLRGDVEYKTAMAGEMTRRALIT
FT                   AYARAAH"
FT   gene            36380..36901
FT                   /locus_tag="Bxe_C0030"
FT   CDS_pept        36380..36901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0030"
FT                   /product="Carbon monoxide dehydrogenase, small chain(CoxS)"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35957"
FT                   /db_xref="GOA:Q13IY2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY2"
FT                   /protein_id="ABE35957.1"
FT                   /translation="MSRKIMVSFKLNGKETDVVVEPRELLIHTLREKCLHTGPHIGCET
FT                   SHCGACTVDFDHMSVKSCTMLTVQAEGAEVLTVEGLAQAGELHALQEGFMQEHGLQCGF
FT                   CTPGMLMRAYRLLQENPDPGEADIRYWMAGNLCRCTGYQNIVKAVQYAARKLRGEAVET
FT                   SHPLMTADTH"
FT   gene            36918..39329
FT                   /gene="coxL"
FT                   /locus_tag="Bxe_C0031"
FT   CDS_pept        36918..39329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL"
FT                   /locus_tag="Bxe_C0031"
FT                   /product="Carbon monoxide dehydrogenase form I, large
FT                   chain"
FT                   /EC_number="1.2.7.4"
FT                   /note="Citation: Appl. Environ. Microbiol. 69 (12),7257-
FT                   7265 (2003)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35958"
FT                   /db_xref="GOA:Q13IY1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY1"
FT                   /protein_id="ABE35958.1"
FT                   /translation="MGHLDTNLDRLAALEGMGCARKRREDPRFIQGKGTYVDDVKMPGM
FT                   LFGVMVRSPYAHARVKKIDKSRALAHPGVHAVLSAADLKPLKLHWMPTLAGDVQAVLAD
FT                   EKVCFQNQEVAFVVADDRYVAADAAELVEVEYEELPPVVDPLTALAADAPVIREDIQDK
FT                   QAGAHGARKHPNHIFTWQVGDKDKTDRVFDNAEVTVKQAMLYPRVHPCPLETCGCVASF
FT                   DKARGDLTVYITSQAPHVVRTVVGLLSAIPESKIRIISPDIGGGFGNKVGVYPGYVTSI
FT                   VASIVLGRPVKWIESRAENLSSTAFARDYHMTGELAADRGGRIKALRVHVTADHGAFDA
FT                   CADPTRWPAGMFHVCTGSYAIPNAFVSVDGVYTNKFPGGVAYRCSFRVTEAVYLIERMV
FT                   DVLAQKLGIDKAEIRLRNFIRKEQFPYATPLGLEYDSGDYEPALNKVLAAVDYPALRAE
FT                   QAARRADLTAEWLLGIGVVNFTEIVGAGPSKMCDILGVGMFDSCEIRVHPDGSAIARMG
FT                   TITQGQGHQTTYAQIIASEAGIPASLITVEEGDTSTAPYGLGTYGSRSTPVAGAAVARA
FT                   SRKIREKARQIAAHLLEASPNDVEFDLDRFVLKGSPEQFKTIKEVAWAAYNNVPEGLEM
FT                   GLEAVDYYDPPNFTFPFGAYVCVLEVNRYTGETRVRRFYALDDCGTRINPMIIEGQIHG
FT                   GLTEGFAVAMGQELPYDEAGNLLGGTLLDYFVPTSAETPHWETDFTVTPSPHHPIGAKG
FT                   VAESPHVGSIPCFTAAIVDAFAHLGVTHMNMPHNAYRVWQQCRVLGLARQ"
FT   gene            39430..40050
FT                   /locus_tag="Bxe_C0032"
FT   CDS_pept        39430..40050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0032"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35959"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY0"
FT                   /protein_id="ABE35959.1"
FT                   /translation="MKVVLEKVFPLAATADSAWQLMQDIEAVAGCMPGAKITERVDATH
FT                   YKGTITVRLGPATMSFKGDIEVLDLDRASRRLHLTGKGADASGTSAASMDLVAAVRATG
FT                   ESCELTGKSEVTMSGKAASLGGRLMGPVSEQMLRQFVANFAARLPAVQAQQTALPGGAA
FT                   QPQTQPPAATPDTAAPPSELNGLALAWAVVRDWLRGIFSRKTA"
FT   gene            40066..40959
FT                   /locus_tag="Bxe_C0033"
FT   CDS_pept        40066..40959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0033"
FT                   /product="Putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35960"
FT                   /db_xref="GOA:Q13IX9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX9"
FT                   /protein_id="ABE35960.1"
FT                   /translation="MATDRMHDVIKLQEQLARHGFIAGRGFAAALLLTMEMRRPLLLEG
FT                   EAGVGKTEVAKALARLLDTRLIRLQCYEGLDAHSALYEWNYQHQLLAIKLFEQDDRPIP
FT                   DKEQDIFSERYLLKRPLLEAITTTPAPVLLIDEIDRTDEAFEAYLLELLSDFQMSIPEL
FT                   GVIRPAERPFVILTSNGTREISDALRRRCLYQYVDYPGFEKELLIVRTQIPDVPEKLAR
FT                   QMVEFVQSVRQMDLRKKPGLAETLDWVAALLRLGVSAIDADGVERIIDSLAALVKTRED
FT                   QAGLTRPVVEKLVASC"
FT   gene            40953..42155
FT                   /locus_tag="Bxe_C0034"
FT   CDS_pept        40953..42155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0034"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35961"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX8"
FT                   /protein_id="ABE35961.1"
FT                   /translation="MLTGIDGAAAPRPQPSGLEEALTARYAGFAGWLRANDFQVTGSDV
FT                   AASMEVALRMGQLDSQVLRWSLRALLCSRAQEWRRFDELFDAYFFAPNRRKQVETRAGG
FT                   AGRIEPDPAAGQRDGSEGAPLSPASGGGAAPPDGSTAEQGACGEASLAQADFRHLNQPD
FT                   ELFAIDTAIRRFAQRLQGIQLRSERRANAGSVIDMAWTVRRSVSRGGLPLELGWRRKRR
FT                   LRPRIVLLLDVSRSMSLYSFFYLRLARVLSARVSDVHCFIFHTRLVAIEQALRDPDPWR
FT                   SQERLQLLSAGWAGGTRIGDSLDEFNRQQATRLLHSRTAVVVVSDGYDAGEPERLQQAL
FT                   ATMRRRCRCVVWLNPLASRADFAPASAGMQAALPYIDLLAGARDLASLERVLPQVLSVL
FT                   Q"
FT   gene            42166..43206
FT                   /locus_tag="Bxe_C0035"
FT   CDS_pept        42166..43206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0035"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxF
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35962"
FT                   /db_xref="GOA:Q13IX7"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX7"
FT                   /protein_id="ABE35962.1"
FT                   /translation="MNDETLLQLEQRLIEEARPFAVVTVIRAAPPTSAWVGAQALVESD
FT                   GALHGWIGGGCSRAIVIEAAQQTLRAGLPKRVRISNEPGRPEADVEAHAMPCASNGTLE
FT                   LFIQPTLPAPAVLVLGSTPTALEACELAQRVGLRVSAAANVTAPFAALGLSRVVQGFDV
FT                   AVFEQIKPRLILVATQGDGDEDALEAALRSPAAAVLLVASQRKAERLRDAMRVRGIAPE
FT                   RLAALHAPAGPHIHAHTPQEIALGAVAGLVTLRRELEQATAADADARHLVSGEAVAALP
FT                   PCEAPSARYLNPVCGMAVEIASAKHVLDYGGQRIYFCCDCCKLEFERRPGKYLAIAQRK
FT                   AQLENT"
FT   gene            43203..43880
FT                   /locus_tag="Bxe_C0036"
FT   CDS_pept        43203..43880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0036"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35963"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX6"
FT                   /protein_id="ABE35963.1"
FT                   /translation="MSDTDAWKAAAPREAPVFSAVVLAAGLSSRMPGQHKLLLPLDTQP
FT                   AVRRTVSALVGAGPAEIVVVTGHQGRAVMEALDGLPVAFRSNPRYEEGQMTSVAAGVAA
FT                   LTAPCNMVMVCLADQVLLDAADYRELIDAFAAMPRGSILVPFFNGQRGNPVVFSASYAA
FT                   EVVSGHVNPGCRKLIAEHADEVFIHEATHDRFTTDMDTPDDYARIQARLSDARMSTPLI
FT                   PHG"
FT   gene            complement(43906..44289)
FT                   /locus_tag="Bxe_C0037"
FT   CDS_pept        complement(43906..44289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0037"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35964"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX5"
FT                   /protein_id="ABE35964.1"
FT                   /translation="MPSAVRNSLLWIFDAFERDSTYLCKRMFGCDAAYIDGLLCLVAAD
FT                   RGEPWNGLLVCTSQERHAALIAEMPALRPHPVLGKWLYVAQDDPAFEVVVARMTALVLA
FT                   RDPRVGVEPKPRKHRGKATLPNT"
FT   gene            complement(44434..45498)
FT                   /locus_tag="Bxe_C0038"
FT   CDS_pept        complement(44434..45498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0038"
FT                   /product="High-affinity nickel transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35965"
FT                   /db_xref="GOA:Q13IX4"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX4"
FT                   /protein_id="ABE35965.1"
FT                   /translation="MANPVRALFGDERAHLRRKIGGLYLLLIAFNVGAWVWAFVAFRPY
FT                   PLLMGTSLLAYSFGLRHAVDADHIAAIDNVTRKLMHDGKRPFTVGLMFSLGHSTIVVLA
FT                   SAGIAATAMALQTKMAGFREIGGLIGTLVSSFFLFAIALMNLVILRSVIRAFRRVRRGE
FT                   PYAEEDLDMLLADRGFFARIFRPLFRLITKSWHMYFLGFLFGLGFDTATEVGVLGISAA
FT                   GAAQGMPIWSILVFPVLFMAAMTLIDTTDSILMLGAYGWAFVKPIRKLYYNMTITAISV
FT                   VVALLVGSIEGLGLLVDTLQLSGRFWNAIGSLNDNFGVIGYVIVGVFVVSWLVSAAVYR
FT                   WQRLDELEVRSRQV"
FT   gene            45639..46097
FT                   /locus_tag="Bxe_C0039"
FT   CDS_pept        45639..46097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0039"
FT                   /product="Transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35966"
FT                   /db_xref="GOA:Q13IX3"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX3"
FT                   /protein_id="ABE35966.1"
FT                   /translation="MQRITMTIDDDLLAIVDAMVEQRGYTSRSEAFRDLVRESQAREPA
FT                   GAAGEQCVATLTYVYDHATRDLARRITQAHHERHDLAVASMRVHLDHDSLLESSVLQGR
FT                   SQEVAAFADSIASQRGVRFARLHTIPVSIERARHHHGAASGQHDHLHV"
FT   gene            46310..46687
FT                   /locus_tag="Bxe_C0040"
FT   CDS_pept        46310..46687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0040"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35967"
FT                   /db_xref="GOA:Q13IX2"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX2"
FT                   /protein_id="ABE35967.1"
FT                   /translation="MTTHARKHLIAWLGILAMCLIVFAPVVSQLLVSARAGNPDAILCS
FT                   ATLPPADAALHDHGGTLAACGYCDLLADQPGVPTLPAPQAVLIVLVMLLALPVPCTRFT
FT                   PIGAFPSGQPRAPPAFRQISL"
FT   gene            46777..49242
FT                   /locus_tag="Bxe_C0041"
FT   CDS_pept        46777..49242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0041"
FT                   /product="Putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35968"
FT                   /db_xref="GOA:Q13IX1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX1"
FT                   /protein_id="ABE35968.1"
FT                   /translation="MHTLRLRDAALPASTRYSVRTLLPIVVLGAIHGAAAAAAGDSAQA
FT                   VAATGSAASAPEAAAASATDAATLTLPAVQVSGQTSGSRSYAEKNLLPQTTESVTARQI
FT                   AETINMTDTEDALKYLPDLLVRKRYIGDTQAPMATRTTGINASARSLVYADGVLLTPLI
FT                   NNNNQNGSPQWFMVAPQEIDRIDVMYGPFAAGLPGNSYGAVTQITTRMPKHFEASVDVT
FT                   GAIQHFSQYGTHTGEPAAQYSATLGDRIGKLSWWFSANHLNSFSQPLTFGTVSQSKTPA
FT                   GAGLPVIGGGFADTNRTGGAIQVIGAGNFIHTIQDDATLKLAYDFTPTLSATYTLGYWQ
FT                   NRSKAQAETYLYDANGAPYYGAGSGPVNLGGFAYSASTLAGQFSSNNVEQEHLMQSIDV
FT                   GTHTQGRFDWQLIVSNMDYLQDLSRLSTGLYPAALTGGAGRTTDMSGTGWSTLDLKGTW
FT                   RPQGMQGANIVSFGAHYDQFRLESPTFNTADWISGGNGSLYSNSLGRTETSAIWAQDVW
FT                   RVAPALTATLGGRYEWWRAYDGFNFSTGSNGAGVSVTQPGVDKSGFSPKASLNLALTDT
FT                   WSVTGSIGRALRFPTVGELYQTVQTGATFLQANPFLKPEDVWSGELALERDTNSGHLRL
FT                   SVFDEYVYDALISQTALVPGFATPVSFTQNVGKTRETGVELAGQQDDVVVKGLSLSGNL
FT                   TYTNSDILSDDGFRATSPGDTAVGKRVPYIPSWRATLAATYRPDAHWAYTLAARYSSRL
FT                   FATVDNSDANPATFMGFQRFFVMDARVHYQYDHHWGGALGVDNLNNRKYFLYHPFPQRT
FT                   FYAELKYDF"
FT   gene            complement(49331..50182)
FT                   /locus_tag="Bxe_C0042"
FT   CDS_pept        complement(49331..50182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0042"
FT                   /product="H+-transporting two-sector ATPase, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35969"
FT                   /db_xref="GOA:Q13IX0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX0"
FT                   /protein_id="ABE35969.1"
FT                   /translation="MRGIAAARSREAQSRIEAIRACARTVGNAIGDALMFEQHDEPQAP
FT                   PGHAAGNEVVIVLCAEQGFVGTFNEHVIEATARRVASRSTEFFLIGARGIAVAAEHGLT
FT                   IGWSAPMVAHADEVPALADRITAALYERLNAGQATRVTLLHAVPNPSVTIEVVKTALWP
FT                   FDFTRFKQALRANPPLITLTPEILLAKLAEEYIFAQLCEAIMLSFAAENEARMRAMVAA
FT                   RTNVHDTLDELIGESRRLRQDEITSEIVELSSVTLAAATPRRRRHGERKRGKPEPGDSG
FT                   LS"
FT   gene            complement(50251..51843)
FT                   /locus_tag="Bxe_C0043"
FT   CDS_pept        complement(50251..51843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0043"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35970"
FT                   /db_xref="GOA:Q13IW9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IW9"
FT                   /protein_id="ABE35970.1"
FT                   /translation="MTQTTPDSREDAWLERSRATLAKAQPGARAEAVGRVEHVADGIAL
FT                   VSGLPDVRLNELLRFEGDRFGFALTLDADTIGAVLLDDADAITAGSIVTGTGQVVQVPV
FT                   GPGLTGRVVDPLGRPLDGRGAVHADARMPIERPAPSIIERDLVAEPLATGILLIDALFA
FT                   IGRGQRELIIGDRATGKTAIAIDAIVNQKNSDVICVYVAIGQRASAVERVIAAVREHGA
FT                   PERCVFVFASSAASAGLQWIAPFSAMTIAEYFRDRGQHALVVIDDLTRHAATHRELALL
FT                   TREPPGREAYPGDIFYLHARLLERAAKLSPERGGGSLTALPIAETDAGNLSAYIPTNLI
FT                   SITDGQIVLDTGLFAANQRPAIDVGLSVSRVGGKAQMPALRNVSGRLRLDYSQFLELEM
FT                   FSRFGGLTEARVKAQVVRGERIRALITQPRFTPLRPVDEVALLGALAEGVFDALPVDLL
FT                   PAIRTRVAAHLDAHGGNAGAVLEDTGTLDATAQALLVAAVRTLAQDCATASATAPPDPP
FT                   AASAAELPQPDSP"
FT   gene            complement(51824..52570)
FT                   /locus_tag="Bxe_C0044"
FT   CDS_pept        complement(51824..52570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0044"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35971"
FT                   /db_xref="GOA:Q13IW8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW8"
FT                   /protein_id="ABE35971.1"
FT                   /translation="MHIDGWTLGLQTVNVLVLVWLLARYLFRPVAKIIAARQQAATALM
FT                   ADAANARAAALAERSQAADQAAQIAQQRGDLLAAASAEAAALKTSLESAARADADRLRL
FT                   AAQADLATARQAAAAADANRASRLAIGIAAKLIDRLPQETRIAGFIEGLAAELAKLPAA
FT                   TRAELSPDAPVHLLAPRALKDDELAACHAALARVLGRDLPLPVTVEPALLVGLELEAPH
FT                   AIVRNSFRADLAYLQSELLAHDTDHA"
FT   gene            complement(52584..52832)
FT                   /locus_tag="Bxe_C0045"
FT   CDS_pept        complement(52584..52832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0045"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35972"
FT                   /db_xref="GOA:Q13IW7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW7"
FT                   /protein_id="ABE35972.1"
FT                   /translation="MTNLIQVISILAAAIAVSFGAIGPALGEGRAVAAAMDALARQPES
FT                   AGTISRTLFVGLAMIETMAIYCLVIALLVLFANPFVK"
FT   gene            complement(52829..53596)
FT                   /locus_tag="Bxe_C0046"
FT   CDS_pept        complement(52829..53596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0046"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35973"
FT                   /db_xref="GOA:Q13IW6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW6"
FT                   /protein_id="ABE35973.1"
FT                   /translation="MRRARGRHRAVRGTAPGPCGGTIMIHSPLLTTPLFHAGPVPVTAP
FT                   VVTTWAIMAVLVSGAALATRRLSLSPSKFQSVLELLVTTIDAQILDTMQAEPHRYRSLI
FT                   GTLFVFILISNCSSLIPGVEPPTAHLETDAALALVVFCATVFYGVRTRGVLRYLATFAE
FT                   PTWIMIPLNVVEQITRTFSLTVRLFGNVMSGVFVVGIVLSLAGLLVPIPLMALDLLTGA
FT                   VQAYIFTVLAMVFIGAALADSPNPKKPTAEGTS"
FT   gene            complement(53801..54112)
FT                   /locus_tag="Bxe_C0047"
FT   CDS_pept        complement(53801..54112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0047"
FT                   /product="Putative ATP synthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35974"
FT                   /db_xref="GOA:Q13IW5"
FT                   /db_xref="InterPro:IPR011744"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW5"
FT                   /protein_id="ABE35974.1"
FT                   /translation="MSRSDEPDDNERLAHAARQARTRERRARDEPEPSLGNRLGQIGIL
FT                   GWSIVIPTLLGLAIGHWLDRHFGTGVFFSAPLLMIGAAFGLWSAWKWMHRQTRSKHHD"
FT   gene            complement(54109..54528)
FT                   /locus_tag="Bxe_C0048"
FT   CDS_pept        complement(54109..54528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0048"
FT                   /product="H+-transporting two-sector ATPase, delta/epsilon
FT                   subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35975"
FT                   /db_xref="GOA:Q13IW4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR024037"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IW4"
FT                   /protein_id="ABE35975.1"
FT                   /translation="MSPTLRLTISTPASLLVNAQAIVALRAEDGSGSFGILPGHADFLT
FT                   VLTPCVLRWRGTENIRRFCAVEEGVLRVSEGHSVTIACRSGMLGDSLAALEAQIETARA
FT                   RTLDTARNARVEQTRLHAQAVRQLLRYLRPSRGDA"
FT   gene            complement(54525..56006)
FT                   /locus_tag="Bxe_C0049"
FT   CDS_pept        complement(54525..56006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0049"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35976"
FT                   /db_xref="GOA:Q13IW3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IW3"
FT                   /protein_id="ABE35976.1"
FT                   /translation="MDTAQPAMTAPPAQAAADEPVGRVTAVRGAVIDVAFDTGALPMIE
FT                   DALVITTDDGQPIIAEVQAHLDEGTVRALALRSTNGLRRGAPVRAAGGPIEVPVGEAML
FT                   GRLIDVSGVPGDNGTPLPPGTPRRPIHRKPPPLASQGAETRIFATGIKVIDLLTPLAQG
FT                   GKAAMFGGAGVGKTVLVMELIHAMVERYQGISVFAGVGERCREGHEMLTDMRHSGVLPR
FT                   TVLVYGQMNEPPGARWRVPLTALTVAEYFRDERHQNVLLLMDNVFRFVQAGAEVSGLLG
FT                   RLPSRVGYQPTLATEVAGLQERIVSVGDVSVTAIEAVYVPADDFTDPAVTAIAAHVDSM
FT                   VVLSRSMAAEGMYPAIDPIASSSVLLDPLVVGGEHARIAIEVRRAVEHYRELQDVISLL
FT                   GVEELGADDRRIVGRARRLQRFLTQPFAVTEAFTGVPGRSVPVADTLAGCKAILDGNCD
FT                   DWQESSLYMVGTLDEAREREQATRNAKPVSEHAEP"
FT   gene            complement(56010..56783)
FT                   /locus_tag="Bxe_C0050"
FT   CDS_pept        complement(56010..56783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0050"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35977"
FT                   /db_xref="GOA:Q13IW2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW2"
FT                   /protein_id="ABE35977.1"
FT                   /translation="MNGIIDLSGKRGLVVGIANEHSIAAGCARMFRAIGAEIAVTYLND
FT                   KAEPYVRAVAETLPASLVMPCDVTVPGQLEAVFARISREWGKLDFVLHSIAFAPAVDLH
FT                   ASLVDCSAEGFALAMDVSCHSFIRMTRLALPLMAEGGSLMTVSFYGAERAVDHYNLMGP
FT                   VKAALESSVRYLAVDLAPRRVHVHAISAGAVKTRAASGLDHFDVLLDEVRARTPARHLV
FT                   TIDEIGRIAAVLASDAGMTLTGSTLYADAGFHVVA"
FT   gene            complement(56780..57973)
FT                   /locus_tag="Bxe_C0051"
FT   CDS_pept        complement(56780..57973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0051"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35978"
FT                   /db_xref="GOA:Q13IW1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW1"
FT                   /protein_id="ABE35978.1"
FT                   /translation="MNDPLLLTFNPGSSTVKIGLFSVSAERATRIGQGSIDFRHAPLSL
FT                   HLVDGGGTREIALKAVVTEHLHEVLDETLNWFATHFSLTDLVSVGHRVVHGGDRFAGPA
FT                   EITDATLASIVELVPLAPLHQPQSVRLIRAIRHLRPNLAQSASFDTAFHRTQTELVRRF
FT                   ALPRHFFDSGVKRYGFHGLSYRFIAGALTRRFPLLAHSKVIAAHLGSGASLCAMSAGAS
FT                   RDTSMGFSTLDGIPMATRCGALDAGVVLHLLGQPGMTPDALEKILYEQSGLLGVSGISA
FT                   DSRELAASTQPQAQEALDLFVLRIAGEAARLATTLGGLDCLVFTAGIGEHQPPIRAAVC
FT                   KALAWLGVELDDAANARNAAVISSSASRVAVLVIATDEEQVIADETVSILHSQGATA"
FT   gene            complement(57970..59376)
FT                   /locus_tag="Bxe_C0052"
FT   CDS_pept        complement(57970..59376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0052"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35979"
FT                   /db_xref="GOA:Q13IW0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW0"
FT                   /protein_id="ABE35979.1"
FT                   /translation="MDDNLLHNRTFDELVLGESASLVRTAGLDDIQLFAAMSGDVNPAH
FT                   VDAAFASHDMFGHVVVQGMWTAGLVSALLGTRLPGPGTIYLDQDLQFRHPVVPGDVVTA
FT                   TVTVKEKRADKRIVILDTRCTNQRDEVVLTGVATVLAPAEAIVWPRMASPDVSVRRHDR
FT                   YDAFIREAQTLPALRTAIVHPCSAEAIKAAIEARNKGMIDPVLIGPEAKLRAAAELAEV
FT                   SLEGVAIVAVEHSHAAAARAVEMGAAGKVGALMKGSLETEELLSAVVSAASGLRTGRRI
FT                   SHVYAMDVPAYSKPLFITDAAVNVAPSLEQKRDICQNTIDLLHLLGIEQPRVAVLAAVE
FT                   NVNPRMPTTLDAAALTVMAARGQIRGALVDGPLAFDNAISLAAARTKGIVSPVAGQADI
FT                   LLAPDLEAGNMLAKQLMYFGGADAAGLVLGARLPIIVTSRADSLRVRLASVALARIVAR
FT                   RTLHDMALTS"
FT   gene            complement(59386..61182)
FT                   /locus_tag="Bxe_C0053"
FT   CDS_pept        complement(59386..61182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0053"
FT                   /product="Putative poly-beta-hydroxybutyrate polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35980"
FT                   /db_xref="GOA:Q13IV9"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV9"
FT                   /protein_id="ABE35980.1"
FT                   /translation="MDARYKTVSTGQPALAQQPADRAPSNPFRSLDYRKEATIARFTGG
FT                   LSPAALSLAVADWLIHLASAPGKRLELTSLAAANTRQIADYVFRGVSAHAESAPLAQPA
FT                   PGDQRFRAAVWQTEPYRFWQQTFLLTEQWWKAATSDIPGATKHHENVVGFGARQLLDMF
FT                   SPTNFPFTNPEVIQRTQAALGGNLIEGARNLLEDVQRQASGQPPAGVDQFKVGAALAVT
FT                   PGKVVFQNHLIELIQYIPTTDKVVAEPILIVPAWIMKYYILDLSPHNSLIRFLVGQGYT
FT                   VFCISWRNVGAEDRDLSLEDYRTLGVMAALDTIAAIVPDQRVHATGYCLGGTLLSIAAA
FT                   AMAGVGDERLASVSLLAAQTDFTEPGELQLFIDDSEVYFIESMMWSKGYLEASQMSGAF
FT                   QMLESNDLIWSHMIHDYMLGDRAPMFDLMAWNADSTRMPYRMHSEYLRQLFLDNDLASS
FT                   RYRVDGRPISLRNLRAPMFVVGTDRDHIAPWRSVYKIHYLSSTEITFVLTSGGHNAGIV
FT                   SEPGHANRQFRMEYAAPADLRVGPDEWLAAAEPRDGSWWPAWTAWLAERSTADLVAPPH
FT                   LGLAGQPRASLVDAPGTYVLQY"
FT   gene            complement(61363..61746)
FT                   /locus_tag="Bxe_C0054"
FT   CDS_pept        complement(61363..61746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35981"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV8"
FT                   /protein_id="ABE35981.1"
FT                   /translation="MGPHLSAPPQYCGQTAGGNYCPRAFADKNSPYVCISSDAQRRPRD
FT                   TDCLIAQDIPLVAGPFHPEEMAPFTTNHRQYGAAGDLNGVHSPGFIRLRVVGQHAVKQR
FT                   FFQYRRADGRRVDADQLLSNRVR"
FT   gene            61778..63175
FT                   /locus_tag="Bxe_C0055"
FT   CDS_pept        61778..63175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0055"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35982"
FT                   /db_xref="GOA:Q13IV7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV7"
FT                   /protein_id="ABE35982.1"
FT                   /translation="MIEQWRETLRAVHGVESKYKRLVKAIAGDIENASLPAGARLPPQR
FT                   DVAAELAISVQTVTNAYKELERQGLIRCEVGRGSFVTARVTETMSSYMLDTAERSVVDF
FT                   SIARIIHTAEHDAMWRKVCATLSTIDDQPWIRAFRPIAGFEHHRQAGIAWLASLGMPAS
FT                   ADTLLVTNGAAHGIFLALASTVGPGDTVLCEGLTDHGVIGSANVLGFTLKGLEIDEYGI
FT                   HPEHFEEMCDSERITALVCTPTLNNPTVALMPDSRRRAIARIAERYGVYVIEDDVYGPL
FT                   PAKAATPISSLIPDLSFYCTSLTKSVMTGLRIGYLATPRRLALRAESVLRVSSWMATSP
FT                   MAEVATRWIADGTAARLVEIQRERLGRRQVQLQKTLGKYVLGAHPQALSAWLRVPDHWR
FT                   TDRLVKELRNRDIAVTSPDPFLVRDADRPNAVRVCVGAEVGEETYQSALETMLDVFEQY
FT                   PQVHDFA"
FT   gene            63364..64398
FT                   /locus_tag="Bxe_C0056"
FT   CDS_pept        63364..64398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0056"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35983"
FT                   /db_xref="GOA:Q13IV6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR014333"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV6"
FT                   /protein_id="ABE35983.1"
FT                   /translation="MSVPSLADLSLADVYRARRRIEGRVRHAPLVESQSLSALAGVPVF
FT                   LKLETVQPTGSFKVRGATNALGHLAEQGCRKVVTASTGNHGRAVAHAARTLGIDATVCM
FT                   SALVPANKVDAVRALGAHVRIVGKSQDEAEHDALRLVREEGFAYVPPFDDPHVIAGQAT
FT                   IGLEIVEALPDVANIVVPLSGGGLFAGVAFAARSANRAIGLTGVTMARGAAMHASLVAG
FT                   QPVLVEEVATLADSLGGGIGLENRYTYALTRDLIDQTVLLDEASIARGIAHAYRHERLV
FT                   VEGAAAVGIAALLDGVLPAGRIGRGPLVLIVTGANIDMDLHRRIVDADSMQPDSTQSGL
FT                   HPIS"
FT   gene            64395..65396
FT                   /locus_tag="Bxe_C0057"
FT   CDS_pept        64395..65396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0057"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35984"
FT                   /db_xref="GOA:Q13IV5"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR014334"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV5"
FT                   /protein_id="ABE35984.1"
FT                   /translation="MTSITLLGETELRALVPLDLAAIDQVEAAFLALATEAVAMPPILR
FT                   LDLPEHNGEIDVKTAWLPRFDSLAIKVSPGFFGNPSLGLPSLNGLMLVLSARTGLTEAV
FT                   LLDNGYLTAVRTAAAGAVAARWLAKPHTPRVAVLGAGEQARLQLQALTLVRRIEHVRVW
FT                   ARDAASARRFAQEMSVSLGVQCDAARDVQHALADADVAITATPSRSPLIEAADLHPGLH
FT                   ITAMGSDTEHKNEIAPAALAAARYICDRAQQTRVLGELHHALNAGAVRADAAITELGQV
FT                   IARQAVGRADEADVTICDLTGTGAQDTAIAALALQRARAAGAGTIFRNDVKR"
FT   gene            65505..66554
FT                   /locus_tag="Bxe_C0058"
FT   CDS_pept        65505..66554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0058"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35985"
FT                   /db_xref="GOA:Q13IV4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV4"
FT                   /protein_id="ABE35985.1"
FT                   /translation="MRASPIQPTVDFNADGEQHGFLKLPHSHDTSAWGAEMIPVTVLRN
FT                   GEGPTALLTGGNHGDEYEGPIALAKLAGSLKAQDVRGRVIIVPFMNYPAFRAGSRTSPI
FT                   DRGNLNRSFPGKPDGTVTEKIADYFQRYLLPLADYVLDLHAGGRTLDFVPFAAIHLLPD
FT                   AGQQARCEAAMRAFGAPYSMRMLELDSVGLYDTAVEEAGKVFVSTELGGGGTATVQSVA
FT                   VAERGVRGFLRHAGILGQAAAAHEAGRESGRGAPRTTTLLDMPDGTCFTTSEHDGLLEL
FT                   CKDLGEMVESGEVIARIYDASRSGVAPVEYRARRGGMLAARHFPGLVRIGDTVAVVAEV
FT                   VERGIPVTL"
FT   gene            66564..67055
FT                   /locus_tag="Bxe_C0059"
FT   CDS_pept        66564..67055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0059"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35986"
FT                   /db_xref="GOA:Q13IV3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV3"
FT                   /protein_id="ABE35986.1"
FT                   /translation="MKLDRYDLAILRILARDGRMTKSRLAEEINLSISPAWERVKRLEE
FT                   AGVIRGYRADIDWVGAFKGSRVVVEVTLARHTAHDMRRFEERIAAAPQVVQCHATGGGV
FT                   DYVMHVMSRDIDHYQRFIDSLLTDELGIEKYFTYVVTKVVKSGAEGLPDWAEEHIADGG
FT                   "
FT   gene            67198..68721
FT                   /locus_tag="Bxe_C0060"
FT   CDS_pept        67198..68721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0060"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35987"
FT                   /db_xref="GOA:Q13IV2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV2"
FT                   /protein_id="ABE35987.1"
FT                   /translation="MLLGHPVLFKSLCYVDGRWVHSASAASVAVHNPADQQVLGHVPML
FT                   DAAQITEAVGAAQRAFSTWRWLPVSQRSALLLRWHELILRHQHDLAAILSLEQGKPLAE
FT                   ARGEIAYGASFVEWFAHEVRRLNGRTIPTHIDGAHLGTMIEPVGVAALITPWNFPCAMI
FT                   TRKAAAALAAGCTVVVKPAHETPFSALALAQLAEEAGFPAGVFNVVLGEPQMAMERLVG
FT                   DSRVRSVSFTGSTRVGALVMQAAARAGIKKTALELGGNAPFIVTGDADLDQAVRVAVAA
FT                   KFQTSGQDCCAANRIFVARPLYEAFVAQYSDAVKALKVGAAFEANVDVGPLMHQAAFDS
FT                   TAQRVADAKARGARITAGGGAHERGGWFFEPTVVADAAPGMRIYDEENFAPISAVSPFD
FT                   SLDEVVERANDTEYGLAAYVCARDLNTVFQLIRRLDFAMVSVNGAKFTGAPIPFGGIKS
FT                   SGLGREGGAEGFEPFVETRYFCLGQLGLPVTESLPAHRLAAATGAAATA"
FT   gene            68762..70159
FT                   /locus_tag="Bxe_C0061"
FT   CDS_pept        68762..70159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0061"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35988"
FT                   /db_xref="GOA:Q13IV1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV1"
FT                   /protein_id="ABE35988.1"
FT                   /translation="MTQLDQLFDADRAHFMHPSTHAHDHASGALPGRIVTGAQGIRIED
FT                   HQGKSYIDAFAGLYCVNIGYGRTEVAEAIYEQAKKLAYYHTYVGHSTDTIIELSSRIIE
FT                   WAPQGMKKVYYGMSGSDANETQIKLVWYYNNVKGRPDKKKIISRQRGYHGSGIVTGSLT
FT                   GLASFHQYFDLPIGRVKHTVCPHWYRHAPAGMNEAQFVAYCVEELEKLIAQEGADTIAA
FT                   FIAEPVMGTGGILPPPAGYWPAIQQVLKKHDILLICDEVVCGFGRLGSKMGAQHYGIAP
FT                   DLITVAKGLTSAYAPLSGVIVSEGVWDVIDKASQEFGAMGHGWTYSGHPICAAAALANL
FT                   DILERENLTQNAAQTGAYLLEQLHAAFDSHPLVGEVRGAGMLAALEFMADKDGRQPFDA
FT                   ALKVGPRVSAAALQRGLIARAMPHGDILGFAPPLITSRSEVDEIVKLAREAVDEVASAV
FT                   LSPAASA"
FT   gene            complement(70323..71417)
FT                   /locus_tag="Bxe_C0062"
FT   CDS_pept        complement(70323..71417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0062"
FT                   /product="Putative Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35989"
FT                   /db_xref="GOA:Q13IV0"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV0"
FT                   /protein_id="ABE35989.1"
FT                   /translation="MLPETMKAVVLTAHGGLDKLVYRDDVPVPVCRAGEVLLDVTACGL
FT                   NNTDVWVREGAYGTDDDPQAVSTWRRGRSTLSFPRIQGADIVGRVIAVGHGVSDARVGE
FT                   RVIVDASIYNRDDDSLADIDYIGHGRDGGYAEYTAVPAQSAHRIDSACSDAELATFWCA
FT                   YHTGEQMIERAAVKSGETVLITGASGGVGSAIVQLCRARGAVPYAVVSKGKEEAVRELG
FT                   AQGVMLRDSEDFAAAVERMTGGRPVDVVADLVGGALFGKLLNVLRPEGRYTTAGAIAGP
FT                   VVQLDLRTMYLKQLQLNGSSQGTRGAFKRVLDYIQAGTIRPVLAATYPLSKFHEAQTQF
FT                   MAKRFVGNIVVVPDRHYNGTADRT"
FT   gene            complement(71489..72709)
FT                   /locus_tag="Bxe_C0063"
FT   CDS_pept        complement(71489..72709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0063"
FT                   /product="Putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35990"
FT                   /db_xref="GOA:Q13IU9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR014335"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU9"
FT                   /protein_id="ABE35990.1"
FT                   /translation="MSDTTQVEPRTAAPTLRLPFERAEYAARIAKTRKAMQAAGIELLI
FT                   VSDPSNMGWLTGYDGWSFYVHQCVLLALDGEPVWFGRGQDANGAKRTVFMQHDHIVGYP
FT                   DHYVQSAVRHPMDYLAREVIEARGWGSLSIGVEMDNYYFSAAAYRSLVAQLPNAKWHDA
FT                   TALVNWQRAVKSPREIEYMRVAARIVERMHAHIVERIEPGMRKNDLVAGIYATGISGVD
FT                   GYGGDYPAIVPLLPTGADAAAPHLTWDDTPFAKDAGTFFEIAGCFKRYHCPQSRTVYLG
FT                   QPPKHFIDGERAVVEGIEAGLAAAKPGNTCEDIANAFFAMLHKYGIEKNSRCGYPIGAS
FT                   YPPDWGERTMSLRPGDKTVLEPGMTFHFMPGLWLDDWGLEITESILITENGVETFCNTP
FT                   RKLFIKP"
FT   gene            73245..74030
FT                   /locus_tag="Bxe_C0064"
FT   CDS_pept        73245..74030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0064"
FT                   /product="ectoine ABC transporter ATP-binding protein /
FT                   hydroxyectoine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35991"
FT                   /db_xref="GOA:Q13IU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU8"
FT                   /protein_id="ABE35991.1"
FT                   /translation="MIKPLIRIDRITKRYGPLTVLDELSLDVMPGEKLALIGPSGSGKT
FT                   TILRILMTLESIDGGHVEIDGEQLFHMQQGGRTVPANERHLQMMRGKVGMVFQHFNLFP
FT                   HKSVLDNVTLAPILTKGESRETAEKRALELLDMVGMADKAKSRPAQLSGGQKQRVAIAR
FT                   ALALAPRIMLFDEVTSALDPELVEEVLNVMHRLARETDMTMLLVTHEMGFAHDFADRVL
FT                   FFDRGRIVEEGKPEDIFSHPEHERTQAFLRKIIAAGHRL"
FT   gene            74087..74929
FT                   /locus_tag="Bxe_C0065"
FT   CDS_pept        74087..74929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0065"
FT                   /product="ectoine-binding protein / hydroxyectoine-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35992"
FT                   /db_xref="GOA:Q13IU7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU7"
FT                   /protein_id="ABE35992.1"
FT                   /translation="MKLKGILITGTLSLLSLTSLAAVAQDKLAQLREQGFARIAIANEP
FT                   PFTAVGADGKVTGAAPDVARAVFRKLGVNDIVASISEYGAMIPGLAVGRHDAIAAGLFM
FT                   TPQRCAAVAYSQPVLCAVEAFAVKKGNTRSIKTYEEIAKDPKAVIGVEGGTTEQKLATA
FT                   AQIPAERVVIVPDGQSGLKMLQDGRIDAFALPLLSISDLLAKAKDANLESIAPVQGTPV
FT                   QCDGVAFRKQDTALRDAFDVELKKMKESGEFAKIVEPYGFSAKAAISTSRDKLCAATN"
FT   gene            75004..75663
FT                   /locus_tag="Bxe_C0066"
FT   CDS_pept        75004..75663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0066"
FT                   /product="hydroxyectoine ABC transporter membrane protein /
FT                   ectoine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35993"
FT                   /db_xref="GOA:Q13IU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU6"
FT                   /protein_id="ABE35993.1"
FT                   /translation="MNDWSGYLLLILKGAQTTVELTVMGAALALVMAFVAGLGRLSRFT
FT                   AVRALATSYIEFFRGTSVFVQLFWAYFVLPMVGLTLTPLQAGVLALGLNVGAYGAEVVR
FT                   GAVVAVGQEQRSACVALNLSSYQRMRHVILPQALPLMLPTFGNNAIELLKGTAVVSLIS
FT                   LGDMTFQAQVVRSQTGNTLIPFATILALYFAMACLIALGVRKLERRMSFGLDRMRR"
FT   gene            75668..76327
FT                   /locus_tag="Bxe_C0067"
FT   CDS_pept        75668..76327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0067"
FT                   /product="hydroxyectoine ABC transporter membrane protein /
FT                   ectoine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35994"
FT                   /db_xref="GOA:Q13IU5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU5"
FT                   /protein_id="ABE35994.1"
FT                   /translation="MEWDWSFAREILPILLQGLKITVLATLLGAIVAAVVGMVFAILRL
FT                   SPNRAVASITTAVVSVIRGTPLLVQLYLVFYVLPDIGVRMPALAAGVLALGVHYATYAA
FT                   EVYRAGIENVPRGQWEAAKACNLSPAQSWQHVILPEAVPPMLPALANYLISMFKETPLL
FT                   SAITVLELMNEAKIVANTDYRYLEPMTLVGVLFLCISLIAVFGVRLLERRFPPLGH"
FT   gene            76331..77110
FT                   /locus_tag="Bxe_C0068"
FT   CDS_pept        76331..77110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0068"
FT                   /product="Putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35995"
FT                   /db_xref="GOA:Q13IU4"
FT                   /db_xref="InterPro:IPR014332"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU4"
FT                   /protein_id="ABE35995.1"
FT                   /translation="MPTTIQPSARPPHLDERAFDKRIGLVILATDHTTEPDFAALVAGE
FT                   RIGIYVNRVPYANPVTPDNLRAMQPSLTAGAALILPGETLDVVMYSCTSASVMIGDAEI
FT                   EQAIHAAKPQARVVTPTAAAAAALNALGARRISVLTPYTVETSQPMAEYFAAQGFIIDR
FT                   FTCIGLTDDREMARISHDDIVAFARAAMAEESDALFISCTAVRAAAVVARIEASIGKAV
FT                   VSSNLATAWMCLRLCGESDARPALGRLMTLALPPAVC"
FT   gene            77191..78528
FT                   /locus_tag="Bxe_C0069"
FT   CDS_pept        77191..78528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0069"
FT                   /product="major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35996"
FT                   /db_xref="GOA:Q13IU3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU3"
FT                   /protein_id="ABE35996.1"
FT                   /translation="MDYAQSWDAEAMQRQSPSLLRRAIAASALGNATEWFDYGIYAYGL
FT                   TYISAALFPGSTAQATLFALATFAISFLVRPLGGLFWGPLGDRLGRKHVLALTIILMSV
FT                   ATLLVGLVPSYARIGWWAPALLIVLRMIQGFSTGGEYGGAATFMAEYAPDKKRGFCGSF
FT                   LEFATLAGFSLGAFLMLGCSVVLGNASMHAWGWRLPFLIAAPLGLIGFYLRSKLEDTPV
FT                   FIELEQSSHKEQQGRVSLKALLTGYWKPLLLLGGLVVALNVVNYVLLAYMPTFMQKQLG
FT                   MSDNMSLLVPLIGMLTMMVFLPFAGTFSDRIGRKNVWWFSLIGLFVAAIPMFVLMKHGM
FT                   AGALIGFSVLGLLYVPQLASISAMFPAMFPTQVRYAGMAIAYNVSTSIFGGTAPMVNEW
FT                   FIARTGNALVPAYYMMGACVIGALALIFVTETSGCSLRGREIPGKK"
FT   gene            78946..79629
FT                   /locus_tag="Bxe_C0070"
FT   CDS_pept        78946..79629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0070"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35997"
FT                   /db_xref="GOA:Q13IU2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU2"
FT                   /protein_id="ABE35997.1"
FT                   /translation="MLSGIVGTGSSMMLMPVLVLFFGPQQAVPIMAIGAVMGNLGKVFA
FT                   WWREIDWKACGAYCATAMPGAALGVHTLLALPAHFVDIALGVFFVAMIPTRRWLARRAV
FT                   RFNLWHLALIGAPVGFLTAIVVSTGPITVPVFTSYGLERGAFLATEAAGSLAVYATKIA
FT                   AFKELGALPANVVVKGLTAGAALMTGSFFARSVVIRMKPSTFRLLVDGLMLSSGVSLLW
FT                   AATGQ"
FT   gene            79787..80197
FT                   /pseudo
FT                   /locus_tag="Bxe_C0071"
FT   gene            complement(80250..81956)
FT                   /locus_tag="Bxe_C0072"
FT   CDS_pept        complement(80250..81956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0072"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35998"
FT                   /db_xref="GOA:Q13IU1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU1"
FT                   /protein_id="ABE35998.1"
FT                   /translation="MESNYPPAQTDELAMRAARPADHAAENGVLLRIARAQLGSRERLL
FT                   QEIADAALLLCDAGSSGISLVEGDDQHKQFRWLAVAGLCVGLQGKTTPWRDCPCGVALE
FT                   SAAPQLFVRPQDHFASLRFPGVNITEGLVVPIPTDNGFVGAIWVMSHTPARQFDREDVR
FT                   LLANLAVSAGAALTTVDARDTGEGSERRHSEFIAMLGHELRNPMAPIDSAVGAAKQLCS
FT                   DNEKAVEVLTIAQRQMRHLRTLVDDLLDAARLKHGKLAIKHSNTSLNEIAFDAVTAVRH
FT                   HIESRRHSLKVTGLDEQVPVRADHVRLSQVLGNLLSNAAKYTPTGGTIELTVKVAADEE
FT                   PAQPDLVVIEVKDNGIGIDSSVQPHVFELFAQSARGNARAEGGLGIGLAVAKRMVELHD
FT                   GTISLQSDGSGRGTSVTLRLPILRSRDDSPATVDTAQPRELRPVRLLLVDDNADALQSL
FT                   GMLLELEGHQVTMSASGREAVQLIRQTLPEVAIIDVGMPDMDGFDVATAVRSDSRLDDV
FT                   TLVALTGYAAESDKSRALAAGFDYHLTKPLSLEKLQYILANRAGGKLGGIV"
FT   gene            complement(82059..82310)
FT                   /locus_tag="Bxe_C0073"
FT   CDS_pept        complement(82059..82310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35999"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU0"
FT                   /protein_id="ABE35999.1"
FT                   /translation="MALQSFCENACLFRCRLPATDRIRGNCALASGTGFALLANAPVAS
FT                   ACRRCGGNPRPDGGRTPVFPESLVQSFMLRSTSKAHAG"
FT   gene            82361..82870
FT                   /locus_tag="Bxe_C0074"
FT   CDS_pept        82361..82870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0074"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36000"
FT                   /db_xref="GOA:Q13IT9"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT9"
FT                   /protein_id="ABE36000.1"
FT                   /translation="MPTKPVVPAPTDELDTVPDTSSPAYATHHPLTRAFDRFASLVTRW
FT                   AGSPAAFCLAVLTVLAWVVTGPIFHYSEGWQLVINTGTTIITFLMVFLIQQSQNKDSVA
FT                   LHLKLNELLSSHRAASNHLIGIEDASEEELRRLAAAYLRLSTKPDTGTAAGGSLTPERT
FT                   GPPTDS"
FT   gene            82954..84057
FT                   /locus_tag="Bxe_C0075"
FT   CDS_pept        82954..84057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0075"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36001"
FT                   /db_xref="GOA:Q13IT8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT8"
FT                   /protein_id="ABE36001.1"
FT                   /translation="MSSNSKQSSDYPAVEVRKGQVTEKMPREAFRERFMARFYDPAFRA
FT                   EDDALGRLEAIAWDAYCNARKSPVTAKAGPGFADPDYDLSVEWRAASERVKAAQIRQQE
FT                   RATPSRVLIVNASSRNDYTCPGEMSKSFRLGKLAQETLERKACEVDFLDLSLLNSEHDL
FT                   HIHPCKGCVSTAMPLCHWPCSCYPNHSLGLVNDWMNEIYERFAACHGVLFVTPVYWYQV
FT                   SSPLKLLMDRLVCADGGNPDPTSTHGKQADEAKRLELAGWDYPKHLAGRAYGIVVHGDV
FT                   AGIEGSRRALTDWLNWMGFIEAGAKSRLDRFIGYYEPYATSHATLDRDADMQKEVVNVA
FT                   EAVALCVAQIRNGRKEPDEHLEPARAK"
FT   gene            84153..85403
FT                   /locus_tag="Bxe_C0076"
FT   CDS_pept        84153..85403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0076"
FT                   /product="Putative phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36002"
FT                   /db_xref="GOA:Q13IT7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT7"
FT                   /protein_id="ABE36002.1"
FT                   /translation="MTDQADGPLAQRRRLGEWLPRNEAHLARYRLELAARARERGATAP
FT                   RTSAVDELARLINGDPVLRMDMTRAIAQAREEGYVLGYSSIDELMSIIDYLMTYAPPFS
FT                   ETSLIHCPLNAVLDWPMCMPSGSALFRDPALNAQLKRVLNCWCGFLSGPHSREHLNTSP
FT                   PEGWFCAEADQRIGLSQFICDPDEPYWGFASWNDFFTRQFRAGERPVDEPDNHKVVVSA
FT                   CEAAPYNIQLGVKLNDTFWIKSQPYSLQDIFTSAQPELARAFAGGSIYQAFLSAFNYHR
FT                   WHAPVSGVISSAYAVDGSYYSDADSEGEDPGGLNDSQGYITAVAARAVIVIECDDRAIG
FT                   KVGCVFVGMADVSSCVIEALPGQRVNKGDELGFFQYGGSTCCLVFEPDVIRGFVPQPPF
FT                   DDNQEPVKVNARIATAR"
FT   gene            complement(85507..86643)
FT                   /locus_tag="Bxe_C0077"
FT   CDS_pept        complement(85507..86643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0077"
FT                   /product="Putative glutathione-independent formaldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36003"
FT                   /db_xref="GOA:Q13IT6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT6"
FT                   /protein_id="ABE36003.1"
FT                   /translation="MKALVYEGPRKVTVKEMPDAKIERPTDVLVKITTTNICGSDLHMY
FT                   EGRTNMETGRILGHENLGVVVEVGAGVERIKVGDRVCLPFNIGCGFCKNCERGLTGFCL
FT                   TTNPGMAGAAYGFAGMGPYSGGQAEYLRVPFGDFNCLVLPPDAEEKENDYVMLSDIFPT
FT                   GYHATVLAGVEPGDSVVIYGAGPVGLMAALSASIKGASKIMVVDSHPDRLKLAEKIGAI
FT                   PVDDTDGSSAERILEMTGGEGADRGCECVGYQCSCKGHEVPNLTMNNLIKAVRPTGGIG
FT                   VVGVFVAEDPKAGDELAKKGQLALDFGQLWMKGQHIATGQANVKAYNRKLRDLIAAGKA
FT                   RPSQIISHELPLDKAPDGYKHFDERDDGWTKVVLKPAA"
FT   gene            86964..87917
FT                   /locus_tag="Bxe_C0078"
FT   CDS_pept        86964..87917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0078"
FT                   /product="Putative Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36004"
FT                   /db_xref="GOA:Q13IT5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT5"
FT                   /protein_id="ABE36004.1"
FT                   /translation="MSTMLAYRIHRFGGPEVFRSERIDVPEPGAGQVRVRVLTASANPV
FT                   DIKTRAGDYPLIREDSLPYTLGRDFAGVVERVGAGVGEWKQGDEVYGFVGQGQGAYAEF
FT                   VVVDAQALARRPAKVDMAAAGAVPLAALTAWQGLFEQGDLAGGQRVLIHAGSGGVGHFA
FT                   VQFAKHEGAEVFVTASGDGLAFVRSLGADHVIDYRTQRFEELARDMDLVFDLVGGDTQK
FT                   RSWAVVARGGALISTLAEPSQTEAASHGARAARYTARPDGYQLSEIAALIDDGKVRVKV
FT                   AETYPFDAAADALARLEKGHVRGKIVIAVAPASTNS"
FT   gene            88074..89102
FT                   /locus_tag="Bxe_C0079"
FT   CDS_pept        88074..89102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0079"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36005"
FT                   /db_xref="GOA:Q13IT4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT4"
FT                   /protein_id="ABE36005.1"
FT                   /translation="MRGLRTGAGSFALILALAASPVHAGPAAPLNYFLHAAGPAAAPTQ
FT                   RLGWVLSAIAILVTLIIAGLLVGAIVRRRPAPPTRPFNAEAGGMHWIYIGTGVSSIVLL
FT                   AILVYVLITLESVASPAAHPQLTLTVTAYDWWWKVDYADDPDPLRNFSTANEIHIPVGQ
FT                   PVKILLKSADVVHAFWVPQLAGKTQTIPGQTNEQWIQADQPGIFRGQCSQFCGAQHAHM
FT                   AFEVVAQSPADFAAWRAAQGRTAGGSAGDAAVAAGRHLFAERCAGCHTIRGSDAAGLQA
FT                   PDLTHLLSRRTLAAGALTNTPEHLLDWIEHAQRIKPEALMPDIPLTTGDAAALSAYLAT
FT                   LH"
FT   gene            89132..91174
FT                   /locus_tag="Bxe_C0080"
FT   CDS_pept        89132..91174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0080"
FT                   /product="Putative cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36006"
FT                   /db_xref="GOA:Q13IT3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT3"
FT                   /protein_id="ABE36006.1"
FT                   /translation="MAEHAATAATPGTPPRAARDALPDASPLVRTPRRGRVEAGSAEEK
FT                   RLREIWEAPPGWRGWLSTVDHKTIGLRYLVTAFVFLLMGGVEALIMRIQLARPNATVLT
FT                   PEQYDQLFTMHGVTMIFLYALPVLSGFSNYLWPLVLGARDMAFPRLNALSYWVFLFAGI
FT                   FLYASFPAGQAPDAGWFNYAPLSGLEYNTGPNIDVYALGMVLLGISTTVGSMNFVVTLL
FT                   RMRAPGMSLDRIPVLVWGTLTASGGNLLAVPSVSLAFFLLWMDRRIGTHFFDVLNSGRP
FT                   LLWQHLFWIFAHPWVYAVVLPAMGIVSDALPVFCRRPLVGYGPVALSTVATMVIGFVVW
FT                   IHHMFATGIPALALSFFGAASMVIAIPSAVATFAWIATIWTGRPVFRVPFLFFAGFVLL
FT                   FVVGGVSGVLTAAVPFDWQLTDTYFVVAHLHYVLLGINVFPVMGGIYFWFPKFTGRMMS
FT                   ERLGKLGFWVLFIGFNVAFFPMHIAGLLGMPRRIYTYPADMGWNTVNLVTSLGSFLFAA
FT                   GVLIFLIDLLVSLKHGKPAGDNPWDAPTLEWSVSSPPPPYNFAVVPSLASRHPLWEGRI
FT                   DEPDTAFHARSQLDEGYLLAQGREALGTSALEARPDVILKMPADSYAPFWLAVFASLVF
FT                   AGLALSAWIFAGAMLAGCAVSIIVWLWPERALIQREPATVHDAGG"
FT   gene            91176..91829
FT                   /locus_tag="Bxe_C0081"
FT   CDS_pept        91176..91829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0081"
FT                   /product="Putative cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36007"
FT                   /db_xref="GOA:Q13IT2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT2"
FT                   /protein_id="ABE36007.1"
FT                   /translation="MSDAIDLNQPSDGSTEPMLALPVGSAGERSGGWWGCLTLIATEGA
FT                   LFGYLIFSYLYLASQSPQHWPPEGLPKLGLGIANTIILLSSSGFVWLCERCVRRGRLRW
FT                   AVASMAVGIVLGCLFVGIQLLEWRDHPYGLTTHLYGSLYFTITGFHMAHVVVGIVVLLL
FT                   LLLWTALGYFDAKRCAALTIGGLYWHFVDVVWLFIFSTLYLTPYLFQGWSWQRA"
FT   gene            91814..92239
FT                   /locus_tag="Bxe_C0082"
FT   CDS_pept        91814..92239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0082"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36008"
FT                   /db_xref="GOA:Q13IT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT1"
FT                   /protein_id="ABE36008.1"
FT                   /translation="MAESVTSPEAPHSPLRYALAGLLLAPLAWLVQMVIAETLAAQSCY
FT                   PFDVPLSAPAMPWMRPALVGVSALCLAAGASGAVIAWRNLRRIARMEKSASGNARPTRT
FT                   ELAGFLSRIAAMCSALFLFALIATDVALAIVSPCRWW"
FT   gene            92242..93663
FT                   /locus_tag="Bxe_C0083"
FT   CDS_pept        92242..93663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0083"
FT                   /product="Putative alcohol dehydrogenase cytochrome c
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36009"
FT                   /db_xref="GOA:Q13IT0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT0"
FT                   /protein_id="ABE36009.1"
FT                   /translation="MRTFRDFVMHRWASVGRRMPRYAGPGLLVALALALAGARVFAANP
FT                   VNASADNGNVANSAPAGADAAEIARGAYLAKAADCAGCHTAAPRVTRPGAAPMLSPPFA
FT                   GGLGMTSPFGTIYSSNITPDPQAGIGRYSYDDFARALRDGVAPGGKRLYPAMPYPSFAR
FT                   ITDDDMHALYAYFMHGVQPVATPAPETRLPFPFNQRWVLMFWDWAFAPRGVFKPEAGRD
FT                   AQWNRGAYLVQSLGHCGACHTPRGPAYEERGYSESSAAYLTGGTNDHWFAPNLTGDRGA
FT                   GLGRSSAADLAAFLRRGHGGGLITFGSMVQVVEDSTQYLNDADLAAIAVYLKSLPPRAE
FT                   SGRFDGRSRAAQQTAQALKTGDVERPGAGIYASYCARCHQMDGAGVPQKYPRLAGNPAV
FT                   LSSSTTSLVRLLVEGGGSPHTQDGPESRKMPSFAARLNDREMAHVLTFIRNTWGNAAAP
FT                   VTAKDVSGVRAALHK"
FT   gene            complement(93861..96155)
FT                   /locus_tag="Bxe_C0084"
FT   CDS_pept        complement(93861..96155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0084"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36010"
FT                   /db_xref="GOA:Q13IS9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS9"
FT                   /protein_id="ABE36010.1"
FT                   /translation="MSTAHKDSDAYQHASGGWGSLKAVASALIQEKAPVETSRVLVHQN
FT                   KPDGFMCVSCSWAKPAHPHTFEFCESGAKATAWDLTSRRVNPEFFQQHTLAELEQWHDQ
FT                   ALEDAGRLCAPMRWDAALDKYVEVTWEHAFAEIGRELRAIKPDEAVFYTSGRASLETAY
FT                   MYQLFARMYGTNNLPDSSNMCHESTSVGLKQAIGVGVGTITLEDFKHTDLMFFFGQNVG
FT                   TNSPRMLHDLQEARERGVPIITFNPIREPGLVSFVNPQSPTQMLKPGATQISTQYHQLK
FT                   AGGDSAAIVGICKAVIEADDRAQATGAARIVDAGFIAEHTSGFDDFARYVRNARWDELE
FT                   RICGLTRAALTAAADEYMRAKAVIIHYGMGLTQHRMGVQNVRMIVNLLLLRGNIGKPGA
FT                   GPSPIRGHSNVQGQRTVGVTEKPELAPLDKLAEQYHFTPPRKEGMATVDACKGVIDGKV
FT                   RAVFQLGGNLVRSVPDRYAIEPAWRKLRLTVSIATKLNRSHLVHGEVSYLLPCLSRIEI
FT                   DERMGNAQAVAMEDSTGCMHGSHGVAQPASDQLLSEPAIVAGIAKAALDSTSVDWDAWS
FT                   NDYALVRDAIAETYPEIFHDFNARMWTPGGFHRPLPARERKWETKSGKAEFMVPQTLNE
FT                   DPDMPERQPDDLRLFTLRSDSQFNTTIYTLDDRFRGVRGTRMVLLMNRRDIERHGLEAD
FT                   AEVSLEAVSPDGIPRRVDGFRIMEFDLPAGCVAGYYPECNPLIPLSHHAKESKVPAAKA
FT                   IPVRIVAAQTV"
FT   gene            complement(96282..97133)
FT                   /locus_tag="Bxe_C0085"
FT   CDS_pept        complement(96282..97133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0085"
FT                   /product="ABC taurine family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36011"
FT                   /db_xref="GOA:Q13IS8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS8"
FT                   /protein_id="ABE36011.1"
FT                   /translation="MSSIDSLPSSPAGRRAAGRRKPRRGLPGEGPTAILSVASVVAIAA
FT                   LWWAATSFHWVPPLFLPAPQAVWSAFVDAWNGRIQGGLPLCQHLMWSAIRVFGAFALAS
FT                   VTAVPVGILMGVSRIARGLLDPPLEFYRPLPPLAYLPLVVIWFGIDETAKLIVIYLACF
FT                   APIAMAARAGVRSATAEQVNAAYSLGASFAQVVRHVVLPAALPEILTGLRIAIGFGWTT
FT                   LVAAEMVAATAGLGQMVLNASSFLRTDVVVMGIVLIGLIAWTFDLGMRALERRLVPWRG
FT                   KA"
FT   gene            complement(97130..97924)
FT                   /locus_tag="Bxe_C0086"
FT   CDS_pept        complement(97130..97924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0086"
FT                   /product="ABC taurine transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36012"
FT                   /db_xref="GOA:Q13IS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IS7"
FT                   /protein_id="ABE36012.1"
FT                   /translation="MSTLEIRGLGVTYEGASTAALEGVDLQIESGEFVVALGASGCGKT
FT                   TLLNCLAGFIDPTAGCARLNGEPIAGPGAERGVVFQKYALMPWLNVIDNVALGLRFQGV
FT                   GRARRREIARETLALVGLDQHADARVYALSGGMQQRVGIARALASDPQVLLMDEPMGAL
FT                   DALTRETMQELVLDVWGRTRKTIFFITHSVEEALFLATRLVLMTPGPGRIAESHELPFA
FT                   RQFLASRDARAVKSSPEFIQWRERLVRRLHGEPHTAREVALS"
FT   gene            complement(97921..98943)
FT                   /locus_tag="Bxe_C0087"
FT   CDS_pept        complement(97921..98943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0087"
FT                   /product="ABC taurine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36013"
FT                   /db_xref="GOA:Q13IS6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS6"
FT                   /protein_id="ABE36013.1"
FT                   /translation="MKPLLSSLRTAAAGLTLFTLMAGAVHAESREVVIGYQDMVVPWRY
FT                   AQVSGAVEKATGYKVTYRKLAGGADVIRALASGSIQLGEAGSSPIAAGLSQGVDISLFW
FT                   ILDNINDAEALVARNGSGVTKLTDLKGRKIGLPFVSTSHFHALVALQDAGVDPSTVKIL
FT                   NLRPPEVAAAWERGDIDATYIWDPVLAKVKKNGKVLITSGEVARESGKATFDGFAVNRK
FT                   FAQDNGAFLVGLVKVLADTDAQYRDHKAAWTVGSKEVEGVAQESGANAADVPASLALYA
FT                   FPTLAEQASPTWLGGGAQSGAAKSLAATAAFLKSQGTIQNVLPDYSAGVDPRFVQQAAK
FT                   "
FT   gene            99417..100823
FT                   /locus_tag="Bxe_C0088"
FT   CDS_pept        99417..100823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0088"
FT                   /product="Putative selenium binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36014"
FT                   /db_xref="GOA:Q13IS5"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS5"
FT                   /protein_id="ABE36014.1"
FT                   /translation="MGMRPDPTFHASPKLAMDAPAENYAYTLLLSPDFSQPDALAVIDV
FT                   KPGSPTYSKVVHTVPVPNKGDEFHHFGWNACSSALSPLTGHAFLERRYLIIPGMRSSRI
FT                   YIVDTKPHPTQARLHKIIEPEEIFRKTGYSRPHTVHCGPEGIYVSTLGGGGKEGTDGPP
FT                   GIFIMDCETFEVLGRWEIDRGPQEKHYDFWWNLPRDYMVSSEWALPPQFENGIVAEDLL
FT                   SNRYGHHIHFWDLRARRNVQSIDLGANHQMALEVRPAHDPSREYGFIGVVVDTTNLEGS
FT                   IWTWWREGGQFHIEKTATIPPEPAAAELLPPLLQGFGAVPPLVTDIDLSIDDKFLYVAC
FT                   WGTGEMRQYDVTDPRKPKLAGSVHIGGIARRTPHPNGETFAGGPQMVEISRDGKRVYWT
FT                   NSLYSSWDNQFYPNGVPAAQVMARAEPGGGLTLADDYWVAFPDGYRAHQIRLEGGDCST
FT                   DSFCYPSVGI"
FT   gene            100820..101497
FT                   /locus_tag="Bxe_C0089"
FT   CDS_pept        100820..101497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0089"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36015"
FT                   /db_xref="GOA:Q13IS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS4"
FT                   /protein_id="ABE36015.1"
FT                   /translation="MTGGGWSQTGLWLAVLASGLYHGVNPAMGWPLAVSSGLMQRRVRA
FT                   LVVALFYLAAGHVLAMFVVMLPFAMLAILLAWQREIQLGASVLVAGFGAFLLICRRHPR
FT                   VLARIPPGRLALWSFAVAIAHGAGLMLVPVYLGLCRAYRMDRAHQAAQSLIDADLRMAL
FT                   FVSAAHATAMIAAGGLLAWLVYRYLGLKFVSRSWFNLDAIWASSLILVGMLSLAVNAAA
FT                   PVG"
FT   gene            complement(101700..102887)
FT                   /locus_tag="Bxe_C0090"
FT   CDS_pept        complement(101700..102887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0090"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36016"
FT                   /db_xref="GOA:Q13IS3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS3"
FT                   /protein_id="ABE36016.1"
FT                   /translation="MSVPSRQRPSFLRRKLLGTAVALALGGIASIAPAAAPASGEPVLF
FT                   GVSGPLSGPNAQYGAQWKAGFDLALDQINRDGGIHGRPLQYVFEDSQSDPRQAVTIAQK
FT                   FVGDPRILIELGDFSSPASMAASPIYQRAGLVQLGFTNSHPDFTKGGDFIWSPSVSQAD
FT                   AQPLLAELAAKQGFKRVAVLYQNTDWGRASKDVFVKAAASRGIQVVASEGYQPTDKDFR
FT                   ATLLRLRDANPDALVLISYYSDGAQIVRQARGSGLHTPIVAASSVYSPKFMELGGDAVN
FT                   GVTTNTSFFPDDPRPEVQHFVRTFEAKYHQQPDAFNAFAYDAAIIAAYALRAGGLDRRG
FT                   VRDALPRLRDVPSVVFGRATFDPATRRVIGVRSVNLVVDHGRWVLLSAKSSLAAK"
FT   gene            complement(103004..103579)
FT                   /locus_tag="Bxe_C0091"
FT   CDS_pept        complement(103004..103579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0091"
FT                   /product="Alkylhydroperoxidase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36017"
FT                   /db_xref="GOA:Q13IS2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS2"
FT                   /protein_id="ABE36017.1"
FT                   /translation="MNRTHGFTAATLEWTAWLDTVALDKASPEQTAVLEASHPKASTSD
FT                   YYLLLVHEPEVLAQRSGAFNSIMYAPGGLSRAERELASTVVSRVNGCVYCASVHAQRFT
FT                   QLTRRSDVIEQVFADPATAGTNERERAIVRYAIDLTLHPEAVDRRSLDALRVVGLTPAE
FT                   ILDLSQAIAIFAWANRLMLTLGEPVFPQ"
FT   gene            complement(103576..104145)
FT                   /locus_tag="Bxe_C0092"
FT   CDS_pept        complement(103576..104145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0092"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36018"
FT                   /db_xref="InterPro:IPR023982"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS1"
FT                   /protein_id="ABE36018.1"
FT                   /translation="MSTDTFSPGSAVVNDVVSQLAGLSADGSVAALRAARADATRYTQG
FT                   SHDALFAPELAGLTLPDRLYAAWYAAWLTPSHTAAQSYRERLLAASSAPSLSAAALDAV
FT                   ATQGLPAAADAIEAVGGPRLAAILAHTHALITRPATTGKPELAALQSAGLTTRAIVALA
FT                   QLIAFVSYQVRVVAALQALQALEQPA"
FT   gene            complement(104198..105694)
FT                   /locus_tag="Bxe_C0093"
FT   CDS_pept        complement(104198..105694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0093"
FT                   /product="Putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36019"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS0"
FT                   /protein_id="ABE36019.1"
FT                   /translation="MTSHAERTGATLAAAAAPGGLAALEARLREDLAWLELPAPAWVPA
FT                   RHVDARRVLDVAIIGGGMAGLTASAELRLLGIDNQQVFDQAPEGREGPWITYARMQTLR
FT                   SPKQLTGPALRLPALTFRAWYEAQFGREQWDALYKIPRTLWMDYLRWYRRVLELPVRNH
FT                   ARIVSLQPRDDGLIELDVAGLHGGNECVLARHVVLATGREGLGGPFVPEVARDLPKHRY
FT                   AHSSEDIDFASLRGRRVGVVGASASAFDNAASALEAGAASVDLFVRRTELPRINKLTGI
FT                   GSPGLVHGFVHLPDEWKWRFLHYAAQSQTPPPRDSVLRVSRYEQARFHLGSPLNGIAAN
FT                   ADALQVQTPKGRYEVDFLIFATGFHSELDTREEFAAIAPHVRRWRDRYTHPEDLPNEEL
FT                   ASSPDLDRNFAFQPRERHTCAALSRIHCFNHSASLTHGKLAGDIPAISDGAQRLARAIA
FT                   AMLFDADRERHYAALLAFDTAELAGDEWTDADAIATDAGP"
FT   gene            complement(105691..106671)
FT                   /locus_tag="Bxe_C0094"
FT   CDS_pept        complement(105691..106671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0094"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36020"
FT                   /db_xref="GOA:Q13IR9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR9"
FT                   /protein_id="ABE36020.1"
FT                   /translation="MELHHLEAFSAVMSAGSMTGAGRLVGRSQPGVTRMIQELEQEIGY
FT                   ALFDRKGPRVTPTQRAFLLYEEVERSLIGLDAIRASARAIGLDAPAPLRVAATPALAAA
FT                   LVPRTIAALAQHEAPLDVQLRSASAEHIVQALLARTVEVGVATLPLDHATLDLHYIVEA
FT                   PCVAVLHADHPLAGPGVLALQDIAAHPVVTVANRYRLRRRIDAAFADAGLQPVIALETN
FT                   ASLNAVMAAHARLGVALVDPATAFGTRIAGTVVRRIDAHIPFLFGVVTLPGKPLSSGAS
FT                   RLIEALGHVCVDLLPDAVRHAAAQHDALMTRRANPSRTHTKGVPA"
FT   gene            107022..108221
FT                   /locus_tag="Bxe_C0095"
FT   CDS_pept        107022..108221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0095"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36021"
FT                   /db_xref="GOA:Q13IR8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR8"
FT                   /protein_id="ABE36021.1"
FT                   /translation="MSMVLNRTEIRARAWRGALRALALAAVGALAQINLAHAAGTSSDP
FT                   YWVGVTGPLSGQDAQYGEQWKRGFDLALEQINGSGGIDGHPLNYDFEDSRSDPRQAVQI
FT                   AQKFVDDKRILLELGDLSSGASMAASPVYQRGGLVQFGFTNSHPDFTKGGDYMWSTAIS
FT                   QAEEQPMLAHYATTGLGFKKIAVLYLNTDWGRTSKDIFAKAATSDGAQVVAAEGYQPNE
FT                   KDFRATLTRIRSANPDSIVLISYYSDGAQIVRQARAAGVREPIAAVGSVYSPKFLELGG
FT                   AAVNGVYTESNFFPGDPRPEVQSFVTRYRAKYGGDPDTFAARAYDAMILAGEVIRRYGA
FT                   NRSAVRDGFAKIDNVPSVIFGKFKFDPQTRRVAGAKNRELVVKDGKFALWNGAQATRAQ
FT                   "
FT   gene            108268..110091
FT                   /locus_tag="Bxe_C0096"
FT   CDS_pept        108268..110091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0096"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family / amino acid/amide ABC transporter membrane
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36022"
FT                   /db_xref="GOA:Q13IR7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR7"
FT                   /protein_id="ABE36022.1"
FT                   /translation="MSAWFDYTINGLIVGNIYALLAVGLALIFGVSHLINFAHGSVYMV
FT                   GGFIGWLCLTRLGLPLPVALLATVAGCALLGMLIERIGLRPLQGAARIAPLLATIGISF
FT                   VLDQLAQIVFGPDPRPVPSTLPEWSFTIGGATLGSLDLLIAATGIGAAAVLYVFLRFTR
FT                   LGWAVRATAQDRDAALQMGVNVHAVNRAVFAIACGLGGLSGLLVGMYYNSIDPAMGFQA
FT                   TLKGVVALLIGGLGNVPGAIAGSLLLGLVESYGVALFGTSYRDLFAFVLLLLFLVWRPN
FT                   GLFSANRRLPPEPLTGTFLSYGRALRVPRGVLIAAVVSAFALPLIAPSPYLLQTLTNGW
FT                   IYGLLALSLTLVAGTVGQISLGHAALLLIGAYGSALLSVNLGWSPAVTIPLAGAITALI
FT                   GTLLVYPSFRLRGHYVSIATLGIGEIVGLVVLNWDSLTRGPVGITGIPPLALFGWQVTS
FT                   ARAVYWFALAVLVVLALLQVRLLRSHLGRTWRAIREDDVAARAYGVRPNRYKAIAFACG
FT                   GFAAGIGGGIAAHLYSYINYQTFDSQVSILALTMVILGGLGSVAGAVVGAVALISLPEL
FT                   FRFAADYRMLIYGVVLLLLVRFRPQGLFGTA"
FT   gene            110102..111010
FT                   /locus_tag="Bxe_C0097"
FT   CDS_pept        110102..111010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0097"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36023"
FT                   /db_xref="GOA:Q13IR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR6"
FT                   /protein_id="ABE36023.1"
FT                   /translation="MNPASVSGRDILFDVRRVTRRFDGLTAVDGVSLSVARGECVSVIG
FT                   PNGAGKSTLFNLLTGMDVPDEGEIRLDGEDVTGTSPERLAARGVARTFQHGRVFGNLSV
FT                   LDNVLIGAHSRLALARPGWPVLGAFSEVVRALVRPSALRREEAALRADAEAIIARFGTR
FT                   LTPRIEQPAHSLSYANRRRVEIARALALRPRMLLLDEPTAGMNESETAEMLELILDLKR
FT                   DGLTILLIEHKLDLVMRLSDRVIVLDDGRKIAAGLPDAVRNDPAVIDAYLGHRHVGAQA
FT                   GPAAQAVAARSDSTVTGAQHA"
FT   gene            111007..111795
FT                   /locus_tag="Bxe_C0098"
FT   CDS_pept        111007..111795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0098"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36024"
FT                   /db_xref="GOA:Q13IR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR5"
FT                   /protein_id="ABE36024.1"
FT                   /translation="MTAHDPLTRAQTNSATMTAPLLQLDNIDTFYGQIQVHFGVSLEVP
FT                   RGEIVSLLGGNASGKSTAMKIILGLHRPRSGTIRFDGRAINGLLTPQIVRLGIASVPEA
FT                   RRLFGDMTVRENLLMGAFTRRDREGIAQDYERMLALFPRVKERLAQRAGTLSGGEQQML
FT                   AMARALMSRPALVCMDEPTMGLSPLYVDKVLDLIRTVNQQGVTFFMVEQNASLALQIAH
FT                   RGYVLQTGRVVLSGEAGALLGDQRIRDAYLGGALAAETAS"
FT   gene            complement(111916..112749)
FT                   /locus_tag="Bxe_C0099"
FT   CDS_pept        complement(111916..112749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0099"
FT                   /product="ABC nitrate/nitrite/cyanate family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36025"
FT                   /db_xref="GOA:Q13IR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR4"
FT                   /protein_id="ABE36025.1"
FT                   /translation="MSSVTGRPAATPRDSNAAAGGPRIVSGWLARTLLGLTGLAGIVAI
FT                   WWLAIHLIARPDSLAAQFSPGRALAALPSLVTEDRLLVHIATSLRRIAIGLAWALLIGV
FT                   PLGFLIGRIKAFDTALSPTLQFLRMISPLSWMPIAVMSLGVGDRAVYFLLAFAAVWPLV
FT                   MSTAAGVTQIDRRWLQLAESLAATRGEMLWHIFVPGLAAHVLTGVRLAIGILWIVLVPA
FT                   EMLGVSSGLGYLILDTRDRLAYSELTAVILVIGALGFLLDYAARLIYRRCGYEQR"
FT   gene            complement(112742..113932)
FT                   /locus_tag="Bxe_C0100"
FT   CDS_pept        complement(112742..113932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0100"
FT                   /product="ABC nitrate/nitrite/cyanate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36026"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR3"
FT                   /protein_id="ABE36026.1"
FT                   /translation="MCQLPMSRREWLKLASMFTVAGAAPLLAALNARAAENPDAPVRIG
FT                   YLPITDAAPLLVAHNNGYFDASGLAVEKPTLLRSWAQLVEAFLSGQVNVVHLLAPMTIW
FT                   ARYGSQAPAKVVAWNHVNGSALTVAPDIGKLGELGGKTVAVPFWYSIHNVVVQHMLRAQ
FT                   GLVPVLEKDGELKANEVRLIVMSPSDMPPALASRQIAGFIVAEPFNAAAEELKVGKVLR
FT                   FTGDVWKNHACCVVFMHERDLTERAAWSQKVVDAVVKAQVWTRAHPQEAAQLLSKSGRN
FT                   HYTPHSANVLTNVLAPPPGDEGRYLADRAITHADWHAKRIDFQPYPYPAYTEELVRRLK
FT                   ATQVEGNAQFLHQLDPAFVARDLVDDRFVKKSIESAGGMKAFGLAESFTRTETILV"
FT   gene            complement(113948..114742)
FT                   /locus_tag="Bxe_C0101"
FT   CDS_pept        complement(113948..114742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0101"
FT                   /product="ABC nitrate/nitrite/cyanate family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36027"
FT                   /db_xref="GOA:Q13IR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR2"
FT                   /protein_id="ABE36027.1"
FT                   /translation="MSDLTAAGAPRIEVCGVGLRYAQRSVLDGISLRVRPGELVSVLGP
FT                   SGSGKSTLLRIIAGLQQPGAGHVEIDGEILRGPRPDVALAFQDPCLLPWLPVEKNVAFG
FT                   LGFARQPALSRGERRERVTAALQEVGLAHARHYTPRQLSGGMAQRTALARCLARQPRTL
FT                   LLDEPFGALDEVTRADMQRLLVTVVRDTNAATVLVTHDIDEALLVSDRVVVLGAQGTLI
FT                   LQLDIVVAPPRETRVQELGALRIQILQALQDSMTHTPLSAHT"
FT   gene            complement(114739..115842)
FT                   /locus_tag="Bxe_C0102"
FT   CDS_pept        complement(114739..115842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0102"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36028"
FT                   /db_xref="GOA:Q13IR1"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR1"
FT                   /protein_id="ABE36028.1"
FT                   /translation="MNHAPLTAVTPQLATWLDANAEAIDAGQELAPQILPQLGRAELFR
FT                   IGVPGQLGGLGGTTVEAIEAVAGVAGHSLAAAFVFWGQRTFIEYLLQSPNEALRTRSLP
FT                   MLLRGELAGATGLSNAMKYLSNIEPLQMNAAPLSGAGVTAGWTLNGSLPWITNLRREGF
FT                   LAAAAFDHSDGAPPSIFAIPHDAPGVIRSDDLDLIALRSSNTAALKLDGAVLDASWQIT
FT                   ADARAFLVQARPAFLGLQCGMSIGLARRALAAVAASSAAVRAAVDGEASRLAYDLDALS
FT                   QRLFDGIRHGTFLAAPATLFEVRIGLAALVDAAVRLEVQAAGGRGYLRGPGGAARRTRE
FT                   AAFVPIVTPSIVQLKNQLAQHRQAQAA"
FT   gene            complement(115839..116474)
FT                   /locus_tag="Bxe_C0103"
FT   CDS_pept        complement(115839..116474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0103"
FT                   /product="Alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36029"
FT                   /db_xref="GOA:Q13IR0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR0"
FT                   /protein_id="ABE36029.1"
FT                   /translation="MDSGALSCAWPSTTMNALLQGSDMSRLPLQTLESAPAASRPYLAR
FT                   AQAANGFLPNLVASLANAPAALEAYLTVAEINGRGSLTLAERETVQITAAGIHGCGFCV
FT                   AGHTAVALKKAQLEPALVDAIREQRTLSDSRLDAVAVFTRAVIATRGAVADEQLAAFHR
FT                   AGFSDAHALEIVLGVSLATLCNFANNLAQNELNPQLAAYRWEASAHAA"
FT   gene            complement(116518..117492)
FT                   /locus_tag="Bxe_C0104"
FT   CDS_pept        complement(116518..117492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0104"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36030"
FT                   /db_xref="GOA:Q13IQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ9"
FT                   /protein_id="ABE36030.1"
FT                   /translation="MLPNDDRIADWLLSSLELKSTIFHVGQYCGTWQASTAGRRRASFH
FT                   VVLHGQCWLHLAANPQGEAQSLQLETGDAVFLLHDMPHCLSPDPQPPASGRESERIGTM
FT                   SPLTLTADARASAQGSVGIACGFFEFNSGLDNMLLSLLPDRVVARRDNPSLEGARAIFE
FT                   LIRAEALRDPNVPSPLIARLTDLLFVYALRASNGTDGITRCFWALMRRAEFAPLLSAII
FT                   ESPGERWTTDTMASFVHMSRARFCRQFVEISGQPPAQLVTLIRMKLAAAMLRGGARTPD
FT                   AAERVGYQSESAFAQAFKRVTGVQPGAWRRARIAREAGRATLH"
FT   gene            117852..118823
FT                   /locus_tag="Bxe_C0105"
FT   CDS_pept        117852..118823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0105"
FT                   /product="ABC aliphatic sulfonates transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36031"
FT                   /db_xref="GOA:Q13IQ8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ8"
FT                   /protein_id="ABE36031.1"
FT                   /translation="MTRHSSPGRRHFIEAGLALALASAIPGAHAQGGASSARVLRIGYQ
FT                   KGPFSILKGRGTLDKRLAALGTRVEWTEFPSGPPQLEALNVGSIDFGDVGEAPPIFAQA
FT                   AGAPFVYYGQTAKRPVSEAVVVPDDSPVTSFSELKGKRIALVKGSNTHFLLVRLLAAAK
FT                   IDYRDVTPVWLSPSDARAAFERKAVDAWAIWDPFLAVAQKTANARIIADGSGVVANRAF
FT                   YFTSHNYVQKNDDVLRVVLGEIGALDKWVEANRSEAAGEFAQLWGVPREIVEVALARLQ
FT                   YGVEPISRETLADQQRIADAFYELKLLPKRIEVAHAAPPSLA"
FT   gene            complement(119050..120246)
FT                   /locus_tag="Bxe_C0106"
FT   CDS_pept        complement(119050..120246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0106"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36032"
FT                   /db_xref="GOA:Q13IQ7"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ7"
FT                   /protein_id="ABE36032.1"
FT                   /translation="MKKTTTATLLALGTFAATAHAQSSVTLYGVADAGLLFNNNVKGEK
FT                   LYALSSATSSRFGLLGTEDLGGGLKAIFTLENGYTVGTGALGQGGLLFGRKAFVGLKSD
FT                   TYGTLTAGRQYSVSNDATSSFASGADWAASGLGYGTRAGDVDNVDTSNRIQNALKYQSP
FT                   VFRGLSFGVLYSFGGQAGQFSRNAVTDVAVSYANGPVKLGASYMFTKDPYYATFGDQGN
FT                   SSTPTSSATGSNNNMPSRIYGGYASAGSQQIITAGGSYALGAATIAVLYSNTQFQNLGT
FT                   VNAVGSFGTRYNGGTATFNSGELNVKYLLTPALTLAGAYIYTHNSGADGVGSANYSQVN
FT                   LGTIYALSKRTSLYAIGFYETASGVDSTGKQAVADFSGASYSSNNRQLAAIVGITHRF"
FT   gene            complement(120457..121398)
FT                   /locus_tag="Bxe_C0107"
FT   CDS_pept        complement(120457..121398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0107"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36033"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ6"
FT                   /protein_id="ABE36033.1"
FT                   /translation="MKSQRITASIFLSAIASLAMSLSTLALAANTLDLNPEQRDRIRVE
FT                   KDPAAINAVGGSYRFVKDDTLTIGIHPFIPPISTYATDARTIVGFDADLAQVIADSLGK
FT                   KLELVPVAWADWPLALQSGKFDAVISNVTVTEERKAKFDFSTYRKDQLGFYVKSDSKIT
FT                   SLQEPKDIAGLRIITDPGTNQEKILLEWDKQNVAHGLKPITVQYYDDDAVKNLAIQSGR
FT                   ADAVFSVNAVQAYQAAEQRKTRLVGTVSGGWPRTAEVAITTRKGSGLADALTTALNDLI
FT                   KSGTYTHVLDKWNLGSEAISKASTNPPGLPKL"
FT   gene            complement(121480..121794)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0108"
FT   gene            complement(122114..123346)
FT                   /locus_tag="Bxe_C0109"
FT   CDS_pept        complement(122114..123346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0109"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36034"
FT                   /db_xref="GOA:Q13IQ5"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ5"
FT                   /protein_id="ABE36034.1"
FT                   /translation="MSTVLEPAGHAAATNPQSAALQTSVAPPTLLPHPLLETIGARAAG
FT                   YDRENRFFAGDLEDLQRVGFLRASVPVELGGLGLTLPQLLREQVRLATRAPATALALNM
FT                   HLYWIGAALHLYRRGDASARWILTEAAAGKVFAAGHGEPGNDLGLAHSFVKATPLGDGG
FT                   YRFDGRKILTSLAPAWDWLGVHGLDDSDPAAPKIVHAFIHRDAAGHRTVETWDALGLRA
FT                   TRSDDTYLEGAIAQHQHVIRVLPAGIPDDPFVDGILGAVLPGLAAVYYGIAKRALELAI
FT                   ATAKTRTSQALAGKTYAYKPLTQLSVAQAAIELDSIEALVERVAAQWWQGYPDGEPWIA
FT                   RLLASKQHAVDGALRVVNLALKIAGAGALSKNNELERLYRDVRAGAFHPPNADATHEVI
FT                   GQAWLGVLGKV"
FT   gene            complement(123359..123634)
FT                   /locus_tag="Bxe_C0110"
FT   CDS_pept        complement(123359..123634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0110"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36035"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ4"
FT                   /protein_id="ABE36035.1"
FT                   /translation="MAEVVSDNHQRRIYRLGVPDDDALAGETARLIARQGGDNGIRALS
FT                   LNAATARRFTRYFEHLSSADGNNLPLAGRVIAAGVVPDDKYCGPAA"
FT   gene            complement(123948..124544)
FT                   /locus_tag="Bxe_C0111"
FT   CDS_pept        complement(123948..124544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0111"
FT                   /product="Putative nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36036"
FT                   /db_xref="GOA:Q13IQ3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ3"
FT                   /protein_id="ABE36036.1"
FT                   /translation="MTTSNSRTADHPVDRLFLNRWSPRAFTQDLIPESTLLTFLEAARW
FT                   APSSYNSQPWRFVYARRGTAHWERFLGFLNDFNRGWAQHAAAIIIVLSKSTFVPPGGNE
FT                   EVPAPTHSFDTGAAWGYLALQASLAGWHAHGLAGIERERIRAELAVPDVYSIEAGIAIG
FT                   LPGDKSTLPEALQAREIPSPRNPLSAIATEGHFTV"
FT   gene            complement(124620..125567)
FT                   /locus_tag="Bxe_C0112"
FT   CDS_pept        complement(124620..125567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0112"
FT                   /product="Taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36037"
FT                   /db_xref="GOA:Q13IQ2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="PDB:5KEU"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ2"
FT                   /protein_id="ABE36037.1"
FT                   /translation="MSAAALQETPSIQVKPLSAHIGAELHGVDLTRKLDPSEVAQIRAA
FT                   LLRWRVVFFREQFLTHEQHVAFSAQFGEPTLGHPVFGHVDGHPEVYSISKYRKATRFEG
FT                   QALLRPWTGWHTDVTAALNPPWASILRGVTIPPYGGDTQWTNLALAYEKLSAPLRAFVD
FT                   GLRGVHRFTPPAGASGTEAFVKAVEQRVLVTEHPLVRVHPETGERVLYVSPSFLKSIVG
FT                   VTPRESEALLELLWEHATRPEFTVRFKWEAGSVAFWDNRATAHLAPTDIFDLDFDRQLY
FT                   RTTLVGDVPVGPDGRQSVAIEGSPVSAAAAVALN"
FT   gene            125823..127322
FT                   /locus_tag="Bxe_C0113"
FT   CDS_pept        125823..127322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0113"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36038"
FT                   /db_xref="GOA:Q13IQ1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ1"
FT                   /protein_id="ABE36038.1"
FT                   /translation="MSTVAFPSAAADPQAPADSAGRAAVIRSAQDVARIVNAGAAKGSN
FT                   ARIVIAIALGGVFLDAYDLTSLAYGIKDIAREFSLSPVQVGFVSSAITFGAILGALFGG
FT                   YLTDRIGRYRVFMADMLFFVVAAIAAGLAPNAWVLGGARFLMGFGVGLDLPVAMAFLAE
FT                   FSRVAGKGNKAASVAAWCPAWYAATSVCYLLILGLYAILPAHHLGWLWRLTLAFGAVPA
FT                   IAIILVRSRYISESPVWAANQGDLDGAARILKRSYGVDAVVERSDTPVKAPRAASWRNY
FT                   GVLFNATYRRRTILAAVIGSASSFGYNAIIFGLPVIITSFFHQGPLTTIIAALALNLAF
FT                   AFVGGLIGVRTAPTVGAWKMTVLGHALQFVSLIGLALIGKPGNGALVVLALLLLGGYLF
FT                   GQGFGPGSHSMTYASLSYPTSLRGIGVGFNQTLVRSASTVSLFLFPVLAAAFGTKVFWV
FT                   IAIAPLSSLLVLLAIRWEPSGYDIDGEDYAQPPVTAKTAHA"
FT   gene            127488..128936
FT                   /locus_tag="Bxe_C0114"
FT   CDS_pept        127488..128936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0114"
FT                   /product="Putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36039"
FT                   /db_xref="GOA:Q13IQ0"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ0"
FT                   /protein_id="ABE36039.1"
FT                   /translation="MTLSTHPDQHAIDTLRLIGPAPDNWVPPRAGIDHNVVIVGGGQTG
FT                   TAFAFALRRAGIGQVSVIDAAPDEDHAGVWLNRARMNKLRTPKTLVGPEAGLPGLSFQA
FT                   WYEARFGAASYEEIDRIARTRWAEYLAWYRHFLDIPIRYGTRLTLIEPVDEHFRLHLEV
FT                   RDGATVKSVVETARKIILGNGVAGNGAPYIPPALKNLPPSHLAHTADAIDFAALRGKSV
FT                   AVIGAAASAFDAAATALEAGAAEVHLFARRERIASVPVIRTRAYPGAYDNYFHLPDAIR
FT                   WAQARRFRRAGSTPPVDAVERVTRFPNFHLHPGTSWTEADVRNGRVETSVAGEPFAFDF
FT                   VIAGTGYVVDPALRPELAQLAGRIRLWRDQYVPASNDSDDALGAYPYLGAALEYLEKTE
FT                   GDAPYLRNIHVYNPAAFVSFGLPVGDVPSMKRDIPAVVQRISRDLFLADLHAHEARING
FT                   DIAADFDASIYAGSIWQRDKADIA"
FT   gene            128987..130045
FT                   /locus_tag="Bxe_C0115"
FT   CDS_pept        128987..130045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0115"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36040"
FT                   /db_xref="GOA:Q13IP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP9"
FT                   /protein_id="ABE36040.1"
FT                   /translation="MSTQFESIAPHAPASGTPAGDATRAAPRRGLSRGVLSAGLAAIAW
FT                   LASAAQTTWWPSLDDWPYTREFIVLKLALAAFAVALGVAGWRGSQSPSPTAARASAWLR
FT                   AMPWLLALALGVSAWEAVTAQLEWLPRPFFAPPQALIGVFAEDYPRLGSSVVHSFGLLA
FT                   YGYVLGAVAGFVTGVSIGWSQAVSYWVHPVLRLIGPLPATAWLPLAFFFFPSSFSASVF
FT                   LIALATAFPVAVLTWSGVASVNPAYYDIARTLGARPSFLILRVAIPAALPSVFVGLFMG
FT                   LGASFSVLIVAEMMGVKAGLGWYLQWAQGWAAYSNMYAALLVMALMCSGLITLLFRVRD
FT                   RLLAWQKGLLKW"
FT   gene            130039..130869
FT                   /locus_tag="Bxe_C0116"
FT   CDS_pept        130039..130869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0116"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36041"
FT                   /db_xref="GOA:Q13IP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP8"
FT                   /protein_id="ABE36041.1"
FT                   /translation="MVAVPEVLNQSAAASPVRDAARIDVRHVSHRFALRGAALPVLQDV
FT                   SFTVEPGEFVALLGPSGCGKSTLLRLVAGLDAPTQGSVHANGAAITGPDPSRVVVFQDP
FT                   TLYPWRTVRGNVAIGPQAQRRRFARRDAAQEDHARQRIDAALELVGLSEFAEAFPHQLS
FT                   GGMAQRVALARALVNDPALLVLDEPFGKLDSLTRIRMQGELARLWQDARFSVLLVTHDV
FT                   EEALLLANRVIVFSERPARVVAEVRNDAPYPRHRDDPKLVALRREVLAQLGLDT"
FT   gene            130911..131954
FT                   /locus_tag="Bxe_C0117"
FT   CDS_pept        130911..131954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0117"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36042"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP7"
FT                   /protein_id="ABE36042.1"
FT                   /translation="MNPYNEFPLSPARRAWLRKTAWSAGAAALGGAVLSLPGSLALAQT
FT                   PSAPLKPLKLSWNAGAICTAPVAVAVKQGFFARHGLQVELVNFSGSTDQLLEAIATGKS
FT                   DAGVGMALRWIKPLEQGFDVKLTAGIHGGCMRLLATRASGIVDVAGLKGRTIGVSDMAS
FT                   PTKNFFAIVLKKIGVDPERDVSWRQYPANLLGEALKKGEVQAIADGDPTIWSIRESDHL
FT                   YEVSNNLCGEYQTRSCCVLGVRGSLVRKDRATAQQLTQALLEATEWTANHPAEAAAIFS
FT                   AYTPSADVGQLTAMLKTHTDHHHPVGDAFKKEISLYADDLKTVGVLNSGTDSNRLADRV
FT                   FSNVLTA"
FT   gene            132297..133634
FT                   /locus_tag="Bxe_C0118"
FT   CDS_pept        132297..133634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0118"
FT                   /product="Putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36043"
FT                   /db_xref="GOA:Q13IP6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP6"
FT                   /protein_id="ABE36043.1"
FT                   /translation="MTRQLRLGAFMRPATIHTGAWRYPGAYPDANFNFAHLKRFAQTLE
FT                   RGRFDAFFMADHLAVLNMPVDALKHSHTVTSFEPLTLLPALAAVTEKLGLIATASTTFD
FT                   APYHVARRFASLDHISGGRAGWNLVTTSNPDAALNFGLEEHVEHDERYRRAREFFDVVT
FT                   GLWDSWADDAFIRDTETGTFFDPQKLHVLNYKSANFSVRGPLNIARPVQGWPVIVQAGS
FT                   SEAGRQIAAETAEVVFTAQSSLADGKRFYADVKGRMEALGRPRDHMKVLPAAFIVVGDT
FT                   LEQARETRARLDTFVHYESGTASLSIALGHDISGFDPDGPLPAIPETNASRTARQRVVE
FT                   WAQRDGLTIRQLAQRIGGYSGLEMVGTPAMIADQMEQWLTEEGSDGFNVMFSHLPAGLD
FT                   DFVDKVIPELQARGIFRREYEGATLRENLGLPRPENRYFAPGSERA"
FT   gene            133756..134025
FT                   /locus_tag="Bxe_C0119"
FT   CDS_pept        133756..134025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36044"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP5"
FT                   /protein_id="ABE36044.1"
FT                   /translation="MHQIDGGRVMAHSAMAIWDGFRHPRAFLRSWVKRAPGTAVLPHEA
FT                   QAACTHACNSAERLERIAAYARSGYFHIEYTAGMFVVPLDIPPD"
FT   gene            134239..134706
FT                   /locus_tag="Bxe_C0120"
FT   CDS_pept        134239..134706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0120"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36045"
FT                   /db_xref="GOA:Q13IP4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP4"
FT                   /protein_id="ABE36045.1"
FT                   /translation="MTLEVAERPTHTLLEAARTRATEAGLPYAGGLAPQDAWALVQTGN
FT                   ALLVDVRTAEERKFVGLVPGSLHVAWATGTSLTRNPRFVRELEARTGKDAVVLLLCRSG
FT                   NRSALAAEAAAKAGFTQVFNVLEGFEGDLDGAQRRGSSNGWRFHGLPWIQD"
FT   gene            134750..135733
FT                   /locus_tag="Bxe_C0121"
FT   CDS_pept        134750..135733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0121"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36046"
FT                   /db_xref="GOA:Q13IP3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP3"
FT                   /protein_id="ABE36046.1"
FT                   /translation="MAVFDVDDIVLALQTVRQQWREVQKRSLEPGGRELPGREALSQVV
FT                   DTLKGVLFPMRLGPPDLRQESENFYVGHALDAALHALLSQARLELHYRSRHAPPAADVI
FT                   EREASVAVRAFAARLPAIRTLLDSDVLAAFHGDPAAGSVDEVLLCYPGVLAMIHHRLAH
FT                   ELYRLGLPLLARIVAELAHAQTGIDIHPGARIGAGFFIDHGTGVVIGETSIIGERVRVY
FT                   QAVTLGAKRFPRDAEGHLEKGHARHPIVEDDVVIYAGATILGRVTLGRGAVIGGNVWLT
FT                   QDVAPGSHVTQAVSRSEGIGVVSAAPHKPVPPNTLAEEPAVAGGAR"
FT   gene            135730..136005
FT                   /locus_tag="Bxe_C0122"
FT   CDS_pept        135730..136005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0122"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36047"
FT                   /db_xref="GOA:Q13IP2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP2"
FT                   /protein_id="ABE36047.1"
FT                   /translation="MTLIVRNFGAAVRRLRELQGWSQEQLAEYAGLNRSYVGEIERGSA
FT                   IASIVTVDKLARAFGVSIECLLRSSSDQAGVILPEASAPINPAPAS"
FT   gene            136115..137047
FT                   /locus_tag="Bxe_C0123"
FT   CDS_pept        136115..137047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0123"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36048"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP1"
FT                   /protein_id="ABE36048.1"
FT                   /translation="MTATVGGLTALGDTAARQLANATKTVPQLATITPRWLTHLLQWLP
FT                   VEAGIYRLNQVKNPEAVVAACTAREDESILPRTFVPYEEQPREYFLNAVSTVLDVHTRI
FT                   SDLYSSPHDQIKEQLRLTIETIKELQESQLINNPDYGLLANVAEEQRVFPLTGAPTPDD
FT                   LDELLTKVWKEPAFFLTHPLAIAAFGRECTRRGVPPPTVSLFGSQFLTWRGIPLIPSDK
FT                   VPVADGKTKILLLRVGDKRQGVVGLFQPGVAGEQGPGLSVRFMGINNHAIASYLISLYC
FT                   SLAVHSPDALAVLDDVEIGKYHDYPDTYK"
FT   gene            137052..139118
FT                   /locus_tag="Bxe_C0124"
FT   CDS_pept        137052..139118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0124"
FT                   /product="L-selenocysteine selenide-lyase
FT                   (L-alanine-forming) / cysteine desulfurase"
FT                   /EC_number="4.4.1.16"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36049"
FT                   /db_xref="GOA:Q13IP0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP0"
FT                   /protein_id="ABE36049.1"
FT                   /translation="MDSVLPHDVPSGPPAGLPDPALLATLANAFFSALPGSAPQPDGGG
FT                   VVGGAPSLAGTLPLSAPVLGELSNPVPAGSPLAGPGGAGTGVPGAALPQGRLPGGNLLP
FT                   SAPTHVLSLGNRAPALAPHAAAQNGLPDSAVTVAPALAPRFGGAALGVSEGHGAQRPSA
FT                   GGAPAPSAVSSPSASPFYFLGDAGPAHPAAGASSDIVVPGWSEVTAQSLGLPGVDEPLS
FT                   GQRFSYDRPDEPASAANTHTARAAQPAGSSHYFLNEAQASRLPGQKSGMADAVPHAGAS
FT                   AHPPFDVNAIRRDFPILQERVNGRQLVWFDNAATTHKPQAVIDRLAYFYAHENSNIHRA
FT                   AHALAGRATDAYEAARSKVQRFIGASSPDEVIFVRGTTEAINLIAKTWGAKNVGEGDEI
FT                   IVSHLEHHANIVPWQQLAAQTGAKLRVIPVDDSGQVLLDEYRRLLNDRTKIVSVTQVSN
FT                   ALGTVVPVKEIVELAHRAGAKALVDGAQSVSHMRVDVQALDADFFVFSGHKVFGPTGIG
FT                   VVYGKRAILEDMPPWQGGGNMIADVTFERTVFQPPPNRFEAGTGNIADAVGLGAAIDYV
FT                   QQVGIENIARYEHDLLAYATSVLQPVPGVRLIGTARDKASVLSFVLKGYETEEVGHALN
FT                   EEGIAVRSGHHCAQPILRRFGVEATVRPSLAFYNTCDEVDALVSVVRRLSARR"
FT   gene            139438..140193
FT                   /locus_tag="Bxe_C0125"
FT   CDS_pept        139438..140193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0125"
FT                   /product="Putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36050"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN9"
FT                   /protein_id="ABE36050.1"
FT                   /translation="MTEPLERQNDHPRLAWIAGVGASAGLGAALARRFAREGLTVVVTG
FT                   RSHERLDARVAEIRGAGGHALALPGDVTSESDLAAITRQLADAGTLEVAIFNAAGATRA
FT                   PTLELTAEQFEAAWRVTTLGGFLFARAALQPLLARGHGSLLFTGATASLRGRPPFAAFA
FT                   SAKAGLRSLAQSLAREFGPRNIHVAHVVIDGGIDGERLRTSAPQRVSERGPDGLLDPAD
FT                   IADAYWYLHRQSRSAWSQEIDLRPFNESF"
FT   gene            140212..141051
FT                   /locus_tag="Bxe_C0126"
FT   CDS_pept        140212..141051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0126"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36051"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN8"
FT                   /protein_id="ABE36051.1"
FT                   /translation="MSDIVIDTPASATTIEAELNYLEFTGEKPVSYQYEPPPGVPKRSG
FT                   VYRPYRVQISNARLAPPPGPLSLDRNGFELHRQASALSDFSDPAKIESIYYPEAQTLLK
FT                   QATGAKRVVVFDHTLRDGKPERAAGVREPVKYIHNDQTFVSGPRRVRDHLPAEEAERLL
FT                   QGRVAIVNLWRPIGETVQSSPLALCDSRSIALNDLVASDLVYPDKVGETYALVFNPRHR
FT                   WYYFPRMTPDEFLLLKIYDSAGDPIARLSAHSAFDDPTSPANAPGRRSIELRSLLFF"
FT   gene            141288..142106
FT                   /locus_tag="Bxe_C0127"
FT   CDS_pept        141288..142106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0127"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36052"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN7"
FT                   /protein_id="ABE36052.1"
FT                   /translation="MKIWTRSAAVVGLLLTLSGVAHADRLDDIKKAGVLRVATFDSNPP
FT                   FGFVDPKTNQIVGLDVDYARAVAAKLGVKLEIQPTNPANRIAFLKSNKVDLVFANFTIT
FT                   DERKKEIDFSTPYFASGTQFIAKKGVLKSPQQLDSLRIGADKGTTNEQQVRAQFPAATI
FT                   VAYDDTPFAFAALRAGNVQAITQDGPKLVALLANVPDKEKYEIPPFTISNDYEGVGVPK
FT                   NEARLLNVVNETLVGLEANGNAAKIYDQWFGPGSKAPLPRLFKIGDPQKS"
FT   gene            142190..142948
FT                   /locus_tag="Bxe_C0128"
FT   CDS_pept        142190..142948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0128"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36053"
FT                   /db_xref="GOA:Q13IN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN6"
FT                   /protein_id="ABE36053.1"
FT                   /translation="MMTMNAWLEPRYVAWIWRGFAMTLALSASVAVCATLLGFALALAR
FT                   SAPSAALRRAAAGYVLIFRNSPLLVQLLFWYFGAAVLLPDGLMNWLNTPHVVVLGPVTL
FT                   SWPTFEFVAGWLGLTCYSTTFIGEEFRAGMRGVRDGQYQAAAALGLTRFATFRHVILPQ
FT                   AVRIATPPLAGQYMNVIKNSSLTMAIGFAELSYSSRQVETETLKTFQSFGMATLLYIAA
FT                   IATIEVALLIWQRRGAYGSGGVRFPRGGRS"
FT   gene            142945..143640
FT                   /locus_tag="Bxe_C0129"
FT   CDS_pept        142945..143640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0129"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36054"
FT                   /db_xref="GOA:Q13IN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN5"
FT                   /protein_id="ABE36054.1"
FT                   /translation="MSAVDWLPILRYLLAGAFPNGPLGGIALTVMLTLTSAALSALLGL
FT                   AGGVSLVMTRGLPHLLLLAVVGLFRAIPVLMLIFWTFFLMPVLLHVDVPGLATVVCALA
FT                   LIGGAYLSHSVQAGIVAVGDGQWQAAQSLGMTRGQALRHVLLPQAIRTMTPSFVNQWVS
FT                   LIKDTSLAYIVGVPEFTFLANQVNSRLMVYPAQIFLFVGLVYLVLCCTFQWGVTRLLSG
FT                   AFDAGAARR"
FT   gene            complement(143707..144117)
FT                   /locus_tag="Bxe_C0130"
FT   CDS_pept        complement(143707..144117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36055"
FT                   /db_xref="GOA:Q13IN4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN4"
FT                   /protein_id="ABE36055.1"
FT                   /translation="MSESKRQIRPGAFLMETGHHIAAWRHPDMHASGGPDFQHYVQLAR
FT                   IAERAKFDVIFFANSVSVREKEEGTDGFNVMPPWLPGGLSAFTEQIVPELQRRGLFRTE
FT                   YEGRTLRENPGLPRPVNRHVLAGKNAAAVAAR"
FT   gene            complement(144167..145012)
FT                   /locus_tag="Bxe_C0131"
FT   CDS_pept        complement(144167..145012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0131"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36056"
FT                   /db_xref="GOA:Q13IN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN3"
FT                   /protein_id="ABE36056.1"
FT                   /translation="MTLATSEGLDIRHVRKRYVQRGTALDVLDDITLRVRPGEFISVLG
FT                   ASGCGKSTLLRLIAGLDTDYSGDIFVAGERVRDTSLQRGIVFQDHRLFPWLTASQNILA
FT                   ALRNAPLTAKQKRDAVAEHIALVGLAGFENAYPNQLSGGMAQRVAIARGLVNRPRVLLL
FT                   DEPFGALDALTRGRLQNELQRIWEQERITMILVTHDVDEAVYLGDRVVTMAPRPGRIKR
FT                   IVDVGLPRPRKRGDARFLRLRDEIVADFGESGDLPSDGDDGSPSVEAAHPPITEWRLAW
FT                   "
FT   gene            complement(145054..145935)
FT                   /locus_tag="Bxe_C0132"
FT   CDS_pept        complement(145054..145935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0132"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36057"
FT                   /db_xref="GOA:Q13IN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN2"
FT                   /protein_id="ABE36057.1"
FT                   /translation="MSFLSKLRTRTGPGRSGRKGPPPCDCALPEPRKKIRTVVTRRGAA
FT                   WRGVLLPLVAIALWSAVSALHLVKSGLLVSPLAVLQTGWQQTVSGALLRALSASLAREA
FT                   SGFVIGTVGGLLLGSLLGFSRLARRMVGPSFDTFKQISLFAWIPLISVWFGLGDAAKVV
FT                   FLSLAALLPVTAHTCDGIHAVPRSYVEVARAFRYSRLQLIAHVILPAALPSIFTGIYLA
FT                   LIYSWLATLGAEYLLVSGSGIGNLLIDGSEQFRMDLVLFGIIVVGLTGWALNALARAIE
FT                   RAIFARRPLRAS"
FT   gene            complement(145961..146812)
FT                   /locus_tag="Bxe_C0133"
FT   CDS_pept        complement(145961..146812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0133"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36058"
FT                   /db_xref="GOA:Q13IN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN1"
FT                   /protein_id="ABE36058.1"
FT                   /translation="MSETAIPVATAAGGDARSQHKARRTGERLRSVAWLLAPWLLPAAL
FT                   LALWTIGCERGWIAPQILPPPARVYETFMELAHSGDLVRHTLISLQRVVVGFGIGTMGG
FT                   FAIGAALGLSRTLEAYVLPGFNALVQIPVLGWLPFLLLLVGVGEPLKYILIAHAALVPA
FT                   TLSTLQGFRQSPHSLEEVARGYGYSEWQRIVYVVLPAAVPTLATGVRLAFTKAWLALVV
FT                   VELVASSEGLGYLIVYGRQLFQLDLVMASVVVVGAIGLVVNRLLDSLEARLRRGQPSAF
FT                   RE"
FT   gene            complement(146825..147925)
FT                   /locus_tag="Bxe_C0134"
FT   CDS_pept        complement(146825..147925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0134"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36059"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN0"
FT                   /protein_id="ABE36059.1"
FT                   /translation="MRRSSSYTTENMRYFKLLKSLTVCAALAAATLNAYADKLSVIRIG
FT                   VAQQGAGDPPTFGGSPAATVQLQQLLEKEFAADGIKVEWLFFKGAGPAVNEAIADKSLD
FT                   FAFQGDLPAVLARANGLKTRILLESGVRAGIKIAVPPDSDIHTIKDLKGRRTAIFRGTN
FT                   LQLVVDNALAANQLDERDLRVINLDTASSLAALASKGIDASVNDYHLYKLRDQGLAKII
FT                   YESQTDGPQFTRQSHLLVLDDFEHAHPEVVQRVVNAFVKGAQWSSDEANRDALFKLWAQ
FT                   SGVSYASWQAEFAHQSLKDRNSPLIDAFIVARYKAVAQDALKLKLIRQPVDVDNWFEPR
FT                   YLDNALHAQKLDRYWTRYDAAGKPLS"
FT   gene            complement(147961..149601)
FT                   /locus_tag="Bxe_C0135"
FT   CDS_pept        complement(147961..149601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0135"
FT                   /product="groEL 60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36060"
FT                   /db_xref="GOA:Q13IM9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IM9"
FT                   /protein_id="ABE36060.1"
FT                   /translation="MAAKEIIFSDVARSKLVEGVNILANAVKVTLGPKGRNVVLERSFG
FT                   SPVVTKDGVSVAKEIELPDRVQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQ
FT                   KYVAAGLNPLDLKRGIDKAVVAAIDELKKISKPTTTSKEIAQVATISANGEESIGQRIA
FT                   EAIDRVGKEGVITVEDGKSLDDELDVVEGLQFDRGYLSPYFINDQDKQVAVLDNPYVLL
FT                   HDKKVSNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGF
FT                   GDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGEHK
FT                   NIEARVKQIRAQIDEASSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDA
FT                   LHATRAAVEEGIVPGGGVALIRVRNAISGLKGANADQDAGIKIVLRALEEPLRQIVTNA
FT                   GEEASVVVAKVAEGSGNFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAALLLTT
FT                   DATVYEAPKDPAPATSAAGPGAPGAGYDF"
FT   gene            complement(149615..149905)
FT                   /locus_tag="Bxe_C0136"
FT   CDS_pept        complement(149615..149905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0136"
FT                   /product="groES 10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36061"
FT                   /db_xref="GOA:Q13IM8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM8"
FT                   /protein_id="ABE36061.1"
FT                   /translation="MSLRPLHDRLIVKRLDQETKTASGIVIPESAAEKPDQGEVIAIGP
FT                   GKRDSDGKRIEPDLKVGERVLFGKYAGQSVKVDGTELLVLREEDVVAVVTQ"
FT   gene            150312..151529
FT                   /locus_tag="Bxe_C0137"
FT   CDS_pept        150312..151529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0137"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36062"
FT                   /db_xref="GOA:Q13IM7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM7"
FT                   /protein_id="ABE36062.1"
FT                   /translation="MQASLDTAAPPTLHAALAALPALARAIGEDAAQREARRELPFDRF
FT                   ALFRQSGLGLLRFPAEWGGLGGSLEDLFHVVATLAAEESNVAHALRIHYDLTEQLLLSP
FT                   RSAFNDTQIERVRQGAIFGGASTELGTSRPGEIVTALVRDGEHFRVTGKKYYSTGTAFS
FT                   DYARINVQDENDEKASIVIPVDREGVRVLDDWDGMGQRMTASGSLVLDNVQVFAHEVAT
FT                   RGYTSLAGRHGSAVRQLHLVAVAAGIVRNILADARRYVVHYGRPVLHSPAPSAREDGFV
FT                   QQVVGDLAAHSLAVDALVQQNARTLDQSANAIRSGAANAEERVLEGALATAKTQLVVSK
FT                   LALHAGERLFEIGGASATARSHNFDRHWRNLRTIFSHNPLLHKARVIGDYELNGVTTHL
FT                   TEGRVF"
FT   gene            151584..151928
FT                   /locus_tag="Bxe_C0138"
FT   CDS_pept        151584..151928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0138"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36063"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM6"
FT                   /protein_id="ABE36063.1"
FT                   /translation="MSRDLLLLLEPGFTDPNRPGERFICPDGAPIEGLLASDPALNARL
FT                   DIHRLPFTRPRAAVVEALDAEHQGLPVLIFGDEQPAPADAQTLGDKRFVTDTRRILELL
FT                   AQRHGFPKVH"
FT   gene            complement(152132..152407)
FT                   /locus_tag="Bxe_C0139"
FT   CDS_pept        complement(152132..152407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36064"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM5"
FT                   /protein_id="ABE36064.1"
FT                   /translation="MCGWPCCCNAHDKTAAAPTEPMVPHMQSRPRTKDPPSHRLAASRN
FT                   AHVGQIAVKTVGRGPVTVHAPANQRDLLQPDRRTSASPVSALRSPE"
FT   gene            152478..154082
FT                   /locus_tag="Bxe_C0140"
FT   CDS_pept        152478..154082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0140"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36065"
FT                   /db_xref="GOA:Q13IM4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM4"
FT                   /protein_id="ABE36065.1"
FT                   /translation="MAGLNRRDFLISSGAALAAASMPSLAFAQGEATAPKRGGTLNMLI
FT                   NPEPPVLVSIFQTTGPALVASSKVLEGLLAYDFDLRPKPQLATAWTVSADGLKYAFTLR
FT                   QNVKWHDGEPFTSADVAFSIDLLKAVHPRGRSTFANVTRVTTPDARTAVIELSKPAPYL
FT                   LKALSAGESPIVPKHLYASGDPLTNPHNNAPIGTGPYRFKAWTRGANIVYERNPDYWDA
FT                   GKPYIDGLVFKVIPDAAARSAAFETGALDLGGENPVPLTDLPRLTQLPQLAVETRGYRF
FT                   LEPLSEIDFNLDHPILKDLRVRQAIAHAINPQVVQRTIAYGYADLSPTPITPGSPYHDA
FT                   KITAYAFDIAGAEKLLDAAGYPRKDGGMRFGLTHDFLPYGDLYRRQADYVKSALARVGI
FT                   DVTVRSQDLPAFLKRVYADRQFDFTSIGVNTLFDPSVGVQRLYWSKNIRPGVPFSNAPH
FT                   YSNAEVDRLLESASVETDESRRVALYQQFQQIVYRDLPILNLVAPRMITLANRRVHNHT
FT                   VSAQGLEGNLADVYLSA"
FT   gene            154096..155076
FT                   /locus_tag="Bxe_C0141"
FT   CDS_pept        154096..155076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0141"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36066"
FT                   /db_xref="GOA:Q13IM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM3"
FT                   /protein_id="ABE36066.1"
FT                   /translation="MSRSLRVGAIARRTAWQVLPTVVGIVILNFFLLKLMPGDAADVLA
FT                   GESGSATAETMQVLRAKFGLDQPVLHQLWSYLTHLSHFSLGYSPRYDMPVMQLILSRLP
FT                   NTLFLMGVALSLAIVAGVTLGAVMAHWAGKWPDRLLSVLALLFYSTPGFWIGLLAIVLF
FT                   SVHLGWLPSGGNITLGVQLHGVAYLADAAKHVLLPAATLATFFVAIYARLTRAAMLEVQ
FT                   RQDFVRTAQAKGLHPWRVTVRHVLRNALMPLTTIVGIHFGTLLGGAAVTETVFSWPGLG
FT                   RLALDAVMARDFSVLLGVLLLSSLLVIVANVLVDLLQAWLDPRIA"
FT   gene            155141..156112
FT                   /locus_tag="Bxe_C0142"
FT   CDS_pept        155141..156112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0142"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36067"
FT                   /db_xref="GOA:Q13IM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM2"
FT                   /protein_id="ABE36067.1"
FT                   /translation="MASDSPDLISSSPEPGASSWRRQLAGTLFGQRRAGAARAPGPQRT
FT                   GRGVWRALLRNPSALAGLVLFTAFIALALGAGHLFPGDPLDMVAAPFEWPGADPQYWLG
FT                   TDSLGRDVAAGIAHGTRVSLLIGAAAAAIGLVIGTLVGAAGGFFGGVVDNVLVRVTELF
FT                   QTIPSFLLVIVIVAIGRPGVTVIALAIGIASWPTVARIVRAEFRTLREADFVLAARSQG
FT                   FSNARIIFGEILPNALPPVIVTASVMVASAILIESSLSFLGMGDPNVVSWGGMIGAGRD
FT                   SLRTAWYLTAIPGTAIVVAVLSLNLLGDGLNDALNPRLRERT"
FT   gene            156115..157854
FT                   /locus_tag="Bxe_C0143"
FT   CDS_pept        156115..157854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0143"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36068"
FT                   /db_xref="GOA:Q13IM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM1"
FT                   /protein_id="ABE36068.1"
FT                   /translation="MTPRTHEVDRAANLLEVRDLRVSFGAHEAVRGLNFEVAQGETLAL
FT                   VGESGCGKSATALSLMRLVPAPAQVTGSVCFDGRELLDLSAPEIRAVRGRQISMIFQEP
FT                   MTSLNPVLSIGAQIVETLRQHERLSKAAAWKRAIELLELVRIPEPQRRVFDYPHELSGG
FT                   QRQRVMIAMAVACRPRLLIADEPTTALDVTIQARILELLDGLRRELSMSLLLITHDLGV
FT                   VAQHADRVAVMLAGELVEEAPVEQLFTRPGHAYTQGLLGASLNLADDLHYQGWKLPEIR
FT                   HGIADDGKPTFAVVPRSARTGQYVTQTAVRSAAHDDAPLLALHDVRIDYPHRHGKSTLR
FT                   AVDGVSLQIARGETVGLVGESGCGKSTLSKAILRLIPATRGQIRLRGTDLVPLRERELR
FT                   PLRRHVQMVFQDPYASLNPRRTVGEILNTVLVVNGVDDARQRQLRIAAILDRVGLPGSA
FT                   LGRFPHEFSGGQRQRIGIARALVLEPDLLICDEPVSALDVSIQAQILNLLVELKRDLGL
FT                   AYLFISHDLSVVRYIADRVHVMQAGRIVESGDHREIWRAPQHAYTRTLLEAIPGRSFDA
FT                   QAA"
FT   gene            complement(157887..158738)
FT                   /locus_tag="Bxe_C0144"
FT   CDS_pept        complement(157887..158738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0144"
FT                   /product="Putative NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36069"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM0"
FT                   /protein_id="ABE36069.1"
FT                   /translation="MLYRTALLRFFNPRLACAFIVLAALAPLAAHAADSSTAQPLRIGF
FT                   VPGPYADEFKAGVEPQLREKGYTIQYVEFSTGLEANQAVYRGEIIADVMQHEVYLKSYN
FT                   DRNGTDLVGVVQVPTPPMGLYSSRHRSLSEVKPGARVAVPNDPVNLERALKILQRIGWI
FT                   RIKPNPNPVDVTERDVIANPAGIKIVPLESAQAPRALDDVDYATIQGNFAIFSGHKLTD
FT                   ALALEQMTPPYINQVVVKAANRKTRATQDIVQAYQSVQFQRAIRGNHFYDGFRLPAYFG
FT                   NP"
FT   gene            complement(158781..159131)
FT                   /locus_tag="Bxe_C0145"
FT   CDS_pept        complement(158781..159131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36070"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL9"
FT                   /protein_id="ABE36070.1"
FT                   /translation="MEYRQLGCCGIKVSTLTLGTMMFGSPTDEAAAARIIDLAHEQRIN
FT                   RRLQQTEWRTEAQWHDYLPALCYRLTAEDTAFVDSLVASGQPSTPEFNDPGRPFCGRIA
FT                   RRGAPQDEPYCA"
FT   gene            complement(159170..160789)
FT                   /locus_tag="Bxe_C0146"
FT   CDS_pept        complement(159170..160789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0146"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36071"
FT                   /db_xref="GOA:Q13IL8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL8"
FT                   /protein_id="ABE36071.1"
FT                   /translation="MAHVTTQAALRRYGKRVLSGTLGFAMTLVVALASQASQAQTRGGT
FT                   LNFVVTPEPTALVDLATTATNVLKVSPKVTEGLLEYDFNFAPKPSLATSWEISDDSRKY
FT                   VFHLRHGVKWHDGKPFTSADVAYSIQTLRQVHPRAKTTFANVTHIATPDPYTVIITLSR
FT                   SAPWLIKAFSSSETPIVPKHVYDGTDVLANPANNAPIGTGPFRFVRWVRGSYIEYARND
FT                   DYWDKGKPWLDRIVVKIINDPAARTVAFEDGSVDLSGDTPVPLSDLARLKDNPKLGIES
FT                   RGYEFQAGVARIEFNLDNPLLKDPKVRQAIASALDREVIRKVIYYGYATPLASPIIPSN
FT                   PYHDPAPTPYPFNVEHANGLLDQAGYPRKADGTRFALTVDPLPIGDLPARTAAYVKSAL
FT                   ARVGIAVTVRSQDLPAYLKRIYTDRDFDFSINGMSNLFDPVVGVARLYTTGNFRRGVPF
FT                   TNGSHYSNPEIDQLFSQVAEETDEVKRRQLFSQIQRIVERDLPDINLVSPQYITVYSRA
FT                   VHNHTISPDGVSASFADLWLQH"
FT   gene            complement(160830..161894)
FT                   /locus_tag="Bxe_C0147"
FT   CDS_pept        complement(160830..161894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0147"
FT                   /product="Putative desulfurizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36072"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL7"
FT                   /protein_id="ABE36072.1"
FT                   /translation="MSRIWYTRCPAPTPFGIAAQKGWLQQEFAADGIDVKALQDADDVL
FT                   VRRSHFTHSQPWSFRQGGNIPALWARAQGSDTRLIGLSWVDEFQALITLDRQLDATPHA
FT                   LAGRRFGFPRSTRAGGVVDFHRATALRGFSSLLNALGVQFEDIDFVELPHTPRGLDGAK
FT                   PAGDAPLDAWLDAQRSHEFARETEALLRGEADVVFVKGATGLDITNLLNAKILIEIGAQ
FT                   PNRALHANNGTPRPLTVDAQLLRERPDLVERVLARTLAAGDWAQGHVAELASYVGREVR
FT                   SAEHWVERAYPGGLHRQLTIGLDPHALAALSDFKRFLFKWGFIATDFDFDAWVEPAPLA
FT                   AALERRRAFAVSTA"
FT   gene            complement(161969..163189)
FT                   /locus_tag="Bxe_C0148"
FT   CDS_pept        complement(161969..163189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0148"
FT                   /product="Putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36073"
FT                   /db_xref="GOA:Q13IL6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL6"
FT                   /protein_id="ABE36073.1"
FT                   /translation="MPESIVTPPMRASAPHADGARDASPFVPVRSPATFAQSPVSLAFG
FT                   QPLLLGLFLPIQAGGWSASTLPRTTDWTFDYNLELVQKAEAFGFDLVFALSQWLPNGGY
FT                   GGVFNGQALDSFMSLAAMTARTERIILVATSHVLYGPWHPLHFAKFTATLDHISKGRWG
FT                   INVVTGHRAIEHEMFGWHRIDHDRRYQLAAEFLDAVQQLWAQPDNFSFAPQLSSWKLDK
FT                   AFVTPKPRFGRPLLVNATGSDAGIEFAARYSDVVFITSPAGSEIEAALAALPAHTARVK
FT                   AAAAAHGRPIRTLINPMVICRETAAEARAYHDAIVAHGDEGSFHRFDSDAHAWRGGAGQ
FT                   RNSAAARAVGGNIAIVGSPQQIADYIVRLHRAGIDGVQLSFFDFKPDLEFFGDRVLPLL
FT                   RDAGLRH"
FT   gene            complement(163366..163680)
FT                   /locus_tag="Bxe_C0149"
FT   CDS_pept        complement(163366..163680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36074"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL5"
FT                   /protein_id="ABE36074.1"
FT                   /translation="MNGPIVWSVEVSGTSYEWQRRETHNFMNLVWPARLHRRCIEPSVG
FT                   SHQAFRFICMNQRISASNRSAAISGSRQERQYGFPTGSRGNLSCRADPHKYAGQIRRFR
FT                   "
FT   gene            163767..165104
FT                   /locus_tag="Bxe_C0150"
FT   CDS_pept        163767..165104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0150"
FT                   /product="Putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36075"
FT                   /db_xref="GOA:Q13IL4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL4"
FT                   /protein_id="ABE36075.1"
FT                   /translation="MSRRSGQLRLGAFLYPAGHHIAAWRHPQAQADAGVNFRHYVQLAQ
FT                   AAEAAKFDLVFLADGVGTRGDNVDFLSRTAHSYVAQFEPITLLSALAAVTGRIGLVGTA
FT                   STSFNEPYHIARKFASLDHISGGRAGWNLVTSSSEHEAKNFNRDKHYDHAERYERATEF
FT                   AQVTQGLWDSWEDDAFVRDKANGRFFDPRKRHVLEHKGRFFQVKGPLNVARSPQGHPVV
FT                   VQAGSSEAGRELAASTAEVIFTAQQTLEDAVAFYADVKERMRAYGRDPDDLKIMPGVFP
FT                   IVGRTESEANEKFEQLQSLVDPKVGLALVSGLTGGFDLSDYPLDGPIPELPETNASKSR
FT                   QSLTIELARREHLTIRQLYLRVAGARGHWQLVGTPAQIVDQLEERFVNHGADGFNVMPP
FT                   VLPHGLTDFIELVLPELRRRGLFRTSYEGSTLRENLGLRRPAHRVR"
FT   gene            165280..166539
FT                   /locus_tag="Bxe_C0151"
FT   CDS_pept        165280..166539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0151"
FT                   /product="Putative sulfite oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36076"
FT                   /db_xref="GOA:Q13IL3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030835"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL3"
FT                   /protein_id="ABE36076.1"
FT                   /translation="MPLNPSPSRTRRRLLGRLAAGGLVASHAAAAAELLKPLEVAPSSR
FT                   VPGAPILEHPYGVPSPHEANVVRRSARVWPLPGAASSMTPLADLHGALTPNGLVYERHH
FT                   GGVPDIDPDQHRLAIHGLVRTPKLFTMDDLLRLPSESRIHFLECSGNTGNEWSGPSGQP
FT                   VQLTHGLLSCCEWTGVRLSTLLEEVGGLSKQIDPARGWLLAEGADAAVMARSLPLERIL
FT                   DRALVVYAQNGERLRPENGYPLRLIVPGFEGNTNVKWLRRLKVVDAPLQTREETSKYTS
FT                   LLANGTARQFAFEMDAKSVITRPSPGHRLTTHGYYPITGLAWSGRGTVRKVEVSTDGGA
FT                   TWRVARLDGAIRDRALTRFQADWRWDGGPAAILSRATDSTGYVQPTRAELVAARGLNSQ
FT                   YHYNAIQQWRVDTSGEVRNA"
FT   gene            166532..167119
FT                   /locus_tag="Bxe_C0152"
FT   CDS_pept        166532..167119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0152"
FT                   /product="Putative sulfite oxidase cytochrome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36077"
FT                   /db_xref="GOA:Q13IL2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL2"
FT                   /protein_id="ABE36077.1"
FT                   /translation="MREGRSRCVRMHAALAAFLLLMALASCSSIAPDAPGAQNATAGHD
FT                   IGTPVTAQELAAWNIDVAPDGRGLPPGSGDVATGAHVFAAKCAACHGAQGQGGLGDPLV
FT                   GGQGTLASAKPKRTVGSYWPYATTLFDYIRRAMPYNAPESLSADEVYALSAFLLNQNGI
FT                   VAANTRLDAASLPRVVMPNRNGFVIDPRPARL"
FT   gene            167329..168237
FT                   /locus_tag="Bxe_C0153"
FT   CDS_pept        167329..168237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0153"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36078"
FT                   /db_xref="GOA:Q13IL1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL1"
FT                   /protein_id="ABE36078.1"
FT                   /translation="MTTAFASTAASHAGQAIETQPIEIRAFDGPVGAEVFGLDLGQPLS
FT                   PEDFARIHRAHLDHHVLVFRDQRITPDQQVAFSRRFGPLQIHVLHQFQLPGYPEVLVVS
FT                   NIVEDGKPIGLGDAGHYWHSDLSYKEKPSLGSLLHAQELPAEGGDTLFANMHLAWDTLP
FT                   AHLRTAVEGRSAEHTYLAKYAELQKRSPWRPNLSAEQIASVKPVVHPIVRTHPETGRKA
FT                   LFVSEHFTTRVIGLPEDESQTLLDELFAHSVRPEHLYRHRWAEHDMVFWDNRSLMHLAA
FT                   GTPDHLRRKLYRTTIEGDVPF"
FT   gene            168286..169338
FT                   /locus_tag="Bxe_C0154"
FT   CDS_pept        168286..169338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0154"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36079"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL0"
FT                   /protein_id="ABE36079.1"
FT                   /translation="MLARFRSTATRSSFGRRFTAALLTFSMGVAGFAATAPAHAEGQIR
FT                   VAEQFGIVYLLLNVARDQQFVEKEGRKQGLDIKVDWVKLSGGAAVNDALLSGAVDIAGA
FT                   GVGPLLTIWDRTRGKQNVKGVASLGNLPYYLISNDPNVRTIADFTEKDRIAVPAVNVSV
FT                   QSRVLQYAAAKRWGDKDYNRLDKFTQALPHPDAAAAIIAGGTEITGHFGNPPFQEQELA
FT                   GNPKAHIVLNSYDVLGGPSSATVLYATEKFRDNNPKTYRAFVDALADAARFITANPDAA
FT                   ADIYIRTNQSKIDRNLLVKVIKNPQVQFKVAPQNTFGLAQFMYRVGAIKNEPKSWKDYF
FT                   FDDPATAAGS"
FT   gene            169400..170230
FT                   /locus_tag="Bxe_C0155"
FT   CDS_pept        169400..170230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0155"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36080"
FT                   /db_xref="GOA:Q13IK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK9"
FT                   /protein_id="ABE36080.1"
FT                   /translation="MVANPTLLFPDSAGHPGAATSAKLLAVEHVNLEYRTRERIVRATH
FT                   DVSFDVYGGDRFVLLGPSGCGKSTLLKAVAGFIQPTSGSISLDGQHVRGPGADRIVVFQ
FT                   EFDQLPPWKTVLQNVVFPLRVAKKLSRAEARERALHYLEKVGLASFANAYPHTLSGGMK
FT                   QRVAIARALAMQPRVLLMDEPFAALDALTRRKMQEELLRLWEEVNFTLLFVTHSIEEAL
FT                   VVGNRILLLSPHPGRVRAELNSHQYSQDSFGRSDFQRSAAHIHHLLFEQTETVQ"
FT   gene            170227..171105
FT                   /locus_tag="Bxe_C0156"
FT   CDS_pept        170227..171105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0156"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36081"
FT                   /db_xref="GOA:Q13IK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK8"
FT                   /protein_id="ABE36081.1"
FT                   /translation="MSSPATLLPPVREEYERPLEPLGELVLEAPLPLGKRLLAQSWLRK
FT                   TLIALVLIAGWEVAARVVDNDLLLPTFGATFSAFVQGVWSGELLQKTAVSMSVLLRGYL
FT                   LGAALAFVLTSLAVSTRVGRDLLSMLTAMFNPLPSIALLPLALLWFGLGTGSLLFVLVH
FT                   SVLWPLALNTYSGFQSVPATLRMTGRNYGLTGMRHVLLILVPAALPSILAGLRVGWAFA
FT                   WRTLIAAELVFGASSGSGGLGWYIFQNRNELYTDRVFAGLAAVIVIGLLIEHLVFDTLE
FT                   RITVRRWGVQQ"
FT   gene            complement(171379..172203)
FT                   /locus_tag="Bxe_C0157"
FT   CDS_pept        complement(171379..172203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0157"
FT                   /product="ABC methionine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36082"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK7"
FT                   /protein_id="ABE36082.1"
FT                   /translation="MKGQKIIGSVLATLILGWGIVASPLSHAADQTVRVGIMSGEDEDV
FT                   WRVVAANAAKHGLLVKTTTFNDYTQPNAALSQHDLDANSFQHKPYLDAQIAARGYRIIP
FT                   VGYTYVQPIGLYSRKVKSVADLPTGATIGVPNDPSNEGRSLLLLQAQGLITLRPDVGLL
FT                   PTVRDIANNPKNIHIKELDAGIVGRAIGDLDAAVINTDWAIKAGIKIPQERIAQEKVAG
FT                   NPYRNFIAVNENDQKAPWVHALVESYQEPNVAAEILRVYHGATLPAWNESPK"
FT   gene            complement(172319..172534)
FT                   /locus_tag="Bxe_C0158"
FT   CDS_pept        complement(172319..172534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0158"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36083"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK6"
FT                   /protein_id="ABE36083.1"
FT                   /translation="MYYKGYEVAPAAQALPSGLFAANLVIQDEASLQKRAYVFDALDYF
FT                   FESDLAIAYAARWARMWIDNRRLPRG"
FT   gene            complement(172810..173814)
FT                   /locus_tag="Bxe_C0159"
FT   CDS_pept        complement(172810..173814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0159"
FT                   /product="ABC aliphatic sulfonates transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36084"
FT                   /db_xref="GOA:Q13IK5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK5"
FT                   /protein_id="ABE36084.1"
FT                   /translation="MTLMTRRAFTRAMLAAALTITGTQGHAQASRTAGSPVALRIGYQK
FT                   SSTLITLLKARGSLEQALAPLGVNVSWHEFASGLPLTEALNVDAVDFSADVADTVPVFA
FT                   QAAHANFVYIAQEAPSPGAQAIIVRKDGPLHTLADLKGKHIAVTKAAGSHYLLLAALAK
FT                   AGLSPADVTIHYLAPADGRAAFEHGSVDAWITWDPYVASVDRDTSVRILADGNGLASYQ
FT                   RYYLASSNFAAAHPAVIQILFDQLSQAGTWLRTHPEDAAKTLSPIWGLDTTTIERANAR
FT                   RSYVVRPVVPQNFSEQQKIADTFLQAGLLPARVDTGEAQRWDFATKRAEPAGS"
FT   gene            complement(174080..175489)
FT                   /locus_tag="Bxe_C0160"
FT   CDS_pept        complement(174080..175489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0160"
FT                   /product="Putative monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36085"
FT                   /db_xref="GOA:Q13IK4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK4"
FT                   /protein_id="ABE36085.1"
FT                   /translation="MPGAATPLRLSPHFRETPVYTSPPRRLHLNVNILHSGFVPSAWRL
FT                   PDADPRAFIDVAHYIRVAQIAEAAKFDAVFLADNASIADQIDFRPITALEPTVLLASIA
FT                   AATTRIGVIGTASTSYNEPYNIARRFSTLDHVSGGRAGWNIVTTADLGSARNFGRETVP
FT                   VHAERYARAAEFTEVVKKLWDSWEDDALVGDKTRGRFIDTTKVRPVSHHGKYFDVAGPL
FT                   NLPRSPQGHPVLVQAGGSADGRELAARHAQAVFSAAQSFDESAAYGRDLKARAAALGRG
FT                   PDAIRILPGLTTIIGSTETEALRRRDELVDLIPWSYSLTRLAGILGLPVERLELDQRLP
FT                   DDLPLPGGGNGNHTFFNATLAQARNHGYTARQLIRALAGGGGHRVVVGTPEQIADDIER
FT                   WFVGGAADGFNLMPDALPDGLKQFVDGVVPILRRRGLFRTDYEGSTLRDHLGLPRPVSA
FT                   HPAGQEAAVTA"
FT   gene            175695..177284
FT                   /locus_tag="Bxe_C0161"
FT   CDS_pept        175695..177284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0161"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36086"
FT                   /db_xref="GOA:Q13IK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK3"
FT                   /protein_id="ABE36086.1"
FT                   /translation="MSLRNSSRGYVFGALSAFILICASSLPVLAAPNHGGTLTWLVTPE
FT                   PASIIPLTSTAGGNAEIGPKVVEGLLTYDKDLNPQPLLATAWSVSKDGLEYRFTLRRGV
FT                   KWHDGKPFTSADVAFSILTLKQVHPRGRSTFANVVDVRTPDPYTATIQLSKPAPFLLTA
FT                   LSGSESPIIPKHLYEGTDIVSNPYNSAPVGTGPFVFKSFVHGSYILLERNPDYWDKPKP
FT                   YLDKIVVRFLPDAAARAAALESGAANLGDQAIPLSDVKRFSALPEFKVDTTNWPYVSNH
FT                   QQLIFNLDTPVLKDKAVRKAISQAVDVNALNRVVWYGYGQVSAAAIGAANTKYHDADIH
FT                   YFPYDIAQANAALDAAGLKRGPDGKRFTLRLLFNPFQDPRAADFVRQSLARIGIDGEIE
FT                   SYDFATYVKKAYTDRAFDITLEALANVFDPTVGVQRVFWSKNFKIGLPFSNAAHYSNPE
FT                   VDRLLEAASAETNEAKRRQLFIQFQQIVHDDIPSIEFGANPNITIVSKKVKDYAPTGEG
FT                   LRGNFSDLYIEP"
FT   gene            complement(177326..177829)
FT                   /locus_tag="Bxe_C0162"
FT   CDS_pept        complement(177326..177829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0162"
FT                   /product="flavin reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36087"
FT                   /db_xref="GOA:Q13IK2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK2"
FT                   /protein_id="ABE36087.1"
FT                   /translation="MSNGIADLFRHLTAGVYVIGVADGDRRNAFTASSIMQISFSPLLL
FT                   AISISPAHESYALLGGGRVFSINVLGEQQQALARHFGTQSGRTVDKLASIPWRPGKSGA
FT                   PLLRDALAHFDCRVVSDIEAGDHRLVVGRVIDGTVVSPHGRPLIYAQTGNMDMSASLFP
FT                   PDFS"
FT   gene            complement(178053..178907)
FT                   /locus_tag="Bxe_C0163"
FT   CDS_pept        complement(178053..178907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0163"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36088"
FT                   /db_xref="GOA:Q13IK1"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK1"
FT                   /protein_id="ABE36088.1"
FT                   /translation="MNPSSSPYGNAWQQEVLSELGVPRDFDVDAERERRIGFLGDYLAS
FT                   QGLRTYVLGISGGVDSSTAGRLAQLAVDRLRARGYEAKFLAVRLPYGSQRDEEDAALAL
FT                   EFIRPDETLTVNIKEPSDAMLQSLKRGGAQYVDDFQEDFVLGNIKARQRMVAQYAIAGA
FT                   RVGVVIGTDHAAESLMGFFTKYGDGGADILPLSGLTKRRVRALARALGASERLANKVPT
FT                   ADLESLTPQKPDEDSYGISYEDIDDFLEGKPVSDEVLTTIRRFHTATRHKRALPVSVNP
FT                   ANR"
FT   gene            complement(178913..179434)
FT                   /locus_tag="Bxe_C0164"
FT   CDS_pept        complement(178913..179434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0164"
FT                   /product="Competence/damage-inducible protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36089"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK0"
FT                   /protein_id="ABE36089.1"
FT                   /translation="MNIPMQAVSFLSSRGLKLATAESCTAGQIASYLASVPGSGSCLDV
FT                   GFVSYSPSGKAGFLGVKESTMKQFGLTSEEVAREMAEGALRQEGCCADVVVSNTGLADP
FT                   AAAGSPPAGTQCFAWSFRMREANIVTFSETRRFSGGRNDVRSAAALYALSRIEHYFNQL
FT                   PSARRERHTR"
FT   gene            179675..179878
FT                   /locus_tag="Bxe_C0165"
FT   CDS_pept        179675..179878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36090"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ9"
FT                   /protein_id="ABE36090.1"
FT                   /translation="MNKDQREGLKEELKGYVNKGIGSITGNEDRKVKGEVQITNGDNRK
FT                   DLGDQEDSIDRNAIDPGNPSNL"
FT   gene            180101..181288
FT                   /locus_tag="Bxe_C0166"
FT   CDS_pept        180101..181288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0166"
FT                   /product="Putative glutathione-dependent formaldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36091"
FT                   /db_xref="GOA:Q13IJ8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ8"
FT                   /protein_id="ABE36091.1"
FT                   /translation="MRALCWHGKKDVRIDNVPDPMIEHPRDAIIKVSSCAICGSDLHLF
FT                   DGFMPTMKSGDVLGHEFMGEVVEVGAENQKLKIGDRVVVPFTIACGECDRCRRGFFSVC
FT                   ERSNRNKEMADKVFGHSTAGLFGYSHLTGGYPGGQAEYVRVPFADFTPVRIPDGLTDEQ
FT                   VLFLGDIFPTGWQAAAQCEIEPTDTVSIWGAGPVGQFAIRSAILLGARQVISIDRVPER
FT                   LAMARAAGAITINFDTESVLDRLNELTQGKGPEKCIDAVGMESHATRSFDALYDRAKQA
FT                   LMLETDRPHVLREMIYVCRPAGILSIPGVYGGLIDKIPFGAAMNKGLTFRMGQTHVNRW
FT                   TDDLLRRIQEGQIDPSFVITHTVPLEQGPEMYRVFREKEDGCVKVVLKPSPSMGQ"
FT   gene            181592..182707
FT                   /locus_tag="Bxe_C0167"
FT   CDS_pept        181592..182707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0167"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36092"
FT                   /db_xref="GOA:Q13IJ7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ7"
FT                   /protein_id="ABE36092.1"
FT                   /translation="MIPGVGFDMCAAAPQCSMGAWPRRRRLGPLAAVSLCPMSYVAKVG
FT                   AQPQQSALQPAGVQAAHIAKLWNLSLIVCGIVFALVLLATLVALIRNGRHAATPAQTTQ
FT                   PPDLSSLTRPEHRTRRIVIGVSVMSVIVLVGLIVADVLTDRALSKLPVDDPLRIDMVGA
FT                   QWWWQASYRPEGGRPGFVTANELHVPVGRPIVVSLQAADVIHSFWVPNLHGKKDLLPGI
FT                   DTTIEFRADQPGVYRGQCAEYCGAEHALMAMLVVAEPRERYAAWVARQARPAAQSADAV
FT                   ALQGRAVFERASCAHCHTVRGSSAQGTPGPDLTHLMSRETIAAGVLANTPQNLAAWIRD
FT                   PDALKPGTTMPAVPLSDTDRVAVVRWLRTLQ"
FT   gene            182704..185337
FT                   /locus_tag="Bxe_C0168"
FT   CDS_pept        182704..185337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0168"
FT                   /product="Putative cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36093"
FT                   /db_xref="GOA:Q13IJ6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ6"
FT                   /protein_id="ABE36093.1"
FT                   /translation="MSTTEPLLDAEAAARIKDGPDADAGTLAALAQTWADPRGVSGWFS
FT                   AIDHKIIARRFMVTTFVFFVLAGLMALVMRTQLARPASHVVGPDMYDQLFTIHGTAMMF
FT                   LFAVPVMQAVAMYLIPLLIGARSVAFPRMNAYAYWVFLFGGLTLFIAFLLGAGPRSGWF
FT                   SYVPLAGPDYATGKGSDIWAQMITFTELAALLVAVVLITTILKMRAPGMSLNRMPLFAW
FT                   ATLVTQFMVIFAMPAVMLASTALILDRLVGTQFYNPSLGGDVLLWQHLFWFFGHPEVYL
FT                   IFIPALGFMSSIIETFSRRPIFGYSAMVLALIATAFLAFGLWVHHMFATAVPDLGKTFF
FT                   TAASVMIAVPSGIQIYCWLATLLTGRLNLKPPLLFVLAFFFILVLGGMTGIMLGSVPLD
FT                   LQVHDTYFVVAHLHYVLLGGAVFPLFGAFHYWFPKFTGRMLGERLAHWQFWLFFIGFNV
FT                   TFFPMHLLGLHGMPRRVWTYPAGMGWDGMNLIATLGAYMIGVSVLLFIVNVVMSLRHGA
FT                   RAAANPWGAGTLEWSVPSAPPPHNFDVLPVIHGRAPLWEPAAAPRAVAGLAVHAREVLT
FT                   TSALDARPDTRPLFPGPSLWPFLSAIATTIFFIGSIFTPSAVWWGTVPVAVAMICWFWP
FT                   GRRENRVARALERWPASSAAQRAARRAPARPSSREAAGRGPQPRLAVLDVRALPSFGFS
FT                   HRSLMWWATAGLMLIEGTVFAMAVGMYFYLRTVNAAWPMNAPPPSLVWGSLNTAVLVAS
FT                   LWPNQLARRAAENGERERARLWLLVCLAFAVAFLVVRGFEFAALNVMWYANSYGSIVWL
FT                   LLGLHTTHLITDTVDTAVLATLLYTGPFEKKRLLDTSENAVYWYFVVLSWLPIYAVIYF
FT                   VPRMHP"
FT   gene            185334..185678
FT                   /locus_tag="Bxe_C0169"
FT   CDS_pept        185334..185678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36094"
FT                   /db_xref="GOA:Q13IJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ5"
FT                   /protein_id="ABE36094.1"
FT                   /translation="MKRTGLSVWLGLLAAPAVVLGAQSLNYALVQLACATGRHTALDAV
FT                   SAVAFLFSMVAAWLAYRRWRGTATPFDASYVRRDARRPFLALMAMLVAALCAVIQLTMW
FT                   FPQWLLSPCR"
FT   gene            185675..186673
FT                   /locus_tag="Bxe_C0170"
FT   CDS_pept        185675..186673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0170"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36095"
FT                   /db_xref="GOA:Q13IJ4"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ4"
FT                   /protein_id="ABE36095.1"
FT                   /translation="MTARLHAACRVAGRARERGARAGVCAGLLALAHAPLACAHVLTGA
FT                   ERAAPTFGWSFDAWVVVLMLASTLAYAVGYVRLRLRGSPRSRATRAWHASAFAAGMAAL
FT                   VFALCSPLDSLSAALFSAHMVQHETMMLIAAPLLVLGRPLGVWIWALPRAARRRIGRAV
FT                   RAPAVARAWRGLTAPLAGWTLHAAALWGWHAPVMFEAALAHPWVHTLQHTSFMLTALVF
FT                   WWTVFGDGASRQSGGHAMLSVFTTMVHTSALGALISLAPGLWYPSYVEPTSALGIDPLH
FT                   DQQAGGLIMWVPGAMAYLIGGLAIAARWLRGHEPPRVIADPAAALPQDGGR"
FT   gene            186670..188079
FT                   /locus_tag="Bxe_C0171"
FT   CDS_pept        186670..188079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0171"
FT                   /product="Putative cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36096"
FT                   /db_xref="GOA:Q13IJ3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ3"
FT                   /protein_id="ABE36096.1"
FT                   /translation="MKPRPLMAGATARRHAALCACMAALAVAVAGVATREARSEEARAP
FT                   AGPATVLPSASARPALPQPASPQPDAVMLARGEYIAKASDCAGCHTAPQGGAPYAGGNG
FT                   LGSPFGTIMSTNITPDPHYGIGQYTYDDFARVLRKGVARGGKRLYPAMPYNAFAKIDDA
FT                   DLHALYAYMMHGVAPVAKPNRKSDVSFPFNQRWGLWFWQLAFVPREPYQPHADRDAQWN
FT                   RGAYLVQSVGHCGSCHTPRGIAYQERGTDESSSTFLTGGVNDHWFAPDLTGDAGSGLGR
FT                   WRASEIAAFLKTGHGGGNIAYGSMVEQIEDSSQYLTDDDLLAIGRYLKSLPPRNPSATY
FT                   APHDDVARKPLNGSRVPEALSVGYNVYRSFCAQCHGGDGRGVPNVFPALAGNSSVLAED
FT                   TTSLIRLLVEGGNSPSTLTGPPRQQMPRFADTLADVQIGQVLTYIRSAWGNNAQPITAN
FT                   DVSSLRQKLHK"
FT   gene            188144..189538
FT                   /locus_tag="Bxe_C0172"
FT   CDS_pept        188144..189538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0172"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36097"
FT                   /db_xref="GOA:Q13IJ2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ2"
FT                   /protein_id="ABE36097.1"
FT                   /translation="MQGLPCRWAAGPFPFPLPNLDMIAEAVWFLLIGGLLTFIALARGP
FT                   IGRLPLTGAMIYLVVGVFIGPAFAGLVDVDLTRDPGLVRMLAEVGLVISLFAIGMHLRV
FT                   PLRDRLWMLPLRLGGPAMLVTIALMTAFVMLVEGRPLGTALFLAATLAPTDPVLANELR
FT                   VKEAGDDEPVRFALSGEGGLNDGAAYPFAMLGLALVGAPQFGTGDGLTFAGSVGWGVGS
FT                   ALAIGWVLAVVFVKTVFYLRTRYGEAIGLDGFLALGLMSASYGAALIVHAYAFVAVFAA
FT                   GVALRHEELRATGDTNPAEVLENVERGARVDAAKDPERAHAYLAEAMMGFTLEMERIAE
FT                   LSLMLLIGCVVSAHWREMLDAKAVLPALFLFFVARPLSVYTAMAGSQADGGQKRIIGWM
FT                   GIRGVGAFYYAVLGIQEAGDTLRALLPAVLDTIVLSVLVHGSTAGYALQRYFRRYREPK
FT                   EQEQRA"
FT   gene            190127..192526
FT                   /locus_tag="Bxe_C0173"
FT   CDS_pept        190127..192526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0173"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36098"
FT                   /db_xref="GOA:Q13IJ1"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ1"
FT                   /protein_id="ABE36098.1"
FT                   /translation="MHSSASIRVAHLLSVLFASLSGVYLLVGGIWLAATGGSLYYVFAG
FT                   IVMLVTAVLIYRRSPLALGLYALLLLCTIVWSLWEVGTDFWALAPRLDVLVVFGIWLLL
FT                   PYVYRAFEPSAKTHGLALGATLIVSVAVLVFAVFNDPQEINGTLASAPAQAAATPAGER
FT                   VAEGDWPAYGRTQHGTRYSPLKQINADNVKDLKVAWIFRTGDMKRSTDPGEITNEVTPI
FT                   KVGDMLYLCSPHQILFALDAATGQEKWRFDPKLKTDPSFQHVTCRGVSYHDSTASGSNN
FT                   DSPDQAPATAPAICARRVYLPVNNGHLYALDAQTGQLCPDFANHGDLDLQVGQPVTTAG
FT                   QYEPTSPPVITGKVIVIAGSVEDNYSTREPSGVIRGFDVNTGKLLWAFDPGAKNPEAVL
FT                   GAGQHYSVNSPNSWAPAVYDAKLDLVYLPMGVSTPDIWGGYRTPEQERFASGLLALNAT
FT                   TGKLAWFYQTVHHDLWDMDLPAQPTLADITDRSGNLVPAVYAPAKTGNIFVLDRRTGTP
FT                   IVPAPEKPVPQGAAQGDHVSPTQPFSALTFRPDRKLTGADMWGATMFDQLVCRVMFQRL
FT                   NYDGTFTPPSVKGTLVFPGNLGMFEWGGIAVDTDRQIAIANPIALPFVSRLMPRGPGNP
FT                   IEPAAGGTGGSGTESGIQPQYGVPFGVTLNAFMSPLGLPCKQPAWGYISAVDLKTNQIV
FT                   WKKRIGTVRDSSPLPLPFKMGMPMLGGPMTTAGDVFFIGATADNYIRAFDTNTGKQLWQ
FT                   ARLPAGGQATPMTYEAKGKQYVVIAAGGHGSFGTRLGDYVMAYALP"
FT   gene            complement(192603..193130)
FT                   /locus_tag="Bxe_C0174"
FT   CDS_pept        complement(192603..193130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0174"
FT                   /product="Putative hydrogenase/oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36099"
FT                   /db_xref="GOA:Q13IJ0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ0"
FT                   /protein_id="ABE36099.1"
FT                   /translation="MWQLLKQIARTGTPDPRVPESDDAWRTESQQIQQDILDLLGRALC
FT                   IREIDAGSCNGCELEIHALNNPYYNLEGLGIRFVASPRHADMLLVTGPLTVNMTEAVRL
FT                   AYEATPDPKLVVATGECACTGGMFKESYAVCGPLAKLLPVDVTIPGCPPPPLDILRGIL
FT                   GALRVKRTTRAR"
FT   gene            complement(193130..194698)
FT                   /locus_tag="Bxe_C0175"
FT   CDS_pept        complement(193130..194698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0175"
FT                   /product="Putative NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36100"
FT                   /db_xref="GOA:Q13II9"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II9"
FT                   /protein_id="ABE36100.1"
FT                   /translation="MRINAFGFPGLVRLSAFAGKSSAFRARVDAHTWTRTAGTVRDAGG
FT                   RLISVWGTEEAADRFVISAAYALEDGILWLQLPADDRHESGGYGYPDLSAVFPCATRMQ
FT                   RAVYDLLGLRAIGAEDTRPWLNHGNWAADYHPLRKRSSGTERFEPSQDADYPFVPVAGD
FT                   GVHEIAVGPIHAGVIEPGHFRFSVVGEKVLRLEERLGYAHRGIEKLFQRTPWLLGQRLA
FT                   ARIAGDSTVAFSWAYCMAVERAFEVRIPPRAQWLRALLLERERIANHLGDLGALGNDAG
FT                   FAYGLAAFSRLKEDWLRVNDQCFGHRYLMDRIAPGGMATDLDPRCIPAMLTQCEQIDAE
FT                   VRAMQAIYDDQSGLQDRFAGAGIVSAKVAEHFGVCGLVGRASGRKIDVRVDHPYAPYHE
FT                   VQVRAVSDDRGDVAARVAVRFNEIYESLRLLRALLSDLPGGHVVTPVEHAGAPSCGVGW
FT                   IEGWRGDVFIAVETGADGTLLRCHCHDPSWHNWPALEHAIIGNIVADFPLINKSFNLNY
FT                   AGHDL"
FT   gene            complement(194702..196162)
FT                   /locus_tag="Bxe_C0176"
FT   CDS_pept        complement(194702..196162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0176"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36101"
FT                   /db_xref="GOA:Q13II8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II8"
FT                   /protein_id="ABE36101.1"
FT                   /translation="MTEAWLVPLVFAIPLFAGATLALVGQRPVAPELNVGFSFLTFAAA
FT                   TLLAVQTETHGSVFAPGKLFFVDPLNVFLVALTAFVGWTTSIFSRPYMRIERDRGKMTG
FT                   PRMRLYHSMYQLFIFAMLLALLTNNMGILWVAMEAATLATVLLVSVYRTAASLEAAWKY
FT                   FILCGVGIAQALFGTILLYLAASRQLGGTDALLWTSLDAVKGSLDPTIMSLAFVFLLIG
FT                   YGTKVGLVPMHNWLPDAHAEGPTPISAVLSGLLLNVALYAVLRCKVLADGALRNGLPGY
FT                   LLVGFGLVSVLVATFSLFRQKDVKRLFSYSSIEHMGLMTFAFGLGGPIATFAGLLHMTV
FT                   HSLVKSAIFFTVGHAAQKAGTQAIDDIRGLLRVSPTVGWGMMLGTLAILGMPPFGVFAS
FT                   EFLILTTAMSKLPWATPFLLLALAVAFAAIFVRVQRMVFGDTTARVLEHPPALLPVFVH
FT                   LGIGLVLGLYIPPWLATWYRQAAAMIAG"
FT   gene            complement(196155..196814)
FT                   /locus_tag="Bxe_C0177"
FT   CDS_pept        complement(196155..196814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0177"
FT                   /product="Putative membrane protein"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36102"
FT                   /db_xref="GOA:Q13II7"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II7"
FT                   /protein_id="ABE36102.1"
FT                   /translation="MHGFATQIINFLAAILLLLSFAMLSQRRILSLIHLYTLQGLTLVS
FT                   ANVTLGYVTADVHLYISAALTLVLKVGLIPWILYRLVQRLNVKADVEPLLNIPATLLIG
FT                   IVLVIVAFNVASPISQLASSVARGTLGIALACVLLSFMMMITRANAIPQVIGFLSMENG
FT                   LFFAAAAATNGMPMIVELGIGLDVLVGILILGVFMFQIREQFDSLDIHHLEKLKDD"
FT   gene            complement(196815..197765)
FT                   /locus_tag="Bxe_C0178"
FT   CDS_pept        complement(196815..197765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0178"
FT                   /product="Formate hydrogenlyase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36103"
FT                   /db_xref="GOA:Q13II6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II6"
FT                   /protein_id="ABE36103.1"
FT                   /translation="MITLSGLLSQGLEILLALAAAPLLTGWVNLCRARLQNRRAPSIWQ
FT                   PYRMLHKLFNKESVVADHASPLFRGAPYVVWACMTLACAIVPTLSTDLPLSPAADAIAL
FT                   VGLFALARVMISLAAMDIGTAFGTLGARREMLVGFLAEPALLMVLFSASLITQSTLLTR
FT                   IVSTLSHRELAIYPSLAFAGIAFAMVSLAENARLPVDNPTTHLELTMIHEALILEYSGR
FT                   HLALMEWATSLKLFAYSCIGLALFIPWGIAEAGSPAALLLAIPALFIKLLTGGAALAVV
FT                   ETSNAKMRLFRVPEFLATAFLLAVIGMLVHFLLGA"
FT   gene            complement(197762..199771)
FT                   /locus_tag="Bxe_C0179"
FT   CDS_pept        complement(197762..199771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0179"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36104"
FT                   /db_xref="GOA:Q13II5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II5"
FT                   /protein_id="ABE36104.1"
FT                   /translation="MEHLLVIHYVLLVIAGWLAVGVLGLANLHRTRVVAHSLFPLGAGF
FT                   ALLLCGLGLAGVFAGPQQAVLPPGLPHLPFHLRLDGLSAYFLCVLGVVSAGVSAFSAGY
FT                   FRKGEGTPPGVLCFEYHVCLASMAMLLLADDAYCFMVSWETMTLSATFLVMTNHRLAEI
FT                   RRAAWLYFLISHVGALALLLCFGLLQANTGDYTFANMREQHLDVFWASLAFLLALFGFG
FT                   TKAGIFPLHVWLPEAHPAAPSPVSALMSGFVLKAGLYGVLRTVFDLLHVQIAWWGVLML
FT                   VLGLFTALFGVVFSAVQTDMKRLLAYSSIDNIGLMFVSMGLAILCRAYGMSALAALSMT
FT                   ALLYQIASHAAFKSLLFLGTGSVLHATGERNLGRLGGLLRFMPWTAWAALVGVLASAGL
FT                   PPLGGFVSEWLLLQSFLFTPGLPDPFLNRVVPLAAALIALVAALAGYTMVKFFGIIFLG
FT                   QPREAKLRDARDASPWERAGFVWLAAICALLGLLPVQFVAVLDRVTQLLVGAGIGEAVA
FT                   RNGWLLLAPAGVDRASYMPAAFLLFFFACCGLAWLLVRRLYHGRLRRAAPWNCGHPFVN
FT                   ARMQDTAEGFGQPIREIFAPLFRIERRLPSPFDRQPVYSITVTDRTWALIYEPLERLVK
FT                   RVAALAGMLQTGRIAVYLTHSFLVLIALLILVRR"
FT   gene            complement(199792..200619)
FT                   /locus_tag="Bxe_C0180"
FT   CDS_pept        complement(199792..200619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0180"
FT                   /product="Putative acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36105"
FT                   /db_xref="GOA:Q13II4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II4"
FT                   /protein_id="ABE36105.1"
FT                   /translation="MSADHNAFRRALTERWGKAFGEPVIHEDPRTRSLCFGAPGVQSSM
FT                   RTSDPLELDLPYTRAMMSFQLFCPDPKDILIVGLGGGSLSKYCFHKFPSARVTTVEIDE
FT                   RVIALRDAFFIPPESERFRIVHADAAAYLPDKVGLADVILLDGFDASGLPASLSSQYFY
FT                   DCCHAALRDEGVLVANLLSSDPRLGAHLDRIHRACHGKLFRTMARREGNTIAIGIRQAT
FT                   WPGWPDLYARAEAITASTGLDLCRYVKKMERHHRVEPVSEHPSSDTLAVEQNR"
FT   gene            201017..201778
FT                   /locus_tag="Bxe_C0181"
FT   CDS_pept        201017..201778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0181"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36106"
FT                   /db_xref="GOA:Q13II3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II3"
FT                   /protein_id="ABE36106.1"
FT                   /translation="MPAHYFRSLTGKNRSTEADRQLGFSLAFVAGATNAGGFLAVKQYT
FT                   SHMSGVVSSIADQAALGDFSLVLAGAGSLISFLLGAACSAVLVNWGRRRRLHSQYASPL
FT                   LVEAVLLLCFGLLGSHLALWDTLFVPATVVLLCFIMGLQNAMITKLSGAGIRTTHMTGI
FT                   VTDIGIELGKLFYWNSAKADPGVSLVLANRGRLKVQGTMLAMFVVGGFTGAMGFKHIGY
FT                   ASTVPLAGVLIVLAIVPLVDDLRAQVYRLDR"
FT   gene            201962..202159
FT                   /locus_tag="Bxe_C0182"
FT   CDS_pept        201962..202159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0182"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36107"
FT                   /db_xref="GOA:Q13II2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II2"
FT                   /protein_id="ABE36107.1"
FT                   /translation="METKSARLTILIDPVKKEAFEKLCAAQDLTPSQVVRQLIRDYLDQ
FT                   HGVSYRTKSAIGARPRRKTA"
FT   gene            complement(202506..204092)
FT                   /locus_tag="Bxe_C0183"
FT   CDS_pept        complement(202506..204092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0183"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36108"
FT                   /db_xref="GOA:Q13II1"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II1"
FT                   /protein_id="ABE36108.1"
FT                   /translation="MNNVELFHYLLLLVCGAGLLTWLAERLTIPPAVMLLVGGSAVALS
FT                   GPHMTVGMDPNLILTAVLPPLLMSSSFYTAWRDFRREIATISSLALGAVVFTTVAVAVA
FT                   VHAFEPALSWPACFALGAIVSPPDAVAAKAMLERYPLPSRLVTVLEGESLVNDASGLLL
FT                   YQMAIAAVLVGQFTVSRAATVLLMLMVIGIATGAACGQAMIWLIRRLPDPMLRIVLTFL
FT                   MAWGSYSVAEELGGSGVLSVVTCGLVLGIHQHRVFDAHTRIKATATWEVIVFVLDALVF
FT                   ILIGLALEGIVSRMGNVSSMLKTGVGVALPATVAAILARLLWVAAAIYLPSLLSSRLGK
FT                   SPHPWSRGEAAILGWAGMRGVVSLAAALALPDNFPGRDVIVFSTFLVIFATLVIQGGSL
FT                   AFLIRLTGLRPVRSTTMSELEARTHTFGASLKEIEKISQSATDDDKPLVQRLIDEYKVR
FT                   VSNNERAFEAGKEHVELRARQLRLELDLVAISRQALLGLHHEGKIQDSVLHRLEAELDL
FT                   EELRLHRLLEP"
FT   gene            complement(204379..206271)
FT                   /locus_tag="Bxe_C0184"
FT   CDS_pept        complement(204379..206271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0184"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36109"
FT                   /db_xref="GOA:Q13II0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II0"
FT                   /protein_id="ABE36109.1"
FT                   /translation="MSTRDKEFPDLILHRGRFTTLDRNRPEATAVAIRQRVFTAVGSDA
FT                   EIVPLAGSATRVIDLLGLRVLPGLIDNHLHIIRGGLNFNMELRWDGVRSLATAMDMLRA
FT                   QVAITPPPQWVRVVGGFTEHQFDEKRLPTIDELNAVAPDTPVFILHLYDRAILNAAALR
FT                   VVGYTKDTAEPPGGEIVRDSAGNPVGLLLAKPNAGILYATLAKGPKLPPEYQVNSTRHF
FT                   MRELNRLGVTGAIDAGGGFQNYPEDYAVIQKLSDAGQLTIRLAYNLFTQKPKGEKEDFL
FT                   NWTKTSKYKQGTDYFRHNGAGEMLVFSAADFEDFRQPRPDMTPDMEGELEGVVRVLAEN
FT                   RWPWRMHATYDETISRALDVFEKVNRDIPLNGLNWFFDHAETISERSIDRIAALGGGIA
FT                   VQHRMAYQGEYFVERYGAQAAEATPPVARMLEKGVRTSAGTDATRVASYNPWVALAWLV
FT                   TGKTLSGLRIYPQRNCLDRETALRMWTENVTWFSNEEGRKGRIETGQFADLIVPDHDYM
FT                   SCPESDIAGTTSLLTVVGGKIVYGAGPFAKFDAPLPPAMPDWSPVRAYGGYAGWGAAQG
FT                   KEGTPLQRAAAQQCGCAHACGLHGHAHARAWTNNVPAADLKSFWGALGCACWAV"
FT   gene            complement(206268..206558)
FT                   /locus_tag="Bxe_C0185"
FT   CDS_pept        complement(206268..206558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0185"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36110"
FT                   /db_xref="GOA:Q13IH9"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH9"
FT                   /protein_id="ABE36110.1"
FT                   /translation="MKLYIFSLLAGILVGVIYSLINVRSPAPPLVALVGLLGILAGEQL
FT                   IPVAKQMLSGSAFHTAWHESKCDQHMFGALPGRQTGDTSRTAAVNSPEKRS"
FT   gene            207224..207931
FT                   /locus_tag="Bxe_C0186"
FT   CDS_pept        207224..207931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0186"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36111"
FT                   /db_xref="GOA:Q13IH8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH8"
FT                   /protein_id="ABE36111.1"
FT                   /translation="MDHTMSNPKLEVLTPANSQIIFIDQQPQMAFGVQSIDRQVLKNNV
FT                   VGLARAASVFNIPTTITTVETESFSGYTYPELLDVFPGHPLLERTSMNSWDDQKVRDAL
FT                   AQNGRKKVVVSGLWTEVCNNTFALCAMDEGGYEIYMVADASGGTSKEAHDYAMQRMIQA
FT                   GVVPVTWQQVLLEWQRDWAHKDSYDAVMAIVREHSGAYGMGVDYAYTMVHKAAQRVRDK
FT                   HEVRAPVPAPISK"
FT   gene            complement(208022..208999)
FT                   /locus_tag="Bxe_C0187"
FT   CDS_pept        complement(208022..208999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0187"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36112"
FT                   /db_xref="GOA:Q13IH7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH7"
FT                   /protein_id="ABE36112.1"
FT                   /translation="MHPLPDFEAWAIFARVVDTGSFAKAAESLAMSQPTISKAISRLEQ
FT                   RLGTALLYRTSRRLSLTPTGRMAMERAIRIMNEGEAVEAEASAQAATPHGTVRVAAPMS
FT                   FGLKYLTPLVPAFLDRYPDVNIELALDDTLVDVVADGFDVALRIAELADSSLRSRQLCA
FT                   VRRPLVASPGYLDRHGRPRHPRELEHHACLIYTNLPTPGLWRFSHATEGECAVPVKGKM
FT                   WSNNAEALGPALLAGHGLALQPEFVVWEALSRGELEEVLPEWQIARIHLNLITPPGVLR
FT                   PARVTALLDYLGECLASTPWAHTNDSPFPANAEGRPPGQRRSRT"
FT   gene            209147..209797
FT                   /locus_tag="Bxe_C0188"
FT   CDS_pept        209147..209797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0188"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36113"
FT                   /db_xref="GOA:Q13IH6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH6"
FT                   /protein_id="ABE36113.1"
FT                   /translation="MRGRVSLTQPGENDVSSSSGHHRSDLDEYLGTPAACRPGECHRQA
FT                   AHRAGCLFGARRVAPAGRFDVSSSARQNPRWVDAILVQPWLLPLVRMALVSAYVIGGLA
FT                   KLANFHAAVLEQEHFGLHPGWLWAVFAIVVELGGSVCVIADRLVWLGAGGLGVLTMVAM
FT                   FVANDFWNQLGSARFMALNSFFEHLGLLAALVMATCVAGVKQSAGTAGVQKNP"
FT   gene            209813..210712
FT                   /locus_tag="Bxe_C0189"
FT   CDS_pept        209813..210712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0189"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36114"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH5"
FT                   /protein_id="ABE36114.1"
FT                   /translation="MRKLRSLIVTTLIAVGLAASSVAPARPPGGPQLAVGPQYDTTHVY
FT                   VAPADFDRFTDSLVATFGGHKSRQGVFQVTPTPSQTMSQLVFTPVGTLSVFGFKTPIPY
FT                   PFGDERTGYLVTDMDAAVRSARAHGADITVATFPDPIGRDAIIAWPGGVHMQLYWHNQA
FT                   PSYDPLQTVPENRVYVSPERADSLIRNFVAFSHGKVVSDERNAPGAEIGRPNDTYRRVR
FT                   VESGFGKMTVLVTDGHLPYPFGREMTGYEVANLADTLQKAQAAGVTVLVQPFTSDGREA
FT                   ALVQFPGGYIAEVHAAAQ"
FT   gene            210820..211410
FT                   /locus_tag="Bxe_C0190"
FT   CDS_pept        210820..211410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0190"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36115"
FT                   /db_xref="GOA:Q13IH4"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH4"
FT                   /protein_id="ABE36115.1"
FT                   /translation="MKSEDSILAAIAGYVDTLGFVALFGVFTAHVTGNFVLIGAEVAGF
FT                   GQRAFMKLMALPAFIAGVVVSSVLLRSMQGATPSRAACVLYAVQAALTLAFCLAGVGVS
FT                   PVVHADGASVIVCGMVGAAAMGVQNAHSRLVSRPGMPDTVMTGNVTQVVPDMTDMLSPQ
FT                   TPPGIKVAARARIGKILPAVLAFATGAIAGAVA"
FT   gene            211753..213216
FT                   /locus_tag="Bxe_C0191"
FT   CDS_pept        211753..213216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36116"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH3"
FT                   /protein_id="ABE36116.1"
FT                   /translation="MTWVRPKPIAGKEAVAYLSIVVAGLAFGPSDGARAETDETAAVDE
FT                   AASACTAKRPVVLFNRWQEDWSVLANPCVPRQPLDSLKYIRLGGDPDSYLSLGANLRER
FT                   LETNNALLFGIGSGHADTYLIQRAQVSADARIGQHLQFFVQLADARAFGKDAVSSVDKN
FT                   PLDLEQAFVAWVSPLGPGVVKLRIGRQEMAFDLQRFISVRDGPNVRQAYDAIWADYEYQ
FT                   KWRFIGYATQPVQYRNTTVFDDVSNRHLTFSGVRFERQEVGPGDLSGYYSRYNRSNARF
FT                   LDATGDEHRDVFDLRYTGKTGRTDWDVESMFQSGHVGTRTIGAWAVGSLAGYTLDLPGA
FT                   PRVGVQIDAASGDRHPGDGRVETFNPLFPNGYYFTLAGYTGYANLVHVKPSITLRPTSK
FT                   LSLLGALGFQWRETTADAVYQQANAVVPGTAGHGSRWTGMYVQLRADWTIASNLTGSVE
FT                   AVHFQVGDSIRNAGGSNSDYVGVEMKYGW"
FT   gene            213402..213770
FT                   /pseudo
FT                   /locus_tag="Bxe_C0192"
FT   gene            complement(214001..214783)
FT                   /locus_tag="Bxe_C0193"
FT   CDS_pept        complement(214001..214783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0193"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36117"
FT                   /db_xref="GOA:Q13IH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH2"
FT                   /protein_id="ABE36117.1"
FT                   /translation="MIDVDALTVRFRTRTGYFDAVREASFHVGAGEVFGLVGESGSGKS
FT                   TILRALTGLAPLAGGHMKIGSHGPGEKIDRSFRRDVQMVFQDPYGSLHPRFTVDRALRE
FT                   PLTINGIDRQDERIVDALREVGLGPAYRFRYPHQLSGGQRQRVAIARALIVEPRVLLLD
FT                   EPTSALDVSVQAEILNLLRRLHRERNLTMILVSHNLAVVGFLCSRVAVMRNGEIVEQRD
FT                   IASIRARQVEHEYTRNLLLATTGYRRNAVQATGTDAAL"
FT   gene            complement(214780..215670)
FT                   /locus_tag="Bxe_C0194"
FT   CDS_pept        complement(214780..215670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0194"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36118"
FT                   /db_xref="GOA:Q13IH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH1"
FT                   /protein_id="ABE36118.1"
FT                   /translation="METDMPADMIQPLCEIDDLRIGFHGHDGALTEAVRGLSLTLHRGE
FT                   RLGIVGESGSGKSLTGRALLGLLPPAAQYRAKAMTFDGQDLLSMSARKRRQLCGQQMGM
FT                   ILQDPKYSLNPVMTVAQQMREVFDLHGPKLGRREMREQIIAALAAVHIRNPERVADAYP
FT                   HELSGGMGQRVMIAMMVSSGPRLLVADEPTSALDVLVSMQVLGILDEMIEKHHTGLIFI
FT                   SHDLPLVMSFCDRVVVMFAGRVVETCAARDLVHARHPYTRGLLAASPPLIDPPDQLPVL
FT                   KPDPAWLTQPAGASA"
FT   gene            complement(215660..216574)
FT                   /locus_tag="Bxe_C0195"
FT   CDS_pept        complement(215660..216574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0195"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36119"
FT                   /db_xref="GOA:Q13IH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH0"
FT                   /protein_id="ABE36119.1"
FT                   /translation="MNAVRRRWQDWLLSDTPASRKQAALGLAYRRWRRFAGNPLSVFGL
FT                   AILALLIIIAAIGPLIAPHDPLQQVLSDRLLPPGASSHWLGTDQLGRDILSRLIYGSRL
FT                   TLSIAILVVVIVVPVGLLIGTTAGFFGDWVDNVLMRLTDVALAFPKIVLALAFAAALGP
FT                   GVVNAVIAISITAWPAYARLARAETLRLVQADFIHVARLQGASRTRILLRYIVPLCSSS
FT                   VIVRATLDMAGIILTVAGLGFLGLGAQPPSPEWGFMVASGRNVLLDSWWVATIPGFAIL
FT                   LVSLAFNLLGDGLRDVFDPRHGN"
FT   gene            complement(216639..217709)
FT                   /locus_tag="Bxe_C0196"
FT   CDS_pept        complement(216639..217709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0196"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36120"
FT                   /db_xref="GOA:Q13IG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG9"
FT                   /protein_id="ABE36120.1"
FT                   /translation="MSTPFTAFERVRALSSESAGLRWTLRVMRWIITLVITFTGLLAVT
FT                   FVIGRKVPIDPVLAILGDRASATAYAAARLQLGLDRPLAVQFLIYVRDVLHGNFGMSLL
FT                   TAHPVIEDIQRVFPATLELATLSTIIGVLIGVPLGVIAAVRHNRWIDHVARFVGLVGSS
FT                   VPVFWLGLMGLLLFYAKLHWVAGPGRVDPGFDGMVDTHTGSLLVDSLIAGEWDVFFNAF
FT                   SHIALPAAILGYYSVASLSRMTRSFMLEQLNQEYITTARAKGLPERQVIWRHAFGNIAV
FT                   PLLTVTALTYSNLLEGSVLTEIVFAWPGIGSYLTGALLNADMNAVLGSTLVIGVTFIAL
FT                   NLLTDALYRVFDPRAR"
FT   gene            complement(217765..219372)
FT                   /locus_tag="Bxe_C0197"
FT   CDS_pept        complement(217765..219372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0197"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36121"
FT                   /db_xref="GOA:Q13IG8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG8"
FT                   /protein_id="ABE36121.1"
FT                   /translation="MKLVLRNVLAAAALASALTCSFTAADPAAAATPKDMFVMATFLDE
FT                   FTTLDPGEVYELVPEEYVANTYDRLVRVDLKDPSKFNGDVAQSWTVSPDGLTFTFKLRA
FT                   GLKFHSGNPLSADDVAWSIQRTVLLDKGAAAVLQGIGLTRDNVLANVKKVDDTTVSVTT
FT                   DRKYAPTFVLNVLGAWPASVVDKQLLLAHQKGNDFGNDWLRTNEAGSGAYKLVKWTAND
FT                   SLVLQRFDGYRLPLAMKRIVLRHVPEASSQRLLIENGDVDVARNLSPDDLAALTKSGKA
FT                   HVTAVPQATLLYLGLNVRNPNLAKPEVQEAMKWLIDYNGIQSNVAKTTYKVHQTFLPEG
FT                   FLGVLNTNPYQQDVAKAKALLAKAGLPNGFSVTMDVRNGYPYSEIAEAVQADLAQGGIK
FT                   VQIIPGDNKQTLAKYRSRSHDIYIGEWSADYIDPHSNAQGFAWNPDNSDKSAYKMLAWR
FT                   NSWDIPDLTKETNAALAESSTAKRAELYQTMQKQMLANSPFVILFQQVSQVAARPGVTG
FT                   LEVGPINDLVSYRDLKKQ"
FT   gene            complement(219437..220048)
FT                   /locus_tag="Bxe_C0198"
FT   CDS_pept        complement(219437..220048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0198"
FT                   /product="Putative D-alanyl-D-alanine dipeptidase"
FT                   /EC_number="3.4.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36122"
FT                   /db_xref="GOA:Q13IG7"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG7"
FT                   /protein_id="ABE36122.1"
FT                   /translation="MRSLSPLSSGHPTAPSMTKSRLIEITPATHGVDIDLVYATGRNLT
FT                   GKPIYKEAHCLLLEPAEAGLRNAIGIARDAGLRLRIFDAYRPPQAQQVLWDFLPDSTYV
FT                   AEPERGSNHSRGTAIDLTLLDAGGHELDMGTGFDAMTIESEHFHPGLPVHVQRNRLLLL
FT                   GIMHAAGFAHIKNEWWHYELPGSRALPLIDDSESGTLRLM"
FT   gene            complement(220036..220299)
FT                   /locus_tag="Bxe_C0199"
FT   CDS_pept        complement(220036..220299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG6"
FT                   /protein_id="ABE36123.1"
FT                   /translation="MPTGECQMSRTPDCWVQCWVPRWVPFTPASDIYSPALANSPATRR
FT                   ESKPALTRPGSLAPRPRSFNLLITAIVARNRQPQGKFNPCAL"
FT   gene            220526..220864
FT                   /locus_tag="Bxe_C0200"
FT   CDS_pept        220526..220864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36124"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG5"
FT                   /protein_id="ABE36124.1"
FT                   /translation="MARERLITEKEAGALVERLAAQLLSSSHSLRASVCAIHQALLKPG
FT                   CSIGCWTIFTRTEQISRIYLLEILHKFCQQCAAFLQLGSVKWEVLRAHCVCCLLAGNTS
FT                   SLINLIQT"
FT   gene            220866..224480
FT                   /locus_tag="Bxe_C0201"
FT   CDS_pept        220866..224480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0201"
FT                   /product="Chitinase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36125"
FT                   /db_xref="GOA:Q13IG4"
FT                   /db_xref="InterPro:IPR002859"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG4"
FT                   /protein_id="ABE36125.1"
FT                   /translation="MAMSKRNNAGLVRLTLIAGAVVALLHNGTSFAGSSVDAGAADNEP
FT                   ASTRQNDESTAKRKNYNLDLLPQQPSDLIYLTTVTEPDSLYLKLTFDRASLPAGGYVQI
FT                   SNGASQDVATYRAEDLLTGPVTVRGDTAVIRTVLPRLRVLGELHLSHVDYGKPAVNASV
FT                   RALIGNDERRQRACYVGTDMYRYSLPAVVAMGSGSGSVVGNGRYLLTNQHVTLGVAGKT
FT                   ESRGIELNYFRNSCDTTSEPNDPLRIRTDRIVAIGDGGSTDYSLVSLNDFDVQHAHTKE
FT                   LFGSARIRPLGDNALGDEIYIPQYGNGGLMPQVIGDLFEGKHAAVTSVGTTIKYNADTQ
FT                   SGSSGSPVLSRATNEIIALHYAGSDSANYGVRLTTLHKNVLPFIERENDNIVGEGNVKS
FT                   VALVIPPFVLGKSVGTIASGAIVAPFPDVRMTHHGAYSEALLDSQDELTLDLGAVRYQL
FT                   YFQGPAGAHDLSSQAVAGDELFIRLVPPATPSTTLSTSLAWLPLKVTDARGTLLENLIV
FT                   RVENSEYDPFTVPFDASSPDVTRLSFDIANAKKDYMLDSRFDGEQYGYVALYPGEGPAQ
FT                   LVGSTTEPYASIQLPLKNQMGRAEVVRLRGYRATACSRRAMQSTIGCASGEYSTLRLEY
FT                   LAADNPNLSAGTYDGFLPLQAQRSSATSRKILAEVHLKVASDALPVANVGESARTVVAS
FT                   SVEQTYALDGTGSRDPADEKLTYKWRVASGSFGIRNADQAKAQAVVPKNATGEGVYELT
FT                   VTNESGKTAKATVKVTAVAPQVTISGGTQQVKDNEQASYSANANFDGATYSWKLSSAAG
FT                   KQAATGSGAQWKTPVGLDAGTYTVSLDARNGAGDRSASAQQKLTVERTVALPGPEANAG
FT                   ADRTVVATNDTGFAYPLVGSASRDPNGQAITYQWRVVSGPFTLRNGDRADAEAIVPKGT
FT                   TGTGVFELKVTNAAGKTATATTKVTAIAPAVTLTGSTTVTGSGAASYKANANFEEATYS
FT                   WTLTDTSGQQVVSGSGADWNLSADVKNGNYTLKVLASSVKGQRSATATLALKVERAVAP
FT                   KPVEAKISGPVEIRAGTTIELSGAQSVNPNGTPTTYLWTVPPQLGSNAETPSVRLTAPA
FT                   NATVGAQYTIKLSVYDTQNKLSSTASYTVTVKAGETPAGPAYPAYKAGTEYKAGELVLN
FT                   YGQLYQCKPFPYAGWCSQAPPAYEPGKGWAWTDAWIKK"
FT   gene            complement(224470..224811)
FT                   /locus_tag="Bxe_C0202"
FT   CDS_pept        complement(224470..224811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36126"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG3"
FT                   /protein_id="ABE36126.1"
FT                   /translation="MLPAFFAPEIVGRQQITDAFRQTFAPLAFLIQHCAAGLIAIEGNR
FT                   ARANWSVSEWFRTIGVRLREPLKPPINGKRPERKCARAVKCRPARRAVRFPEKNLDRTA
FT                   LTWDWLFTS"
FT   gene            complement(224842..225756)
FT                   /locus_tag="Bxe_C0203"
FT   CDS_pept        complement(224842..225756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0203"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36127"
FT                   /db_xref="GOA:Q13IG2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG2"
FT                   /protein_id="ABE36127.1"
FT                   /translation="MSTPDESGRAGSGMYNLRSIFPSSSSMPSDAEEHDSDLPGTSPGP
FT                   RATARIVQVLRILAEQPEGATLTQLSGLCATPKTSLLALLRALTFEQYLVHQDGKYTLG
FT                   VEAFKLGAAIVAQRRFPELARPVMKRIALEAGETVLIGQLASDRPSLVYVMTEESRKAI
FT                   RFIAGLGERRELYSSSGGRVLLANMSAEQREHYFKSVKFVAHTPFTVTNKREIRRMINE
FT                   AEETDIAVTVDQSSIDVVGFASPIRDETGSVIAVLVMGTPSSRGIPQMDRFKALIHEGA
FT                   NEISAALGYRPAGRPVPPSIRHL"
FT   gene            complement(225766..227073)
FT                   /locus_tag="Bxe_C0204"
FT   CDS_pept        complement(225766..227073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0204"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36128"
FT                   /db_xref="GOA:Q13IG1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG1"
FT                   /protein_id="ABE36128.1"
FT                   /translation="MQESSKQSRQNDVAGSRLRPLEGIRVLDLSRVLAGPWCTQNLADL
FT                   GARVIKIERPGAGDETRSWGPPFLRDAGGRDTSESAYYLCANRNKQSVAIDIGSPEGAA
FT                   LVREFAKTCDVLVENFKVGGLKKYGLDYESLAELNPRLVYCSVTGFGQTGPLSKRAGYD
FT                   FLVQGMGGLMSITGEPDDIPGGGPEKVGVAVTDLMAGMYATTGVLAALMERARSGRGQH
FT                   VDIALLDCQLAMLANQSMNYLTTGIAPRRLGNAHPNVVPYQTFATNNGHLILACGNDGQ
FT                   FRALCGAMNRPELATDVRFATNSARSVNRADLIPLLASLFATRSNDEWITTLEACGVPC
FT                   GPINDIAQAFESEQARHRNAVRHMAHPLAGSAPTVTSPLRLSATPVEYVQPPPLLGEHT
FT                   AAVLHDLLGMEPAQIAGLSQAGVIGVPFVADVHEEA"
FT   gene            complement(227124..228431)
FT                   /locus_tag="Bxe_C0205"
FT   CDS_pept        complement(227124..228431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0205"
FT                   /product="major facilitator superfamily (MFS)metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36129"
FT                   /db_xref="GOA:Q13IG0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG0"
FT                   /protein_id="ABE36129.1"
FT                   /translation="MNTNTQATQELAAAPRTWQRSARAIFAGSVGNAVEWFDWSVYTAF
FT                   AIYFSKQFFPADNDTASLLATFAVFAVGFGMRPLGGWAIGAFSDRFGRRSALTITIVMM
FT                   AGSSLLISFLPTYRTIGVLAPIVMTVLRMLQGLSVGGEYGAATTFLAESAPAGRRGFHG
FT                   SFLFFSIAAGLLLASALAWGMTHFMSRAALEDYGWRIPFFIGGCGSLLGFWMRRNVPET
FT                   VAFEKLRRKGRIEPRSLLWTWNHHRGAVLRLVGISVLGAFSFYLFISFMPIYAIRHAGA
FT                   IPGDAFAASTASIAIFMIAQPFFGALSDRIGRRPQLIAFAAAYLVFLYPVVTSIGPGFQ
FT                   SMLLVECFGLLTYGFYSAIAPSIMAELFSTDVRGVGIGAAYNLVVALLGGTTPYLMTWL
FT                   QSIHREGWFLAYVCAGAAVSLITYWRMPETRGIELE"
FT   gene            228807..229277
FT                   /locus_tag="Bxe_C0206"
FT   CDS_pept        228807..229277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0206"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36130"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF9"
FT                   /protein_id="ABE36130.1"
FT                   /translation="MNSSQDLQLLGRGFYWQEIHAGQRFRTFRRTVTESDLVNFISATG
FT                   MLEAIFIDADYEHGAMRGRPVPAALTSGLIEGLLFQTMVQGTGLALLEFSMKTHGPVVV
FT                   NDAIYGIVEVDEVKPTSKNNRAVVTSHVDVLNQRDERVLSYTAKRLLAGRPE"
FT   gene            229339..230502
FT                   /locus_tag="Bxe_C0207"
FT   CDS_pept        229339..230502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0207"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36131"
FT                   /db_xref="GOA:Q13IF8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF8"
FT                   /protein_id="ABE36131.1"
FT                   /translation="MIDQFPLTWIPPADETLRAPVRAFLREVLGSRSPATRARSWMEFD
FT                   ASFSRALAEQGWLGLTLPREYGGGGRSPFARFVLVEELLAAGAPVSAHWIADRQSGPLI
FT                   ARYGTSAQKAFYLPRICAAEAFFCIGMSEPNAGSDLASVRTRAERTGNGWRLSGRKIWT
FT                   TNADRSHFMIALVRTSGTPEDRHRGLSQVIVDLFAPGVHIAPIEDLAGDRHFSEVTFDD
FT                   VQLADDALIGTEGAGWEQVTAELAFERSGPERIYSSVVLLEEWLRTLRVAGLAGNEVAR
FT                   SDRRALGALIAELSTLRELSLSVTGRLAHGASPATEAALVKDLGTSFEQSIPAVIADAL
FT                   GARPFQRPDGDLADTLAYVTKVAPSYSLRGGTREILRGMIARGLGLR"
FT   gene            230519..231532
FT                   /locus_tag="Bxe_C0208"
FT   CDS_pept        230519..231532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0208"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36132"
FT                   /db_xref="GOA:Q13IF7"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF7"
FT                   /protein_id="ABE36132.1"
FT                   /translation="MDDMLTDSIEPVLIDRCTPDLVREVENARDRKAGRDLWQQLDELG
FT                   FIDALVAESAGGAGLSLDEAAGVLFAFGRHGMPLPAAHTMLARRMLADAGIQAPRGPIA
FT                   LAVLNDVQSHRAFVPYGCVCDSVLVERSEGIWLVDIDHVTVEPHDEWGTLGATITFSAG
FT                   VEQRIKVAQSGPAPSESVVLELGARVTAATMAGAMARVLDMTITHVNDRQQFGRSIGKF
FT                   QAVQHNLSVMAEHAAAAYIAAQRACAAESTSQHRLSTAIAKARASRAAPLIANTAHALT
FT                   GAMGITAEYDLQLFTRRLHSQRVQFGSESYWDEVIGSHAIDHWDSVVQGIVGLEAA"
FT   gene            231582..232205
FT                   /locus_tag="Bxe_C0209"
FT   CDS_pept        231582..232205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36133"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF6"
FT                   /protein_id="ABE36133.1"
FT                   /translation="MGGDAGSAGGGHRVNHIGPMSLPMQRRMFAVVGASDSVQRRRRAR
FT                   AFNRPAASAYSAYYAFTRRTVFCVGVPAQRGSIRMNQACGAGPGPMRIGVSGIADRRSR
FT                   ARRRQWNRNAGTLARERSSRVGHVPCAPQRSVNLSCERGATMQTDPTVDPVADPANQPL
FT                   DEPDTHPRPLPGSPPDTDPLAPGSSPEDEEELGDSQSSSPVQRD"
FT   gene            232332..232589
FT                   /locus_tag="Bxe_C0210"
FT   CDS_pept        232332..232589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36134"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF5"
FT                   /protein_id="ABE36134.1"
FT                   /translation="MAGAERLFQVLIATLDAPAHFSCFACTAARSKARRSFKADRVDER
FT                   VATHRYPGAYCAMSASVHLLRPATIKKTHRHVWQEKDACP"
FT   gene            232850..233077
FT                   /locus_tag="Bxe_C0211"
FT   CDS_pept        232850..233077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36135"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF4"
FT                   /protein_id="ABE36135.1"
FT                   /translation="MEQELEVLRGQIHGLVAAVSTIASVLPDSASADAAEVLGEMIATT
FT                   GSSGLSATALDAMHATMRQVSGALAVSLHR"
FT   gene            complement(233116..233844)
FT                   /locus_tag="Bxe_C0212"
FT   CDS_pept        complement(233116..233844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0212"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36136"
FT                   /db_xref="GOA:Q13IF3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF3"
FT                   /protein_id="ABE36136.1"
FT                   /translation="MTKDISSNTGSRVAPKRRNSPGRPVGVSNLREKILDAAEVDFADH
FT                   GFAGATLREVANACGVTQALITYHFGTKHRLFEEVFLRRATRISEQRLELLHQLAQNSQ
FT                   KPSVSDIVRSFLEPMLTLRRSPGGRAFIRLHARLHTEPPEISYRLRGLAYDESTHAYVA
FT                   AFRSALPEVPEKDLYWRVMLMIGAYLYAFSDSHRLEVLSEGACNTADATETLEQLTAFI
FT                   VGGLAAPHSGKPPKAVRKRK"
FT   gene            234075..235286
FT                   /locus_tag="Bxe_C0213"
FT   CDS_pept        234075..235286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0213"
FT                   /product="Salicylate 1-monooxygenase (NahW)"
FT                   /EC_number="1.14.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36137"
FT                   /db_xref="GOA:Q13IF2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF2"
FT                   /protein_id="ABE36137.1"
FT                   /translation="MTRKLRVGVIGGGIGGLALTAALAQQGFDVRIFERTGSFGEVGAG
FT                   IQVTPNAVKVLEAMGLGDALRKVAFLPQAIVGRNWDTAKEIFRIPLAEECPRLYNAPFF
FT                   HVHRADLHHLLIDQVPAHAATLATACVDVRQTGETAVARFEDGSEFEADLIVGADGVRS
FT                   TVRSKLFGETAPGFTGNMCFRAVVPVEGDFDFVTPDSSFWLGPKSHVVTYYVRGGKAVN
FT                   IVAVNETADWVEESWNAPSSREELLAAFEGWHPNLIQLFERVESVFKWGLFDRDPMPAW
FT                   SRGRITLLGDAAHPMLPFLSQGAAMSIEDGYVLARSLTAHGSDVASALRDYEAERLPRT
FT                   SRVQLESRERGRTYHLPTRFAQSKRDLIYQFKSWLNPHASGIQADWVYSYNATDFTPRV
FT                   AAVA"
FT   gene            235323..236078
FT                   /locus_tag="Bxe_C0214"
FT   CDS_pept        235323..236078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0214"
FT                   /product="Putative cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36138"
FT                   /db_xref="GOA:Q13IF1"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028615"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF1"
FT                   /protein_id="ABE36138.1"
FT                   /translation="MSKNIYRIGQIVPSSNTTMETEIPAMLLARQQIRPERFTFHSSRM
FT                   RMKKVEKSELAAMDAESDRCAVELSDARVDVLGYACLVAIMAMGHGYHRQSEQRLKAHT
FT                   AENGADAPVVTSAGALVDALGVIGAKRVAVVAPYMKPLTKLVVDYIGNEGYEVCDYRAL
FT                   EIQDNLEVGRHDPSRLPEIVAGMDTRGVDAIVLSACVQMPSLPVVAQVEAMTRKPVVTA
FT                   AVATTYAMLKALGLERIVPGAGTLLSGAY"
FT   gene            236089..236913
FT                   /locus_tag="Bxe_C0215"
FT   CDS_pept        236089..236913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0215"
FT                   /product="Putative hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36139"
FT                   /db_xref="GOA:Q13IF0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF0"
FT                   /protein_id="ABE36139.1"
FT                   /translation="MSTFLYGANLRANGIRQHYLRYGGASGDRSARDVVVVLPGITSPA
FT                   ITWGFVGERFGAHFDTYVLDIRGRGLSEAHDELDYSLDAQAADAIAFAAALGLERYALV
FT                   GHSMGARIAIRAARSAPAGLTRLVLIDPPVSGPGRRAYPAQLPWYVDSIRLCRDGAGLE
FT                   AMRAYCPSWTDEQLALRAEWLHTCSERAVRESFAAFQTDDIQADLPAIEVPMLLMAAQR
FT                   GDVVRDDDIREIRRLNPRVDAVRVADAGHMIPWDNEAGFYQAFGSFLGVPLS"
FT   gene            236965..238005
FT                   /locus_tag="Bxe_C0216"
FT   CDS_pept        236965..238005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0216"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE9"
FT                   /protein_id="ABE36140.1"
FT                   /translation="MLEAWKTVLSLSNLQPGQTVTVLTGATSHPQSVSTALTAATAMRA
FT                   VVNRLDLQPINGEKALSRDSLAYLGTTPLTGNRAAIAALSASDIVLDLMTLLFSPEQHE
FT                   ILKSGAKILLAVEPPEVLVRMVPSVEDRGRVKAAADRLARAKLMQVRNDAGTDLLCPLG
FT                   QYPAISEYGFVDEPGRWDHWPSGFALTWPNEGETQGTIVLSPGDILLPQKSYIRSEIRL
FT                   VMKDGFAVSIEGGMDADLLSEYMASFEDPEAYAMSHIGWGLQPRAHWSTLGLYDREATL
FT                   GMDARAFEGNFLFSLGPNNEAGGTRTTACHIDIPMRNCTVTLDGEPVVTRGKVHAQQPG
FT                   SQKTHA"
FT   gene            237998..238633
FT                   /locus_tag="Bxe_C0217"
FT   CDS_pept        237998..238633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0217"
FT                   /product="isochorismatase hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36141"
FT                   /db_xref="GOA:Q13IE8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE8"
FT                   /protein_id="ABE36141.1"
FT                   /translation="MHSEVETYRRQGFGNTLQPRAPFGLLIVDFVNGFADPAVFGGGNI
FT                   AAAIGNTRPVLAAARRRQWPVAHTRIVFADDDADSNIFALKVPGMLTLKERDHNSAIVD
FT                   ELAPQSGEMVVRKTVPSAFFGTSLAAWLAQRGVQTLIVAGAVTSGCVRASVVDAMQYGF
FT                   RPVVLSDCVGDRAIAPHEANLFDMEQKYAAVMESCVLLDLVAGSEAAA"
FT   gene            238830..240008
FT                   /locus_tag="Bxe_C0218"
FT   CDS_pept        238830..240008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0218"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36142"
FT                   /db_xref="GOA:Q13IE7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE7"
FT                   /protein_id="ABE36142.1"
FT                   /translation="MSGKFEPTQGTDGGKAKLALLALCLAGAVSQAHAQSSVTLYGVVD
FT                   EGIDYVNNSGGSSLVRLRDGTWDGIFGSRFGLKGSEDLGGGLKAIFKLESGFDATNGKN
FT                   LQGGRMFGRSAYVGLSNDRVGTVTFGRQYDLVTDYLQPVTSNGQFTGPFVHAGDIDNTA
FT                   NTYRVDNAVKYASPSFGGLTFGGMYSFSGGNGLGTTGMWSVAAAYEHAGLNLAAVYDHF
FT                   NNPGLLINDGNFIGNTTGAAIGASGAFSYVGSPRNQQILGLGGSYEIGKATAGFTWTNT
FT                   KFDDANGTTSSVVFNNYDAWLKYNLTSSTTVGGAYIYSAGRVNYNGERPKYHTAGLFAS
FT                   YSLSKTTMLYAMGAFQQAAGDAKLADIYDYAIADASSTNRQLMFRIGMNHRF"
FT   gene            240129..241259
FT                   /locus_tag="Bxe_C0219"
FT   CDS_pept        240129..241259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0219"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36143"
FT                   /db_xref="GOA:Q13IE6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE6"
FT                   /protein_id="ABE36143.1"
FT                   /translation="MTFALCVTAAGTLACQAARAAEPVRIGLIQPLTGSVAYNGHADVN
FT                   GAKLAVAEINKAGGVLGRPVELKIEDGQCNPANTVNAAEKLIQKDRVSALIGAFCSSST
FT                   AAIMPVAQKYHLPLVTGVSSEADLTEKGNPWFFRAAETDQLLAHAFAPTIIRTLQLKSV
FT                   AYVGVNDDWGRGSVQEFQQSLQAGGVKTVSTDYFDHGATDFYTLLTKLRASGADAVFVA
FT                   AETQDGSILVKQIKELGLHIKVFGVGSWATADFIDLAGPAAEGVYAAVPYASTLTTPEN
FT                   TAFVASYQTAYKAAPGKYSAAGYNAVEIVAKAIARAGSTDADKIRAALAQTDFAAPNGR
FT                   YRFTAKGQAYGFSVVLVQIHNKAPQVVATTPVSAPH"
FT   gene            241287..242159
FT                   /locus_tag="Bxe_C0220"
FT   CDS_pept        241287..242159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0220"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36144"
FT                   /db_xref="GOA:Q13IE5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE5"
FT                   /protein_id="ABE36144.1"
FT                   /translation="MDLLLQFLVNGVVIGVFYALSALGLTLIFGLMRVVNFAHGEFYML
FT                   GGILGWFVTTRLGLDFFSGLAIVAVVMAAFGWVIDRLLIERVRHQGEEAGILLTIGLSI
FT                   VIANVALLVVGTAPHKVVGPVSDAPVLLGPVVLTRVRLVALAIAALLVAAAHGLIHRTT
FT                   LGRAMRATFQDPMAARLAGIRTERIYASTFALGTTIAALSGMLLASIYSAQVSIGGTVS
FT                   LKAFVVVILGGMGSFAGAIVGGLVLGIVEAMWGGYLSTNLVDLVGFVLVIALLLFRPYG
FT                   LFSLRAERA"
FT   gene            242161..243147
FT                   /locus_tag="Bxe_C0221"
FT   CDS_pept        242161..243147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0221"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36145"
FT                   /db_xref="GOA:Q13IE4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE4"
FT                   /protein_id="ABE36145.1"
FT                   /translation="MKFERNGMLILGLAALLLPLAVHDQYLIHLGVLTLFYAVLATSFN
FT                   LVTGYVGEFSLGHTAFLGIGAYTAAILSTRFGFPMWCTVPLAGLVSMIGGLAIGAITLR
FT                   LQGPFFVIVTLAFSEALRLVADNWVAVTNGPMGIAGVPQPEWITRLGNVHATQVFFYIV
FT                   LGIAIVALYLAYRFVYSSVGRAAVTVRENRYVAQSVGIWPFAMAMQAFVLGATLAGVAG
FT                   GFYAHYISFVGSDVFGFPFMATMIIMVLVGGKGTLLGPLAGALLVTLLQEYLREAQELR
FT                   LTLFGLFVILIVLFLPRGLMGLVAKRTASARSRDGDVAAAGTLRGGA"
FT   gene            243147..243935
FT                   /locus_tag="Bxe_C0222"
FT   CDS_pept        243147..243935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0222"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36146"
FT                   /db_xref="GOA:Q13IE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE3"
FT                   /protein_id="ABE36146.1"
FT                   /translation="MEQVRTDCILQVDRLCKRFGGVAAVRDVSFDLKRGEILGLVGPNG
FT                   AGKTSCFNLITGFYRPDSGDVLFEGRPLTGMKPHRIARAGVVRSFQKTNVLKPLSVFEN
FT                   VLAGHYLAARQSLWRVFFPGQAVRDAETRVRREAKRIVDLMGLGKRIDSPAYLLSCGEL
FT                   RLLEVAMALAAKPRLLMLDEPAAGLNTQEAVVLGKVLRELRDREVEAIILVEHNMNLVT
FT                   NTCDRLVVMNFGEKLAEGAPRDILHDPRVVEAYLGKAHAA"
FT   gene            243932..244657
FT                   /locus_tag="Bxe_C0223"
FT   CDS_pept        243932..244657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0223"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36147"
FT                   /db_xref="GOA:Q13IE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE2"
FT                   /protein_id="ABE36147.1"
FT                   /translation="MNASAQPVLTVSDIHVAYGKTKALHGVSLEVACGEVIALIGANGA
FT                   GKSTMLRAISGLLPLSAGAIHWNGNSIGGLAADRIVASGIAHCPEERHVWPAMTVLENL
FT                   SLGAYLCRSREVVARRTELAFERFPRLRERSSQLAGTLSGGEQQMLAIARALMSEPRLL
FT                   LLDEPSLGLSPKVAHEILDVIRAINEHGVTVLLVEQNVHNALSVAKRAYVFETGQIAAT
FT                   RTAEELLGDNELLAAYLGG"
FT   gene            complement(244885..245160)
FT                   /locus_tag="Bxe_C0224"
FT   CDS_pept        complement(244885..245160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36148"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE1"
FT                   /protein_id="ABE36148.1"
FT                   /translation="MTDPQADDCPVGKPNRCDARDAVSPRGRDRYRKRFLDGASAIARH
FT                   AQSLMRRSSRYSGCAAVRMACLSCQDIRLISRHRSLMACSTAAVHY"
FT   gene            complement(245157..245567)
FT                   /locus_tag="Bxe_C0225"
FT   CDS_pept        complement(245157..245567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0225"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36149"
FT                   /db_xref="GOA:Q13IE0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE0"
FT                   /protein_id="ABE36149.1"
FT                   /translation="MAFSTGNNDDQVLSEINITPLVDVMLVLLVAFILTAPLLNNAIHV
FT                   NLPKTARTAALDDKRPLTISIDDHGKVFFDKREVPADTVETELRAQRSHNAELAVVLQG
FT                   DTKVPYGSVARVMAAIERAGISRVSVVTDSHP"
FT   gene            complement(245567..246289)
FT                   /locus_tag="Bxe_C0226"
FT   CDS_pept        complement(245567..246289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0226"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36150"
FT                   /db_xref="GOA:Q13ID9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID9"
FT                   /protein_id="ABE36150.1"
FT                   /translation="MSDTYSSLIVKGALWALVLFSIVTWALILAKGTQSWRVARNNQRF
FT                   QKAFWSAGDLPQAAALGNPRDSALGRVAHAAFTALTETSEGLHDLEHSWDRLESLERLL
FT                   RQQIVKERGSLESGLAILASVGSTAPFVGLFGTVFGIVHAMTAISQNGTADIGVVAGPI
FT                   GEALVTTGVGIAVAVPAVLAYNFFVRRLKVTGGVLDDFGTDLISLAQKSNFRIRPFNRA
FT                   APDESTAPIDATSEGAYV"
FT   gene            complement(246319..247146)
FT                   /locus_tag="Bxe_C0227"
FT   CDS_pept        complement(246319..247146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0227"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36151"
FT                   /db_xref="GOA:Q13ID8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID8"
FT                   /protein_id="ABE36151.1"
FT                   /translation="MNSTTLLFPSTRRRYRLAALRPAMPAGPFVHDVNVLIPPSLALGD
FT                   RRHPLRFRTLWAVLLVAVAAHLALIHALHAARSHAPHTPVKLPPVRIELVTPPKPLPEA
FT                   PTPPPPSPAPAKTPPRVTHAAPMARAVRPPPVAAPRPARPELPATPSDVPLAPAPTAVP
FT                   APPAAPAPAALAPAPAEAKVVPPNGSAAYLHNPPPDYPPMARDQGWEGHVVLSVHVLAN
FT                   GHPDSVEVRTSSGRKVLDRAAVNAVTNWIFAPARRGDTPIDGWVDVPLDFKLG"
FT   gene            complement(247202..248521)
FT                   /locus_tag="Bxe_C0228"
FT   CDS_pept        complement(247202..248521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0228"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36152"
FT                   /db_xref="GOA:Q13ID7"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID7"
FT                   /protein_id="ABE36152.1"
FT                   /translation="MNTCQRNEINVATHCPTSSRSVPDLQAPSTLHLPARLTRDCLSAH
FT                   DFDALAKKRLPAPLYSFVAGGSEDHHAHVGSREAFLAYRFVPRVLCNVARVQQHVTVFG
FT                   RSYQSPFGIAPMGGVALTAYDGDLALARGAAHADIPMVVSGAALTSLEAIRAQASNAWF
FT                   QAYLSADRDADAALLDRVAAAGYETLVVTVDVPVAANREHNKRSGYTAPLRPNAALAWQ
FT                   ALTHPRWLVGTLARTLLMGGVPRYRNLAAGNGARVFSSEAAHQFSRRAAFDWQDLARIR
FT                   QRWRGNLVLKGILSAADTVIAREHGVDGVIVSNHGGRQLDSAIAPLTVLPEIVDAAAGL
FT                   TVMIDSGIRRGTDILKALALGAQMVFIGRPFNFAAAVGGAPGVAHLAALLRDEIARDMA
FT                   LLGVSTLDALHSGFLRESRHPVSNMRNHERPSIPTRQPAA"
FT   gene            248765..249532
FT                   /locus_tag="Bxe_C0229"
FT   CDS_pept        248765..249532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0229"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36153"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID6"
FT                   /protein_id="ABE36153.1"
FT                   /translation="MTATITGKPTSKQRRRFMRNAVAGAALSGGVRSAMAQPVAIGASA
FT                   TRSSAPAVAAANTAAPIVPAGYAFLRPAEADFVEALVDHMVPADELTGSGTALGLNQYF
FT                   DRTLGGAWGDGAGLYLEGPWHAGTPAQGYQLPLTPAELFRVGTDALRSYCSGHFGKPFA
FT                   SLDAQQKETLLHALNDGQVVLEGCPDTKRYFALLHQLVNEGLFADPLYGGNVGKAGWRL
FT                   VGFPGVIAEHEKDVRIYRNSPYSAPVLSIGDAS"
FT   gene            249544..251319
FT                   /locus_tag="Bxe_C0230"
FT   CDS_pept        249544..251319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0230"
FT                   /product="Putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36154"
FT                   /db_xref="GOA:Q13ID5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID5"
FT                   /protein_id="ABE36154.1"
FT                   /translation="MTDRIEKPVDAVIVGMGWAGGIMARDLAAAGLRVVGLERGAPRST
FT                   AEDFALPRIRDELQYAIRMGLMQDVKRETLTFRNTTTQVALPMRRLGSFLPGDGVGGAG
FT                   VHWNGLTWRWSDLDFQIRTLYEEQYGKRFIPDEMSVQDWGITYAELEPYYEAFERLAAT
FT                   SGRAGNLRGELRDGGNQYEAPRQSDYPLPPLTRGLAAEVFSGAASQLGYRPFPVPASNA
FT                   SRAYTNPDGIAFGQCQYCGFCDRFGCEANAKGSPHHTVIAVAQRSADFSLRPWSRVTRI
FT                   VKDSDGSRVTGVEYVDLRSGQRILQPASIVVLSAYTFSNVHLLLNSQIGTPYDPQTQRG
FT                   IVGKNYCYNIGAGATLFFEDRAFNPFIGAGGSSAAIDEFYTNRAFDRSKAGFVGGSVIV
FT                   SGLFSGRPIAHHPVPDGTPPWGSEWKRQVAHYYNRAMPIGAMGSVMPNRFNYLDLDPTY
FT                   RDPFGAPMLRLTYDHQENERRVARHAATVINEIAAAARPDRLNPAHASNAPYSIERYQG
FT                   THNTGGAIMGASPAHSFVNKYGQSWAYPNLFVTGGAVMPHNAAYNPTATIGALTLNAAR
FT                   AITSRYLRGDGQLLV"
FT   gene            251408..253723
FT                   /locus_tag="Bxe_C0231"
FT   CDS_pept        251408..253723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0231"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36155"
FT                   /db_xref="GOA:Q13ID4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID4"
FT                   /protein_id="ABE36155.1"
FT                   /translation="MLRRKYNKRTTGSLRYDAAVLQCGRESGRFALNAGAMKLLPFSLI
FT                   SALATGFAHAQEPTAAPSAASSTTAATPFAASQAATATTVSATAATSTTLPEVTVTAER
FT                   HVTDLKKTPVSVGVLGADRFTTGGVAQPGDLNAATASLVAGGPSQRTAGSGGIYIRGIG
FT                   TGSPTYSSAVALYVDDVYIPRSLGNGLYMAFPDVERVEVLRGPQGTLYGMNSSAGARKV
FT                   ISLDPTDNSAWIQGTAGSYGALGVKAYVSHEIKPGLLYFSLAYGRYKDDGYTNDPVIGR
FT                   SIDSTNTEVLRGKVRLTPTADTEALFSYDIERDRSDTYSYIAPNYPGSGIRTSYENTDP
FT                   SIDRDISGVSLRLTKKFGDHLSLRSITAHRWISDGRYPLTQDGVPTDLYGWLLNIDQHQ
FT                   TSQEFQFNGDYDRFSFTTGAVYFSEDVTDFRPSWTSGVYKGIVSQIENKSYAAYAQGHY
FT                   KITPQFGVTAGIRVNRDEQNYQNTGFASNAALQVLGTTFQTGQLTQNVNSVTPKIGIDY
FT                   QWNPNIFSYASITKGEKSGGYNPVAASLAISQIAVSPERVLTYELGNKLTFWGGRAQLN
FT                   TALFYNDFDDYQAAIGNAIINGQLINGSVTVNAGKARTYGAEFELTARPVSDLNVNTWL
FT                   TVQQAEFQQFVNPTGAPTGNYVGNQLPYASHIIAGVHATYRLPLHVPGTTRIGATVRFL
FT                   SHSYIDIANQQPLGAQTYIDAMAEYTSPSSNWTATFEVRNLLNRAYVLGYNVTPSIGLN
FT                   AYNYSPPRTFMVSLRRDF"
FT   gene            253802..255118
FT                   /locus_tag="Bxe_C0232"
FT   CDS_pept        253802..255118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0232"
FT                   /product="Putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36156"
FT                   /db_xref="GOA:Q13ID3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID3"
FT                   /protein_id="ABE36156.1"
FT                   /translation="MANRKRKLKLATFLSGFSGIAGWRHTDAYADGSVNFEAFKKVAQT
FT                   AERGLFDFAFVADSAYITEDSIPYFLSRFEPATILSAVSVVTRNLGLVGTFTTSFSEPF
FT                   TTARQLASLDKLSGGRAGWNAVTSALEGLGRNHSHERIHPHELRYEIANEYLDIALGLW
FT                   DSWEDDAFIRDKQSGVYADLSKMHRLNHKGKFFQVEGPLNMERSPQGRPVVFQAGGSEP
FT                   GRDLAARLADAIYSRHSDIPRATEFSEDIRRRAVAYGRAPTDILIFPTITPIVGRTREE
FT                   ANAKYEERIQYVNIDLAIQYMSRFFSFYDFTQHALDEPLPDLGDIGKDSFKSTAELYLR
FT                   WAKEENLTLRQLALRVATPRGDYIGTPVEVADKIQAIYETGIIDGFIIGDGLEDFVDDV
FT                   VPILQERGIYRTEYESSTLRGNLELDYPVNRYAKSRGEA"
FT   gene            255115..255897
FT                   /locus_tag="Bxe_C0233"
FT   CDS_pept        255115..255897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0233"
FT                   /product="Putative class II aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36157"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID2"
FT                   /protein_id="ABE36157.1"
FT                   /translation="MSAVPPKPQPRVFDNVDDERYDRKLRLAATFRLFARFGFQEGVMG
FT                   HASVRDPERPDHYWTNPYATDFSSLTPDDLVLYNLDGQIVEGSNRYIHVGGTQIHIPIL
FT                   KTRNDVNAVVHTHSVHARAWSVLNRLIDPVSAESAAFYERHTLYDTYRHGEGYSLANAI
FT                   GTNRAVLLKNHGVLTVGQTIDEAAWLFVAFERAAQAQLLAEASGPIGCIPHEDALTISE
FT                   RTTPAFGWLNFQPLFQGVLHANPDLKPRPNTVLRHVGP"
FT   gene            255884..257029
FT                   /locus_tag="Bxe_C0234"
FT   CDS_pept        255884..257029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0234"
FT                   /product="ABC sulfate ester family transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36158"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID1"
FT                   /protein_id="ABE36158.1"
FT                   /translation="MSARNVGRRFFSRTLTRLLMTPTRSGCFFDPLLRLLSVVLLFVTC
FT                   AAHAETPPQVIRFGSPEISTNRALAGGVIVGIANEKGWLRDEFGKDNVRLEFDTFRNGA
FT                   PAVGQALANRQLDFAVQGDLMSVIGHAAGLPTTLLLPSVKLGNAYLAVPPQSSIARIAD
FT                   LRGKKVAYFKGNFVHLQVLRILAANGMSEKDIRSVFLDPPTSIAALASGDVDAVFGGPE
FT                   LLPARDRGALKIVYTTRGQSPTLTAQSGFIARTEFVKAYPQTTQRIVDVLVKTARWASD
FT                   PANKDQVFALWSTDGQRRADLEEDYSGRPISDRMSPLIDPFFVGRYQATLDQAAALGFL
FT                   HGPKFDVEQWIDRRFLQSALTRLGLNDYWQPLDVHGERARP"
FT   gene            complement(257065..257856)
FT                   /locus_tag="Bxe_C0235"
FT   CDS_pept        complement(257065..257856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0235"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36159"
FT                   /db_xref="GOA:Q13ID0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID0"
FT                   /protein_id="ABE36159.1"
FT                   /translation="MPRIHFNPDGRRSPTEFEPVTVHHRKPPLDGIISSHRHNWSQLTC
FT                   PLKGSMRVTTERQVWTVTSFRAVWIPPGVDHELTMVGATEFHAVFIDPQHSPLPANQCC
FT                   VVDVSPLMRELMQWLGADYGPATDHSRRLTDVLLEEVRRATRRTSALVLPGDRRLKSLC
FT                   EALMEDPGSTLTLGEWAHRTGASERTLARLFQIELGTTFGAWRQQLRLSCAVDLLRSGL
FT                   SLSRIAADLGYADSAAFSTMFKRAFGVAPSRYHASSAQAMN"
FT   gene            258135..258977
FT                   /locus_tag="Bxe_C0236"
FT   CDS_pept        258135..258977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0236"
FT                   /product="ABC sulfate ester transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36160"
FT                   /db_xref="GOA:Q13IC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC9"
FT                   /protein_id="ABE36160.1"
FT                   /translation="MTFHQRAVFAGAAGPAARIARWFARWFARCAPLRHLIALPLPLAL
FT                   LLVWWTGYRAAWISPQVLPSIGQVVHALGAGWQSGDLQRDAGVSLLRVLAGFVLGGTLG
FT                   VPLGVAMGLSERIRDYVYPCFRIIAYVPLLGWLPLLVLVLGIGETLKIVLIAKAALVPI
FT                   TLNTYNGMRNVPAAYGELGAVFRFSRWQLIRHVVFPAAFPQIWSGVRYGLTQCWLLLVI
FT                   VEFLASDSGLGYMIISGQQLFQMDTVFAALLVIGVIGFLLDRGLRWLEACLFGEERRP"
FT   gene            258974..259792
FT                   /locus_tag="Bxe_C0237"
FT   CDS_pept        258974..259792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0237"
FT                   /product="ABC sulfate ester transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36161"
FT                   /db_xref="GOA:Q13IC8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC8"
FT                   /protein_id="ABE36161.1"
FT                   /translation="MNELANVARTVSAGTGARRWTRFRRGVILPLVLGITWWAVYAFGW
FT                   AHSRMFVPPAQVIRTGLAMSFDGELPGAWLASLGRDLLGLAIGSLCGFGFALFLKSARW
FT                   IDAAIAPTFHAIRQVALFAWIPLLGTWFGLGEVGKVVFISLAAFFPVWLNAAQGLEAVP
FT                   RHYDELADVFRFTRWQRFRRIVLPAIVPSLFNGFYLALVTSWIATLGAELLMTSGVGIG
FT                   TVLNDGRENFRMDQVLLGVAVVGLTGFAFHSFAAGIDSRLARRRGAGARP"
FT   gene            259824..260684
FT                   /locus_tag="Bxe_C0238"
FT   CDS_pept        259824..260684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0238"
FT                   /product="ABC sulfate ester transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36162"
FT                   /db_xref="GOA:Q13IC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC7"
FT                   /protein_id="ABE36162.1"
FT                   /translation="MTRSKPVDTLTLRSVSKEYVSGGATRRVLDDIDLNVARGEFVGIL
FT                   GASGCGKSTLLRLIAGLDRDYGGDILMHGERVAGTDLRRGIVFQDHRLLPWLSVERNIA
FT                   LGLMNAPGTKAQKAQAVREHIALVQLEGYEAARPHQLSGGMAQRVAIARALINRPELLV
FT                   LDEPFGALDAMTRSYLQRSLAYIWASEQATMVLVTHDVEEAVLLSDRVVVMSARPGRIR
FT                   RIVDVRLPRPRDPASAAFAAIKADLLNDFKELHSDPAAVAAPGALRRAGRAASPHEVSI
FT                   ARGAR"
FT   gene            260720..261289
FT                   /locus_tag="Bxe_C0239"
FT   CDS_pept        260720..261289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0239"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36163"
FT                   /db_xref="GOA:Q13IC6"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC6"
FT                   /protein_id="ABE36163.1"
FT                   /translation="MTLDARILILPGRGSSGSDHWQSHWEAANPHYLRVQQDEWDSPVL
FT                   DAWLPRLNAAIQAEAVPALLVAHSLSVSLVAHWASRYSGPVAGALLVAPSDVEAPSYPA
FT                   GTSGFAPLPLRPLGFPAIVVASTDDPRVSVERARQFADAWGARFVLAGAYGHLGSASRL
FT                   EDWPFGQLRLAELAKLAGVTLPVNAA"
FT   gene            complement(261314..261706)
FT                   /locus_tag="Bxe_C0240"
FT   CDS_pept        complement(261314..261706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0240"
FT                   /product="Putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36164"
FT                   /db_xref="GOA:Q13IC5"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC5"
FT                   /protein_id="ABE36164.1"
FT                   /translation="MSYYGCARVILRIGCCGALGFGWGMASADSVAPAQAFERCAACHG
FT                   VAQGDQRVGPSLGDVLGRQAGSMEGFRYSSAMRSSGIVWTAQSLELFLKDPQRAVPGNR
FT                   MAFSGVDDAPTRDAIVDYLREHSQAR"
FT   gene            262064..263011
FT                   /locus_tag="Bxe_C0241"
FT   CDS_pept        262064..263011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0241"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36165"
FT                   /db_xref="GOA:Q13IC4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC4"
FT                   /protein_id="ABE36165.1"
FT                   /translation="MSNFRGVIYDSIVDTIGATPLVRLSKLAAACDCRADVVGKLEFFN
FT                   PLASVKDRIGIALIETAERAGRIKPGTLLIEPTSGNTGIGLAFVAAAKGYPLVLCMPES
FT                   ASIERRKMVGLLGAKVELTPASEGMGGAIRRAEALKRNHPDSLILQQFDNPANPDAHRH
FT                   TTAEEIWNDTAGRVDIIVSGIGTGGTITGIGQTLKARKPELQMIGVEPSGSAVLSGGKP
FT                   GPHKQQGIGSGFLSSILDLSVVDEIVTATDEDAIQTARQAAALEGVPIGISSGAALSVA
FT                   LRVGRRPGNAGKLIVVIVPSFAERYLSTELFADV"
FT   gene            complement(263123..264079)
FT                   /locus_tag="Bxe_C0242"
FT   CDS_pept        complement(263123..264079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0242"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36166"
FT                   /db_xref="GOA:Q13IC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC3"
FT                   /protein_id="ABE36166.1"
FT                   /translation="MQKNTSNAHANLNWDDLRYFLEVARTQRASGAAKRLGVDHTTVAR
FT                   RVRELEAALGTVLFDKSRADGFVLTAEGQRLVAYADAVETSVHSASEQFAGAAQSLSGH
FT                   VRIGSTEGFGCFFLSPQLTRFTARHPGISIDLLPVPHFVSLSKREADMAITLERPERGQ
FT                   YVFTKLCDYRLRLYGTREYLEAHAPIGAVADLRNHAFIDYVADLAFSHELLYLNRTIPN
FT                   VTARLCSTSVIAQYYAALQGNALAILPCFMGAPDPRLVPILPEEIVVTRHFWLSSREDL
FT                   RKLRRVASLWDYLRAAADANRPFLMGESREMHYVDFQ"
FT   gene            264220..265533
FT                   /locus_tag="Bxe_C0243"
FT   CDS_pept        264220..265533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0243"
FT                   /product="major facilitator superfamily (MFS)metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36167"
FT                   /db_xref="GOA:Q13IC2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC2"
FT                   /protein_id="ABE36167.1"
FT                   /translation="MEMQSNPHGAAVIAPVPKRARDYLLAGWASMAGTTIEWYDFFLYG
FT                   TAAALVFNKIFFPTLDPILGTMAAFATYGVGFIGRPMGGIVFGHFGDRIGRKSMLLVTL
FT                   LLMGIPSMVIGLIPSYQSIGYWAAGLLVAMRFLQGMAVGGEWGGAVLMAVEHAPPGRKG
FT                   FFGSLPQTGVGFGLILSSLAMAAVTALPEADLLAWGWRVPFLASILLVIIGWVIRVRVP
FT                   ESPDFERVKALGEPVKAPILAAMRRHPRELLIILGARTAENTWFYLVVAFALAYAANQL
FT                   KIPKAAILHAITAGAVLSLFTMPFCGYLSDRIGQKRLFLIGLVIMCVFAAPFFAMLATR
FT                   HPATVWWAMVLGVGVVFPILYAPESQLFASQFPAEIRYSGISLSVQIAGVLGGGVAPMI
FT                   ATALLALGSGNPHYVVAYMVALGIVALICTLLMRAGAE"
FT   gene            265657..267183
FT                   /locus_tag="Bxe_C0244"
FT   CDS_pept        265657..267183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0244"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36168"
FT                   /db_xref="GOA:Q13IC1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC1"
FT                   /protein_id="ABE36168.1"
FT                   /translation="MNAVTRESSGNIGTARLLIAGEFVESKTTEWRDIVNPATQEVLAR
FT                   VPFATAEEVDAAIRSAHAAFATWKNTPIGARMRIMLKYQALIREHMPRIAKTLSAEQGK
FT                   TIPDAEGDIFRGLEVVEHAASIGTLQQGEFAENVAGGVDTYTLRQPIGVCVGITPFNFP
FT                   AMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMQLVELALEAGVPKGVLNVVHGGKDVVDA
FT                   LCTHELVKAISFVGSTAVGTHVYRLGSEHGKRVQSMMGAKNHAVVLPDANREQTLNALA
FT                   GAGFGAAGQRCMATSVVVLVGAAQQWLPDLVAKAKTLKVNAGNEPNTDIGPVVSRAAKQ
FT                   RILDLIETGVKEGATLALDGRDVKVAGYEQGNFIGPTVFTDVTTDMEIYRQEIFGPVLV
FT                   VLNAATLDDAIALVNRNPFGNGVGLFTQSGAAARKFQSEIDIGQVGINIPIPVPVPFFS
FT                   FTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDDTVNDGVNTTISLR"
FT   gene            267220..268116
FT                   /locus_tag="Bxe_C0245"
FT   CDS_pept        267220..268116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0245"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36169"
FT                   /db_xref="GOA:Q13IC0"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC0"
FT                   /protein_id="ABE36169.1"
FT                   /translation="MKIGFIGLGNMGAPMAHNLLKAGHTVNVFDLNAQAVQALVDAGAR
FT                   AAGSPKAAVTDVECVVTMLPAAAHVRSVLTADDGVLAGIAKGVTIIDSSTIDPASVKAL
FT                   AELAAQHGNTLVDAPVSGGTGGAAAGTLTFMVGGSAAAYEQVKPVLSAMGKNIVHCGDT
FT                   GTGQVAKICNNLVLGITMAGVAEAMSLGAALGIDPKVLGGIINTSTGRCWSSDTYNPFP
FT                   GVIEAAPSSRGYTGGFGTDLMLKDLGLATDAARSARQPVYLGALAQQLYQTMSTKGAGR
FT                   LDFSAVIKLYQFEEKPR"
FT   gene            complement(268428..269438)
FT                   /locus_tag="Bxe_C0246"
FT   CDS_pept        complement(268428..269438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0246"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36170"
FT                   /db_xref="GOA:Q13IB9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB9"
FT                   /protein_id="ABE36170.1"
FT                   /translation="MQLAAPKGTIAICFVEKALQPVRERGLDIDVLLAAAGIAPRLLAL
FT                   PQTRVSAASYSTLWRQINHALDDEFFGQDSRRMKVGSFAMLCHIVIHCQTLGQALRRAL
FT                   RYFDLLLDDLSCTVSVERADARITLHVRAGTPVRIFAHETLLVMLHGLMCWLVGRRIRI
FT                   RVAHFAYPEPAYSTEYHLMYSPVLEFGCPCTDIVFDGSYLDLPVIQTEQTLKSFLRTAP
FT                   ENVVLKYKNQHGLAARIREKLKTQPLDRWPTFDGLATSLDLGASTLRRRLKDEGQTYQI
FT                   IKDELRRDMAIGFLCDTKKNVDEIAIELGFAEPSAFHRAFRRWTGARPGAYRIRN"
FT   gene            269649..270785
FT                   /locus_tag="Bxe_C0247"
FT   CDS_pept        269649..270785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0247"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36171"
FT                   /db_xref="GOA:Q13IB8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB8"
FT                   /protein_id="ABE36171.1"
FT                   /translation="MPDSFTDEQRMIRDAARDFATQCLAPHAAKWDRDGDIPQNIVSQL
FT                   GELGLMGMTVPAEWGGTYTDYVAYALAVEEIAAGCAACATMMSVHNSVGCSPILNFGTD
FT                   EQKSLYLADLASGRAIGAFCLTEPQAGSEAHNLRTRAVLRDGTWVLNGSKQFVTNGRRA
FT                   AVAIVFAVTDPDAGKRGISAFIVPTHTPGFKVGKPEKKLGIRASDTCPVTLEDCAVPES
FT                   TLLGRRGEGLKIALSNLEGGRIGIAAQAIGIARAAFDAARSYAAQRIQFGKPIREHQSV
FT                   ANMLADMITRLNAARLLVHHAARLRSAGLPCLSEASQAKLYASEVAEEVCSQAIQIHGG
FT                   YGYLEDYPVERHYRDARITQIYEGTSEVQRMVIARQLD"
FT   gene            270892..271680
FT                   /locus_tag="Bxe_C0248"
FT   CDS_pept        270892..271680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0248"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36172"
FT                   /db_xref="GOA:Q13IB7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB7"
FT                   /protein_id="ABE36172.1"
FT                   /translation="MSAEMIDVDRLDDGRVAVLTLRRPPANAFTPEGLSQLQRTVESLD
FT                   EDERVRAVVITGEGPKFFSAGADLNAFADGNRDVARVAAQRFGAAFEALQNARPVVIAA
FT                   INGYAMGGGLECALACDIRIAEEQAQLALPETAVGLLPCGCGTQTLPWLVGEGWAKRMI
FT                   LTGERVDAATALRIGLVEEVVGRGAARDAAVAMAQRVTTLSPQAVTFSKGLIHHARNGV
FT                   PRTAALALERERFVDLFDGADQQEGVRAFLEKRAPRWHNT"
FT   gene            271700..272812
FT                   /locus_tag="Bxe_C0249"
FT   CDS_pept        271700..272812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0249"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36173"
FT                   /db_xref="GOA:Q13IB6"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB6"
FT                   /protein_id="ABE36173.1"
FT                   /translation="MNVNQQAETAAQELVIQEINHVGVVTLNRPKAHNALTHAMVLALT
FT                   ERLSQWKDDPAIYGVVIRGAGDRAFCAGGDIRALYQSYRDGSPLYRDFFVDEYRLDHML
FT                   HQYPKPCVAVMDGLVMGGGMGIAQGAALRVVTSRSQIAMPETAIGLFPDVGASYFLAKM
FT                   PVELGLYLGITGVTLNAADALFAGLADTFAESNHLNDLDGLLSAITWTREPLADLRNAI
FT                   RTGHRADSGRPSLEALMPAIQHHFDPARSIGQVIDSLDAERDPRYGEWASTTAETLRQR
FT                   SPLMMCVTREQLLRGRHAELADCFRMELGMVYRAFDDGDVIEGIRALLIDKDKAPRWRA
FT                   ATVDEVTQPMVSRFFDSPWSRDGHPLRDLA"
FT   gene            273002..273751
FT                   /locus_tag="Bxe_C0250"
FT   CDS_pept        273002..273751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0250"
FT                   /product="Electron transfer flavoprotein beta-subunit,
FT                   EtfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36174"
FT                   /db_xref="GOA:Q13IB5"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB5"
FT                   /protein_id="ABE36174.1"
FT                   /translation="MKVVVAVKRVVDYNVKVRVKADGTGVDIANVKMSMNPFDEIAVEE
FT                   AVRLKEAGVATEVIAVSAGVTQAQETLRTALAIGADRAILIESNEELQPLAVAKLLKAL
FT                   VDREQPSLVILGKQAIDDDSNQTGQMLAALANLPQATFASKVVVADGKATVSREVDGGA
FT                   ETLSLTLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLEVVKPEDLGVDVTPRLKTLKVVE
FT                   PPKRPAGVKVPDVQTLVGKLKTEARVL"
FT   gene            273869..274852
FT                   /locus_tag="Bxe_C0251"
FT   CDS_pept        273869..274852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0251"
FT                   /product="Electron transfer flavoprotein, alpha subunit,
FT                   EtfA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36175"
FT                   /db_xref="GOA:Q13IB4"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB4"
FT                   /protein_id="ABE36175.1"
FT                   /translation="MTILVIAEHDAPKEAPLGGNASLKAATLNTVAAAAVIATLAAHDI
FT                   HVLVAGHNAQGAAEEAAKIAGVTKVLLADAPQLEAGLAENVAATVLNIAKDYSHILAPA
FT                   TAYGKNIAPRIAAKLDVAQISDITAVDSADTFERPIYAGNAIATVQSQDPIKVITVRTT
FT                   GFDAVAAEGGSATVGKIEAAADAGVSQFVSREVTKLDRPELTSAKIIVSGGRGLGNGEN
FT                   YTKVLEPLADRLNAALGASRAAVDAGFVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLA
FT                   GMKDSKVIVAINKDEEAPIFSVADYGVVGDLFTVVPEFASQLAQLD"
FT   gene            complement(275060..275371)
FT                   /locus_tag="Bxe_C0252"
FT   CDS_pept        complement(275060..275371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36176"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB3"
FT                   /protein_id="ABE36176.1"
FT                   /translation="MAMPDARLRQREHRQHLIESAPGERALLQPRVPPALDPQHRTART
FT                   TFITGSTSTRNVPCASIVTVGAGPHQPVPRGATLLVDRLERPCEAVFVFGYGAFSETE"
FT   gene            275711..276808
FT                   /locus_tag="Bxe_C0253"
FT   CDS_pept        275711..276808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0253"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36177"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB2"
FT                   /protein_id="ABE36177.1"
FT                   /translation="MAEPQHTASGTVAELTYPFAGPPAPGQTREVAPGVLWIRMPMPLA
FT                   LDHINLWAIADGAGWTVVDTGLRNAGTAEVWERLFEEALGGRPVTRVIVTHMHPDHIGM
FT                   AGWLTRRFNCRLWMTRLEYLHCRVLVADNGREAPPDAIRFLRGAGWDDSAIEGYRARFG
FT                   NFGKGTYALPDSYRRLRDKEVIRIGQHDWAVVVGNGHSPEHACLWSPELKLLISGDQVL
FT                   PRISSNVSVHPIEPDADPMSDWLMSLKKIAGNVPDDVLVLPGHNECFHGLHARLAGLAA
FT                   GQDAAFERLRAALAKGPGRVVDVFPALFRRPITGSDAQLLGLATGESQACLNYLLYRGE
FT                   ISVDVDADGVRWYSLCEPGSEASGS"
FT   gene            276885..277160
FT                   /locus_tag="Bxe_C0254"
FT   CDS_pept        276885..277160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36178"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB1"
FT                   /protein_id="ABE36178.1"
FT                   /translation="MLVSRSPSMHGIGHAASGREAPRKLHPLRRYLYAGNFRVGLPAVL
FT                   CQDIGLVDGMGRRAESSAMVVSGVPAGNAGLVRASQTPSTVRIRYS"
FT   gene            complement(277155..277682)
FT                   /locus_tag="Bxe_C0255"
FT   CDS_pept        complement(277155..277682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36179"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB0"
FT                   /protein_id="ABE36179.1"
FT                   /translation="MAYRQRHRISARRNSEMHGEHTDTWSQTVALLDHGLAHQMMDTLA
FT                   RIAAAHPQKTAWSHHPALTVRVIERTSARTVSVSWCDPLSGYYGYQSWHASLARRRASC
FT                   VLSGEPISRGDPVYQPSSRPSRPGNAGAMILASRVDAALRVDHQPAGHEVAAGATGRTD
FT                   GAGCCGLQEGAL"
FT   gene            278072..278467
FT                   /locus_tag="Bxe_C0256"
FT   CDS_pept        278072..278467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36180"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA9"
FT                   /protein_id="ABE36180.1"
FT                   /translation="MLDAGTSGKPERQEAAFMINSPRAILRKRVAIALMAATTAMSAIP
FT                   AMAQHDRHGGGGHGGGYHGGGYRGGYHGGGYDRGGHGGGGGLIVGALLGAVAAAAVTSA
FT                   VQAPPAVTYAEPPPPPPPGVAYYPPGY"
FT   gene            278560..279099
FT                   /locus_tag="Bxe_C0257"
FT   CDS_pept        278560..279099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0257"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36181"
FT                   /db_xref="GOA:Q13IA8"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA8"
FT                   /protein_id="ABE36181.1"
FT                   /translation="MNNILRSTAAPALLVLAFTTGSAWAQTPASGAAAPASTAQTGGHA
FT                   KKHQDFVEQRIDELHAALKITDQQSQQWDAFAQTMRDNAKDADQAFRERASKLGSMTAD
FT                   EAMKSYASITQLHAQNMQKLATAFSALYATLSDDQKKTADVLFRNEHKHGKRHGPQRQH
FT                   KPAAGGAASAPVPASD"
FT   gene            279817..281295
FT                   /locus_tag="Bxe_C0258"
FT   CDS_pept        279817..281295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0258"
FT                   /product="cyclic nucleotide-regulated small
FT                   mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36182"
FT                   /db_xref="GOA:Q13IA7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016846"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA7"
FT                   /protein_id="ABE36182.1"
FT                   /translation="MPANLLLHMAPSCLAAALNLLLVLLGMPNRLVIRTIGRCAAFALL
FT                   TAAMLHDGMVPTQAPWHLMLPEVRFVWGALEIAWWLLAASTVAAVVRTYYTLGGRLRER
FT                   RFMLDVIGTLLYLSAALAIITDVFHIPLKGVLATSGALAIVLGLALQSTLSDLFSGLLI
FT                   NATAPYRVGDSISLDSGTEGQVVEITWRATHLAKANRDLIVVPNSTIAKSRIVNASLPR
FT                   GAHASTARFQAPSRLRPSDVMHALQLAAETCVGIAARPAPVIVTRSVGLDATDYEVSFF
FT                   ASERWQADEALNSFYDAAHRHLESFHALISPAAQADDASAGTLEYQLIAGIRVFGLLAR
FT                   EERIKLAAALVRRELTPGQIVLEAGQIPDAITIVGYGVLAASPGGDDHSADILRFGPRE
FT                   YLGESGPIAGVPLSVRVVARTYAIVYELPGNAVAALLKEHPEVAHALSARLADREREGR
FT                   ALMQPQAEMPVTRHGLASWIASCIRALHQGHREP"
FT   gene            complement(281448..282035)
FT                   /locus_tag="Bxe_C0259"
FT   CDS_pept        complement(281448..282035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0259"
FT                   /product="isochorismatase hydrolase family protein"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36183"
FT                   /db_xref="GOA:Q13IA6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA6"
FT                   /protein_id="ABE36183.1"
FT                   /translation="MMTQPLSIDRKRAALLVMDFQKLIIDGYATESEPLLSRTATLLEA
FT                   TRDAGIMVIYVVVGFRPGYPEVSERNMTFSAIRTSGRFATDDASIEVHPAVAPRAAETV
FT                   VTKHRVSAFAGTDLDMILRANSIDTLLLTGIATSGVVLSTLRHAADADYRVFVVGDCCS
FT                   DSDAEVHRVLLDKIFPRQAVVSEASTIIAGLA"
FT   gene            282403..283107
FT                   /locus_tag="Bxe_C0260"
FT   CDS_pept        282403..283107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0260"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36184"
FT                   /db_xref="GOA:Q13IA5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA5"
FT                   /protein_id="ABE36184.1"
FT                   /translation="MTTTVARPTLACAEKRSRGRPTRSATIDPDALLRSARQVFARQGF
FT                   EATSVREIARDAGVDPSLMAHHFGSKEALWTAVVEQIAHQAVPMIEATRKLRMLRVTAR
FT                   GRVERALVILVERVFEEPDIGLFFSTAATEKGERLDVLIERLVRPYHDVFAPLLAAGMD
FT                   SGELAQNDPEVMYWMLINAVSRTVSYGHVLATFSSLPRRPRDFKRAVLEIARGMLGAGP
FT                   NANRRYQQKSRM"
FT   gene            complement(283174..284715)
FT                   /locus_tag="Bxe_C0261"
FT   CDS_pept        complement(283174..284715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0261"
FT                   /product="Putative radical SAM domain/B12 binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36185"
FT                   /db_xref="GOA:Q13IA4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027564"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA4"
FT                   /protein_id="ABE36185.1"
FT                   /translation="MKVLTVHPSGLMYTRVFLRLEPLGLETVAAVLREAGHEVRLIDLQ
FT                   VETHRDLHRLIRNWQPDAVCFSGNYLANIPEIVDLAKSVKEKQPRCFVFVGGHSVSFTA
FT                   ADILRHAEGAVDCVLKGEGEASVVALLEAASHGADLLQIPGAVTQHGEGPPPHFVESLD
FT                   PVRPARDLLRHRRKYFIGTLDPCASIEFARGCPWDCTFCSAWTFYGRSYRARSPEVVAG
FT                   ELASIREPGVFIVDDVAFVHADHGMEIGKAVQRRGIRKKYYLETRGDVLLRNREVFEFW
FT                   RGLGLQYMFIGMEAIDAEGLKAFRKRINLDRNFEALAFARSLGITVAINLIADPDWDHD
FT                   RFEAVRQWCLEIPEIVNISVNTPYPGTEIWLREQRRLTSLDYRLYDIQHAVLPTRLPLP
FT                   EFYAELVRTQQVLNRKHLGWTALRGAAGHACHLLLRGQTNFVRMLWRFNSVFNPQLQLN
FT                   DHAREVHYTMSPPPGITEQRIDVKALYVHGPIGRKGRRIDDATENFVEQTRMGAG"
FT   gene            complement(284806..286098)
FT                   /locus_tag="Bxe_C0262"
FT   CDS_pept        complement(284806..286098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0262"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36186"
FT                   /db_xref="GOA:Q13IA3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA3"
FT                   /protein_id="ABE36186.1"
FT                   /translation="MTQPVRIVIVGGGIAGLLLATRLGNRLGRRGEAHVTLVDRSPTHI
FT                   WKPMLHTIAAGTTDVHQQQVFYLTHARAHGFTYRPGEMCGIDRDTQQIQLAALAMPNGE
FT                   VVMGPGTLGYDILVLSTGSRANDFGTPGVPEHCHFIDSQPQAEAFNEAIRSRIVRSVVE
FT                   NEPLRVAIVGAGATGVELAAELSHLLDVASSYGDASIRARLHLGLYESAPRVLTAFPPD
FT                   ISASSEALLRRLGFEVHTRTRVTEARAQRLRLNDGSEVAADLMVWAAGVKAPDFLGKLP
FT                   GIEASHANQLFVRPTLQTTHDDHIFALGDCASLTPPGNERPLPPTAQVATQQAEHLAKH
FT                   LPRWLNGEPLPEFTFRDFGALVSLSDYNAFGTLGKFGFFKGGFIRGRFAQISHAMLYRR
FT                   HQQALHGFGKASLLWTAERINALVQPKIRLK"
FT   gene            286615..286980
FT                   /locus_tag="Bxe_C0264"
FT   CDS_pept        286615..286980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36187"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA2"
FT                   /protein_id="ABE36187.1"
FT                   /translation="MAVGSAKLQMADRELLRREETVPGEQQAIAAKSSACFPGGLQPVK
FT                   QGDYRMRCAGPDSRGSGAASVDEAPRTHIWLSPLEDLAFEKRQPPVWKTIGDCAGFAAG
FT                   RSRSARQASATQPVMLV"
FT   gene            complement(286967..288193)
FT                   /locus_tag="Bxe_C0265"
FT   CDS_pept        complement(286967..288193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0265"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36188"
FT                   /db_xref="GOA:Q13IA1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA1"
FT                   /protein_id="ABE36188.1"
FT                   /translation="MAEPKTRPAPLAGITVLDFSKVLAGPVCTQILADMGADVIKVESI
FT                   EGGDDTRRWPPFRKEGDNQDGTVFLSANRGKRSIAVDLKSTGGRAVIRRLAESADIVIE
FT                   SFGPGVAQRLGVDAGTLHEINPRLVHCSISGFGTEGPMRFAKGYDVILQAFSGMLGIIG
FT                   NPGDPPIRVPFSPIDQATGYHAVTGILAALFERNRTDRGTAVEASLFDSSVSFMGYLLQ
FT                   SFWERGTEPERHGSGHESLCPYEAFATADKPIMLGIANDALWRSFCELAGIAELGRDPR
FT                   FATNADRVSNRKETVALVRDILSRRPRDEWVDSLNNAGIPCSPIHTLAELSEHPQLVES
FT                   GMRLDYGHPTYGKLSGVAQAVKFNGQRATAELPPPLFGEHTREILRRLKLSDHEIDAMR
FT                   NAGHVFTLT"
FT   gene            288276..289019
FT                   /locus_tag="Bxe_C0266"
FT   CDS_pept        288276..289019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0266"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36189"
FT                   /db_xref="GOA:Q13IA0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA0"
FT                   /protein_id="ABE36189.1"
FT                   /translation="MLGEKKLLGAVHVPKSSDVLANELRQRIVKGELTDGDLLPPERDL
FT                   VSQTGLSRGSVREALRILELEGFVATRPGRYGGTVVRRPTEKQLSHCLNLYIQGNGVTL
FT                   SEIVAAREALGPTLAQWAALHRTDEEMAELEAVTAKMESLYEDVPAFLEANLEWYAVLA
FT                   RASHNELLRVFLASITSLIHEALKVDSLASDDARSLALLAHRRIMNAIRQKDAAAARRR
FT                   MERHIQAYSEIVQAVIKGADGDLKV"
FT   gene            289038..289811
FT                   /locus_tag="Bxe_C0267"
FT   CDS_pept        289038..289811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0267"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36190"
FT                   /db_xref="GOA:Q13I99"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I99"
FT                   /protein_id="ABE36190.1"
FT                   /translation="MSIDLRTEGHVCVITINRPERMNALDAAHYDDLSAAWCQVRDDTR
FT                   IRAAVITGAGEKAFCAGADLKSFVSSAPELEEIMLTQKSQLLNRGLEVWKPVVAAVNGY
FT                   CLGGGMTLLLASDIRIASRHVKFGLSEVKRGIFPGNGGTQRIAQQLPHAIAMEVLLVGD
FT                   TFSAEMAERWGLVNQVTAPEDLMETALVYAEKLAANAPLAVQAAKELAIRSRDVDLATG
FT                   LRMEQVMLRLLQTSSDVKEGVKAFAEKRAPVFEGR"
FT   gene            289867..290745
FT                   /locus_tag="Bxe_C0268"
FT   CDS_pept        289867..290745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0268"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36191"
FT                   /db_xref="GOA:Q13I98"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I98"
FT                   /protein_id="ABE36191.1"
FT                   /translation="MASRSLLFIPGDSEKKLAKGESTAADALILDLEDSVSASRLQMAR
FT                   GLVHEYLAARRKDRRQKLWVRINPLSSPLALQDLAQVIPGRPDGIMLPKLKSAKEVVTL
FT                   DNYLSAFEAASGQEPGQTQIIPVATETAASIFRLGEYSGISSRIAGLTWGAEDLATALG
FT                   ARENRQPDGTYDLTYQLARSLCLLGSAAASVPAIDTITADFRNESLLRSECDDARRAGF
FT                   KAKMAIHPDQVPVINELFLPGEAEVVQARRIIEAFEQADGAGTVQLDGSMLDMPHLKRA
FT                   RDVIGMVNGLS"
FT   gene            290821..291600
FT                   /locus_tag="Bxe_C0269"
FT   CDS_pept        290821..291600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0269"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36192"
FT                   /db_xref="GOA:Q13I97"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I97"
FT                   /protein_id="ABE36192.1"
FT                   /translation="MPVELIRAGSVATVRLCRPEKLNALDEEMREQLIERFDECARDAS
FT                   VRAVVLTGCGRGFCSSGDVSSMGHFTPETARKRLRQAHRMILAVANIDKPVVASVRGPV
FT                   AGIGWSLALACDLVVASVTAKFIQVFRNVGLVPDGGSVYFLTQILGVQRAKEIVYSARP
FT                   VSAQEALSHGLVMEVVPDEELDARSIRLAETLAEGPQLSFAISKKMFKSMYLPTLENFL
FT                   DTEAWAQTSCLLGAEHREGVSAFLEKRRPAFNRDLEQ"
FT   gene            291651..293084
FT                   /locus_tag="Bxe_C0270"
FT   CDS_pept        291651..293084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0270"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36193"
FT                   /db_xref="GOA:Q13I96"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I96"
FT                   /protein_id="ABE36193.1"
FT                   /translation="MLETRRSAAMRLDRLPIGRFHWRLLGLIGGGLFLDGFEVYVAGGV
FT                   VGFLVKTGWANMHSAAMFVSASVAGMALGTWLAGVLGDRFGRRFTYQFNLLLFGLASFA
FT                   AAVVSSMDQLIVARFVMGIGLGAEVVVSYGTLVEYIPPAHRGRWSSGLSLCGNAALFVA
FT                   ALVGYFVIPDLGWRWLFGGVGVAALIIWYMRKAVPESPRWLESQGRFEEADRILDDIEQ
FT                   ELAYVGQPGEAAVPAYAVVPDLPRRMLVPRFIIGIMMSVAGNAAFYGLIVWLPTFFFRQ
FT                   GFTVGSSLGYSMVMSAGGPAGALVGMAIADRVRRKRAIIVLSIVAALLGLVYPLCKTPL
FT                   SVLVTGFLLVSALYAFVAVAWASYLPELFPTRIRLRASAVCNVTGRLAAIAMPFAVVQL
FT                   YAKFGVFGVVGALGGILLAQAAVIALLGIDTNNVSLEELTGQSAEEIGPAANQRFPSSR
FT                   DGRLGSRSSQFGMSGIEDQ"
FT   gene            293101..294033
FT                   /locus_tag="Bxe_C0271"
FT   CDS_pept        293101..294033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0271"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36194"
FT                   /db_xref="GOA:Q13I95"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:3E02"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I95"
FT                   /protein_id="ABE36194.1"
FT                   /translation="MKQSKKIIITCAVTGSIHTPTMSPYLPITPEEIVKEGVAAAEAGA
FT                   AMLHLHARDPLNGRPSQDPDLFMRFLPQLKERTDAILNITTGGGLGMSLDERLAPARAA
FT                   RPEVASMNMGSLNFNISQAAAKFDTFKFDWERPYLAGTRDFILSNTFSQIERGMTELGA
FT                   SGTRFEFECYDVGHLYNLAHFVDRKLVEPPFFLQCVFGILGGIGADPENLLHMRTIADR
FT                   LFGQDYYLSVLAAGRHQMPFVTMSAILGGNVRVGLEDSLYSGKGQLATSNAEQVRKIRR
FT                   IIEELSLDIATPDEARAMLKTKGANETSF"
FT   gene            294355..295521
FT                   /locus_tag="Bxe_C0272"
FT   CDS_pept        294355..295521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0272"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36195"
FT                   /db_xref="GOA:Q13I94"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I94"
FT                   /protein_id="ABE36195.1"
FT                   /translation="MRKIVCLSVFAAAVFGAPSAYAQNSVTLYGVIDVGINWQSNAGGK
FT                   HLFSMVDGMAGANRFGLRGTEDLGGGWKTVFVLENGFYAINGATQFTGMFGRQAYVGLS
FT                   NAQYGMLTLGRQYDSLVDTLQQYSIVVKLGGAMFFHPGDVDNIGDSHRVNNAIKYTFKR
FT                   GPLTATALYSMGGVAGQSGRNQIWSAGVNYAGPSFSLGAAYLDVRNPNVSFFPVNNVGA
FT                   SASLDNIGPKPVFSGYASAATYRVIGLGGHYVFDPVTFGIVYTNVRFGGLGDTSSGPNP
FT                   LGYTGSAIFNGVEVSADYRLSRSLSAGVAYDYTRNNGASGKGAATYNSVMGGVDYSLSK
FT                   RTDVYLVGIWQSMTGVDSAGGSEAQASLFSPSSNGREAIIRVAMCHRF"
FT   gene            complement(295790..296173)
FT                   /locus_tag="Bxe_C0273"
FT   CDS_pept        complement(295790..296173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36196"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I93"
FT                   /protein_id="ABE36196.1"
FT                   /translation="MSREPLAHRSAGNPPTPHERGVYTRCTGANMFKPTRVRRKAGKTS
FT                   FKAEFHTRSGRLRIFADGVVSHDLFPPHSWFVIASYSWGSRWGTHPNKVDLLHVLNHFV
FT                   EQWPDFRHGAGDGVLPDCCMSCG"
FT   gene            complement(296663..297715)
FT                   /locus_tag="Bxe_C0274"
FT   CDS_pept        complement(296663..297715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0274"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36197"
FT                   /db_xref="GOA:Q13I92"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I92"
FT                   /protein_id="ABE36197.1"
FT                   /translation="MKLSQLLVLSAVFGVVSNEVHAQGSVNIYGILDTGVLYQSRTAND
FT                   AGKGFSALDAGGDPTLWGLTGTEDLGAGYKAVFKLESGFSTVNGGFGNSNGNFWGRNAY
FT                   VGVETPYGTLHAGLEISSFFNAVALTDPVGTSFFASAVTTEINAIGLAGAIVSNGLSYT
FT                   SPTIAGLQIRIDHGFGNVAGNFRAGSHTGASANYGNGPFSATIAYFTEDDPVSGASTYR
FT                   GLTANAGYAVGPVTARLSFSKFRNMSTDAPLTNVNVFGAGAEWQITPAVALTAIAYASQ
FT                   DTNVRANKSMLYRVGAQYFLSKRTTLYGQVGLVHNDADMNTTLAVNAPTSFAPPQGTTV
FT                   GVNVGIRHMF"
FT   gene            complement(298008..299516)
FT                   /locus_tag="Bxe_C0275"
FT   CDS_pept        complement(298008..299516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0275"
FT                   /product="Conserved hypothetical protein"
FT                   /note="NHL repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36198"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I91"
FT                   /protein_id="ABE36198.1"
FT                   /translation="MRFGPDGKLYVAQCFGSQISAIDTRNGAATTVTPVGSDIVAPDDL
FT                   AFDSKGNLFATEVMTDRVSMRSADGTVRVLNDGLPTANGITVHGDRIFVDEFRVGGRVL
FT                   ELYTDGRSPRVIAENLTLPNALSMGPDGKLYFPLVATGEVWRVAVENGSPECVVSGLSI
FT                   PTAVKFDVRNGGLVVTEAGSGEVTWVDVVSGKRKTLATLRPGSDNLVFDGDGRLFVSHF
FT                   TDGGITEIGADGNIRTLVAPGLVGPFGIAVDGGGSVYIADGMTLAVVDTSGQLHQPANL
FT                   LNHGFPGYIRGIAVSDGGTVFVTNSAGGLARYRAGEEATFLLPDLDQPMGLAALPNGAI
FT                   RVCEAGRGRVIEYAPDGSTHTLASGLRFPTGIACTAQGRSFVSEGAGGRVVELHHGVVS
FT                   TVLDGLVEPHGLAIAGAALYVLDRGARTLYAVSLEDGSTEQLSHSLPVGPAPNIVPRQL
FT                   PGIKNLMPGPLHSFAGLAADRTGAIYVSCDGDGSVRRLCREAAV"
FT   gene            complement(299770..301425)
FT                   /locus_tag="Bxe_C0276"
FT   CDS_pept        complement(299770..301425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0276"
FT                   /product="Putative cyclohexanone monooxygenase"
FT                   /EC_number="1.14.13.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36199"
FT                   /db_xref="GOA:Q13I90"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I90"
FT                   /protein_id="ABE36199.1"
FT                   /translation="MTTKGNDKNPAKSVDFEAIIVGAGFGGIRALHEMRKLGLSVRLFE
FT                   AGSDVGGTWYWNRYPGARTDSESWSYCFYFSRELMEEWNWPERMPSWQHVQNYMRYTVD
FT                   RFGMRTDMQFDTRVRSAHYNEEENHWTITTEQGESYTCTYFISAIGWFEVPTKPEFKGL
FT                   DSFAGQWYLSCRWPEKPVDFTGKRVGIVGAGSTAVQIFTTVAKTAKHVSLFQRTPNYVM
FT                   PSRNYPLDEADQLSIKRDYDAIVAQIRKQVFAFPMKDSTLRYDDVNDEQRQAILDAGWE
FT                   AGGFRFLFETFCDIFVDERSNAAASEYVRNKIRAIVKDPVVAEKLCPKYPIALKRPPTC
FT                   NFYYETFNRSNVSLVDISESPIDEIVPGGIRVGADHHELDIIIFAMGFDAVTGPLSNLD
FT                   VRGRGGETIKNKWQAGPRTSLGIGIDGFPNLFIVTGPQAPFANVPPIVEAAVTWIGHAI
FT                   THMREKGYDRMEASPEAVESWAQLMQTMVNATLLRHAGTQRSWYMGANIPGKPQTVLFY
FT                   FGGAEAYFNDIERVAANGFEGFNFSRTGETVEPA"
FT   gene            complement(301635..302486)
FT                   /locus_tag="Bxe_C0277"
FT   CDS_pept        complement(301635..302486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0277"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36200"
FT                   /db_xref="GOA:Q13I89"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I89"
FT                   /protein_id="ABE36200.1"
FT                   /translation="MSIQKVGVVGAGTMGNGIAQVCAVAGLQVAMIDISGAAVTDGLAT
FT                   IESSLERLVRKDKLSAADRAAALARVSGNTDYAALKGAGLIIEAATENPGIKLRILRQI
FT                   DEAAEDDAIIATNTSSISITLLAAVLKQPERFIGMHFFNPVPMMALLEVIRGLQTSDET
FT                   HAKTLAFAQTIGKTAITARNSPGFAVNRILVPMINEAIFTLQEGLATADDIDTGMRLGC
FT                   NHPIGPLALADLIGLDTLLAVMQVFYEGFNDPKYRPAPLLREMVAAGRLGRKSGRGFHS
FT                   YA"
FT   gene            complement(302567..303355)
FT                   /locus_tag="Bxe_C0278"
FT   CDS_pept        complement(302567..303355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0278"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36201"
FT                   /db_xref="GOA:Q13I88"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I88"
FT                   /protein_id="ABE36201.1"
FT                   /translation="MSLVQLDFDATTGIARLAFDRPEVLNALDVPLARALNERVQALAQ
FT                   QTGLRCVVLSGNGRAFMAGGDLARFADDFDHADVVVDELLDALHPAILTLRQLDAPVLA
FT                   AVHGAVAGAGLSLMAGCDLVLAAQGTRFVMAYDRVGASPDCGGTYDLPRLLGGRRAAQF
FT                   YLLGETLSAEEALAVGLVNQVVAADALAAMTHEWATRIAAGPTRAYGHYRRLVQQASTS
FT                   SLTDQLERERAAFKAATRTRDFRAGVQGFLRKRSISFSGQ"
FT   gene            complement(303370..304512)
FT                   /locus_tag="Bxe_C0279"
FT   CDS_pept        complement(303370..304512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0279"
FT                   /product="Long-chain acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36202"
FT                   /db_xref="GOA:Q13I87"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I87"
FT                   /protein_id="ABE36202.1"
FT                   /translation="MKRTCFDAGMEQFRDSARKFFAGEIAPHRERWREASVVDREAFRK
FT                   AGEMGYLCMWIDECHGGLGLKDLRYEQILIEENIFHGDRGFFFWLHSRLVAPYLEHFGT
FT                   DEQKQRYFPGIRSGEQILAIAMTEPDAGSDLAGMKTRAEETGDYWVLNGSKTYISNGLN
FT                   ADVVLVAARTHPTKAHGLTLFLVERGMEGFERGRNLRKMGLKSQDTAELFFHDVKIPKS
FT                   HVLGQVHAGFQHLMRGLAEERLLAAIFNVASARLAMHLTCDFVRERKVFGKPLSSFQNT
FT                   RFKLAALDTEIEVAQSWVDRLVAEHNADQLDAVDAARAKLFTSELNGRMVDEGVQQHGG
FT                   AGYMDEYEICRLYQDERIHRILAGTSEIMKEIVARSILDT"
FT   gene            complement(304544..306688)
FT                   /locus_tag="Bxe_C0280"
FT   CDS_pept        complement(304544..306688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0280"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36203"
FT                   /db_xref="GOA:Q13I86"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I86"
FT                   /protein_id="ABE36203.1"
FT                   /translation="MVTTHTEGPIGHLVIDVPGRSMNVLDPELAHALDEALTRLVDDEA
FT                   VRGIVISSGKSSFVAGADLARMSDFVKPGVSQADALGLIGLYNRLLRRIETCGKPVVAA
FT                   ASGTALGGGLELMLCAHYRIATDDPKARFGLPEVGLGLLPGAGGTQRLPRLIGIAASLP
FT                   LLTQGTSLDARAALKLGILNEVVPAGELIQAASRALLEGRVKAIAPWDEKGFRLPGGDA
FT                   YSRVNSDALMAANASLHAATKGNYPAPQAILRAVYEGTRLPIDKGLKLEQQLFVKLVQG
FT                   AVAQNMIRTLFFARQAADKLSRRPAGIAKQSVRRLGIVGAGFMGAGIAQVSAAAGIDVV
FT                   LLDRDLATAGRGRDSIAKALQAEVDKGRLREAVRDQILSRIEVAADHSAFGNCDLVIEA
FT                   VLEDFEVKASVTRATEAALPAHAIFASNTSALPINELASASARPQNFIGLHFFSPVSRM
FT                   ALVEVIVGSATSDETLARSLDYIQQIHKTPIVVRDGYGFYTTRCVEAYIREGVRLLADG
FT                   VNPVLIENAGTALGMPVGPLTLADEVGIDVLHHIVSLFRDREHGRWADDKHGAGNAILG
FT                   RLELAGRFGRKAGRGFFAYPPGEPRHLELGDLDLSVAADQPEVGQVKERLLYAQVLEAA
FT                   RCWTDGVIDDAREADLGAHLGWAFPSWLGGPLAFIDTVGITNFVQRSDELVARYGPRFE
FT                   VPGRLREAAAGGQRFHAVAA"
FT   gene            complement(306721..307929)
FT                   /locus_tag="Bxe_C0281"
FT   CDS_pept        complement(306721..307929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0281"
FT                   /product="Thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36204"
FT                   /db_xref="GOA:Q13I85"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I85"
FT                   /protein_id="ABE36204.1"
FT                   /translation="MSSPFIYDHVRTPRGRGKPDGALHEATSVHLAATVLSALRERTGL
FT                   DTRQVEDIVFGVVAPVGEQGQCLPRVAALQAGYAQEAAGVQINRFCGSGLEACNMAASK
FT                   VHAGAEGFVIGGGAESMSRVPMFSDGGAWSVDPVTAFASNFIPQGISADLLATMWNYSR
FT                   EEVDGFAVRSHRLAAQAWAEGRFDRSVVPVRGVLNEVLLAKDETVRPNCTPADLAGLKP
FT                   SFAELGRKGGFDALAIQRYPTVETIRHVHHAGNSSGIVDGACAVLIGSEAAGRAAGLTP
FT                   RARIRAFAEIGSEPTIMLTAPSFAAERALRRAGMSASDIDLYEINEAFAAVALRFIDAL
FT                   GLDDGKVNVNGGAIAMGHPLGATGAMILGTALDELERTGKGTALVTLCIGAGMGVATII
FT                   ERI"
FT   gene            complement(307999..309153)
FT                   /locus_tag="Bxe_C0282"
FT   CDS_pept        complement(307999..309153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0282"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36205"
FT                   /db_xref="GOA:Q13I84"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I84"
FT                   /protein_id="ABE36205.1"
FT                   /translation="MAGPLAGVKVVEMVGIGPGPFCAMMLADMGAEVIRVDQPRRGPLP
FT                   DPYSALNTRYDVQARNRRSIAVNLKRPEGVATVLSLIAHADALIEGFRPGVMERLGLGP
FT                   ETCVEQNPRLVYGRMTGWGQDGPLAQVAGHDINYIALTGVLAALGDPHHPPAPPLNLVG
FT                   DLGGGGMLLAFGLVCALLEARCSGKGQVVDAAMTDGSALLMSMFYGLRAAGQWQDQRGT
FT                   NLLDGGAPFYGSFACADGRHVAIGPLEPAFYKQLLDLCGVSDPALQVQMEPAQWPQLRA
FT                   TLAEVFRTRTRDDWCKLLEGTDACFAPVLQMEEAPRHPHNVARKTFIEVDGVIQPAPAP
FT                   RFSRTPSTMPTRPPSVGEHSREILRDWGLSADAVDALFNSGSVC"
FT   gene            complement(309171..309650)
FT                   /locus_tag="Bxe_C0283"
FT   CDS_pept        complement(309171..309650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36206"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I83"
FT                   /protein_id="ABE36206.1"
FT                   /translation="MADGLRQSVLPAVTGGAAQRQLKATLHALGRLQRSWDRWPAYLAE
FT                   DNADVRRTLESVLPDLQAAAPASAASLAAIARQLETQAPGPAVQVRGVNDPALAAACVL
FT                   NEALHAVLASLEEWLRTPDQGAPAAREHALQILGELYGRMAERELRAWAVQAEND"
FT   gene            complement(309679..310734)
FT                   /locus_tag="Bxe_C0284"
FT   CDS_pept        complement(309679..310734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0284"
FT                   /product="Putative aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36207"
FT                   /db_xref="GOA:Q13I82"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I82"
FT                   /protein_id="ABE36207.1"
FT                   /translation="MSDTSIGNTSVSPDSGLAARLAELIAQHLPNARDVSVQGIAPMFG
FT                   GNARKAWSLELVFQLDGLPQRRPCVMLIQGADRQIETDVAQEFRVLHGLNGKGTRAPAA
FT                   VAMDARGEIVGAPTIVLERLPGKASAVDFLNSPDPAAARRLTEDLASVVADLHAVDWTP
FT                   AAFDSALEGLSPREVALRQITHWHDTFLAQRLEPLPVMSGLFGWLYRHLPEPQRICLVH
FT                   GDLRPGNFLYEGDRVSGLLDWEMAHLGDPVEDLAWIYRPLWSPERFVPLREFVQRYAAL
FT                   ARREIAWSDVLYYRVFNELKFAVISLTAARAFITSSTPNMRHADRAATVPPCLNRCLAW
FT                   AEQHRKETSRV"
FT   gene            complement(310765..311898)
FT                   /locus_tag="Bxe_C0285"
FT   CDS_pept        complement(310765..311898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36208"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I81"
FT                   /protein_id="ABE36208.1"
FT                   /translation="MSPPSFNDAHFDEQFPLSAMDDFMVHQTPDPVRVVWSTDPRFFER
FT                   YWCVLHDNTGELMIALGGSFYPNLDRAEAYAIVTHRGKQRSVRAWRRLGADRTDLHTGP
FT                   LRHEIVRGMREWRFVLAGNEWDIAFDLQWLDTKRQIYSAAYASLGTRSAPQGRQRDVTA
FT                   GFEGFGMAGGEVRVAGQTLRFEAGELRGTRDRHWGIGRGVGGPALQIGGPKKAGWIGGN
FT                   WISFPHLSIWGNTVLYDYGDARPGVGKVRHVERRWRFEPETHIFLEGESDYTLDTGEIK
FT                   RVRFRRLANQTAYMRCGMYGGTPDKQIYHGMEVPDGTVEGDCYDLTDPQVRAFLSGLNE
FT                   HHCEIECDGQITTGILQPLEPDAYQACAEGKPGWSLL"
FT   gene            complement(312071..313663)
FT                   /locus_tag="Bxe_C0286"
FT   CDS_pept        complement(312071..313663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0286"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36209"
FT                   /db_xref="GOA:Q13I80"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I80"
FT                   /protein_id="ABE36209.1"
FT                   /translation="MSLRYEFDYLCSDVISHNARVFAHSIAVVCGEERLTWRELDIRTN
FT                   QVANAIRALGFDKGDKIALFMPNSLALFELFWGVVKAGCVVVCLNTMLEGSALARITNS
FT                   SDARAMFAGGSSRTLVDEVRDRLEGIAPEHFYSVDSPGDGWNSAQTLFDAAPSTPPQVT
FT                   ILPSDSMTIIYSSGTTGVPKGIEHTHFGRLNYPHGFAMGLAINRYSVAVCATPIYASGT
FT                   WITMFPTMYRGGTVVLLPQYSPEAFIDAVRRERGTHSFLVPTQYIGLLQQPLQNYDLGS
FT                   LKALVTAGQSLLPATYAALLRAFPHAGIYEVYGMTEGFSTLAIPEDVARGKTGSVGKPS
FT                   FLDDVRIIDEQGRELPPGETGEIVAYGPGMMKGYYNRPDMTEAATWISPAGRTYMRSGD
FT                   LGQMDEDGFLYVNGRLKDMIKSGGINIYAADLEQVVIEHPAVHEVAVIGVPHEKWSETP
FT                   VAVVLLKPGASAEPDVLMRWVNQRLSKYQRLSLLLIRDELPRAIYGKVQKQALREQVLA
FT                   LLGSGAAEKVEPQ"
FT   gene            314024..314836
FT                   /locus_tag="Bxe_C0287"
FT   CDS_pept        314024..314836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0287"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36210"
FT                   /db_xref="GOA:Q13I79"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I79"
FT                   /protein_id="ABE36210.1"
FT                   /translation="MSVQPVYPAYASLKLDWPLERVLRVTISRGSMNSMDYELHHDLGG
FT                   IWRLIDADPQVSVVVLTGEGRAFSAGGDFDMVERIVNDHSFRMQMWKDGRQLVENILAC
FT                   GKPIVSAINGAAAGGGLAAALLADISIAGRTVKLVDGHTTLGVAADDHAVAIWPLLVGM
FT                   AKAKYYLMTNEPLTGEEAERLGLVSLCVDNDKVVDKALEVAGRLAAGAPEAIRFTKHAL
FT                   NNWIRSAWPAFDASLAFGILGFTGPEAREGLAALREKRRPVFPQTTHV"
FT   gene            314872..315639
FT                   /locus_tag="Bxe_C0288"
FT   CDS_pept        314872..315639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0288"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.1.1.159"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36211"
FT                   /db_xref="GOA:Q13I78"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I78"
FT                   /protein_id="ABE36211.1"
FT                   /translation="MSQVSRSYIVTGGGGGIGGATVLRLLRTGANVLAIDISSRRLNGV
FT                   KEEAAALPGRMEVLKADITAEQPVEQAVKLALELFGDLHGVANVAGGMPDYTGTDMDRP
FT                   LESISLDYFHRMFALNVDSAFLMSKAATPHFRKKQYGKIVNVASLAAFANRPELGNAAY
FT                   NPAKKAVIGLAETLSLLLGPDGIRVNTIAPGLVMSDKAKGALGDEYTQRHLKQVPLGRL
FT                   ATTSDLAEGIAFFLEPASDGITGETLRVAAGVR"
FT   gene            315695..316645
FT                   /locus_tag="Bxe_C0289"
FT   CDS_pept        315695..316645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0289"
FT                   /product="Putative iron-sulfur oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36212"
FT                   /db_xref="GOA:Q13I77"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I77"
FT                   /protein_id="ABE36212.1"
FT                   /translation="MDKAQEINLVVRAITQEADGVIGLTLAAADGQDLPVWTPGAHIGL
FT                   LVDGGLERQYSLCSEPEDRRQWRIAVLREPESRGGSAWLHSRLQVGDILRATGPGNQFE
FT                   LVDADRYVFVAGGIGITPLLPMIRAVEARGAQWSLLYGGRHRSSMAFAAALEAYGERVR
FT                   IQPEDQCGLLDLKAALGAPQAGVAIYSCGPERLLEAVEATCVGWPEGALHVERFRPRPG
FT                   ALEGESGSFEVVLAKSNLSCQVREGQTIIDALDTAGFHVPRSCGEGTCGTCVAKVLEGV
FT                   PDHRDSFLMGKKRAANQTICVCCSRSLTPRLVLDL"
FT   gene            316707..317924
FT                   /locus_tag="Bxe_C0290"
FT   CDS_pept        316707..317924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0290"
FT                   /product="Putative cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36213"
FT                   /db_xref="GOA:Q13I76"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I76"
FT                   /protein_id="ABE36213.1"
FT                   /translation="MTFIYDPNDPDVRRDPHAVFRKLRETEPVHWSPKLSGWVVTSYEL
FT                   ASEVLTTNGTYSAERFTAVQQHLSEEKRVTAAEVMRWFQHWMVFRDPPDHTRLRRHMAN
FT                   TLNIPVFDARRETVISVVNELLDRIPVGDAFDFFQAFSLWMPGIVVADLLGVERDRLLE
FT                   VKQWSDDMMTFIGSARGVPDKYERARRGANGMGTYFLDLIAKRRAEPREDALSRLIASE
FT                   VEGQRLSDDELVGCMMMVLNGGHETTANLLNNSMLALAAHPQTVQHLRQHPDEMAAAVE
FT                   EFLRYDSPVLSIGRIVTEDTELGDQEIAAGDRVFAMLVGANRDPEVFSDPDELRTSRNP
FT                   NPHMAFGKGPHFCLGTPLARLEGQIALTAILERFSSIELCEPVESIPWLNSLVTHGPTR
FT                   LPLRLK"
FT   gene            318111..318728
FT                   /locus_tag="Bxe_C0291"
FT   CDS_pept        318111..318728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0291"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36214"
FT                   /db_xref="GOA:Q13I75"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I75"
FT                   /protein_id="ABE36214.1"
FT                   /translation="MTTPAIPDTTSTPRAQRVSARRRQLVELTMQLLKEKGFDLLSVNE
FT                   LAERASMSVGGLYRYIKTKSDLLEMICDETNKGLNEQMMERTSAVRGVKEKLRVGFEVY
FT                   WQGCWDAAEPILTAYREWQSLPEAAQHRYIEQEKRVAEYFSDLIRAGVASDEFRVVDAR
FT                   LLAAEMIFLAQMRAVKGWAFHGWDRVAVFAEHWELIESRLRK"
FT   gene            318801..320057
FT                   /locus_tag="Bxe_C0292"
FT   CDS_pept        318801..320057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0292"
FT                   /product="Putative transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36215"
FT                   /db_xref="GOA:Q13I74"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I74"
FT                   /protein_id="ABE36215.1"
FT                   /translation="MTEATVTKKSKNLKAPKLFPDELIDQLLAQVQGKDAESILGESGL
FT                   AGQLRKQLAERMLAAGLNHHLETESEQGKAGNHRNGTSPKTVLTPSGELKLDIPRERQA
FT                   TSGPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPGLISTITDEVL
FT                   ADVEEWQQRPLEAMYPIVYFDALRLKIRDEGTVRNKAVYLALGIRADGRKEVPGLWIEQ
FT                   TEGAKFWLKVFNELKNRGLHDILIAVVDGLRGFPEAIEAVYPAAQIQTCIVHLIRNSLN
FT                   LAGWKDRQPLAAALDAFAQGEWGRKFPTVAAMWQRQWEQVIPFFAYPPEMRRIVYTTNA
FT                   IESMHMQWRKIVKNRGHFPSDEAASKLLYLAFAQHRKGLEDAACHLAASSQPVRHPVRR
FT                   TIHLRHQLRFLTGLSTQDF"
FT   gene            complement(320623..321315)
FT                   /locus_tag="Bxe_C0293"
FT   CDS_pept        complement(320623..321315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0293"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36216"
FT                   /db_xref="GOA:Q13I73"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I73"
FT                   /protein_id="ABE36216.1"
FT                   /translation="MDARAHLPLKKTMSDLAKEGVASRRIANELRSAILNGLISPGTRI
FT                   FQEEIAERFGASRLPVREALRILESEGLILLKSNSGAWVAKLDLAECVEIYKIRERLEP
FT                   LALRESIPKLADAEIASIERVCEETEKASHIDNFLALDRQFHLLTYQRCQMALLGAMVE
FT                   RFWNTTQQYRRAYWNLLGIDERNWAIYEHRLIVDAIKRRDPDDGERVLLSHIRRARLAL
FT                   EGSPKLFD"
FT   gene            321786..323558
FT                   /locus_tag="Bxe_C0294"
FT   CDS_pept        321786..323558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0294"
FT                   /product="Putative pyruvate decarboxylase"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36217"
FT                   /db_xref="GOA:Q13I72"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I72"
FT                   /protein_id="ABE36217.1"
FT                   /translation="MGCRGLHRENVKRSELVKTVQVGRAIVNALRAEGVDALFGMPGGH
FT                   VIQIYDALYDTPEIRHYLVRHEGTAASMAAGYAQLTGRPAVCVVTAGPGATNVLTAVAE
FT                   AHVASLPMVIIAGRGATTTSYRGASQEVPTEKVFAPVTKWSVRIDFADDAIPIVRRAFA
FT                   LARSGRPGPVYIDIPRDILALDCNVPDTYEPVSTLARPNASECILDKAFEALRAARRPI
FT                   IIAGGGAVASNAFEAVRELAEALAIPVLTSLAGRGIISDEHPLSAGGLGTNRNDLSKQL
FT                   LRDADVVLGLGTRFEEMETNWRVGFVPAEQACYIQVDIDPGEIGRSVPASIGIAGDIKA
FT                   VVSSLLTRIKDAGVGLKAGAYATHPRTLDCVKTIQRIEREIDEVASSVESPIHPFRVIR
FT                   AARAVFPRDTTVAIDVGCLSQHMVGAHPIFRVFEPRSLIVPSSFYGMGFATNALPAASI
FT                   VYPDRPALGFSGDGSFQMVLPVLPVAAQYKLAVTWVVLNDQALGSIRDIQKYVYKSRFV
FT                   DTDFEFQPDFATIAKGCGCYGERIEKADDVEAALKRALAANRAGIPAVLDFSVFSARTQ
FT                   GTLDHYVAYGLARD"
FT   gene            323595..324155
FT                   /locus_tag="Bxe_C0295"
FT   CDS_pept        323595..324155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0295"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36218"
FT                   /db_xref="GOA:Q13I71"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I71"
FT                   /protein_id="ABE36218.1"
FT                   /translation="MSLRNAQTLLYGQPVNGITQVGYVVENIDEAMRSFTTQLGVGPWF
FT                   LSGPFETTGAEYRRKPTNIRLKLAVAFSGHMQVEVIQQLDDQPSVYRELIERSGYGFHH
FT                   FALATKDIDAEIARLQEGGAAIAFKARSPRGPRVTYMDGVNGLPGMIELIEMTPRQEEL
FT                   YVLMYAAALAWDGSDLVRPAERA"
FT   gene            324293..325045
FT                   /locus_tag="Bxe_C0296"
FT   CDS_pept        324293..325045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0296"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36219"
FT                   /db_xref="GOA:Q13I70"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I70"
FT                   /protein_id="ABE36219.1"
FT                   /translation="MNILDLKTRSAVVTGAAGAIGKAIAKRLLDSGAAVCLWDINEEAV
FT                   KQSCAELTESGPVEWAVVDICDPLAVSVGLARVIENVGRIDILVNNAGVSGAQVPLEEY
FT                   DLSEWRRVIESNLTGAFVCSQAVIGAMRAGGYGRIVNVASVAGKEGSPRLSAYSAAKAG
FT                   MIAMTKSLGKELAMSPVLVNCVTPGPTRSRMTAETPKEQLALMLSKAPMQRMMEPHEVA
FT                   AMVAWLCTEECSYTTGAVHDLSGGRSSY"
FT   gene            325054..325824
FT                   /locus_tag="Bxe_C0297"
FT   CDS_pept        325054..325824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0297"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36220"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I69"
FT                   /protein_id="ABE36220.1"
FT                   /translation="MNELTDTLIAITGGGSGLGEACAELLAPRVAELALIDRDPDSLAS
FT                   VRARLSGLCEISVHACDIANSDDVSTTFNRIERESRVVSTLINCAGMNVKDRHFGELTP
FT                   DGWNQVIAVNLSGMYYCCQAVLSGMRRQQRGTIINVSSWAGRHAGFFTGPAYNASKRGV
FT                   LALTESINLEEGINNVRATAVVPEAMATPMIRKIPNPPSEEAIAKMMRPLDVARMIDLI
FT                   ISLPQEMCVNEVVMSPTWNLSYLGAYETAIDRMV"
FT   gene            326011..327357
FT                   /locus_tag="Bxe_C0298"
FT   CDS_pept        326011..327357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0298"
FT                   /product="major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36221"
FT                   /db_xref="GOA:Q13I68"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I68"
FT                   /protein_id="ABE36221.1"
FT                   /translation="MAKESTALTVEGTSGAMNDSALLMKTLRAKSMVAAGVGNTLEWFD
FT                   WTMYATFSPYIAGAFFAKSDPRSMLLSALAVFAVGFLSRPLGGIVFGVLTDKLGRKGTL
FT                   VTTVLIMSAASLTIGLMPTYASIGAWSSLLLLIVRLLQGFAHGGEMTASYAYLAEIAPA
FT                   PRRAFWSSSMYVCAGLGGLIATILATVLTNYLTKDVMQAWGWRVPFIVGAVLSIAIIFM
FT                   RRGMMESDVYEKDREESRGTKSIEVRNRWSRRKIIARTCGMFIYEASATLPYYVWTSYP
FT                   AVFAITYRGMAPGSAFAASLGAQIINIICTPVAGWISDHVGRKPLTIFYYLANAIFIFP
FT                   LLGFINDDPWRLFAAQSCMLAVSACIGGTQSAIASEQIPTAYRARVLGTAFPIATAMFG
FT                   GTTPYLTSLFYGRGQGWIFNMYLIVVCLIGAIVVARWKETKGIDLHRVE"
FT   gene            327609..328784
FT                   /locus_tag="Bxe_C0299"
FT   CDS_pept        327609..328784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0299"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36222"
FT                   /db_xref="GOA:Q13I67"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I67"
FT                   /protein_id="ABE36222.1"
FT                   /translation="MRSYTKWLIQLCGATAIISSSAHAQSSVTLYGIIDEGIMYLSNSG
FT                   GSSRTYLDSVNGIDSSRWGLKGSEDLGSGFRAIFQIESGINLNSGAFAQGGTPFGRQAY
FT                   VGLSSAQYGSLTLGRQYDMIFYFPASISPVAIGSVIFGHPGDLDNTAHSLRVNNAVRYM
FT                   SPNFGPFTFGGEYSVGGIVGNTTSNSGYSLGAEFANGPLTIAAAFEYFKNPTSATAGSG
FT                   FFTGNSNGISPLALSLNSAYTSATAYQVFTVAGNYVIGPFTLMASGSQTEYANLGGGFA
FT                   GAAARFRDVDVGVQYKATPSLFFALAYNYLAGAGVRTAAGSTVGNQHYHQLGAMADYII
FT                   SKRTDIYFDAGWQLAKGTSSLGTVAVADISNQGDSSNNHQFLFRLTLRQKF"
FT   gene            328990..330450
FT                   /locus_tag="Bxe_C0300"
FT   CDS_pept        328990..330450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0300"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36223"
FT                   /db_xref="GOA:Q13I66"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I66"
FT                   /protein_id="ABE36223.1"
FT                   /translation="MRYSIKLNDQALLRQHAYINGEWQTADNGSTFTITDPSSGDLLAQ
FT                   VPMMGAAEARRAIHAACIAWSVWRKKTAKDRAIVMRRWFNLVLENADDLATILTAEQGK
FT                   PLAEAKGEIAYAASFIEWFAEEGKRVSGDTPATPDADKRIIVTKEPIGVCAAITPWNFP
FT                   AAMITRKVAPALAAGCTIVVKPAEATPLTALALAVLAERAGIPSGVLNVITGDPRAIGA
FT                   ELTANPGVRKLSFTGSTAIGRMLMAQSAPTIKKVTLELGGNAPFIVFDDADIDNAVEGA
FT                   VVSKYRNSGQTCVCPNRFYVHDAVYDAFVEKLSKAVFELKVGSGRDPGVSIGPLISEAA
FT                   VKKVEAHIADALQKGAKLEVGGARHELGHSFFQPTVLSDVTPDMMLSREETFGPLAAVS
FT                   RFSSEDEVVRLANDTEYGLAAYFYSRNIARVWRLAEALEYGMVGINTGLISNEVAPFGG
FT                   VKESGIGREGSRYGIEDYLVIKYLCLAS"
FT   gene            330435..330758
FT                   /locus_tag="Bxe_C0301"
FT   CDS_pept        330435..330758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36224"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I65"
FT                   /protein_id="ABE36224.1"
FT                   /translation="MSRKLIYGVFTFFQPWGDLMRWMDEALDIQHVKNWAILNPSIEDG
FT                   SESCVQQLDAFCRSAQGFRRFPALEQFPLVARGLPARVILNPGTQLAGVRRHGDRVSSL
FT                   RIN"
FT   gene            330771..332243
FT                   /locus_tag="Bxe_C0302"
FT   CDS_pept        330771..332243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0302"
FT                   /product="benzaldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.28"
FT                   /note="Citation: Biochem. J. 330 (Pt 3), 1375-1381 (1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36225"
FT                   /db_xref="GOA:Q13I64"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I64"
FT                   /protein_id="ABE36225.1"
FT                   /translation="MNVTPSSRLLGDDVWHGRIFTGSWCNGASEAEVKEPASGKRLARI
FT                   GMADGALVAASAKTAFEAQQEWAALPYDERAAVLRRAARLAEESVEEIVGWIVRESGST
FT                   RAKAAFETQVTVKALHEASALPSRSAGEVLPSGPGRLSLARRRPLGVVGVISPFNFPLY
FT                   LAMRAVAPALSLGNAVVLKPDPRTAVCGGFVIARLFEMAGLPNGVLHVLPGDGAAGAGL
FT                   TSDPHVAMIQFTGSTNAGRKVGEAAGRHLKKVSLELGGKNSLIVLDDADLDRAVANTAW
FT                   GAYLHQGQICMATGRVLVQRAIYERFVEKLVAKASSLTVGDPATDDVALGPLINGTQRD
FT                   HVTRVLDAAQQAGARVEAGGSFRDLFFEPTVLTGVTKENPAFSEEIFGPVAVVVPFDTD
FT                   EEAIALANDTEYGLAIAIVTSNVGRALRMGERLRSGLLHINDQTVNDEVINPFGGVGAS
FT                   GNGTSVGGPANWEEFTQWQWLTVKGEAPLYPL"
FT   gene            complement(332330..332698)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0303"
FT   gene            complement(332720..333805)
FT                   /locus_tag="Bxe_C0304"
FT   CDS_pept        complement(332720..333805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0304"
FT                   /product="Putative flavoprotein monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36226"
FT                   /db_xref="GOA:Q13I63"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I63"
FT                   /protein_id="ABE36226.1"
FT                   /translation="MSAAILLSRQGIQVDLVELNPLWAPGGAGITISGPTLRGLREVGV
FT                   ADEVLASGGFWNAVDVCDANSNLTVTVPIAPAVGADELPGVAGIMRTTLAEILGRATRK
FT                   ADTNARLGVTFETLTQDAEGVEVSFNDGSRARYDLVIGADGINSPVRKYVKPEFPGPPF
FT                   TGQRSWRAVVPRLQENSLMYMGKTTKAGLNPISQTECYLFVLDKREGMDFIAPEQWPMM
FT                   LAELLEEFGGAVGEFRRGPLDGSLMNHRLLYRPLAGHMINGPWHKGRIVLLGDAVHATT
FT                   PHLASRAGIAVEGAIVLSEELARRRSLEGAFIAYAGRHYDRARLVVSASGRLGEIERES
FT                   GSREEHTRIMIETQQALRAPI"
FT   gene            complement(333837..334439)
FT                   /locus_tag="Bxe_C0305"
FT   CDS_pept        complement(333837..334439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36227"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I62"
FT                   /protein_id="ABE36227.1"
FT                   /translation="MGMLSSSCASVNVGVNYRAPSAKPENGLTRSDSRPKSLSVPGCSV
FT                   YSTVRICAAISLSTVSEVGNRFATRRGNLAGRSPGVRNTGPLPITRRHTRQTNQRRAAD
FT                   TADRRSVATIVAGLLCSPLPETKLALIDVNRPGAVQYSNPMTFAASWWTSMFCASCASA
FT                   CHGRTLGIVGLGGAGRHVARYGMAFGIVYADRKFSHK"
FT   gene            334745..335404
FT                   /locus_tag="Bxe_C0306"
FT   CDS_pept        334745..335404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0306"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36228"
FT                   /db_xref="GOA:Q13I61"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I61"
FT                   /protein_id="ABE36228.1"
FT                   /translation="MEEGSNISRRRRTALTEGSADYKLKRDEIVQAAVKLFKEKGYKST
FT                   TLSDIAKRAGLDRATVYYYVGSKEELFHEAVKGILDENVIEAERLLRVTTMGPREKLER
FT                   LIERLMTSYEENYPHVYVYIQEEMFEVEGERTPWAKQMVRQTRRFESAVSTLLDQGVTQ
FT                   GIFRDDIPVRLAANAIFGMFNWTHRWFKPGGKQTARHVASAFCKIFFDGMQDAKQP"
FT   gene            complement(335596..336612)
FT                   /locus_tag="Bxe_C0307"
FT   CDS_pept        complement(335596..336612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0307"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36229"
FT                   /db_xref="GOA:Q13I60"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I60"
FT                   /protein_id="ABE36229.1"
FT                   /translation="MKTAARSQDVADLAKVSQSAVSRTFTPGASVSEETRRKVLAAAKK
FT                   LGYRPNALARSLITRRSHIVALVMSYLENQFYPLALEKMSQKFQKEGYHVLMFIAEMDE
FT                   DADAILAEILEYQVDGIVMASANLSPRLARTCADLGVPVVQFNRVSDPRRRSQNTLSSI
FT                   TSDNYSGGQMAANLLVDRGYRRIAFLAGLDNSSTSLERERGFTDALAARNVPLARREAG
FT                   HYDFKLASEATRRLFTAGRAPDALFVANDHMAIAALDVLRSELGLHSPGHVGVIGFDDV
FT                   PQAAWGAYQLTTVRQDLEQMIGSTVALVCEQVTGEVRPTNIVIPCALIERATVRSAD"
FT   gene            complement(336609..337376)
FT                   /locus_tag="Bxe_C0308"
FT   CDS_pept        complement(336609..337376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0308"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36230"
FT                   /db_xref="GOA:Q13I59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I59"
FT                   /protein_id="ABE36230.1"
FT                   /translation="MIVPSAGPDFGLASRRALVTGGSSGIGLAAAAALGRAGAHVTVAA
FT                   RRRAELEVACEALRATGVACEALVLDVTDSASVDREVNSRVPFDILVNSAGMNRPKPLT
FT                   DLTDDDIDAVLRLNVKAAFYLARAVSRRLVDANLGGSIINISSQMGHVGSARRSLYCAS
FT                   KHAVEGMTKALAWELGAARIRVNSLCPTFIETPMTAPMFVQPGFREWVCERIALGRVGE
FT                   MHEIMGPVVFLASDASSLMTGSALMLDGGWTAA"
FT   gene            complement(337373..338704)
FT                   /locus_tag="Bxe_C0309"
FT   CDS_pept        complement(337373..338704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0309"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36231"
FT                   /db_xref="GOA:Q13I58"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I58"
FT                   /protein_id="ABE36231.1"
FT                   /translation="MTNTMVKYIKRGRTAAGKSDSDAKVRAIVESIIQHIEEKGDEAVR
FT                   EYSRKFDNWDPGDFRLSRPEIETARKQLSAREIEDIAFAQTQVRNFARIQRDSMRDVET
FT                   ETLPGVVLGHKHIPMNAVGCYIPGGKYPLLASAHMSVLTAKVAGVARVVSTAPPYQGKP
FT                   HPAIVTAMDMAGADEILVLGGIQAVVAMAVGTPTVAPVDMLVGPGNMFVAEAKRQLYGR
FT                   VGIDLFAGPTETLVIADESVDGELCAVDLLGQAEHGATSPSILLTNSEKLARDTLAEIE
FT                   RQLKILPTASIAAQSWADCGEVIVCDTYEEMLQVADDIASEHVQVMTEDPDFFLNNMTN
FT                   YGALFLGPRTNVSFGDKVIGTNHTLPTNRSARYTGGLWVGKFLKTCTYQRVTTNEASAI
FT                   IGEYCSRLCHMENFAGHGEQANIRVRRYGNRPDLPWYRPVEAQS"
FT   gene            complement(339051..339413)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0310"
FT   gene            complement(339563..340129)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0311"
FT   gene            complement(340119..340373)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0312"
FT   gene            complement(340370..340618)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0313"
FT   gene            complement(340651..341004)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0314"
FT   gene            complement(340923..341396)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0315"
FT   gene            complement(341933..343903)
FT                   /locus_tag="Bxe_C0316"
FT   CDS_pept        complement(341933..343903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0316"
FT                   /product="Cyclohexanone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36232"
FT                   /db_xref="GOA:Q13I57"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I57"
FT                   /protein_id="ABE36232.1"
FT                   /translation="MHNNGLQSATGSAGSASGATPFHQGAMTLEEIKDAVAIANVPALL
FT                   MVLHQFTGDDRWLETPYLPTRGKGLLDHDSGGLPEEIQLQIRHSAIDVIWKLQSGIAPK
FT                   IVAPSPEKLIRMMSVYMGEEVDAIYGQMLSSEFARRVGAPVPGEDNTHVEPPEGFNVIV
FT                   IGTGVAGVAAAERLEAMGVSYVILEKQKAAGGNWWQNTYPGCGVDTPSHLYSFSFAQVD
FT                   WKKHFALRDDVQSYIAGSLRKVGAENRVRFDTEAVAAIYDEEKKIWQVHVKNQAGVSET
FT                   LTANVVLSAVGVLNRPTLPKVAGLEKFQGTMFHSAEWNNAIDLKGKRVAVVGTGASSMQ
FT                   IVSAIGDRVGHLTVFQRSPQWVAPFDKFGLAILDPLRMLIQSCPLYRTWYWLRLFWQFG
FT                   DKVIEALRKDPLWPHPERSVNARNDAHRDYFTRYLKEELDGRPDLFDKCLPTYPPFGKR
FT                   ILLDNGWFRTLRRDNVTLVTEAVTEVREHSLVSASGDEYAADVVIWATGFDVARFVSSM
FT                   DVRGIGGVSLRTAWNDDDPRAYLGISVPGFPNFLMLGGPHSFPGSGSFMFFMEVQMRYI
FT                   SRLLKQMFKKGIVAVDAREDANNRYNELVDELHAKTVWTHPGMSTYYKNSKGRVVFVMP
FT                   FLNVEYWEMVKNVNLEDYTVR"
FT   gene            complement(344115..344786)
FT                   /locus_tag="Bxe_C0317"
FT   CDS_pept        complement(344115..344786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36233"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I56"
FT                   /protein_id="ABE36233.1"
FT                   /translation="MIPDSTLSIHEISAFVDAGIPPDTPPGEHLDPLTVEFIEYALRSS
FT                   VTTLDTQDAEQHAQRALSLGATTAQLHEILLLVSALGVHSLMAGSTKLARLGSPAGKPM
FT                   TLAPLTNEQQALHQKYVGESSYWRRFEEAIPGFLDSLLRFSPEGFEAFFNFCALPWHKA
FT                   TVPALTKELISIAVDATPSHRFLPGVRIHVGNALTLGCGRTALREVLAIAARAPVHSGV
FT                   R"
FT   gene            complement(344783..346450)
FT                   /locus_tag="Bxe_C0318"
FT   CDS_pept        complement(344783..346450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0318"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36234"
FT                   /db_xref="GOA:Q13I55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I55"
FT                   /protein_id="ABE36234.1"
FT                   /translation="MSAHVWTEVTPIGDLLVRAASRHPDRDAVVFPDDRYTYAEVLRRA
FT                   MLVARGLLSLGVRPRDHVGILCTNGIEFIEGLFGVALAGAVAAPINARYKVNELKYIAS
FT                   NADLVAILTTGDADAYVDFPDVFVQAFPELSSSEALGLDLESAPRLRNVILLSGSERPG
FT                   FISRERLLELAARVSEEDVHVARSRVRLRDIGLLLYTSGTTANPKGCLLSHEAVTRGPV
FT                   ERATIRFGLKVADVTWGAGPLFHIGSLSPFLGSIGAAGTYVTDAFFDAGRALDLLIREK
FT                   PTVMFPWFPAIMQALMNHEKWDPAKLSSVRSILLIGPRPLLDKVQAALPQVELVASCGM
FT                   TETAGIYAVSDVSETVEQRATGHGRPCSGIEARIVSLSDGSEVTDSTPGEILLRGYCVM
FT                   EGYYRDPANTRKALDAEGWLHTGDLYSRTPDGRLMFHDRIKDMLKVGGENVAPAEIETF
FT                   LCTHPSVVMASVVGIADARLDEVPVAFVELAAGNTLEAEFLISFCRGQLASFKIPRRIH
FT                   FVDTGTWPMSTTKIDKRQLRERAAKMHVEHISSERGLT"
FT   gene            346492..346770
FT                   /locus_tag="Bxe_C0319"
FT   CDS_pept        346492..346770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36235"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I54"
FT                   /protein_id="ABE36235.1"
FT                   /translation="MRVLQGAMRRTEIDIDDFEALHDLMSLAQGDNPAEAGLSDQRSDD
FT                   RALFAGHADDRSAGPRSPRREVRTLRCSGRPVTITDDGRHRINTPVR"
FT   gene            complement(346771..347061)
FT                   /locus_tag="Bxe_C0320"
FT   CDS_pept        complement(346771..347061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36236"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I53"
FT                   /protein_id="ABE36236.1"
FT                   /translation="MNDSFQLPLDKQGIYEVLSRNGQDALLCVGTHTQCSQTRWTLAIP
FT                   TTYRDVMASGVSTNGPSCSTRIGSGRGRLTRPCHPMASHAALSAPVIQSIR"
FT   gene            347433..348296
FT                   /locus_tag="Bxe_C0321"
FT   CDS_pept        347433..348296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0321"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36237"
FT                   /db_xref="GOA:Q13I52"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I52"
FT                   /protein_id="ABE36237.1"
FT                   /translation="MQSDSNPQYQHIRLEHKGPLTWLILNRPDKANALSNELLDEFSDA
FT                   LRWLTNNGGPVIAIRGEGRGFSSGYDLGQVGKLSSSADPVADRERLRRNVERYLAIWDH
FT                   PKPIIAAVHGYCVAGATQMCVFTDMTIVAEDASIGEPTIPIGGGYIAPLWVPLVGPKRA
FT                   KELAFVPGNSIDGRTAVEWGWANHAVPAGQLIQSVEDLAERIAKIAPAVLRIKKLSINR
FT                   AAESMGFRDAASAVSEMDALLHMTPAVVQLKQWISEVGLKEAIAHYRVPRTTPLTVTPS
FT                   ADSKEQ"
FT   gene            348300..349070
FT                   /locus_tag="Bxe_C0322"
FT   CDS_pept        348300..349070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0322"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36238"
FT                   /db_xref="GOA:Q13I51"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I51"
FT                   /protein_id="ABE36238.1"
FT                   /translation="MESIGFSREGHIAHVRLNRPKSLNAINEEMDRGLYEAWNEINNDP
FT                   DIWVAVLSAEGERAFCVGADVSGGAERPSRMALGGGLTGVGGPLVTLRKPLVAAVQGYA
FT                   LGGGFELAMCADVIVAATTAVFSMPETKVGIIGESGIMHRAIRQLPYRVAMAMILTGDR
FT                   LPARDALAYGLVNEVVEPQVLAEAALRWAEKIAAASPLAVQAAKSAVLQRLDWPLEVAL
FT                   STRFEPIEQYATSEDRVEGRKAFAEKRAPIWRGR"
FT   gene            350021..351622
FT                   /locus_tag="Bxe_C0323"
FT   CDS_pept        350021..351622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0323"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36239"
FT                   /db_xref="GOA:Q13I50"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I50"
FT                   /protein_id="ABE36239.1"
FT                   /translation="MSLSTADNGATRLNDSSDVMGSRTLWDLVQHCATLRPSSHAVRYL
FT                   KDQERPEDMQVFTWDELASLVWEMRCRLAHIGVRDQRTVVLALPGSPLTIVLWLAIASN
FT                   GAVVQAVDPDAGVLPLCAAIRATQPVLVIANPGNAEVLSKALVQSAVSATMIVVKDLSL
FT                   ASPMSGIDGLRSAGPQTPPSAFAESVAGMLQTSGTSGAPKLVELTHANYIASGERLARN
FT                   SGHRASDCFYLCSPFSHTNAQLYCCMPAIVTGGTIAVVERFSASLYFDSARQMGATVSS
FT                   MVAPPMRMALHKALERGSPVDAGSLRLIQYGMNMSDADWRAWDRLFPQIEMRQVYGQTE
FT                   SVSAVLGGAPWEIDDRRTIGRPFLGVDAVRLVGENGEPVKPGEQGELWVRGERGRTLMR
FT                   GYYQNEAATAEAIDADGWLHTGDYMTQDANGRFAFVGRRMHIIRRGGENLSVYELELMM
FT                   QSCPLIEEVAISAEKDALLDATLVVHVIPASGFSEQAFEQWCRDAIGRRGVPDSIRVHQ
FT                   AFPRTISGRVIIRELK"
FT   gene            351672..353417
FT                   /locus_tag="Bxe_C0324"
FT   CDS_pept        351672..353417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0324"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36240"
FT                   /db_xref="GOA:Q13I49"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I49"
FT                   /protein_id="ABE36240.1"
FT                   /translation="MGFGHDRWVRCRAKTFRRFSIALISAFSRRTTSWQVDLRVISRFA
FT                   PFEGVTLTSYSDLILRWRHSAKVLLTCDDTVLTYSECVMRGDELARAFLGLGLERPARV
FT                   ALVLPNSAEFVISLYACARIGITAVPISTWSKPSELRRILRDARVDLVLARDAFPGHAI
FT                   AESLQAACADDPSLDALQVYEWSRGQGAASPVSELLSHGSRCDDRRWSIESGTSAHTDA
FT                   DLVVLYTSGSTGAPKGVILPQSSVALNGVAIAGRMGFGGNDRIFSYFPLFFSGGLCNAL
FT                   TGAISCGAELVTQSRFDPAGALSLIRSRRCTGRNVWHDGLEPVAAVEGFRPGDFSRMRR
FT                   GLHVDPELYRRLSLAVDEGINMYGMTETATAFTCGDWREPADVRQSTHGKPFDGSDLRI
FT                   CNPDETSPLGVGVEGEICVRGYNLMRGYTDGSHVERIDDDGFFHTGDIGFVDPAGYLHF
FT                   VGRRKTLIKVKGLTVQPEEVEATLLRHPAISKAVVVGEGGGHESKGVVALIVLHEGDRW
FT                   DMQALRTYCQEELSSYKVPRLLVVDANRFPLSASLKIDRIGAATLLKQIAAEVGCGDAD
FT                   STEQN"
FT   gene            353496..356597
FT                   /locus_tag="Bxe_C0325"
FT   CDS_pept        353496..356597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0325"
FT                   /product="Putative carbamoyl-phosphate
FT                   synthase/carboxyltransferase"
FT                   /EC_number="6.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36241"
FT                   /db_xref="GOA:Q13I48"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I48"
FT                   /protein_id="ABE36241.1"
FT                   /translation="MSRVLIANRGEVAVRIVRAAKSVGLQTVGIHTPEEANALHVRDSD
FT                   IAVALAGVGTAAYLDIASIIAAAVRTNCSFIHPGYGFLSESAAFARACEQAGVTFIGPS
FT                   PDTLDVFGDKASTRELAIRLDVPVLPATAGLADDASALSFMQSLAAPVIVKAVAGGGGR
FT                   GMRIVTDPTDLPAALSRCRSEAERGFGRDDVYVERYLPRSRHIEVQVIGDGSSVVHLGT
FT                   RDCSLQSRHQKVIEIAPAPWLPVEIEEALLEHALQLARAVQYRGAGTMEFLIDVDNPSH
FT                   YYFIEGNPRLQVEHGITELVTGLDIVALQFAIARGRSLADEGITQDNVVTSGVAVEARV
FT                   TLTTPGTIARFVSPGKGRVDSGAYDGLAVGSGFDPLLAKVMVHEPDYPRCICALADSLG
FT                   ELVVEGPATNRDGLLSLLADPRVRAGDITTTLIDDLPAASATALVSKVAGSVIAVLARP
FT                   GEPLRRGQPIVVVEAMKMEHEVVAPAAGRLEEMLVAVGQQITTGQRVASMGYSGAEAEH
FT                   DAAPGEPAARADLAENLRRHSITLDEARPEAVASRHARHKRTARENVADLVDPGSFVEY
FT                   GALVIAAQRRRRTVEDLELNTPADGLVAGFGTVNGQQIAVLAYDYSVLAGTQGVQSHKK
FT                   AERLFELARRRHAPVVIFAEGGGGRPGDIDNAAKATGMDLGTFVALGRLNGRVPTVAIA
FT                   SGRCFAGNAALVGACDLVIATADANIGMGGPAMIEGGGLGRVESRDIGPAARQFENGVV
FT                   DVLVADEAEATASAKKYLSYFHAAKRNWTAGEQQHLRTIVPEARSRPFDVLRVIQVLSD
FT                   DDAVLELRAGFGRGIITCLVRIEGVAIGIVANNGLHLGGAIDSDSADKMARFLALCDTY
FT                   SLPIVSLCDTPGFMVGPASEETAAVRHFGRLLVAGPNLSVPLCTVVIRKAWGLGGQAMA
FT                   GGGFRVPDAIVAWPTAEFGAMGPEGAVRLGFRRELEAIADPVARDAEFDRLVKDYVRDG
FT                   RGYNAASAFEIDDVIDPADTRRWILATVNRAEPIPPTRRHLDTW"
FT   gene            356628..357200
FT                   /locus_tag="Bxe_C0326"
FT   CDS_pept        356628..357200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36242"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I47"
FT                   /protein_id="ABE36242.1"
FT                   /translation="MLTKSHVKGTLDTSIYTTLRHAMIVNSDNLISNVQKLVDRADIER
FT                   VLYEYAFHLDAADPEQMLPLFTADLHVAYGPNHGAVGAEAYLETLSNDKSGIASFFAAT
FT                   SHHVSNVVIDFTGADTATVRSVLYAYHKYNRERPDGIVMGQYHDEFVRTPEGWKIKRRE
FT                   LKHAGTENYHAKGAALNPIPRKSIQKA"
FT   gene            complement(357395..357709)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0327"
FT   gene            complement(358125..359267)
FT                   /locus_tag="Bxe_C0328"
FT   CDS_pept        complement(358125..359267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0328"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36243"
FT                   /db_xref="GOA:Q13I46"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I46"
FT                   /protein_id="ABE36243.1"
FT                   /translation="MKKAMLALGVASAMSSAAHAQASVTLYGLIDTGIDYVNNSGGGKL
FT                   FQMQDGGYTGLAGSRWGLLGTEDLGGGYKAIFRLENGFNEINGKLGAGGGEFGRQAYVG
FT                   FASDRFGTLTMGRQYDAVVDDFGPLTFTHYYGGIFYHAGDIDNGGNSFRVNNSVKYTSP
FT                   NLHGFSFTGLYAFTNSNEPSVGTTGMWSVGANYTNSTLYLGAAYFFAKNPAVLLPGGDF
FT                   LPNTTESAIGATGSFSYVGNPSNAQVFGFGVNYLISSTTIGLNFSQAKFDNANGTTSSV
FT                   IFNNYEAWVSVAITPAFSAGARYTFSDGKVNYSGQSPRYHQVGVGAKYSLSKTTTIYAA
FT                   ADFEKAAGDAKVADIAEGIVGTASTTDKQLVTRIGIMHRF"
FT   gene            complement(359391..360719)
FT                   /locus_tag="Bxe_C0329"
FT   CDS_pept        complement(359391..360719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0329"
FT                   /product="major facilitator superfamily (MFS)metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36244"
FT                   /db_xref="GOA:Q13I45"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I45"
FT                   /protein_id="ABE36244.1"
FT                   /translation="MAETMTLKQESPMRVIDIRASRHALIGGSLGNLLEWYEFAIYAYM
FT                   VPIVAPLFFHNSDPAANLLATFSIFALGFFLRPVGALVFGRLTDRVGRRPILILIISLM
FT                   TVATTCIGLLPTYSQIGIWAPILLTVLRIAQGLSSGGEMGGAVSLMVESAPEGKRGLYG
FT                   SWSFLGTTLGYVVGGGMATLLATVFSDQILHAWGWRLGFLLAAPLGLVILYLRLNIDET
FT                   PNFKKVSTTLEKSNPDEVIATPAVPGRPLVHLLATLGIVVVWNATGNTFMVGMPSFLSH
FT                   IYGMSFRSSYFLALVTGLIGALTMPFFGALSDRVGRKQVLLAGTAGVFFLSYPLYALLG
FT                   AGFGLSLLSLAIAGVLIGVLGGPMPALLSERFRTRNRATGVSVIYAVSVAVFGGTAPFI
FT                   ITFLARVTGDPLAAAYYTIGCAAISLIALAFVKGKPHLDVLAN"
FT   gene            complement(361551..362333)
FT                   /locus_tag="Bxe_C0330"
FT   CDS_pept        complement(361551..362333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0330"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36245"
FT                   /db_xref="GOA:Q13I44"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I44"
FT                   /protein_id="ABE36245.1"
FT                   /translation="MSDSPLVLQREGSIVTVVFNRPEQINALDLATAVAFEAACRSIAD
FT                   DPSTRVVVIRGEGRSFGVGGDLQGFRSGDAPSHASRLIEPLHRGLKLLAALDAPTIASL
FT                   HGNVAGGSMSLALNCDLAIAADNVRFNLAYTNVATNCDLGGSWALPRLVGLRRALQIAL
FT                   IGEPIGAQEALMIGLVNRVVESSELEAATRALARHLAQGPTLAYGRMKQLLRGSFEHSF
FT                   AQQLDLEQESFEASAGTRDFAEAIHAFFQRRSPSFNGT"
FT   gene            complement(362465..363274)
FT                   /locus_tag="Bxe_C0331"
FT   CDS_pept        complement(362465..363274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0331"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36246"
FT                   /db_xref="GOA:Q13I43"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I43"
FT                   /protein_id="ABE36246.1"
FT                   /translation="MGNGIAQVCAIAGLPVSMIDVSETAIERGLRAIDTSLDALVRKER
FT                   LSEVEKQAALARVSGTVDYDALAGADLVIEAATENLPLKLRILRQIDGIISGSGVVSTN
FT                   TSSISITQLAAVLDRPERFVGLHFFNPVPVMPLVEVIRGLQTSDETHAFAIGFAEVIGK
FT                   TPVTVRNHPGFTVNRILVPMINEAIFVLQERLATADDIDLGMRLGCNHPIGPLALADLI
FT                   GLDTLLAVMEVLHDGFRDSKYRPAPLLKEMVDAGRLGRKSGHGFYSY"
FT   gene            complement(363310..364575)
FT                   /locus_tag="Bxe_C0332"
FT   CDS_pept        complement(363310..364575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0332"
FT                   /product="Thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36247"
FT                   /db_xref="GOA:Q13I42"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I42"
FT                   /protein_id="ABE36247.1"
FT                   /translation="MGRSPLTSFERPLVQTPTPEREFSVTGNTDIFVVAAARTAIGTFG
FT                   GSLKDVPLAQLAILAVRGTLERSGIAPSHVDHIVLGNVIPTEPRDAYLSRIAALEAGIP
FT                   AQTPALNVNRLCGSGLQAIILAAQSLLLGDAQVAIGAGAESMSRGPYLLPALRWGARTG
FT                   DVQAADYMLGILHDPLHRIHMGVTAENVAEREAITREMQDVLAVESQRRAAHAIAEGYF
FT                   RSQIIPVEIPSRKGIVIFDNDEHVRPETTFEQLSTMKPAFKHDGTVTAGNSSGINDGAA
FT                   AVVLATGNAVKDHGLKPLARLVSYGHAGVDPRLMGLGPIPATHLALQRAGLTTGQLDVI
FT                   ESNEAFAAQACAVTQALDLDPKKVNPNGSGISLGHPVGATGAIITTKAIFELHRTGGKY
FT                   ALVTMCIGGGQGIAAIFERTGP"
FT   gene            complement(364594..365193)
FT                   /locus_tag="Bxe_C0333"
FT   CDS_pept        complement(364594..365193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0333"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36248"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I41"
FT                   /protein_id="ABE36248.1"
FT                   /translation="MTANGLPAPAERELLHERKVHLSGFHRKDGLWDLEARMTDERAYS
FT                   SVSAEKGQIPPGQPIHDICVRVTVNDDCIIKSVSASMNAVPYHTCPGALASLANLEGAT
FT                   LGRGWRKRVEDDIGAVKGCTHIRDLLIQVATVAYQTIPIWHAQQHGDVFQSLDGRPPSH
FT                   LGTCLTWAFDGPVVAQLYPEFARSSNDTSGRECPPR"
FT   gene            complement(365190..365531)
FT                   /locus_tag="Bxe_C0334"
FT   CDS_pept        complement(365190..365531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I40"
FT                   /protein_id="ABE36249.1"
FT                   /translation="MSTRGRVVALTRLTRSELPASISQQAIYIGDTVMGTSDTVSLTGD
FT                   GIVERRIRVRESVISLAACSVHRANESGNPLCSFAAYADSMHDAHRQMLASGHDSFGRE
FT                   SRAHRGVDS"
FT   gene            365619..365888
FT                   /locus_tag="Bxe_C0335"
FT   CDS_pept        365619..365888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36250"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I39"
FT                   /protein_id="ABE36250.1"
FT                   /translation="MRCVNILVDYIRHGFSSQRFMRVGALHFTFEDGPQNVLLCVGSTL
FT                   KDISSSAYLCRNHQFFIGGRLSTCMLTKDVEKLESMIMLKMGLG"
FT   gene            365885..366163
FT                   /locus_tag="Bxe_C0336"
FT   CDS_pept        365885..366163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I38"
FT                   /protein_id="ABE36251.1"
FT                   /translation="MNSRNPAVRCLVNDASISRLLCDYAYHLDMSHAANSRICLSTTAR
FT                   SSMVRTSGQAGAAYVETLKGRLVLRGQALRSFSVSCTGCQGHGWFAR"
FT   gene            366327..367970
FT                   /locus_tag="Bxe_C0337"
FT   CDS_pept        366327..367970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0337"
FT                   /product="Cyclohexanone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36252"
FT                   /db_xref="GOA:Q13I37"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I37"
FT                   /protein_id="ABE36252.1"
FT                   /translation="MLKKIETKTFDVVVVGAGITGIYQVYVLRNMGFTVQGYEGGEDVG
FT                   GTWYWNRYPGCRLDTESYAYGYFALTGIIPEWKWSERFAGQPEMLRYVNHAADRMDVRR
FT                   SYQFSTRVVRADWNDSTNMWDLELSDQGRVSCRYLISAVGPLSATRMPNIAGIERFEGE
FT                   SFHTSRWPRDPDDPRGARKIDFAGKRVGVIGTGATGVQIIPIVARTAAELFVFQRSPNW
FT                   CTPLGNHPISDQEMEKLQAAYEEILAFVKSTPTAFPYNRHPKKASETTAEERQALFESL
FT                   YSMPGYGIWLSGYRDVLLSRTSNGYLAEFIAGKIRQRVKDPVIAGKLIPRDHPFGTKRV
FT                   PMETNYYETYNRPNVHLVDVRETPITCVTPRGLQVGSKHYDLDIIIYATGFDAVTGSFD
FT                   QIDIRGKDGLSLKETWQDGPLTYLGLQTRGFPNFFTLVGPHNGATFCNVGVCGALQVEW
FT                   VSEMLGYMREHDLTYSEASHVAQEDWTRQVYEDFSRTLLTEADAWWIKVKVHPDGTRER
FT                   RALVHVSGGPEYREICDEVAADGYAGFELH"
FT   gene            complement(367962..368249)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0338"
FT   gene            complement(368277..368969)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0339"
FT   gene            complement(369187..371586)
FT                   /locus_tag="Bxe_C0340"
FT   CDS_pept        complement(369187..371586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36253"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I36"
FT                   /protein_id="ABE36253.1"
FT                   /translation="MNEDHQNIEAKAAALRSRLGPHIAPRGLYERHKALPFAGRVTCNV
FT                   NRLEAGSWSEIMLDYEVGASGVADGAWLKATFKFYSDWALFQTSDPSAANFISAEYHAA
FT                   PLVPGQSPATVQSLNVRFDQKGHERPFQKAIIVDVADGYLNAGDHIVIRLGDRRRGPGT
FT                   RVQTFVEDQFRFRFYIDPLGTSRFVAVPGDIVIDIHAGAPSQVLLNGPRFVQPGQRAPF
FT                   RVSLQDRWSNACKDIDGGVRVRAYDERSEIVYERELALPRDAWATVALDDLPTASGTLR
FT                   IVADVPSKGDVRAAEVFLTVDATLPVARSLYADLHVHAHDTVGTNSPAYNAAYARDIGG
FT                   IDVLGYTANDFQITDANWQLGIETAEQFNQAGRFVVYPVQEWCGSSTAGGDHNVVFLGD
FT                   ERPGFPYNARGEHNRTLVWNEDMKGTAVDLGRWPVDELWDAYVDDAANHLVMPHVGGRR
FT                   YIPDWHHPELERLVEIASTWGHFDWLYRDVISRGYKLGVAASGDEHRGRPGGGAPGVSV
FT                   FGVHGGLTGVLSDSLDRHSVGRALRARHTWATTGEHSAALVRCGEYQQGDEFNHSGPAT
FT                   LDYRLLGRAGWEYVAAFDHDGLLVERNLHEELGYAERLIRVRWGGARIRDRYRWAAWRG
FT                   RIRIINGTINNFGAGGFEHIEEAAWRTGATDIEFSSDTYGDADNIEIDVSNLARARIVI
FT                   EGTIDGFVKVGDPLKGNPFVHSPMFHWEISGADLLAQGTARHELGGTELFLAVERLTDK
FT                   PLPVDLSGSFDVSAQNAAFGFRPVYVFGRQRDDSKVWTSAQFITFD"
FT   gene            complement(371627..373171)
FT                   /locus_tag="Bxe_C0341"
FT   CDS_pept        complement(371627..373171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0341"
FT                   /product="Na+/divalent anion symporter, DASS family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36254"
FT                   /db_xref="GOA:Q13I35"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I35"
FT                   /protein_id="ABE36254.1"
FT                   /translation="MTHETSELPSLARGSQPATIPDSRLPEPFCESARSLLKARAGFLL
FT                   AWLCFIVIAWVLPTPQGLTHQGRATLAVVAWVAIVWISEAIPVGISGILLPMLLVLSHA
FT                   VTPFPKAASGFAAPVVFLCLAAFLFSAIMQAAGLDRRIALVLLDKLKVRSANGVIWAMF
FT                   IVNFVMSLVVPAANARAAALLPVTNGIIGLFGNSARERDARKAIVIQTLVYGSMISGMC
FT                   ILTAHLPNMVVSGLLEKQLGLRISYFSWLRLQWPYLGMFVLTQFWVQRYFKSRGVPVPG
FT                   GRQAIIEERRKLPPVARQDLTVLLVFAFVGAMWATESLHHLQSEIVALIALALMFAPGV
FT                   MRFGWKDIQERTIWGTLFLLGGALSLSSAISDSGLAQWAADHIYAVAHGYVWWMTLAIV
FT                   MIGTHVIRIGMLSNVAAVTMIAPIALALAPRLGLHPVAFTMLISDTDSFAYLLPTQITA
FT                   GVIAYSSGQFTTADYAKVGIVSVLIAIVYGICVMAPWYAYQGIPLWNPTAPWPFAH"
FT   gene            373357..374088
FT                   /locus_tag="Bxe_C0342"
FT   CDS_pept        373357..374088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0342"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36255"
FT                   /db_xref="GOA:Q13I34"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I34"
FT                   /protein_id="ABE36255.1"
FT                   /translation="MSLIRENATSLYDQIAATLRDEIERGGYEPSGKLPSEAELSERFG
FT                   VSRVTVRLAIGKLVSDSLVERKQGKGTFATGKRFRHRLDALHGFYDSLARQGVHPQMKL
FT                   LRMDQAKKLPPAMHGVFAPSIKTAVYLERLHSVDDDVVALAQTWLLPEAGEISERLAQT
FT                   RPTYEILESLPGWRLARADMSITAVPASGAIAIQLQVTEHTPLLVMKRTSRLSDGRVCE
FT                   ATLFHIRPERYEFTVSSVTHA"
FT   gene            complement(374194..374535)
FT                   /locus_tag="Bxe_C0343"
FT   CDS_pept        complement(374194..374535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36256"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I33"
FT                   /protein_id="ABE36256.1"
FT                   /translation="MSQVHSLPSSSSWHRRQDIISYQYSLLSIGSFWQTLPFRETCHTG
FT                   PQLRGHPIAYNLRMPDVAPPRPFPDTAPLSALRAWYAGVGSRQAVERYCPQALEGGQPA
FT                   CGFADKAPA"
FT   gene            374763..375641
FT                   /locus_tag="Bxe_C0344"
FT   CDS_pept        374763..375641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0344"
FT                   /product="Putative N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="Potentially has regulatory function as described for
FT                   AmpD on AmpC beta-lactamase expression, though other
FT                   protein in LB400 has significantly higher similarity with
FT                   AmpD."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36257"
FT                   /db_xref="GOA:Q13I32"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I32"
FT                   /protein_id="ABE36257.1"
FT                   /translation="MWEQHCAGGVGCRLYDRYVDSVSEPGLACAHTGAALHCPNACGFH
FT                   RIADGLAKAGQFHYLVPDEADGGERFRVYALVPEPRRAWHAGVSYWQGERMLNASSVGI
FT                   EVVNLGFPAQDENVPLTNRRWYPYAPAQIAVVGKLAADVVARHKILPQKVVGHSDIAPG
FT                   RKFDPGPLFPWQKLYEQYQVGAWPDAEAISYYRSYQPFRGDIAELQAMLLAYGYDTPQT
FT                   GVLDAQTLSVVGAFQMHFRPAQYDGVPDVETVAILNALLEKYFGRGRSQLRQAVPGQLG
FT                   PGGENEKGDDS"
FT   gene            375684..375917
FT                   /pseudo
FT                   /locus_tag="Bxe_C0345"
FT   gene            complement(376062..376628)
FT                   /locus_tag="Bxe_C0346"
FT   CDS_pept        complement(376062..376628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0346"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36258"
FT                   /db_xref="GOA:Q13I31"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I31"
FT                   /protein_id="ABE36258.1"
FT                   /translation="MQKRKICQQHNILRLAAVLALAATSISARADGFGVQLAAGVADHD
FT                   VKKGDLGIVWDPGLKWWEIGGYHFTVVGEAHAAYWAVREDHATHPDIWEFGLTPVLRFV
FT                   RSSGWFRPYIEAGVGVRLLSHVRETQDRTFSSSFQFADMVGVGAQFGDHQNYQAGFRFQ
FT                   HLSNAGLEHPNPGINFSEIYVQYNF"
FT   gene            complement(376738..377637)
FT                   /locus_tag="Bxe_C0347"
FT   CDS_pept        complement(376738..377637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0347"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36259"
FT                   /db_xref="GOA:Q13I30"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I30"
FT                   /protein_id="ABE36259.1"
FT                   /translation="MRWLVLLLFAVSAAWTHSRGKVRHGFFRQLSDHSTFTAPLNGFVY
FT                   LFSALPAQPYLPPSRFPELKLLKEEWRTIRDEAFALRDASHIRAATAYNDIGFNSFFRN
FT                   GWRRFYLKWYGRPHPSAVALCPRTVELLGRIPSVKAAMFAQLPPGGRLGLHRDPYAGAL
FT                   RYHLGLATPNHDGCAIVVDGETYSWRDGEDIVFDETYLHYAFNDTQEDRIILFCDIERP
FT                   MKYRWARAINRAIGSFLMRAAASPNETGDYTGGLNRIFRYLYMVRRAGKRLKAWNRTVY
FT                   YVVKWCLFIAIALAIFWR"
FT   gene            complement(377641..377943)
FT                   /locus_tag="Bxe_C0348"
FT   CDS_pept        complement(377641..377943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36260"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I29"
FT                   /protein_id="ABE36260.1"
FT                   /translation="MPDTSADIDQSPVPSGTIAPVQSGSNGPPYRPGNRPMIFVRTGSR
FT                   FYASTLPSHRPDVRRAAQDAGVMARPSPRVITLAHHAVVAMTEAVSDTHAKRTQV"
FT   gene            378494..379291
FT                   /locus_tag="Bxe_C0349"
FT   CDS_pept        378494..379291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0349"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36261"
FT                   /db_xref="GOA:Q13I28"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I28"
FT                   /protein_id="ABE36261.1"
FT                   /translation="MAKSALRVLEIMEFVATHKAGCATHTEISQALGIPKSSLTALLTD
FT                   LQRPGYLELDRETGRYAIGSQVMFLAHAYLRNLNIVRLGTPVVHDVFLKLNVYTTMVIP
FT                   KGDMCLVVCSESLPSPLAHSLSIGQHIPMLHSALGRAILAFLEPEEVERFLHDYTPTPY
FT                   TDRTKTGIEEVRKALAQVRKAGFAHMQGEYLPGIIGIAVPVFNLENRPIAAIGIGIPAV
FT                   EGTTEFEKRICKQLLHSADTLSRRLGAKLKPTPSKLLRKGEEE"
FT   gene            complement(379346..380464)
FT                   /locus_tag="Bxe_C0350"
FT   CDS_pept        complement(379346..380464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0350"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36262"
FT                   /db_xref="GOA:Q13I27"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I27"
FT                   /protein_id="ABE36262.1"
FT                   /translation="MKAKYLALVAPIVLSSHAMAQSSVTLYGVIDEAIRYQSNPGGTGT
FT                   RGASVGMSEGAISGNRFGLRGDEDLGGGTHAIFDLQGGFNAATGKIDQQGQLFGRYAWM
FT                   GLANQKFGTLKVGRQYGSAFSFDAFTFDAIGGGNITATDWELFLVGCRYDNTVDYTNQL
FT                   GPLSLNLQHSFGGQPGNTSIGSTTSGALYYGFGGGKLGIFGQQSKDAASHKLVVGQAGA
FT                   NYGFGKTSLYAYYIYTKRDAGFAIGAAGTSAALANTNIMNNATTAYGAQTVNRIDQFIR
FT                   LGAAYQPLPDWRFTISYAYDHARNVAPGRNGQLQTLYGIADYILSKHTDLYLEVDDSRI
FT                   SGASVNDPNSPLGTAPGVRQVLGASLSLRTTF"
FT   gene            complement(380633..381058)
FT                   /locus_tag="Bxe_C0351"
FT   CDS_pept        complement(380633..381058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0351"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36263"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I26"
FT                   /protein_id="ABE36263.1"
FT                   /translation="MSSVQTEIPLDPNSRPHWEAATRGVLLVQRCTDCGTHRFPAAWQC
FT                   AHCHGRNAEWVALSGLGRIESFCTFHKAYWPSVRDQLPYTVVQVMLDEGVRYMSSMAGN
FT                   PGPQMQIGLRVRAWFDPVSPTLTLIRFAPADAPAPRS"
FT   gene            complement(381055..382215)
FT                   /locus_tag="Bxe_C0352"
FT   CDS_pept        complement(381055..382215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0352"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36264"
FT                   /db_xref="GOA:Q13I25"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I25"
FT                   /protein_id="ABE36264.1"
FT                   /translation="MLSKLQNEPAVAGVGTTRYGKLPGHDIYELAQWALREALDDCGLT
FT                   HADLDGLIVNRIPSYSHFADQCGMNPQYVLATPGHGRFSGICIQTAALLVSSGAVNTVA
FT                   LVYANDGGSAGITYGGDASQFGGAAGAYGGADSHWVPYGMTSPGAFHALMMQRHMHLHG
FT                   TTASQLAEVAMTFRHHASLNPAAVKRDPFTLEQYLESRFICDPLRLLDYCLINDGAVAM
FT                   IITNGSRARDLRKPPVYIRGVGQASQFTGGGFPPDDFWARPMRQVAQEVHSMAGTTVND
FT                   MDGLMIYDNFTPTVLFSLEGFGFCPTGESGRWVSEGHLRLGGRFPANTSGGHLSESYLQ
FT                   GWGLNAEAVRQLRGECDARQIAGADFIQYMAASPVVTSIIYGKDPK"
FT   gene            complement(382244..383131)
FT                   /locus_tag="Bxe_C0353"
FT   CDS_pept        complement(382244..383131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0353"
FT                   /product="Putative senescence marker protein-30 (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36265"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I24"
FT                   /protein_id="ABE36265.1"
FT                   /translation="MSLMQTTPTLACAVDCHNVLGESPIWSPLEQALWWIDVANPTLWR
FT                   HDPASGALDQWSLPRPPAVIALRRNGGLLLLFRRGYLLLDRPAPGDIIAEPVPFALDAD
FT                   RLNDGKVDQAGRMWVGSLARDLVSPVGQLYRFGTDRALHPVDRGFTLSNGIGWSPMQTT
FT                   MYFADTHSKTVHAYDFECTSGTLANRREFIRISGHGGPDGLTVDANGNVWVAVFGAGAV
FT                   HCYRPDGVLARAIELPTAFPTSCTFGGPGLDTLYVTSASMNLDGEAVSGTASTGAVWAV
FT                   EAVGPGQPESLLDY"
FT   gene            complement(383140..384537)
FT                   /locus_tag="Bxe_C0354"
FT   CDS_pept        complement(383140..384537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0354"
FT                   /product="major facilitator superfamily (MFS) aromatic
FT                   acid/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36266"
FT                   /db_xref="GOA:Q13I23"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I23"
FT                   /protein_id="ABE36266.1"
FT                   /translation="MTSLRRLSVRDLIDGRPFGRFQTLLVFLGFMTIVLDGFDAVVMGY
FT                   IAPQLKLDWGLSHESLGAVLSAGLIGQAIGAMAGGPLADRYGRKPVVVSNVLFFGIWTL
FT                   ATAMSSDVRGMVIFRFLTGLGLGAAIPNTSTLISEYAPQRMRSFLITVTLCGYTAGGAG
FT                   GGFISAWMIPAFGWRSVVLAAGVLPVILGVILMALMPESLGFLVARKKGAAAVKAIVAR
FT                   IAPEIARTPYELVQDAQSPHRSSSIRIVLAPQYRMGTAMLWCGYFCVLFLIYLLSSWLP
FT                   TLVKEGGGYSVSESAIAMAMFQVGGPIGSLAIGWAMDRWSKHWILAGVFLIGAASVAAI
FT                   GETSQYYLALCGLALVVGFCMSGGSVGMTALATGYYPTEARATGSSWMLGIGRIGAILS
FT                   AMLGAEMLSLGWSMSDIFTALVIPALIAAVAVLAHKRWDTPRAAGVIQHGAIPHDKDAS
FT                   KPVSTNP"
FT   gene            384667..386346
FT                   /locus_tag="Bxe_C0355"
FT   CDS_pept        384667..386346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0355"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36267"
FT                   /db_xref="GOA:Q13I22"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I22"
FT                   /protein_id="ABE36267.1"
FT                   /translation="MYQHKFSNANLIRICELTGQSPCVSFPHRWRQAVSNIPESRTIPR
FT                   LLRELVANHGNREALVGQGERMTYQQLGERVEALAARLIRTGVKRGEKVGVLMGNRPEW
FT                   VISALAITSIGAVLVSLNSWATARELAYLLSHSGCRHLIATRRYLKYDYAVMLRDMDPA
FT                   IRGRLATVIGVDADLPDGWLPFDDAADVARVEAGDAVRAAGEQVGSDDIAFLLYTSGST
FT                   SAPKGVQLAHGALIVNGWHIGERQRIVPGDRLWLAVSLFWALGCVNAMMNLLTHGGCIV
FT                   LQEAFDAGEALHLIEAERCTVFYGTPNMAQALYDHPERERHDLGSLRTGGTLGSPEQIA
FT                   RVIKLGVSRVCNIYGLTETYGNSHVTSADDDEALRLVSCGQPLPGVEQRIVDANGIDLP
FT                   PGEIGEIRVKGRVIDGYYGNEELTKASFDEQGYFRTGDLGYVDSQGYLYYRGRSKEMIK
FT                   TGGINVSPADVESVLSAHPAIYLAYVVGVPDPVRDEEIGALVVLENGASMASDEILQYC
FT                   RQNLAAYKVPRRLRFVSEGELPMTTTGKVQKNRLAEMFFPPA"
FT   gene            complement(386816..387034)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0356"
FT   gene            complement(387283..388023)
FT                   /locus_tag="Bxe_C0357"
FT   CDS_pept        complement(387283..388023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0357"
FT                   /product="Putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36268"
FT                   /db_xref="GOA:Q13I21"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I21"
FT                   /protein_id="ABE36268.1"
FT                   /translation="MMSLKGKIAMVTGAATGIGATLAQALASSGAEVIGVDIAWDGAQQ
FT                   AGCVERAQCDVADPMSVKTCVANIEAAHGPVDILINNAALASELAPTPFEHIAPEEWLR
FT                   VMTINTMAPFLCSQAVAPRMRERKWGRIVNLTSATIFIGMPPMLHYVASKGAVAIMTRG
FT                   LARELGRDGITVNAIAPGLTMTEGVQRNEAYSDELIAQAIAAQSIPNREQPEDLIAACL
FT                   YLVSDGAKMMTGQILAVDGGTAFH"
FT   gene            388217..388534
FT                   /pseudo
FT                   /locus_tag="Bxe_C0358"
FT   gene            388441..388869
FT                   /pseudo
FT                   /locus_tag="Bxe_C0359"
FT   gene            388876..389340
FT                   /pseudo
FT                   /locus_tag="Bxe_C0360"
FT   gene            389745..390236
FT                   /locus_tag="Bxe_C0361"
FT   CDS_pept        389745..390236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0361"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36269"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I20"
FT                   /protein_id="ABE36269.1"
FT                   /translation="MVRRRQPKTGFMSSLPMTQRPSHEDEGQFALWRSKCPASAVDSLS
FT                   VVVAHTEIPVGESIALLLRLRGFAAVAMSSMENLELMLEHWKPRALLIDTRLCQADDFR
FT                   LVRHAASDTAFSSVLIVALTNIFPEESPQDIKRIGFDGLCRRPCPVWRLADVLDGHFHP
FT                   "
FT   gene            complement(390237..390539)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0362"
FT   gene            complement(390872..391114)
FT                   /locus_tag="Bxe_C0363"
FT   CDS_pept        complement(390872..391114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36270"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I19"
FT                   /protein_id="ABE36270.1"
FT                   /translation="MHRFRRPFASQRTDQSTGFERSTDPVIERSLLNWCQQENEEVYRI
FT                   GLSGGRLTLGSQSRKSGMIQELRRRSCCEEEQVHR"
FT   gene            391215..391532
FT                   /locus_tag="Bxe_C0364"
FT   CDS_pept        391215..391532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36271"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I18"
FT                   /protein_id="ABE36271.1"
FT                   /translation="MSHMIIKVYVRLLGAYRSNAVRLPCQDHRNVKSRTKVMLFLKQFK
FT                   STATTISGIELTRRIHEGSTRSRKADPQGCRCVGRTECYPVRSIRYPAYRKLIDRLTCL
FT                   Q"
FT   gene            391637..391786
FT                   /gene="napE"
FT                   /locus_tag="Bxe_C0365"
FT   CDS_pept        391637..391786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napE"
FT                   /locus_tag="Bxe_C0365"
FT                   /product="Putative periplasmic nitrate reductase NapE"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36272"
FT                   /db_xref="GOA:Q13I17"
FT                   /db_xref="InterPro:IPR004448"
FT                   /db_xref="InterPro:IPR010649"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I17"
FT                   /protein_id="ABE36272.1"
FT                   /translation="MNDEVRKSEELRSFLFLTVVMVPVLTVVLIATYGFMVWFYQLMIG
FT                   GPPH"
FT   gene            391849..392184
FT                   /gene="napD"
FT                   /locus_tag="Bxe_C0366"
FT   CDS_pept        391849..392184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="Bxe_C0366"
FT                   /product="periplasmic nitrate reductase chaperone NapD"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36273"
FT                   /db_xref="GOA:Q13I16"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I16"
FT                   /protein_id="ABE36273.1"
FT                   /translation="MPVVNGSTVTTVVTGDELHIAGIVVHVQPRRIAGVRQAIGMLPGA
FT                   EIHAISELGKLVVTLEGGTASEVAEQLHAIHALPGVYSAALVYQHHEDIESLNEELADD
FT                   AVPSRVY"
FT   gene            392156..394639
FT                   /gene="napA"
FT                   /locus_tag="Bxe_C0367"
FT   CDS_pept        392156..394639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="Bxe_C0367"
FT                   /product="periplasmic nitrate reductase subunit NapA
FT                   apoprotein"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36274"
FT                   /db_xref="GOA:Q13I15"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13I15"
FT                   /protein_id="ABE36274.1"
FT                   /translation="MTLSRRAFIKQTAAATAASAAGVVLPGVDALAASDSLTWSKAPCR
FT                   FCGTGCGVSVGVKNGKVVATQGDPQAEVNRGLNCVKGYFLSKIMYGQDRLTTPLLRMKD
FT                   GKYAKDGEFAPVSWDQAFDVMADHFKRTLKEKGPTAVGMFGSGQWTVWEGYAAVKLMKA
FT                   GFRSNNLDPNARHCMASAVTGFMRTFGMDEPMGCYDDIEQADTFVLWGSNMSEMHPILW
FT                   TRITDRRLSTPTTRVVVLSTFEHRSFDLADQTIIFTPQSDLAILNYIANYIIRNGNVNR
FT                   DFVNRHTVFKQGNADIGYGLRPDNPLQKTARNAGDPNGSQPITFDEFAKFVSKYDAAYV
FT                   TKLSGVPQNKLDQLARLYADPKVKVMSFWTMGFNQHTRGTWANNMVYNLHLLTGKIATP
FT                   GNSPFSLTGQPSACGTAREVGTFSHRLPADMVVTNPKHREEAEHIWKLPAGTIPDKPGY
FT                   HAVLQNRMLRDGKLNAYWVQVNNNVQAAANINGEALPGYRNPQAFVVVSDVYPTVTAVA
FT                   ADLILPSAMWVEKEGAYGNAERRTQFWHQLVDAPAGARSDLWQLVEFSKRFKVEEVWPA
FT                   DLLAKKPEYRGKTLYDVLYRNGQVDRFALTETDSHYRNDEAKAFGFYIQKGLFEEYASF
FT                   GRGHGHDLAPFDAYHKARGLRWPVVNGKETRWRYKEGSDPYVKTGTGWQFYGNPDGRAV
FT                   IYALPYEPPPEVPDKEYPFWLATGRVLEHWHSGSMTRRVPELYRAFPNAVCFMHPDDAK
FT                   AMGVRRGVEVKVMSRRGYILTRVETRGRDKPPRGLVFVPWFDSSQLINKVTLDATDPIS
FT                   LQTDYKKCAVKIVKV"
FT   gene            394649..395128
FT                   /gene="napB"
FT                   /locus_tag="Bxe_C0368"
FT   CDS_pept        394649..395128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="Bxe_C0368"
FT                   /product="periplasmic nitrate reductase subunit NapB"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36275"
FT                   /db_xref="GOA:Q13I14"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I14"
FT                   /protein_id="ABE36275.1"
FT                   /translation="MRAWIVLAVISMIALTASAQPTVPAEPFHDTLRGLTPLDEEAKPP
FT                   LIAPVDNRDVIRARAYAQQPPTIPHKIDGYQLDRNANRCLACHARSRAAESGAVPVAVS
FT                   HYTDRTGETLEHISPRRYFCTQCHVTQADAKPLVANTFTDLPDVRLPPARQTVKK"
FT   gene            395139..395753
FT                   /gene="napC"
FT                   /locus_tag="Bxe_C0369"
FT   CDS_pept        395139..395753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="Bxe_C0369"
FT                   /product="periplasmic nitrate reductase subunit NapC"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36276"
FT                   /db_xref="GOA:Q13I13"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I13"
FT                   /protein_id="ABE36276.1"
FT                   /translation="MRDLIRRYWKTINRPTAYYSLGFLTLGGFIAGVVFWGAFNTAMEL
FT                   TNTEAFCTGCHEMRDNTYAELKTTIHYSNRSGFHAKCSDCHVPHEWTAKIARKMQASKE
FT                   VWAKVFGVVNTREKFEDKRLELAEHEWARFKANDSLECRNCHQFEYMDFTRQSPRAQEA
FT                   HQRFLATGERTCIDCHKGIAHQLPNMTQAQADADAKQAAGH"
FT   gene            395808..396494
FT                   /locus_tag="Bxe_C0370"
FT   CDS_pept        395808..396494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0370"
FT                   /product="ABC heme exporter, ATPase subunit CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36277"
FT                   /db_xref="GOA:Q13I12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13I12"
FT                   /protein_id="ABE36277.1"
FT                   /translation="MLSIERLGVGRGGQMVASGIDLCIEAGWALQIHGANGSGKTTLLR
FT                   VLAGLMPPAGGQVSWYGANVRAHPEKFRRDLAFVGHANGVNDDLTVLENLRFATLLGAG
FT                   SGAPDGTSSVPASGRSGVAAPPSRRDMLARAGMLPLQHTRAGCLSQGQRRRVALARLML
FT                   DRKPLWLLDEPGDALDDSASGWLHECLALHMQDGGIVVATTHRSLQTPAARTRHLHLER
FT                   SGAWLD"
FT   gene            396482..397150
FT                   /locus_tag="Bxe_C0371"
FT   CDS_pept        396482..397150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0371"
FT                   /product="ABC heme exporter, inner membrane subunit CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36278"
FT                   /db_xref="GOA:Q13I11"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I11"
FT                   /protein_id="ABE36278.1"
FT                   /translation="MAGLTLGVIRRELALTWRRRTVTLGSLMFFVIASSLFPLAVGPDP
FT                   KLLQAIAPGVLWVTALLAAMLSAGHLFAQDFASGTLEQMLLSPWPLPGIVFGKIVAHWL
FT                   TGGLAQVLLAPVVALQYELGWRATLPLMGSLLLGTPLLSLIGSMGAALTLGVRGGGVTL
FT                   ALVILPLYVPVLIFGVSASDPGTSAAWSKANFSLLGAALCAAGLLCPWASAVALRIALE
FT                   "
FT   gene            397154..397903
FT                   /locus_tag="Bxe_C0372"
FT   CDS_pept        397154..397903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0372"
FT                   /product="ABC heme exporter, inner membrane subunit CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36279"
FT                   /db_xref="GOA:Q13I10"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I10"
FT                   /protein_id="ABE36279.1"
FT                   /translation="MHMTRINWFHYASPRVFDGLAARLAPCFAVVSGVLILAGLAIGLV
FT                   IAPTDALQGDVYRIMFVHVPAAWMSMFIYVVMAMYCALGLVFNARLAAMMALALAPTGA
FT                   LFTFIALLSGALWGKPTWGAWWVWDARLSSELILLFLYIGFISLHAAIDEPRRADRACA
FT                   VLGLIGVVNIPVIYFSVQWWYTLHQGPSLGFGSGVSMSESMVWGIVVMSFGFWAYSIAV
FT                   TFVRVRVIIRTRERTSPWEARLEERPA"
FT   gene            398066..398554
FT                   /locus_tag="Bxe_C0373"
FT   CDS_pept        398066..398554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0373"
FT                   /product="Putative cytochrome c-type biogenesis protein
FT                   CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36280"
FT                   /db_xref="GOA:Q13I09"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I09"
FT                   /protein_id="ABE36280.1"
FT                   /translation="MRPRSWRLVWVVGGVAVAGLACALVLNAFRANVVFFVSPSQIAAQ
FT                   EIPVTRHFRLGGLVERGSLRRDGDGLTVHFVVTDTATEIAVIYHGVLPDLFREGSGVVA
FT                   QGTLGGDGQFHADQVLAKHDEKYQPPEVSGALRRAQGGRQGLTTLHAAAGRTEGGTGP"
FT   gene            398551..400629
FT                   /locus_tag="Bxe_C0374"
FT   CDS_pept        398551..400629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0374"
FT                   /product="Cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36281"
FT                   /db_xref="GOA:Q13I08"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I08"
FT                   /protein_id="ABE36281.1"
FT                   /translation="MIPEIGHFALILALLLALTTGVLPVIGVQRGIDGWIRLAWPAARA
FT                   QFAFVAIAFGCLSWSFLINDFSVLYVVENSNSALPAVYRFTAVWGGHEGSLLLWVLLLT
FT                   LWMVAVTCFSKQLPVTMVATVLGVMSWIASGFLLFMLFTSNPFSRLIPQSMEGRDLNPL
FT                   LQDPGMVIHPPVLYAGYVGFSVAFAFAIAALLSGRLDAAWARWSRPWTTAAWVFLTLGI
FT                   MLGSGWAYYELGWGGWWFWDPVENASFMPWLAGTALIHSLAVTEKRGSFRSWTALLAIC
FT                   AFSLSLLGTFLVRSGVITSVHAFASDPTRGVFILGFLALVVGGALLLFAWRAPQIGLGA
FT                   GFEPVSREALLLSNNVLLMVAAASVLLGTLYPMVLDALGLDKISVGPPYFDSVFVPLMT
FT                   PAIFLMGVGPLARWKAARVPDLAARLRWAAAVSVVTALALPFTLGSWRPLVSLGLLLAT
FT                   WSFATVAVSMRERIGSQQGRPLLRFRRVPRASYGMWLAHAGIGVFIVGVTLVKGYESER
FT                   DVPMRRGQTVEVGGYQFRFDGVRDVDGPNYRATRASIAVSREGRPVTTLYPEKRLFLVQ
FT                   KMPMTEAAIDHGVLRDLYVAMGEPIGEEAWTLRIQIKPFVRWIWAGCLLMALGGMLAAS
FT                   DRRYRLFPGRRVLQMNEAARSAGVRPLAANEIRQTGAIGAPGVIAAAPHHPVNEDRG"
FT   gene            400626..401168
FT                   /locus_tag="Bxe_C0375"
FT   CDS_pept        400626..401168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0375"
FT                   /product="Periplasmic protein thiol-disulfide
FT                   oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36282"
FT                   /db_xref="GOA:Q13I07"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I07"
FT                   /protein_id="ABE36282.1"
FT                   /translation="MKRVFVPLIGFAVLVAVLAAGLRHDPRRLPSALIGQPAPSFDLPG
FT                   LGATDKRVSPQVLRGQVWILNVWASWCESCRDEHPLLVDLAARRIAPVYGMDYKDERAP
FT                   ALQWLAEAGDPYTASFVDHSGQTGIDYGVYGVPETFVIDRAGIIRYRHAGPLTRQSLDG
FT                   VILPLVRQLQHEDINGS"
FT   gene            401158..401652
FT                   /locus_tag="Bxe_C0376"
FT   CDS_pept        401158..401652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0376"
FT                   /product="Putative cytochrome C biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36283"
FT                   /db_xref="GOA:Q13I06"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I06"
FT                   /protein_id="ABE36283.1"
FT                   /translation="MVRDPNGWPMRWTAVVLLLVTLNCAAWGAAGSSTDDSHYQARVRQ
FT                   LAEGFRCLVCQNQSLADSNADLAADLRAKIGEEVRQGATDAQVRAYMVHRYGDFVLYRP
FT                   PVKPATWALWFGPFVALMVGVSVLWRTMLRRRNVQPRLLDEDERRRVNEWLPAQDESPL
FT                   R"
FT   gene            401649..402587
FT                   /locus_tag="Bxe_C0377"
FT   CDS_pept        401649..402587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0377"
FT                   /product="Putative cytochrome c-type biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36284"
FT                   /db_xref="GOA:Q13I05"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I05"
FT                   /protein_id="ABE36284.1"
FT                   /translation="MITFWMIAAAMLIAALTCVIAPLLRRAATDDDERRPTREGVVLAA
FT                   AIYRAELAELEREFNAGHLSAQHRSEVRRELEARFADEIGAGGRPAGSIDDVATGAASR
FT                   LSRAGTAALLLALLPTAVLVLYMQLGSPLSLAVEGGGDAGQMAVHAASQGSLAVLVGRL
FT                   ATRLQRQPDDAQGWAILARSYAALDRPDDAIAAYQRALMVSPRDAQLLADYADAQASAD
FT                   DGDLNGVALQSIEAALALDPENQKALALAGSAAFDRRDYPLAIHLWEHLEFVAGTDSEI
FT                   AGIARKNIDRARVLAASGSADASGHPAGDTN"
FT   gene            complement(402710..403033)
FT                   /locus_tag="Bxe_C0378"
FT   CDS_pept        complement(402710..403033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36285"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I04"
FT                   /protein_id="ABE36285.1"
FT                   /translation="MPPEAGRTDRGECRADREPSPREAPAPATPRSRPPGLRKQQVHLH
FT                   VELAKYRLDHILALLTKTSSASSINLRAALVSLQSSVTVMKLVFQPAAGKRELLARSLH
FT                   NVV"
FT   gene            complement(403077..403352)
FT                   /locus_tag="Bxe_C0379"
FT   CDS_pept        complement(403077..403352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36286"
FT                   /db_xref="GOA:Q13I03"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I03"
FT                   /protein_id="ABE36286.1"
FT                   /translation="MATQSKRGISRSCLHEGKNITKRFEMTLFNIAMNVYALIHATRHL
FT                   VEFCRRELMFHFFAHVGILLIRFPVWPARPARAFFLHGDNQIGVLR"
FT   gene            complement(403502..403744)
FT                   /locus_tag="Bxe_C0380"
FT   CDS_pept        complement(403502..403744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36287"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I02"
FT                   /protein_id="ABE36287.1"
FT                   /translation="MVLARAESALAETVQQVATVSEMATSIHRCHQYDDAMPPSANSFT
FT                   YESTANYTFRLTWKVISGDSMPALIQVTVRVLQRR"
FT   gene            404182..404877
FT                   /locus_tag="Bxe_C0381"
FT   CDS_pept        404182..404877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0381"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36288"
FT                   /db_xref="GOA:Q13I01"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I01"
FT                   /protein_id="ABE36288.1"
FT                   /translation="MSTEVISRSGRLAGRPPRYGNRQRNPVRRYAGIAVVVLLHILFIW
FT                   ALMNGLANKVVQIVQKPIETKIIEPVKPPPPPPMPTVQLPPPKFTPPPPPFVPPPEVAV
FT                   TPPPARAPTITHQAVPIPTPVAPPPPAPVAPPAPAKPVSHAVGVVCPNSDEVRRSVGYP
FT                   QEAQDNDISGDVMISFVVDPQGHVTDEKVEQSADPILDRAAFSAVKKFNCISQGQPVRV
FT                   QVPFSFKLN"
FT   gene            404952..405881
FT                   /locus_tag="Bxe_C0382"
FT   CDS_pept        404952..405881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0382"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36289"
FT                   /db_xref="GOA:Q13I00"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I00"
FT                   /protein_id="ABE36289.1"
FT                   /translation="MKKRSFAAVAASLLIPATAVSVLAAAVVAPQAVWAQTSAPATNNA
FT                   PATAGGSGSSGADQSAATPQTATAAEPPPLAATSTEVTNPYGLGALWKNGDLVARFVLI
FT                   LLVIMSMGSWYIMITKFLEQLRANRRAKSADEQLWSAPSLAQGAEQLDGNSPFRFIAQV
FT                   GIEAGAHHEEALLEAVDRNTWIDVSIDRAITNVSNRLQDGLAFLGTVGSTAPFVGLFGT
FT                   VWGIYHALTAIGIAGQASIDKVAGPVGEALIMTAIGLAVAVPAVLGYNFLVRRNKSVME
FT                   RVRAFGAQLHTVLLSGTKRQVRAVANAK"
FT   gene            405912..406337
FT                   /locus_tag="Bxe_C0383"
FT   CDS_pept        405912..406337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0383"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36290"
FT                   /db_xref="GOA:Q13HZ9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ9"
FT                   /protein_id="ABE36290.1"
FT                   /translation="MAMNVGQDGDEDEVIASINTTPLVDVMLVLLIIFLITIPVVTHTV
FT                   PVQLPAQTVNPLQTRPDSIEIAVNKDGYFFWNEKLVDAPTLLARLKVASVKLPQPEVHV
FT                   RGDRATRYEFIGRVITACERAGIAKVSFITQPPARGG"
FT   gene            406347..406778
FT                   /locus_tag="Bxe_C0384"
FT   CDS_pept        406347..406778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0384"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36291"
FT                   /db_xref="GOA:Q13HZ8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ8"
FT                   /protein_id="ABE36291.1"
FT                   /translation="MGMNVSSGGGSGEPEVMVDINTTPLIDVMLVLLIMLIITIPIQMH
FT                   SVKMNLPVGNPPPQAVPPPVVQIDIDFDGTITWNGAPVAAGADLEKHMADVAAQPDQPE
FT                   IHLLPNRLAPYNDVAAVLAAAQREGATKIGLVGNEQYMQ"
FT   gene            406836..408044
FT                   /locus_tag="Bxe_C0385"
FT   CDS_pept        406836..408044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36292"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ7"
FT                   /protein_id="ABE36292.1"
FT                   /translation="MMLRSVRRTAAVAALNGLLALAGWPVVSHSADTLRPEVARPLNDA
FT                   QNLYRARNYRGALSKVSLAAAVPGKTAYETRVIGEMQGAAAIAAGDTGVAAGAYEALLS
FT                   SGALDGASTQQYSAALAGIYFQQKNYAAAIRTAQRYQKAGGTDPQMRELLLQSYFLSGD
FT                   CGNVVAALKPGIDAALKGGRAPVESQLQMLAQCAQKTKDDSAHADALAALVAYYPKPAY
FT                   QEQLFNTVRGKPGYFASLDLDIYRLRRATGTLTTAEQYMEMTQLALVAGIPAEAKQVID
FT                   QGFASGVLGHDAQAGREKRLQALVIRRLQGQSDPNNLPVDPVDGALNLVFAGQVQQGIG
FT                   AGAAAVGKDAAHQDAARLRLGEAYYYAGQKAHAAQVFGTVKGADGSADLARLWALVADR
FT                   RSE"
FT   gene            408153..409151
FT                   /locus_tag="Bxe_C0386"
FT   CDS_pept        408153..409151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0386"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36293"
FT                   /db_xref="GOA:Q13HZ6"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ6"
FT                   /protein_id="ABE36293.1"
FT                   /translation="MSSIHNEIDLDADGHHVGYLRLPYSIHRSAYGWIPIPVASIRNGD
FT                   GPVVLLMGGNHGDEYEGQVIVSSLIREIEPQWVRGQLIFLPMANFPAAAAGLRTSPLDG
FT                   GNLNRSFPGDSQGAPTAAIADYIEHTLLVHAQYLIDLHSGGSSLLYDGANMLAIEPRDP
FT                   EEEERLKALLGAFGLPRAFLHRPNPVHAATAARRQGAISIVTELGGGGTVQASLLRDAR
FT                   HGLLNLLGFIGLLSGPLVPAGPPAQTRFFTVSGSRHYVYAYDRGVYEPLIELGDQVVAG
FT                   QPAARIHFPDTPLREPVTAFFAAAGEVVCKRVPAAVERGDCLFHLAEPIQN"
FT   gene            409421..409969
FT                   /locus_tag="Bxe_C0387"
FT   CDS_pept        409421..409969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0387"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36294"
FT                   /db_xref="GOA:Q13HZ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ5"
FT                   /protein_id="ABE36294.1"
FT                   /translation="MSYEIIDATLLDPVARPLLDALQVEYATRYREFRPDSAASASEEL
FT                   VRYPAELFAPPEGAFIVIVLDGETVGGGAFKRYDATTAELKRIWTRADQRRQGVARRIV
FT                   TELETRARRQGYRRIYLTTGFRQPEASGLYLNTGYEPLFDRSIAPEIHFRLPFGKDLLE
FT                   PGRTDSLDDLRQSEPLGQP"
FT   gene            410022..410963
FT                   /locus_tag="Bxe_C0388"
FT   CDS_pept        410022..410963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0388"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36295"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ4"
FT                   /protein_id="ABE36295.1"
FT                   /translation="MKHSRNILSAVAGTLAALAMGIVGTALAATTFNLSPDQHDRVRTT
FT                   PDAAAIKAVPPSFPFVGKDELVIGMTVGAPPLAAYATDEKTVVGFDPDLAQLVADGLGR
FT                   KLKIVVLAWEDWPLALQSGRVDAILSNVTVTEERKEKFDFSTYRRDVLGFYVANSSPIK
FT                   AIREPKDVAGLRVITDSGTNQEKILLEWNKENVARGLKSVQVQYYDDLAVRDVALRSGR
FT                   ADAILSVNSFLAYEAAQRGEVRAVGTISGGWPILADVAITTRKGSGFAAPLTLLLNDLI
FT                   RSGKYTQVLDRWNLGSEAIDTAKTNPPGLPKS"
FT   gene            complement(411090..412379)
FT                   /locus_tag="Bxe_C0389"
FT   CDS_pept        complement(411090..412379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0389"
FT                   /product="Transposase, TnpA"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36296"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GM8"
FT                   /protein_id="ABE36296.1"
FT                   /translation="MTELPDNILHLPQYQVLGCKSTDDEMHFQVDVPDPIACEECGVQG
FT                   EFVRFGKRDVPYRDLPIHGKRVTLWVVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHE
FT                   YVEKESFNHPYTFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRY
FT                   RCILTNIEERTLLDLLATRRQDVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQA
FT                   RIVVDKFHVVRMANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIME
FT                   TWTGAFPQLLAAYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGN
FT                   WREETMTYFETDMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTA
FT                   KVSPFYKKTIGYGLPDFAEELNYGVDLSTI"
FT   gene            complement(412401..412913)
FT                   /locus_tag="Bxe_C0390"
FT   CDS_pept        complement(412401..412913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0390"
FT                   /product="signal peptidase II, Aspartic peptidase, MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36297"
FT                   /db_xref="GOA:Q13GM9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GM9"
FT                   /protein_id="ABE36297.1"
FT                   /translation="MLIIGKKLSPYALLSISGLLAASDQAVKWLVQQSMAYGEYVSVTP
FT                   FFNWVHLWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIAYSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKANTN
FT                   AEPDGSD"
FT   gene            complement(412917..413813)
FT                   /locus_tag="Bxe_C0391"
FT   CDS_pept        complement(412917..413813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0391"
FT                   /product="heavy metal/H+ antiporter, CDF family"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36298"
FT                   /db_xref="GOA:Q13GN0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GN0"
FT                   /protein_id="ABE36298.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITAGALVAWTGSNYPDLIIGTI
FT                   AGGIVLNGARRILALKG"
FT   gene            413909..414316
FT                   /locus_tag="Bxe_C0392"
FT   CDS_pept        413909..414316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0392"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="ISPpu12; Citation: J Bacteriol. 2002
FT                   Dec;184(23):6572-80"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36299"
FT                   /db_xref="GOA:Q13GN1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GN1"
FT                   /protein_id="ABE36299.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCAAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            414484..417027
FT                   /locus_tag="Bxe_C0393"
FT   CDS_pept        414484..417027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0393"
FT                   /product="Putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36300"
FT                   /db_xref="GOA:Q13HY9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY9"
FT                   /protein_id="ABE36300.1"
FT                   /translation="MRVENMKNRAGQPVIGGRRKMLPVAMLAITCNGAAWAQGATAPTE
FT                   ASDVFAAAPEAQPTQTSPAPAPPATSQSMARPPAGRQPGSVDTVQQDTVVVTGTRTTTK
FT                   ASQSLTPVDVISGAQLQATGQSSLRDALVKLSPSISRETYAGDTAQLTDALSLHGLTPD
FT                   HVLVLVNGKRRHTTANIALDGGLNQGSTGVDVDMIPVGLIDHIEILRDGASAQYGSDAI
FT                   AGVINIILKKNSRGGTLQTTTGQTYAGDGLKNGESANIGLNLGDRGYLDLAAEYDRQNH
FT                   TVRTGPDDNFGEFQPGHGFRNPIEGDPASTRESVGFNAGYYLGDDVELYGFGTYAHRDA
FT                   QAYQNYRAPSVLPTVYPNGFVPTETVNENDYSVTAGVKGQNLLGWSWDLSTTYGGDHDG
FT                   MGLTDSANTGLYAAQGFTPTSFRLVTVSNTQLTNNLDFSRAFHLPLLAAPVNVSFGVEQ
FT                   RRETYTIGSGDEYSYLLGGAQALPGLAPVSASDNSRNVLGTYIDLSTHLAPKWTVDLAG
FT                   RFEHYSDVGDTHNGKISTRYDFTPQIAVRGSVSTGFRAPSLAEEYYSNVNVSPASVSGL
FT                   LAANSAAARLIGAQSLKPEESTNYNVGLVLTPVKNLNLTIDAYQIDIRNRIVEGGTASG
FT                   QAAIAAMGAAGLSVPGTVPASAVSASYFTNGASTRTRGIDLTGTYHTGFGEYGQVDWDL
FT                   GVNINNTSVKHVSAGANGQPELNAQQIGWLSTSTPKNKIIIGGTWHSGKWGVTLHETRY
FT                   GSTSSQETYIVGPNAFSTTQFLHFENAARYITDLEVRYDVTNKFQIAVGANNLFNVYPN
FT                   KLPYEAQLEGSQYDSFASTIGENGGFYYLRARYQF"
FT   gene            417165..418166
FT                   /locus_tag="Bxe_C0394"
FT   CDS_pept        417165..418166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0394"
FT                   /product="Putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36301"
FT                   /db_xref="GOA:Q13HY8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY8"
FT                   /protein_id="ABE36301.1"
FT                   /translation="MSYSLSILDKSPIADGTSAYDALRFTVRLAQRAEALGYKRYWIAE
FT                   HHGASGLASSAPEIVVSHLLAHTSRIRVGSGGVMLQHYSPFKVAESFRVLASLAPGRVD
FT                   LGVGKAPGGLPLTTRALQWFHDKAKKPDFAHQLAELDAFLKFGVAEDHPLAGAVALPTP
FT                   PESAQGFLLGGSPESAALAAQHGWQFCYAGHFNRDEANLKRSIDTYRSATGRAPLLALY
FT                   AFAAESKAEAERQVGPLRIFKLQLSTGQSVNLGSSEAAAEFARQVGVTDYRIDELHPHL
FT                   ITGTSDDVRQELNALHERFGIEEFVLDSPVADYALRLASVEALAGAEQAARV"
FT   gene            418192..419526
FT                   /locus_tag="Bxe_C0395"
FT   CDS_pept        418192..419526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0395"
FT                   /product="Putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36302"
FT                   /db_xref="GOA:Q13HY7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY7"
FT                   /protein_id="ABE36302.1"
FT                   /translation="MDQDMNQRNLTFGIMLHGAGGHMNSWKHPAGPADASVNLDFITGI
FT                   AQKAEANGVAFAFVADGLYINEKSIPHFLNRFEPISILSALATATSKIGLAGTLSTSYS
FT                   HPFTVARQFASLDLISGGRAGWNVVTSPLEGSAKNYGGEHPDHELRYEIADEYLEVVQG
FT                   LWDSWDDDAFVRERKSGRFFDRDKLHTLDHKGRFFQVAGPINIQRSPQGQPVIFQAGAS
FT                   DSGIALAGKYADAVFTPSPSLEETRQFSERVRQSAIEHGREATDVKIFPGIGPIVGETA
FT                   AEADAKYRAIRDLLTIDDALAYLGRFFEHHDFTQYPLDEPFPDLGELGTNSFRSATDRI
FT                   KADAKRTGSTLREVALEVATPKTQFIGTGEQIADELIRWFDAGAADGFILGFPVQAEGF
FT                   ADFVQYVIPALEARGRYSRTLTGTTLRDHLGLPRRESRYAKVETS"
FT   gene            419558..421366
FT                   /locus_tag="Bxe_C0396"
FT   CDS_pept        419558..421366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0396"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36303"
FT                   /db_xref="GOA:Q13HY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY6"
FT                   /protein_id="ABE36303.1"
FT                   /translation="MSDTSQRLAGSTRAGHLNEDAADREYAHYRIVPARHHARTAGTVL
FT                   AIVLIGVVLNSVLGNPRWGWGVFAEWFFAGPVLSGLGRTLVLTALSALFGFAFAIPLAL
FT                   ARVSRSPLLTGCAWAFIWLFRSIPPIVLLLLLNNLGYLYETIWIGVPFTHITLLDESTT
FT                   NLISPFFAAVLGLTLNAAAFSAEAIRGGILSVDQGQREAAAALGLPGGRQVRRIVLPQA
FT                   MRAILPTAFNDVIGLAKGTSVVYILAMPDLFYTVQIIYHRNLEVIPLLMVATVWYLVIL
FT                   TALSAIQVHIERYYARGATREPVVNSPLTALFGRWGGARAARREGIAPPAGQDRSAAEA
FT                   GTAGWAQLRVGGKVGIHNVSKSFGTLKVLDDVSLAFPSGSVTVILGQSGSGKSTLLRSI
FT                   NHLERVDDGFIDIDGELVGYRREGRTLYELKEKDILERRRADVGMVFQSFNLFPHLTVL
FT                   ENVVEAPLAAGVPRARAEAEARTLLARVGLTGKADAWPRQLSGGQQQRVAIARALALKP
FT                   KVLLFDEPTSALDPELVNEVLDVIRQLARSGTTLIIVTHEIGFAREVADTIVFMDGGRI
FT                   IESGPPARVLGNPAHPRTREFLSKVL"
FT   gene            421410..422354
FT                   /locus_tag="Bxe_C0397"
FT   CDS_pept        421410..422354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0397"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36304"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY5"
FT                   /protein_id="ABE36304.1"
FT                   /translation="MTPRRKFLANFAALSAVSMVWPAGRALADIRSFDFSPEQRGRLRA
FT                   QKNPAAVRLLSNGYRFVEAGVLTVAVAPFAAPLASYATDARTIVGSDPDYAQLVADALG
FT                   LKLAFVPVAWPDWPLGLASGKYDAVISNVGVTEQRKQKFDFTTYRLGLHAFYVPVVSAI
FT                   QSIHEPKDISGLRIITGSGTIQERILLEWNKQNISHGLKEASLQYFDDLDSASLALLSN
FT                   RADVIFNPHAPLAYAAATQGKIRLVGTVNAGWPLRADVAIASRKGAGLAQALTEATNGL
FT                   IAGGRYQAALARWGLETEAIEHSETNPPGYKDA"
FT   gene            422416..423456
FT                   /locus_tag="Bxe_C0398"
FT   CDS_pept        422416..423456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0398"
FT                   /product="Putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36305"
FT                   /db_xref="GOA:Q13HY4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY4"
FT                   /protein_id="ABE36305.1"
FT                   /translation="MCAARVDHIAFLTPGNYSDDEPEAGFERTLELFRVGESLGYDSAW
FT                   VRQRHLERAVSSAATFLAAASQRTTRIGLGSAVIQMGYENPFRLAEDLATVDVLSKGRL
FT                   NVGLSAGAPNHGALLGERLFDSDPDLVDFSHERIARLRRNLAGDWLGHEDTFVESAAGR
FT                   VRPRVSPYAPGLNDRLWYGGGSRRSIEWAGRNGFNLLISNITLGEGTDDYREAQLRQLD
FT                   LFHSSWNEARAPRVALGRVIVPVDGADIRTRQRYQSFAEGRYARTLMPHGERRILFVPD
FT                   LVGTADEIVERLLTDPVVEGVRELRLELPYDLPFENYHQILEDFITRIAPHLGWRPPAE
FT                   REPVAA"
FT   gene            423991..426447
FT                   /locus_tag="Bxe_C0399"
FT   CDS_pept        423991..426447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0399"
FT                   /product="Putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36306"
FT                   /db_xref="GOA:Q13HY3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY3"
FT                   /protein_id="ABE36306.1"
FT                   /translation="MNKKISAMPGCGAIARWRHKTISLAVATYACSGAAYAQSEAVPPV
FT                   AQPASPAQQSGGQDNVQIQDRVVVTGTRTATKASRSLTPVDVITSEQLQSTGQTDLRDA
FT                   LVSLSPAIQRQAMGGAQAALVDVLTLHGLTPDQVLVLVNGKRRHSTATISLNPGPQQGS
FT                   TGVDIDLIPVSAVDHVEILRDGAAAQYGSDAIAGVINIILKSDTKGGSIETSTGQTYQG
FT                   DGLHQDESAHYGLALGAGGFLDLSAEVSHENHTDRTSQYAHTGALAGSISNIYFGDPES
FT                   TREVVGFNAGYYLGDNVELYGFGTYAHKDAASYQSIRGSVVLPAVYPNGFIPQDLLGEN
FT                   DFSVTAGAKGDNLLGWKWDLSTTYGGDYAHFSQATSENIGLYQATGQTPTNFYIGNQQS
FT                   TEWTNNLDFTRPFNVPLLPAPVNVSFGFEQRTEGYSVGAGEPNAYLYGGTPALVGLTPA
FT                   SASNNTRDVLATYIDLATRLTQQWQLDLAGRFEHYSDVGNTTNGKISTRYDFTPWLALR
FT                   GSVGTGFRAPTLAEEYYTTISPTPTSAFALLAANSSAARLLGAQALKPEKSTSYNLGLV
FT                   LTPARDINVTLDAYEISIRNRIVEGGSQVGQAAINAIGLAGFSTPLGIPASAISASYFT
FT                   NGANTRTDGIDLAATYHTYIGQYGTIDWDVGINFNNTTLTHLAAGANGQPLLNSRQIDY
FT                   LTSGTPKSKIVIGGVWNWGRWGVSLHETRFGTTSAEESYSTGPNAGSVSVFIPFTNKVE
FT                   YTTDLEARYEVTKHFEVAVGAKNLFNEYPNKLPLAAQYAGADIDPTTSAIGMDGGFYYL
FT                   RAKYLF"
FT   gene            426699..427043
FT                   /locus_tag="Bxe_C0400"
FT   CDS_pept        426699..427043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0400"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36307"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY2"
FT                   /protein_id="ABE36307.1"
FT                   /translation="MSRDLLLLLEPGFTDSAHPGERFVCPHSVAIEGLLASDPVRIARL
FT                   DVKHIPFLRPRRDVIAALDDEHQGLPVLVLGSEHPVPEDAQTLGDKRFVTDTKRILALL
FT                   AERHGFPKIH"
FT   gene            427068..427373
FT                   /pseudo
FT                   /locus_tag="Bxe_C0401"
FT   gene            427536..427844
FT                   /pseudo
FT                   /locus_tag="Bxe_C0402"
FT   gene            427854..428381
FT                   /locus_tag="Bxe_C0403"
FT   CDS_pept        427854..428381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0403"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36308"
FT                   /db_xref="GOA:Q13HY1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY1"
FT                   /protein_id="ABE36308.1"
FT                   /translation="MAATSPSTLQDERFVYVSVHDPLARPLFDELVYEYSSRYEGLIKP
FT                   GDIENELLRYPAEAFAPPHGAFVLLLRDGQAIAGGALMSHPDPGTTEFKRIWASRSHRR
FT                   QGLARRVLAELEAQAVRQGYTRVFLGTGPRQPEAIALYRTSGYTLLSAHDFGEDEPPGF
FT                   LFEKYLSPLQTG"
FT   gene            428997..430226
FT                   /locus_tag="Bxe_C0404"
FT   CDS_pept        428997..430226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0404"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36309"
FT                   /db_xref="GOA:Q13HY0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY0"
FT                   /protein_id="ABE36309.1"
FT                   /translation="MTRIAVIGAGITGVTSAYTLARAGYDVTVVDRCRYPAMDTSFANG
FT                   GQLSASNAEVWNNGATLLKALRWMWTAGAPLLLNPVPGWHKYTWLAAFVANMPRYRVNT
FT                   VETVRMAIAARQYLHAMAEEEGIDFDLERRGILHIYPDRRAFEAAKRVNALLREGGLER
FT                   HAVTPAEVRSIEPSLRTACHGGFYTPSDSTGDIHKFTRGLADACRRRGVKFVMEQEIAR
FT                   IARDGERFLLMPRTADGSVASDGAFDGLVVAAGVASRRIAAMLGDHVNVYPVKGYSITV
FT                   HLDDDASRQSAPWVSLLDEERKIVTSRLGADRFRVAGTAEINGENRNIRADRIAPLVDW
FT                   VRQHFPDVGTSRVVPWCGLRPMMPDMMPRVGPGRMPGVFYNTGHGHLGWTLSAATAQIL
FT                   AAAVAAGLPA"
FT   gene            complement(430290..430913)
FT                   /locus_tag="Bxe_C0405"
FT   CDS_pept        complement(430290..430913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0405"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36310"
FT                   /db_xref="GOA:Q13HX9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX9"
FT                   /protein_id="ABE36310.1"
FT                   /translation="MWFDLSQLSPRDGYKLLSSTIVPRPIAWVVSADANGRLNAAPFSF
FT                   FNLFSDDPPVICLGIMGRAGQQKDTGANIRARGEFVVNLVPERLAHQMNATACEYEHGV
FT                   DELQAADLATAPCPTIAIPRIAESPVALECIPMRYIELGNGRMLIAATVRSVYIDDAAV
FT                   LDRDNCYVDTPALGLVARMHGRGEYARTSNLFTMPRPPTPPASS"
FT   gene            complement(430927..431901)
FT                   /locus_tag="Bxe_C0406"
FT   CDS_pept        complement(430927..431901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0406"
FT                   /product="Putative 2Fe-2S Ferrodoxin"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36311"
FT                   /db_xref="GOA:Q13HX8"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX8"
FT                   /protein_id="ABE36311.1"
FT                   /translation="MSEADITAAPGELEVVVRVRTEEADGIASFELRTADGSALPSFDA
FT                   GAHIDVHLPGPMIRQYSLCNPPGERHRYVIAVLREPSGRGGSARMHDLKVGDLLIISHP
FT                   RNAFPLDAENGTKLLVAGGIGITPLKAMAHALTLRGIDFELHYFARSVSRAAFRDALAT
FT                   EPFAAAVRFHFDGDGASLPLADETLAPERIAHIYLCGPTGFIDKVREQAIARGFAAERI
FT                   HVEHFSAENNASCGRSFVVEAVRSGATVTVGENESIARALERAGVQVLTSCEQGLCGAC
FT                   LTPVLEGIPEHRDEYQTAAEKAENAKITICCSRARTPVLRLDI"
FT   gene            complement(431921..433084)
FT                   /locus_tag="Bxe_C0407"
FT   CDS_pept        complement(431921..433084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0407"
FT                   /product="Putative Rieske-type ring dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36312"
FT                   /db_xref="GOA:Q13HX7"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX7"
FT                   /protein_id="ABE36312.1"
FT                   /translation="MSTLENVHASPIHFMSKPAEIEHTQRPLNEASHAPGYIYGDPDVL
FT                   RREKERIFMKDWLCIAHVDELPNPGDFVTHTVIDEPVLIVRNRSGVLQAFYNQCRHRGV
FT                   EVAEGRGNAKIFKCPYHAWSYDLDGKLIGVPFMKEAQGFDQKNCSLKPVRLDTWGGFIH
FT                   ISFDPDAEPLSSYMAEYEQEFGMLRQGELRLGLRWETDFDCNWKFVYENLMDIYHVGVT
FT                   HADTIGRYQDQSSYRYLQLPRGRASIHYRAKTMSETGSSLFGRLPWIDDDSFARIGYLP
FT                   PNLTMLARCDYVRPVTHWPTAVNRTHSVAYFLFPEDKIADPQFQEKIQTYVKFVEQVLD
FT                   EDRGMILSLQRAMNTRGFEPGRMSFMENAIHHALGYHLERLFGPQSA"
FT   gene            complement(433113..433382)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0408"
FT   gene            433528..434763
FT                   /locus_tag="Bxe_C0409"
FT   CDS_pept        433528..434763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0409"
FT                   /product="Putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36313"
FT                   /db_xref="GOA:Q13HX6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX6"
FT                   /protein_id="ABE36313.1"
FT                   /translation="MGTREAGFTTHSRSIHRLSAPGVARLRRPGYYCDGGGLYLQVSPA
FT                   GARSWVYRFRHEGRLREMGLGGLLRVSLADARERAQQCRRQLGCGLDPIEERRKEQAQR
FT                   AAQLARTKTFDECTTAYIRANRAGWKNEKHVAQWESTLDTYASPVIGKLPVRDIDTTHI
FT                   VRVLQPVWEAKPETASRVRGRIESVLDWATAHKYREGENPARWKGHLDKILPARTKVRK
FT                   VQHHAALPYAQAAAFMKALKAQEGLAARALELVILTAARTNEVIGATRSEFDLDAGMWT
FT                   VPAQRMKAQRAHRIPLSETALDLVRRLLDGVQDELLFPGAKKGKPLSNMAMLTVLRRMK
FT                   RTDLTVHGFRSTFRDWAAECTTYPNEMAEMALAHAVDDKVEAAYRRGDMFQRRRQMMDD
FT                   WAAYCARQADGE"
FT   gene            435314..436507
FT                   /locus_tag="Bxe_C0410"
FT   CDS_pept        435314..436507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0410"
FT                   /product="Putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36314"
FT                   /db_xref="GOA:Q13HX5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX5"
FT                   /protein_id="ABE36314.1"
FT                   /translation="MGTLYRLSSLGVARLKKPGRYCDGGGLYLQVSTARTRSWVYRFRR
FT                   RGRLREMGLGPLHAMSLADARETAAQYRKMLLEGIDPIESRRAERMLQHAAAAHSRTFD
FT                   ECSRAFIRANRAGWKSEKHAMQWENTLGTYASPVIGPLPARDIDTALVVRVLEPIWQVK
FT                   PETASRVRGRIESVLDWATVHRYREGENPARWKGHLDKIFPARARVRKVRHHAALPYAQ
FT                   VAAFMNALRAQEGLAARALELLVLTAARTSEVIGAVRGEFDLDAATWTVSAERMKAGRP
FT                   HRIPLSGPALALVRGLLDGAEGDLVFPGTRKGRLLSNMAMLTVLRRMKIAGLTVHGFRS
FT                   TFRDWAAECTRYPNEMAEMALAHAVDDKVEAAYRRGDMFQRRKQMMDDWAVHCGGNV"
FT   gene            436507..436812
FT                   /locus_tag="Bxe_C0411"
FT   CDS_pept        436507..436812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36315"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX4"
FT                   /protein_id="ABE36315.1"
FT                   /translation="MVQTGHGALKRHACVCGLSLRHVWNAAACLPWDESASERYSGTAG
FT                   NSEVFFSNRSPEQEPFVRSRLMGTAGKRWDVGGERVTQDFRNDSPDRMFDAFAGAG"
FT   gene            436861..437088
FT                   /locus_tag="Bxe_C0412"
FT   CDS_pept        436861..437088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0412"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36316"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX3"
FT                   /protein_id="ABE36316.1"
FT                   /translation="MNEHMSGHSGAKARLIRLREVRTRVGLGASTVYRYLAAGKFPRPV
FT                   EIGGGRVAWVESEIDAWIASRREVVGRGTM"
FT   gene            complement(437530..437868)
FT                   /locus_tag="Bxe_C0413"
FT   CDS_pept        complement(437530..437868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36317"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX2"
FT                   /protein_id="ABE36317.1"
FT                   /translation="MRMPISFRLRLFPLQSGNDDTSSFRHQSSRLIATVIWRHPRIFFR
FT                   FSQTKYQLQKTAGCATSESACVLSREIQTVQVIPACRVGGRAIRALRCMGARSGRTIAS
FT                   SSLEEFRQ"
FT   gene            437886..438452
FT                   /locus_tag="Bxe_C0414"
FT   CDS_pept        437886..438452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0414"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX1"
FT                   /protein_id="ABE36318.1"
FT                   /translation="MKELNAWTGTGIDSAPLMLSENATSDQRLQRAEAEVRRLARCMEM
FT                   KDRQLCELRKALAHSATVHYSFEDRLQRELDSLRIMMPTTDFRGHWDTPASEQSDEGFV
FT                   VKLPYVTSILSVLFDAMYTFWAGCDHDHPPKSTTVAHAIDERLGLTSQSNGEASRSGQA
FT                   YASAIRPDRVKEADNRHHGRSPGGR"
FT   gene            complement(438475..439224)
FT                   /locus_tag="Bxe_C0415"
FT   CDS_pept        complement(438475..439224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0415"
FT                   /product="Putative autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36319"
FT                   /db_xref="GOA:Q13HX0"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX0"
FT                   /protein_id="ABE36319.1"
FT                   /translation="MSFVVAGRLDDLPSHIRHDLGTFRHQVFIQRLHWEIPGVPRDAIS
FT                   EWDEFDGGSTVHLVALSANDRVCGCARLMPTTGPYLLRDVFPELTGAGSPPSSPSVWEM
FT                   SRFAGSGLTDHRTGSASGMSLFPYAMSLARSFGATRLIGVVTRPVARLYRRFGLDLRHI
FT                   GASSSPGHADIVACAIDLTTATFDKLQCDADSLLRSISCLGHLPRPQQSLCAPLKAKEE
FT                   GLHSAVSRDETSFPACGSGTARTERAI"
FT   gene            complement(439389..440177)
FT                   /locus_tag="Bxe_C0416"
FT   CDS_pept        complement(439389..440177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0416"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36320"
FT                   /db_xref="GOA:Q13HW9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW9"
FT                   /protein_id="ABE36320.1"
FT                   /translation="MTPISRRRSNEGPHRPSTVSDRQQAGAPAPLKRLACATDIPSLVE
FT                   SFGHAAGKLGFPHYVISRVTRSRSTRAPQTALEMIGSHYPKEWVQHYQRRDYALTDPVH
FT                   RAAFFQSAPYRWHDIIDLTKADHRFLGEASEAGLPAGLSIPVHQSDGSVLLFNLAGPLH
FT                   SVNSEINARRACLMSAQFNFELHRLGLIHSRRAARLLTPCQIVCLTWVARGKTSAEIGE
FT                   ILGCSHYTVDYHVKKAMEALNIWGRTAAAVQATVQGLIKP"
FT   gene            complement(440497..441423)
FT                   /locus_tag="Bxe_C0417"
FT   CDS_pept        complement(440497..441423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0417"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36321"
FT                   /db_xref="GOA:Q13HW8"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW8"
FT                   /protein_id="ABE36321.1"
FT                   /translation="MIPDLGIPHVAFHLPQRVDDVRGWGKRTRQTIATVQNLERAGMRY
FT                   YRNANGQTAIGLAASAIQRLLVASGIAPPEVDCIVYVHTLQGSIAPPPQSLPGLLCDRF
FT                   GFTNAEAFSFAQQHCASALGALRVIRAMFIARPHMKRVLLVGADVMPLDSERLMKAEGI
FT                   LGDGAFAAFIERDAAVNRLLAIATHASGLGWRGVLSKDEQRLAAQYFLAARGLITQTIQ
FT                   QAHCTLNDIQRILPHHLDLPAWHRLLDSLHFPRERLFEKNFARIGHVTVSDAFINLADC
FT                   DGLIPGRPFLLFARGVGGFSAAALLVR"
FT   gene            complement(441420..442412)
FT                   /locus_tag="Bxe_C0418"
FT   CDS_pept        complement(441420..442412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36322"
FT                   /db_xref="GOA:Q13HW7"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW7"
FT                   /protein_id="ABE36322.1"
FT                   /translation="MESSLRATGHPGWDAWMRSWHPDYGHWLEAWPGEEAAGSPPVHLA
FT                   GLVTPDMNCMVPVETGTDLSGLAAKVTKAICRARPPDARPVEIIVFCHSSLDEHVSTTV
FT                   AGRLCAEVGTPCFPFSISQQHGVSPFTALRIASDLFIAEPDIHTILIVAAEKWRPPFSR
FT                   MCGPGIVHGDAAGALLIERTHQGGTNLQLLDAATRHVPVDIGIRASGIPDTPTSALTSM
FT                   IDFLLARHDLRHEDIDEVVGHPGIPSLTRSVGELLNRPAARAQHAVCVHLGAAESIVRL
FT                   AQTLTRGTFRQRHRMLLWGYGIGGSVGTVLLEACCAPFRCQQDAVWSVS"
FT   gene            complement(442481..443089)
FT                   /locus_tag="Bxe_C0419"
FT   CDS_pept        complement(442481..443089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36323"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW6"
FT                   /protein_id="ABE36323.1"
FT                   /translation="MSSQDPAVEPAHRTDGPHRTGGESGSCWLREPDSDDVNDIAAWLA
FT                   EQHINQWFDFGQGRQTLSVLAVRFMIQSGRHRIRMFGPAGHEAASGLVAVSDLAHAFGT
FT                   GSFWVLRDSRRPACRDMTFTASTMLLREAFEADRLHCITAWAVECNVRSRHLLERIGFH
FT                   LIGQQRDCHVMYGSRYGRVHYDLLPADLVDDTGSPQRGA"
FT   gene            complement(443091..444191)
FT                   /locus_tag="Bxe_C0420"
FT   CDS_pept        complement(443091..444191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0420"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36324"
FT                   /db_xref="GOA:Q13HW5"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW5"
FT                   /protein_id="ABE36324.1"
FT                   /translation="MPFRQPVVTDLAPGSWRLNGEQQGLVTAARQFARERLEPLLGGAP
FT                   DSARWSETVRLAATLDLATMILPEPRGGMGISRHDLALVIEQFAAGPLERAAELTLSSA
FT                   ALMTLREYGALDLLPDQTIQHYLDGTTSIAPGIPDVDASGFWVLRQHACSQAMMVRMDG
FT                   ERPQLVLATLTGRRGTGRCFSVALPGPLSIERYTTVPTGDTLLRVVSDDATTEGNPVRQ
FT                   WLVDAATYLAALLSGAVKQGVNFALAYSAYRQTFRKPIAAHQLVAVRLADMLISAHTIH
FT                   LFLRSIAAQDPQTDIAPVRSMAHHVATEALDVTRELVQLCGGHGYVGSMPPAARFQTVH
FT                   WFAMLLIKLEAGLGALAAPDVHQRDS"
FT   gene            complement(444216..445424)
FT                   /locus_tag="Bxe_C0421"
FT   CDS_pept        complement(444216..445424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0421"
FT                   /product="Putative Orn/DAP/Arg decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36325"
FT                   /db_xref="GOA:Q13HW4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR017530"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW4"
FT                   /protein_id="ABE36325.1"
FT                   /translation="MTLTFVRRPPGLQFGGLDVRQLADRAGRTPFFAYDRSAIDIRVRE
FT                   LRNLLPAGMHLHYSIKANPMPAVIHHLAQRVDGFDVASAQEMALALDAGTAPDAIGFAG
FT                   PGKSHDDLRRAVASGINVHVESETQLRLVTALGWELGVQPSVAIRVNPDFQVGHSGMRM
FT                   GGGAAPFGVDVDQVPALLRELEAREVALAGFHVFWGSQCLHAATIIKAQRQSADLILRL
FT                   ASGVPRPLRFVNLGGGFGIPYFPGETPLDVKAVCEAMQDWLPPLCERLPGTTPILELGR
FT                   YLVGEAGIYVCRVIDRKVSRGRTFVVTDGGLHHHLAASGNFGQVLRRNFPVVIGNRPDG
FT                   VPRERCHVVGCLCTPLDRLADEVELPEAHIGDFVVIMQSGAYGRSASPVRFLSHPEPVE
FT                   MLV"
FT   gene            complement(445421..447037)
FT                   /locus_tag="Bxe_C0422"
FT   CDS_pept        complement(445421..447037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0422"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36326"
FT                   /db_xref="GOA:Q13HW3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017529"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW3"
FT                   /protein_id="ABE36326.1"
FT                   /translation="MRNLIDLIQSAARRTPDAESLVCGDVRLTYRQLLQSSRAFGQVLS
FT                   SLGVAPGGRVAIFLDKRMETVVSMLGACAAGCVFVPVNPLLKPEQVAHVLRDSGARCLV
FT                   TTALRVRALAAEGVAPVTDLILVDEPDQVTPDQPTAVRVHRWPDCISSPDDALVPAPAV
FT                   TCIDTDLAALLYTSGSTGLAKGVMLSHRNLLEGAWSVAEYLRLDPSDRVLAVLPLSFDA
FT                   GLSQLTSAWSAGATAVLLNYLTAHDAVLACEREHITAITGVPPLWMQLTGATWSDAARN
FT                   TLRYFANTGGRLPLPVLQKLRALFPHATPFLMYGLTEAFRSTFLDPAEVDRRPDSIGKA
FT                   VPNARVLVVREDGTPCNPDEAGELVHVGACVTLGYWNDAVRTAQRYRPSPEAKPGGAPR
FT                   DMAVWSGDLVRCDSEGFLYFIARNDAQIKSSGYRISPEEIEETVHSSGLVVEAVALGVP
FT                   DDELGEAVVLLVVLAGDSDIDELRNWCTQRLPRYMVPRHIASYPDIPRNANGKFDRAAL
FT                   RSTVASSGLASLKRGPEEKAS"
FT   gene            complement(447063..448010)
FT                   /locus_tag="Bxe_C0423"
FT   CDS_pept        complement(447063..448010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0423"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36327"
FT                   /db_xref="GOA:Q13HW2"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW2"
FT                   /protein_id="ABE36327.1"
FT                   /translation="MSATPLPSVLSLSGVASSLPVRTVDANIWARRCGFPEARANALLK
FT                   NGVQQFHDATATSPVAFACEAVSALLEDTGTTPASIDALIYTHTIQSNVLAPPAGTAAF
FT                   IQSRLGLERALAFSVMQQNCVSPMAAVHLLRMLTVAGRPIQRAIVVCADVMGSGCDHLR
FT                   AIQDLALHSDGACALLLERCVDRNCIVGLHLYTDARYFRGTDDDLQPVPDDRYYWSAFT
FT                   TMRAALGQAGITGSQLVRVLPHHVNLPGWSRLMTMLSAPQERLFTAGFGRLGHVFGADP
FT                   FINFHTAPRGEPGSHSLLFSSGLAGCFGAMVIRH"
FT   gene            complement(448013..449047)
FT                   /locus_tag="Bxe_C0424"
FT   CDS_pept        complement(448013..449047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0424"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36328"
FT                   /db_xref="GOA:Q13HW1"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW1"
FT                   /protein_id="ABE36328.1"
FT                   /translation="MYIATDHGHGQICIASTARYVPKARVHPEALPQKPVATAISMRDA
FT                   VMRSVHADTLRWRQQATPSVAANHPSRSVHPAMPAHVASEPHLSLSEMASAVAGEAIRR
FT                   YPSKEDHAPDQIIVCGTSLEHDLALSCAGRLHSELGSTGVPFAIGQIQGVSFFLALQVA
FT                   ADMMASDERMHTTLIVAAERWLPPFSRQTGSLTVLADGAAAILVSRGSCPGWHVRSLTV
FT                   CTPCTSVSIPPQDIRIDEAAVVEVIGQTCAQAGVKPTTFDWIVPPRINTTLACNVSAEA
FT                   RLPVWRMWYPEPGDIGYLCAADAPAQLHVLLQTVVPANGQRILLWSAGFQGQAACAVLE
FT                   YHGR"
FT   gene            complement(449031..449309)
FT                   /locus_tag="Bxe_C0425"
FT   CDS_pept        complement(449031..449309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36329"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW0"
FT                   /protein_id="ABE36329.1"
FT                   /translation="MTHDTHGPGREEIATTIRSCLLSAVGSTMAADLIADDTNLFDVGV
FT                   DSMNMTDLLLELEQRFGFTLAPEDLTADLFLRFGNLVSFVESHVHRN"
FT   gene            complement(449299..450609)
FT                   /locus_tag="Bxe_C0426"
FT   CDS_pept        complement(449299..450609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0426"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36330"
FT                   /db_xref="GOA:Q13HV9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV9"
FT                   /protein_id="ABE36330.1"
FT                   /translation="MTPHLHTSQQAHAIADISTALADRGLDLDLLATRMRTVSPESDAT
FT                   GEIVGPPWGADDVSALNMNLVPTRYGGCPALQSLVAQATLMAFLGEADASLALALPGPG
FT                   LAMPPVVALASTQQQARFFQRFQSGAPLWGAFAITEPDYGSDATAMRTRARKTGRGWVL
FT                   NGTKCFITNGARADCVITFATINSQMGRYGIRAFLVDCNTPGFTVSRIERMAGLRATQL
FT                   AALSYADCELTDDALLARGDEKPLDDAFSGAQRSWDYFRPLLSAVMVGACRRVRADLVA
FT                   WLDAGGTPADRHRSVASVEASLLDIDRQIAAAWLLCHCTAWKADRGAATSMDSSMTKAF
FT                   ASRMAARVTRAAMDLAGIDGITAFPSLEQAYRDAKAFDIMEGTGDLQRLMIARAAQRST
FT                   SRPWDITASPAGCPAQPDSPPDVDNAHRSGQETSHDT"
FT   gene            450850..451683
FT                   /locus_tag="Bxe_C0427"
FT   CDS_pept        450850..451683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0427"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36331"
FT                   /db_xref="GOA:Q13HV8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV8"
FT                   /protein_id="ABE36331.1"
FT                   /translation="MAARKQTTEKKPVLQPDNKGPRTTKRGDQVAELIKSWITDGKLRP
FT                   GMRLNKEAELQEMFNVSRGSMREALKALEVQGLVRLSTGPEGGATITRVPLARAFQSLQ
FT                   NYLFFESISLEDIYAVRRVLEPLLAAGAVEHLTDADLEALERSVEVCEPFAASHERALD
FT                   QRQEDIRFHDVLAGANPNAFLRCTCQIINQILHTLVIVAGNVTQDDYQAFGRQTVAAHR
FT                   AILEAVRCRDAAAVEKLMVAHMEEAEAQLRKVHAALRQKLVLDSDLGLHAGRKGA"
FT   gene            complement(451686..453110)
FT                   /locus_tag="Bxe_C0428"
FT   CDS_pept        complement(451686..453110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0428"
FT                   /product="Putative amidase"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36332"
FT                   /db_xref="GOA:Q13HV7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV7"
FT                   /protein_id="ABE36332.1"
FT                   /translation="MGNDICDLTAQELHALYKTGTTSPVEVMQAVLLRVEQLDPAVNAF
FT                   CQIAADALDMARESEKRWQHKRPLGPLDGVPVSIKDNVAVAGLATRYGSRATDETPSPH
FT                   DSPCVARLRESGAICFAKTTLPDFAHKIVTDSPLTGVTRNPWDTDRTPGGSSGGAAAAV
FT                   ALGMAPAAIGTDGGGSIRIPAAFTGTFGFKPSFGRVPHAPRGPFGLLSHVGPMTRCVAD
FT                   AARILTVISRPDSRDWYALPFDASDYELGLKCKPTPGGVRIAYSSSLGLAVTPETAVHD
FT                   ALMRTVDTFRELGARVQPEDPPGIARCNAIHSTIWPACCRQLTEGMADGGATLDPSLQA
FT                   YSEAGATISRQTLLAALIERGELGATVNAFFERYDLVICPVYPRVAMSLAELQASKELF
FT                   PHFTAWCNQLGLPAASVYAGSTSDGLPIGIQIVGGRHADALVLWASHILELALGRAPLA
FT                   QLARTLSSSISGRKTH"
FT   gene            complement(453452..453781)
FT                   /locus_tag="Bxe_C0429"
FT   CDS_pept        complement(453452..453781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0429"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36333"
FT                   /db_xref="GOA:Q13HV6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV6"
FT                   /protein_id="ABE36333.1"
FT                   /translation="MSRDTPTSDAVFPRRLKQARLRSGLTQEQLGIHAGIDEFSASARV
FT                   NQYEKGKHTPAIQTSQRLARALLVPTGFLYEDDDLLANLLAIAGRLSKEKKRALLASAE
FT                   KLAQE"
FT   gene            complement(453839..454198)
FT                   /locus_tag="Bxe_C0430"
FT   CDS_pept        complement(453839..454198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0430"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36334"
FT                   /db_xref="GOA:Q13HV5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV5"
FT                   /protein_id="ABE36334.1"
FT                   /translation="MPVKHTTSSIFAKRLKEARVRARLTQEQLGINAGIDEFSASARIN
FT                   QYERGKHLPHLLMGQRLARALHVPTSFLYEEDDLLADLLIVAARLTRGKKKILLANAEA
FT                   LRQSASSRTTKPSNV"
FT   gene            454359..455234
FT                   /locus_tag="Bxe_C0431"
FT   CDS_pept        454359..455234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0431"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36335"
FT                   /db_xref="GOA:Q13HV4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV4"
FT                   /protein_id="ABE36335.1"
FT                   /translation="MTTILNILGYVSILMLVALGLAVVFGMMDIVNLAHAEWVTIGAYA
FT                   LAIAQAVGGQQAFWLALVVAPAVGAALGWCLERFIIRLLYDRPLDTLLATYAVSLILQK
FT                   VLELIFGTQPMLVYAPFSGVVPVPGGSYPAYRIFVIGVALTVTAGCWLLFACTRVGTQL
FT                   RAVIQHRAMAEATGIDTRRLNRIAFCGGAGLASLAGVLVAPMVSVESHLGVSYLAKAFF
FT                   VIVLGGIGSIAGSILGSAVIGTAETLLSYRVDPSLASAMVLVLSIVVIRFRPQGLIPGF
FT                   SAAHQLLGKG"
FT   gene            455240..456313
FT                   /locus_tag="Bxe_C0432"
FT   CDS_pept        455240..456313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0432"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36336"
FT                   /db_xref="GOA:Q13HV3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV3"
FT                   /protein_id="ABE36336.1"
FT                   /translation="MSGKHAGCLRLWLSQPALGPRDVSALLMWSVAMAAAALVPFFAGP
FT                   WLLSTVRDALVMGILALSYDLLWGRAGVLTLGHTTFLGLGAYGFAVATVQFGQAPVTGL
FT                   VAGVLCAAAVAAVIGYFLLFAGVRLHFFAIISLAVLIVAQQLAVSWQSVTGGDTGILGI
FT                   PGLSFSAGGHTLDMSGPRASWYTVAIVLLAATGLIWLVCRSRYGKVLDAIAANEWRAKA
FT                   CGYHTSFHLLLVFVASAALAAIAGVLMAACSGVVAPDVFSPILATEVILWVAIGGRGRT
FT                   GGPVVAAVVLTLLRQTVSSYSTDGWPLILGGLFLACVLFLPNGLQLHELLEAARRAARA
FT                   VWSRPPVHRAEHAREER"
FT   gene            456313..457047
FT                   /locus_tag="Bxe_C0433"
FT   CDS_pept        456313..457047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0433"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36337"
FT                   /db_xref="GOA:Q13HV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV2"
FT                   /protein_id="ABE36337.1"
FT                   /translation="MDGQFLQGTNLSRAFGGINAVAGVDINIAPRDLLCVIGPNGAGKS
FT                   TLVGLLSGAIAPGSGELTLDGERMTGRPMHAFCRRGVVRKFQGTNTFLTMTVRDNLVVA
FT                   GLGVAAYRATPMPDPDAVLEEVGLAGQAGELASYLPHGERQWLEIGMAIMCQPALLLLD
FT                   EPAAGLSAKDAQRLVRLIHRLRERCAVLVIEHDLGFVQSLACETWVMHRGEVVRRGSYA
FT                   EIAADEEIRRIYLGRGATHAAH"
FT   gene            457034..457777
FT                   /locus_tag="Bxe_C0434"
FT   CDS_pept        457034..457777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0434"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36338"
FT                   /db_xref="GOA:Q13HV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV1"
FT                   /protein_id="ABE36338.1"
FT                   /translation="MLRIENLCAGYGDVDVVHNVTLDVLPNEVVGVLGCNGAGKTTLVK
FT                   AVMGLLPRVSGQVSFLDQPVTGLRTHEIAQRGIGLVPQGRWIFPKLTVRENLLMGTQAA
FT                   GGADILDEVFDYFPVLKTRLSQQGGTLSGGEQQVLAISRALCGRPKLLLLDEPSDGVQP
FT                   NLVERIGEVIPELCRRSKLAVLLVEQNLDLVLQSARRCIVLSNGRLVHAGAVEPRHSGK
FT                   GEHPLARYLSPAADAAPDFRPENIQ"
FT   gene            457796..458974
FT                   /locus_tag="Bxe_C0435"
FT   CDS_pept        457796..458974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0435"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36339"
FT                   /db_xref="GOA:Q13HV0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV0"
FT                   /protein_id="ABE36339.1"
FT                   /translation="MNRREFSRTVLLGATASLAASAVAPFARGAEPLKIGLLAPLSGPL
FT                   TRVGQTNRNCAALAVDEINAQGGLLGRPLQLSVEDTQMSTAVTLQKARQLFMRDDVAMI
FT                   TGMVLPSEREAALQAARAARKLIVYPNFDEGRCDPQLLTTGLATSQRIEPLIAWLMRDG
FT                   GRSVCAVVSDIGSNRKVLVPQLQAAVTRHGGKFLDVFWLPFGTRDYGAVLQQVASARPQ
FT                   IAWHSIGDDPVTFVKQYRSFAMKPQLVTDIAHESLSIATTGASTGTIGVSSYFMSIDNP
FT                   ENQAFLTRYTGRYADARDPRLGRYAVVLPHGENTYAGIRLFAEAVRSAGSVDAARVKAV
FT                   LPGVSVALPRGKTGVSRDGGHVLCQTRIGQALADNSFSILESTGPVMPVCEG"
FT   gene            459029..460444
FT                   /locus_tag="Bxe_C0436"
FT   CDS_pept        459029..460444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0436"
FT                   /product="Putative amidase"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36340"
FT                   /db_xref="GOA:Q13HU9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU9"
FT                   /protein_id="ABE36340.1"
FT                   /translation="MSEIVMLNIAQLVAGFRQRSLSPVEVMCAVLDRVTKLDPAVNAFC
FT                   ALDEEGAMSAACEAERRWTRGEPCGPLDGVPVSVKDLVAVAGFPTRHGSWTASPDRESV
FT                   DAPAVARLRRAGAIPFGKTTTSEFGNKIVTDCPLTGATRNPWDTRLSPGGSSGGSAVAV
FT                   ALGMGPLSLATDGGGSIRIPACWSGVVGFKPTFALVPAGNAASWTALSTLGPIARTVRD
FT                   AALMLDAMTGANNDGSSEGGSPAGYSAALDDGVVGLRIGWCPAPDGVPVAPDIAACVGR
FT                   AADTFGALGATVIQTDVAPIADYYGNGRMHSVQWCVFFAQRVRHMEAADRTLLDPELTA
FT                   LADAGARIDTATFVDALLARHALGASMETFFERYDLLLTPTFHCGPPPVPGLPGHLRSA
FT                   PLLTAWCNQAGLPAISVPCGFAGDLPTGLQIIGRRGSDALVLRAARAYELARGDFPAPG
FT                   PELQLPGDVEIAP"
FT   gene            460441..460986
FT                   /locus_tag="Bxe_C0437"
FT   CDS_pept        460441..460986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0437"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36341"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU8"
FT                   /protein_id="ABE36341.1"
FT                   /translation="MNVQIARIVVHLVERCAELGTPVTPPHRQVVAAAVLKTTDQDVAW
FT                   ELEALYATGADLGQMLTGRALLALGCAGEDIQGYGKAALAGAGVPLEWGAALLHPRLGK
FT                   AVRDCLPGASSIMPSVTKRGPAGACIDIPMHSVTDMWSFDHFDTVSLCIPDSPAPDELL
FT                   VAVALAERGRPLARVRPG"
FT   gene            461060..462094
FT                   /locus_tag="Bxe_C0438"
FT   CDS_pept        461060..462094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0438"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36342"
FT                   /db_xref="GOA:Q13HU7"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU7"
FT                   /protein_id="ABE36342.1"
FT                   /translation="MRRDVRGRWSKALAALSLCISAGAVHAQSSVSLYGLADAFAGVVR
FT                   TPGSAGNAWQVGSGGLSTSYWGMSGAEDLGGGMKAIFTLESFYRINGGQSGAYDGQSFF
FT                   GRRAFVGLSGQFGQVTLGRNDSLLFVSTLLFNPFGNSFVFSPMVAHTFLGSAMGAASVQ
FT                   SDTAIDDSIVYQTPEVGGLTGSVLYSNAGIAGHAGQANYSANVLYFAGPFSATAAIQSL
FT                   HTASLFLNGATEQTAWLAGAAYRLQAVKLYLQYERVTNNNDLTDDTVQVGASAQVGTGS
FT                   ILLSWAGTLRRPAQGADVRWSTVVLGYDYPLSKRTDVYAAWRYDTMTSVSSGNSLGAGI
FT                   RMKF"
FT   gene            462226..462465
FT                   /locus_tag="Bxe_C0439"
FT   CDS_pept        462226..462465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36343"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU6"
FT                   /protein_id="ABE36343.1"
FT                   /translation="MQNDTSGVDVLVVASRRVPDQAEHGLEFAPAVFAHILLVDRCLHG
FT                   QHKRPGHGRRVAGRVAHDAMLNGTLSLFTARQHD"
FT   gene            462732..462974
FT                   /locus_tag="Bxe_C0440"
FT   CDS_pept        462732..462974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0440"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36344"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU5"
FT                   /protein_id="ABE36344.1"
FT                   /translation="MSIEDSGTDRILRRREVEARTGLSRSTIYRRMQAGTFPPAIPLGG
FT                   RLVGWRARDIDAFLVNPSRYRVPVRLREGGAGGVP"
FT   gene            463390..463647
FT                   /locus_tag="Bxe_C0441"
FT   CDS_pept        463390..463647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36345"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU4"
FT                   /protein_id="ABE36345.1"
FT                   /translation="MIPETLIRKHRTVTRRHHSMPDPGFERRRRAVHYPAAAIINVPAA
FT                   PNVALSQRLQTWQSLEVVPSSKADATASAVPVRTSISLRS"
FT   gene            complement(463712..464116)
FT                   /locus_tag="Bxe_C0442"
FT   CDS_pept        complement(463712..464116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0442"
FT                   /product="Nitrogen regulatory protein NtrR"
FT                   /function="involved in nitrogen regulation"
FT                   /note="Citation: Mol. Plant Microbe Interact. 14 (7),887-
FT                   894 (2001)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36346"
FT                   /db_xref="GOA:Q13HU3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU3"
FT                   /protein_id="ABE36346.1"
FT                   /translation="MSGYLLDTNIISDMIRNPFGQVAARIEQIDPRAICTSVVVAAELR
FT                   YGCAKKGSAKLLARVESLLATIPVLPLDVPADTEYGGIRAELEAAGQPIGANDLLIGAH
FT                   AYALGLTLVTDNTKEFSRIRGLTIENWLDR"
FT   gene            complement(464113..464391)
FT                   /locus_tag="Bxe_C0443"
FT   CDS_pept        complement(464113..464391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0443"
FT                   /product="Putative nitrogen regulatory protein NtrP"
FT                   /function="involved in nitrogen regulation"
FT                   /note="Citation: Mol. Plant Microbe Interact. 14 (7),887-
FT                   894 (2001)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36347"
FT                   /db_xref="GOA:Q13HU2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU2"
FT                   /protein_id="ABE36347.1"
FT                   /translation="MIVPIPTPSARPREARLFRNNRSQAVRIPVEFELPGDRVLIHREG
FT                   DKLIIEPVRTPANIIELLAAWRQELPPGPDDQFPDIEDPPVRPEDVL"
FT   gene            464573..465262
FT                   /locus_tag="Bxe_C0444"
FT   CDS_pept        464573..465262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36348"
FT                   /db_xref="GOA:Q13HU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU1"
FT                   /protein_id="ABE36348.1"
FT                   /translation="MLSGNPVCARRLNSRPAQRAWDDYVRIFNAIFYRGRRMKSANDGP
FT                   VGIETDGGAGAGSSRKKISDWPRAVIASALGLIMAGIAYSLGDAYCNAYLAGFSVHSGA
FT                   FPADHPTHFVLAVWGGLHATLALQQWLGGHVLRLVCMTAVCLIYFAALPVIFAVISPII
FT                   ANGRGHVEGARALLGKRPLLRKYAGTVMAIMFFFLTALWFFLFVPRRYLFPPLSVRPLA
FT                   RMWRNWI"
FT   gene            466115..466975
FT                   /locus_tag="Bxe_C0445"
FT   CDS_pept        466115..466975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU0"
FT                   /protein_id="ABE36349.1"
FT                   /translation="MKSLLIISAEGNSGRTMLTCLFARHLHRINHWRVLVLDLAEPPCC
FT                   AQMLAGCGLDTTGSGNRAPDLHECASPLTGGCLRVLSADAIDALRARDDPACTRYYANL
FT                   RHLLSVVAPWFDVCLIDAPILPDLRAVCAEALADAVLSPLAMSPDCIGCASEVINGTYG
FT                   IRNVRARLNPALRFAGLLPVVDVPSSMEEAWVKVMETTLREWLIVDRAFPHGYAWLPRM
FT                   WSVMRSVGRVEKRPAPHGYVAAQDVGVAEASRTVTACLNVLTRRLAAIGKDAVHGFRDA
FT                   EVCDA"
FT   gene            466968..467546
FT                   /locus_tag="Bxe_C0446"
FT   CDS_pept        466968..467546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36350"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT9"
FT                   /protein_id="ABE36350.1"
FT                   /translation="MHDAAISFDIAVTGRALLRALRRWSTAIAAFVGISILAPGTARAD
FT                   DWGCQVVLCLSNPGGPEQYGECVPPIEKLWAALRHGDPFPTCDFGAGGAQGTSAVNIFA
FT                   SAGYCREDLLYWGGPEQSELLCNARGAINVEIDGALYTRVWWDARGADRTITEFYGAGS
FT                   TAVPYEPTRSARLFLEREYGGSGGQGGGE"
FT   gene            467543..468190
FT                   /locus_tag="Bxe_C0447"
FT   CDS_pept        467543..468190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0447"
FT                   /product="Putative type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36351"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT8"
FT                   /protein_id="ABE36351.1"
FT                   /translation="MIPLAAFLALTQQCAPAVAPATMAAIVRVESGFDPYAIGVVRGRL
FT                   ERQPANLDEAIATTRALEAGGWNYSAGLAQVNRANWVRLGLTPQAVFDPCRNLAAGAAI
FT                   LQGCFERARLRHPEAQNALRAGLSCYASGDFSSGFRTGYVQRVVAQAARPDPVVPAITT
FT                   DVPPIRVIPSSPQDARSGALRIPDGTPSTTDGRRNRPIGEPGDVTQESAVVF"
FT   gene            468226..468561
FT                   /locus_tag="Bxe_C0448"
FT   CDS_pept        468226..468561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0448"
FT                   /product="Putative type IV secretion system protein
FT                   VirB2/TraC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36352"
FT                   /db_xref="GOA:Q13HT7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT7"
FT                   /protein_id="ABE36352.1"
FT                   /translation="MKSGLQMKWKTIRLATRVLASVRAGRNGLAVAALLTVTPAYAQLS
FT                   QVNTLLTTIQTTLLSVGAVVCSISIIWAGFKMMFQHARFGDIANVFIGGLFVGCATVIA
FT                   AMLIPTS"
FT   gene            468575..468907
FT                   /locus_tag="Bxe_C0449"
FT   CDS_pept        468575..468907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0449"
FT                   /product="Putative type IV secretion system protein
FT                   VirB3/TraD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36353"
FT                   /db_xref="GOA:Q13HT6"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT6"
FT                   /protein_id="ABE36353.1"
FT                   /translation="MSPRMNPLRDPVFKGCTRPAMLWGVPLVPFLMVGSSILIPAIWAL
FT                   LASPPVGVGIVLLLIPVFVTMRSITRHDDQRLAQYALCARMAIRQRNRRFWGAHAYVPV
FT                   RVKRRG"
FT   gene            468909..471380
FT                   /locus_tag="Bxe_C0450"
FT   CDS_pept        468909..471380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0450"
FT                   /product="Putative Type IV secretion system protein
FT                   VirB4/TraE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36354"
FT                   /db_xref="GOA:Q13HT5"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT5"
FT                   /protein_id="ABE36354.1"
FT                   /translation="MSAQPQLIEVAEREVVLADFVPFSSHVTDHVIRTREGDYLSVWKI
FT                   AGIAFEAADPGDILVRHEGFNQLVRSLPGGHVGLWSHRIRRRVTDHFATPYGHPFCQEL
FT                   ATRYYASFAGYRMMANELYLTLVYRPRRTRLGRLFSQAARRTLDDIRRDQHEALKVMAE
FT                   LAAQVESGLKPWDPVALGVYRKQIRYTQRPVRFSAALEFLGYLVNAAWEPVPVPSGRIA
FT                   EALPTSRLFFRTEKVEIRMADATRYAALLDLKDYPEETEPGMLDGLLYGDFEYIETQSF
FT                   TILDRPTAKEALERQRNQMIAGEDVAVSQVQAMDQALDDLINGDFVLGEYHYSLAVLGD
FT                   RPDEVARHVAKARTQLADVGFQTALVDLVADAAWFAQLPGNWRYRPREAKLTSRNFCGL
FT                   ASLHNFATGKREGNPWGEAITIVKTPSGQPLYLNFHATPEKKESADEKALANTQIIGQA
FT                   GAGKTVLELFLLAMAMKYGLTGVVYDKDRGTEIAIRAMGGRYTVFRRGVPTGLNPFQLD
FT                   PDETVLDFWERLVRRLVDTGTLLSAKDELDISRAVREVARMERPLRRLSMVRQLLPAVG
FT                   ENSLHARLTKWCAGGRLGWVLDNPSDLLDFSQNRLFGFDDTELLDDPEVSTPVTMYLLQ
FT                   LTESLIDGRRFVYVMTEFWKRLGDPVFTDFAKDKQKTIRKQNGLGIFDTQSPADVLRSD
FT                   IARALVEQTATFFFLPNPRADYDDYVHGFKLTEAEFNIVRSLGENSRLFLVKQGHRSAI
FT                   GRLDLAGLGDVLDVLSGTTDNVELLDGIRAEVGDDPGVWLPVFHERLAKRRATGGALNA
FT                   LTPRLSGRGAR"
FT   gene            471377..472534
FT                   /locus_tag="Bxe_C0451"
FT   CDS_pept        471377..472534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0451"
FT                   /product="Putative type IV secretion system protein
FT                   VirB6/TraH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36355"
FT                   /db_xref="GOA:Q13HT4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT4"
FT                   /protein_id="ABE36355.1"
FT                   /translation="MSGLFTAVGGTLENGMSTYVTSVSSALSSALVPVVTTALSIWIIT
FT                   YGFAVVRGEAHESVPAFAWRGLKVAVMLAFALGAGIYQSQVVTAVEGATTGLAQTIQTA
FT                   AANAGAGNPGCGTASGSSVTGTSASAIYQTLDCYDRQIDLVMDAYFNKATHEGFSVAGI
FT                   VAGIGDFACGLVAALGASVFLIVLAFEVVMARLLLDLVLGLGPLFIACGAFSPTARFFE
FT                   AWTAKIANYALLQVLIAAFLGMALTAFSADLAPFQVTSASPDANASTLTAAVQGALDNA
FT                   ASWGAGLGMCAAGVLLATVGWQLPAVASGLAGGATMSGFGAFVAGYAARQALRGVGAAM
FT                   RFGHGPRGPGGKISDGGAGSGSIPLYQRAAREHMGDQGNDGGSTS"
FT   gene            472531..473238
FT                   /locus_tag="Bxe_C0452"
FT   CDS_pept        472531..473238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0452"
FT                   /product="Putative type IV secretion system protein
FT                   VirB5/TraF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36356"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT3"
FT                   /protein_id="ABE36356.1"
FT                   /translation="MIASGVRRTLVAIAAATTSSLSSGVHAQGIPVYDAQNVIQAIATV
FT                   GQLKQEVQQELQLYQSLSGTRGFGELMSNPVLSNSLPSNWQSVYTAIQHGGYAGLTGSA
FT                   QTLRSASEIYNCEDQSGIDQQVCQRALNKPFQDKAFGTQAYQTELDELDQIQGLMQQID
FT                   VTQDQKGIGELQARIQIESTAVGNEMTKLQLFRMLADSEDRLIAEQQQELVLKRAGNTA
FT                   RLQDQMVPAGFGN"
FT   gene            473442..474188
FT                   /locus_tag="Bxe_C0453"
FT   CDS_pept        473442..474188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0453"
FT                   /product="Putative type IV secretion system protein
FT                   VirB8/TraJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36357"
FT                   /db_xref="GOA:Q13HT2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT2"
FT                   /protein_id="ABE36357.1"
FT                   /translation="MSSERDARESRDYRRALDFEVSVAHLQERSERRAWHVAMGSVVVA
FT                   ILCAVALAVMVPFYRVVPLPIEVDRLTGEAQVIDVLDAKQTHMRDIEDKHWVEAYVRSR
FT                   ERYDWGLLQMDYDRVLDMSDDRVARDYRSIYSGPDALDRQLGANTQRRIRILSTTLVPD
FT                   EPGRAVVHIERTTRKNGIDNAEPPQRFVVTLAFTYRPSVFTRERTAIENPFGFRVTAYS
FT                   RDPEYTPTAVSPASSPTLSPAPGGAP"
FT   gene            474185..475021
FT                   /locus_tag="Bxe_C0454"
FT   CDS_pept        474185..475021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0454"
FT                   /product="Putative type IV secretion system protein VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36358"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT1"
FT                   /protein_id="ABE36358.1"
FT                   /translation="MRLNTLVRAAALVAGLVGSCAGAFAYDMPGWSGDSRVRQVVYRQD
FT                   EVVRVIAQRGFATHIALDPAEHILVVAPGDRDGWQVVANRGDHDVYLKPQLAAHDTNLE
FT                   IRTDRHSYSFDLVVLPLKARFGSDDEMYRITFVYPDMQAAKTKAADDAVLLRKRLDQAP
FT                   VVRNTAYSMQVMPHSEDIAPTAAWDDGRFTYIRIPNNRRIPAIFRVADDSSESVVDRHM
FT                   EADVIVVHEVARRFVLRLGDEVVGLWNDAFDVDGVPPADGTTVSGVKRVLRSDGHE"
FT   gene            475014..476222
FT                   /locus_tag="Bxe_C0455"
FT   CDS_pept        475014..476222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0455"
FT                   /product="Putative type IV secretion system protein VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36359"
FT                   /db_xref="GOA:Q13HT0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT0"
FT                   /protein_id="ABE36359.1"
FT                   /translation="MNEETSRNVIAPDTDPAKVTDTINGDLPNQPIDRGMPELGQQGGR
FT                   ARAWWLAPLVIVALVIGGAAWTIHGFLVRHDAAEKARRDAVQDQPSQGRVFGDGNPPAS
FT                   AAAAAAASSPAGAATVASAPAAVSTRQVPVHTAPARSYYDAPLLATGGAGAGNGPADER
FT                   ADPAVSAAGVSPGATVVSGSQSQGSGPLARALTPTVTPKVRAGFLGNRSMILAEGAKID
FT                   CAGDTAFDSTQAGISTCTVTKNVYSDDGRVVLIERGSQINSEYRSNLAPGQKRVFILSA
FT                   RIRTPEGVTVEIDSPAADALGRIGVSGYVNNHWGERIGAAMLLGMTQDAIGYLATRGGN
FT                   SNGSVVFENTQQQGNDMASRVLDSTINIPPTLTQNQGAEFTIIVARDLDFSPVYALEPG
FT                   GTR"
FT   gene            476219..477358
FT                   /locus_tag="Bxe_C0456"
FT   CDS_pept        476219..477358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0456"
FT                   /product="Putative type IV secretion system protein VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36360"
FT                   /db_xref="GOA:Q13HS9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS9"
FT                   /protein_id="ABE36360.1"
FT                   /translation="MKASAHILSEAPVPADGLLPRLAEDASVRELMRPLAGLLADPALT
FT                   ELVINRPQRVLTETHLGWQAHDCADLDFERLMSFAVAIATLTNQEVSALHPVLSALLPG
FT                   DARVQVVIPPVVPPRTVSVTIRRPSSREKTLDAYGNEGLFSQTRWHRPAGLDEAMPALR
FT                   PLDRDLARCLEAREFPAFFERAVRGRLNLVIVGSTGSGKTSFMKTLCRSIPATERIVTI
FT                   EDVRELFIHHIENCVHLIYSKGGHGQARVTPADLIASSMRMRPDRVLLAELRGSEAYDF
FT                   LKLLTTGHSGSITSYHASSAAVAIERFALMAKEHPEAATWDDVALRRLLFMTIDVVAHM
FT                   ESTALFDETGVQTGRRWSMTEVWFDPLRRHQTDYHADFR"
FT   gene            477373..477774
FT                   /locus_tag="Bxe_C0457"
FT   CDS_pept        477373..477774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0457"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36361"
FT                   /db_xref="GOA:Q13HS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS8"
FT                   /protein_id="ABE36361.1"
FT                   /translation="MDIGKGTGTGRSASKAIRYHAMLVLVTLAVMAAAAAGLTLALWLA
FT                   SFFFAASQHVNPLHAGFHAWPDAALAWHDGRLPKEGRRLAGAALFGLLLAFGAPALGVY
FT                   TLLEQSGRRRLYGSARFANEADVRRAGLL"
FT   gene            477771..479552
FT                   /locus_tag="Bxe_C0458"
FT   CDS_pept        477771..479552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0458"
FT                   /product="Putative type IV secretory pathway protein VirD4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36362"
FT                   /db_xref="GOA:Q13HS7"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS7"
FT                   /protein_id="ABE36362.1"
FT                   /translation="MSAATHSGGYGGPPLVVGVWRGRYLRFTGQQFVLLAAPARSGKGV
FT                   GIVVPNLLSYPDSVVVLDIKQENFNLTAGFRRAHGHDVYLFNPFAEDGRTHRYNPLSAI
FT                   SDGVFRVGDILAIGYALYPVGGHDDFWKDQARNLFLGIVLLLCEWRDACRTGNTDVPDY
FT                   PVTMGEVLRQSSGNGMPVKAYLQQALLQNRRLLSGACVDALNRFLANDDKVLASILATF
FT                   NAPLTIWANPIVDAATSANDFDLRDVRKRRMSVYVGITPDHLSEAALLVNLVFSQLVNL
FT                   NTRQLPQDSPELKVQCLLLMDEFTSVGKIHIIARAVAYMAGYNLRLLSIVQSVSQLESV
FT                   YGRADARTFVTNHAMQIIYAPREQKDANEYSEMLGTFTDRSRSVSRSNAVFGGRGGSSE
FT                   SFSEQRRPLLLPQELKELGREKEIILLENTKPILAERICYWRDPVFTSRLVAAPAIPAM
FT                   DLVRFIAQVERRVRDVQPDDVDEAGVMHIPPEYLEVLQAWDPRDLPRHLNDVTDEEAAA
FT                   YVERHFMLLGVPAARVAVAARRLSPSDLDVAELRPADRAPKRKSARSTGASRKQHGPAT
FT                   SRPTDGSNVVPLHGERR"
FT   gene            479549..481483
FT                   /locus_tag="Bxe_C0459"
FT   CDS_pept        479549..481483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0459"
FT                   /product="Putative DNA replication primase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36363"
FT                   /db_xref="GOA:Q13HS6"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS6"
FT                   /protein_id="ABE36363.1"
FT                   /translation="MNTRYLSEEERARAALAMIPAEDYATWVDMAFALKQGFGEAGFDI
FT                   WDEWSRTAHNYSERAARVTWRSAGESGGKTLASLFWLAQQHGFDVRGSRAAMDPAERLR
FT                   MSPTHPSVDRAQQAGGVEARVRARQAAVAREALAIWKWARPVGPGNPYLERKQVRSVPT
FT                   LRELEAEELHALLGYAPRSAEELLTGRVLVVPVRIGDTLSTLELIDAHGRKSALAGGAK
FT                   SGGYWVVEPDRFRDGAVTPILIAEGVATALAAWQATGWFSIAALSSGNLRPVAAMWRGR
FT                   YPEAEMLVLADLGAGYEHAKQAALGTSSLLAEPRFAPEARIAGEVPTDFDDMAVLSGFG
FT                   VVGELLREALYGVPQRDAAAGETDGQAVIAQGSDDALKEDHALKEDHAMSNVREKLVGD
FT                   GGVSGRRRTLRRRASSQDAPEPAPSQPAPQETPAPAAGQALSQPPEPDRREADAPRAEP
FT                   PPERATGASSRRQVGEPLYGLDEVPGEIKALAQHRFGAQIRMATPRENGGPYRGEVFNT
FT                   EHYLIQEVSTRSVVFHAKANVEFVSDRLRWMDENQRLNGAEVQVGYDGTHGKVYPWDRA
FT                   RDLLERTVASLKKSAREAGFGNDLDATLDQLQATSWTRVREARAAALAQSKERAGREQE
FT                   QGPGPGHQR"
FT   gene            481529..483103
FT                   /locus_tag="Bxe_C0460"
FT   CDS_pept        481529..483103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0460"
FT                   /product="Putative DNA primase, DNA transfer TraO-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36364"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS5"
FT                   /protein_id="ABE36364.1"
FT                   /translation="MMDETATSSGPRADEPVINVIEPDPPPLPDPQGGAAGAERFDRTA
FT                   ADVLAARRRREFDAVRARLRDQAIQADAPSQATAPQTPSQQTSQQATPHGADDVSATRW
FT                   APLGDPPETVRKRYLRAGNQYFLKDAPHQLAFEDIGPYLVTEHNRPDVVESMVDMARAK
FT                   AWGRIRVSGHEQFRREVWVQATLLGIEVSGYEPKAVDLARLADGRRDRMTNRIDVMEPS
FT                   AAAQAPANRQEAPKAARGSAESQATQPARRDASRAPEARGSAPPAPAEPPRTAPVAETV
FT                   PRVAESEGQERQRYMGELVEHGGAPYQHNPARSDSYYVVYRDTGGADHVVWGVDLERAV
FT                   ADSGALAGQQVMLENLGRRLVTVTVPVLDATGNVIGEEEKEVYRNTWQVDVAGQERAQS
FT                   RPGATERQGDAGRSETAAPEAPEQAQAARRRESSVVPGEERAVQMAVLSAAMRQQGFSE
FT                   RSIARVQQHAQRLMAAFVAEGVSVPRPRVFDPEAPSARSRRARTAAERAPGREVERGPA
FT                   EPAPPSL"
FT   gene            483114..483635
FT                   /locus_tag="Bxe_C0461"
FT   CDS_pept        483114..483635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0461"
FT                   /product="Plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36365"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS4"
FT                   /protein_id="ABE36365.1"
FT                   /translation="MASRARLCVDLGPAKSRWEAWCALHGLTAADGVRQLVHGVLSRDE
FT                   SSEGVTERERHRLLVEGHRERVEIRLTQEELEAASQRALASGLNVNRWMVAVIRAQLVH
FT                   EPQLGEREMRLLADSNQHLAVIVTVLGRLQAHGGASDAGCVLKDTRAVIDTHLRTVTQV
FT                   LRANLDRWSR"
FT   gene            483637..484686
FT                   /locus_tag="Bxe_C0462"
FT   CDS_pept        483637..484686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0462"
FT                   /product="Putative DNA relaxase/nickase, TraS/VirD2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36366"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS3"
FT                   /protein_id="ABE36366.1"
FT                   /translation="MSFPKTYVDQMLLNWGDRLFHDPLRHLRAPRMSRGELRRDVRRMR
FT                   EQLARTLRRTPEVMVKITNRAAGAQGMGAVRRHLRYISRNGRVELEDQDGMTVLGREAL
FT                   HDLTNAWHLGGWGIPEESRRREVFNVLLSMPPGTDRQAVRNAARAFATEEFGDGRRYVF
FT                   AAHDDEAHPHVHLSVQVRGPDGKRLNPRKQDLQRWRERFASQLREHGVEANATRRLARG
FT                   ETRRYPKQAVVHMTKRGEMPRYWRSKADELTRHALWAAHAAPLEAWQGVVHAMAGSQSA
FT                   DDRSLAALVTDFVQTMPVQRDRPDMGRIDRNEGGRRRNPLREHGLRHAERSETQRELFP
FT                   DDPDARVER"
FT   gene            484702..485493
FT                   /locus_tag="Bxe_C0463"
FT   CDS_pept        484702..485493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0463"
FT                   /product="Putative N6 adenine-specific DNA
FT                   methyltransferase, D12 class"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36367"
FT                   /db_xref="GOA:Q13HS2"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS2"
FT                   /protein_id="ABE36367.1"
FT                   /translation="MAMPIIPWIGGKRRLADILIPRFPPHRCYVEVFAGAAALFFMRPA
FT                   AEVEVLNDVNDNLINLYRVVQHHLEEFVRQFKWALSSREVFRWLSDTPPHTLTDIQRAA
FT                   RFYYLQQNCFGGRVEGRTFGTATTSPPGLNLLRLEETLSAAHLRLSGAYIEKLDWQTCV
FT                   ARYDRPHTFFYLDPPYWETEGYGVPFEFGQYERMAVVLKELQGRAILTINNHPAMRALF
FT                   TQFEMECVDIQYTVGGAGNTAPRSELIIYSWDRTKDPVGLF"
FT   gene            complement(485571..485999)
FT                   /locus_tag="Bxe_C0464"
FT   CDS_pept        complement(485571..485999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36368"
FT                   /db_xref="GOA:Q13HS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS1"
FT                   /protein_id="ABE36368.1"
FT                   /translation="MGVLKLALIIAVVVGVAKGIQLFNRHCRRRFGHSFFTTRGFWLAA
FT                   IAINLLWWGFYFWGTAFVHHTTTSDGIILMVLGIVAIAWLLYENIRETDIVHGIGGSTL
FT                   QLVLFLPLALYSFPLLIMGMVFVLVASYKAGPALFIER"
FT   gene            complement(486290..486664)
FT                   /locus_tag="Bxe_C0465"
FT   CDS_pept        complement(486290..486664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36369"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS0"
FT                   /protein_id="ABE36369.1"
FT                   /translation="MGLSVTEIGIAASVPVTRSMHMKEPPITNLHADTTALPEQLFAKT
FT                   LAEPLQQHVLHASLSRLASLGILAPKPAITAASGAVAIVDTATDQRCHILDLRTPGKIA
FT                   AAVALPQIVTRVDAFGWIKD"
FT   gene            complement(486737..487108)
FT                   /locus_tag="Bxe_C0466"
FT   CDS_pept        complement(486737..487108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36370"
FT                   /db_xref="GOA:Q13HR9"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR9"
FT                   /protein_id="ABE36370.1"
FT                   /translation="MNSASRERNPPFTNATGTPNSSDLRAVRHFRTDGIFACVTPESTN
FT                   LPSSGHLILWRFRADWRSASRDEAYSWLSVAKRERAKRYPNRAAAKRYLVGRATLRQIL
FT                   SRMLDCGPGTVVLGDGADG"
FT   gene            487110..487559
FT                   /locus_tag="Bxe_C0467"
FT   CDS_pept        487110..487559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0467"
FT                   /product="Cyanase"
FT                   /EC_number="4.2.1.104"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36371"
FT                   /db_xref="GOA:Q13HR8"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR8"
FT                   /protein_id="ABE36371.1"
FT                   /translation="MISSRNEVTEMIVAAKVAKGITWADVATKVGFSKEWTTAACLGQM
FT                   TLDEQQAKVVGDIFGLPEDAVRWLQVVPYKGALPTAVPTDPLIYRWYEVVSVYDSTMKE
FT                   LIHEEFGDGIMSAIDFSMDIQREPDPKGDRVRVVLSGKFLTYETW"
FT   gene            487906..488340
FT                   /locus_tag="Bxe_C0468"
FT   CDS_pept        487906..488340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0468"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36372"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR7"
FT                   /protein_id="ABE36372.1"
FT                   /translation="MGWPLRPATQLPEMEMNEAPPHLTCSSASAPPGHCGEPSLNRIAI
FT                   HLALLPGQTVSWRIVADSEISAHGSRVWLTRSFSPYDYWMQPGDVLRVTRGERIWLSSE
FT                   GGGTTEVTVTSEHAGRLASTGGWLCRLREIVFDLSFPRAR"
FT   gene            488436..488870
FT                   /locus_tag="Bxe_C0469"
FT   CDS_pept        488436..488870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36373"
FT                   /db_xref="GOA:Q13HR6"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR6"
FT                   /protein_id="ABE36373.1"
FT                   /translation="MNNCKPEFHETGKISQGDDNLQHCIAGVCLTLLLITLFVIAGVCM
FT                   RQEPRGVDGECLQRVTNGEHASLEAFFQNPVQRDAMAQAINACSGRGAAAMWAHETTGL
FT                   GRVRISAHRLGSRKALPTTAHANPAEGTRICTTVRMTRLS"
FT   gene            488926..490056
FT                   /locus_tag="Bxe_C0470"
FT   CDS_pept        488926..490056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0470"
FT                   /product="Putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36374"
FT                   /db_xref="GOA:Q13HR5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR5"
FT                   /protein_id="ABE36374.1"
FT                   /translation="MARKPLGVGIVGLQPGRSWAAIAHVPALRSLPDDYEIVGVANSSP
FT                   ASAKQAAQASDIPYAFADVAELVASPAVQIVTVTVKVPHHFELVKAAIDAGKHVYCEWP
FT                   LGNGLQEAQALADMARARGVLAVVGTQARAAPEIEYLTGLIAGGYVGEVLSSTLVGSGR
FT                   ILGPHVNQVGAYILDVRNGANMLTIPLGHTLAAMRDVLGDVVELSASLIHRRTSATVAE
FT                   TQEVVPMTSHDQVLVNGTLHSGAPVSIHYRGGLSRGTNLLWEINGTEGDIQVSGPSGHT
FT                   QMVQLSLKGARGEASSVEPIEVPPSFYEGWPKEPSPRNVARVYARMAADLRDGTTSAPT
FT                   FDDALAVHQIIAAIESSAGSGLRVPVLLPGRPASDT"
FT   gene            complement(490236..490463)
FT                   /locus_tag="Bxe_C0471"
FT   CDS_pept        complement(490236..490463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0471"
FT                   /product="Putative IS66 Orf2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36375"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR4"
FT                   /protein_id="ABE36375.1"
FT                   /translation="MIPPNTRIWIAAGATDMRCGFNSLAAKVQTALEKDPYGGNIFLFR
FT                   GKRGDLLKALYWCDGGLCLFAKRLEKGRFA"
FT   gene            complement(490460..490858)
FT                   /locus_tag="Bxe_C0472"
FT   CDS_pept        complement(490460..490858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0472"
FT                   /product="Putative transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36376"
FT                   /db_xref="GOA:Q13HR3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR3"
FT                   /protein_id="ABE36376.1"
FT                   /translation="MDRPDDVVAAEPKRPNFTEAFRRAIVEETLKPGASASRIAREHDL
FT                   NVNMVFKWRQRYRKELEAQAARIGGPTEAGTALLPVNVIDVPSPPTSEPPMITSASCEV
FT                   EIEVGKRRVRIRGLSMDLAERFLQDCLK"
FT   gene            491787..492236
FT                   /locus_tag="Bxe_C0473"
FT   CDS_pept        491787..492236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36377"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR2"
FT                   /protein_id="ABE36377.1"
FT                   /translation="MPVARVYTKSQWEAFARALDALPEKPDAERGVTVRDAMKEMRARV
FT                   RAAQAKGYTLEQIAEQAKSHGIDITVGAIRYGLRAAGKGGGANGTRAASGGRAAAHPGP
FT                   SVARSPDSPPRQNQVRKDGGKTVTGQPMPVQGTLGFAIRPDTDDL"
FT   gene            492246..492950
FT                   /locus_tag="Bxe_C0474"
FT   CDS_pept        492246..492950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36378"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR1"
FT                   /protein_id="ABE36378.1"
FT                   /translation="MNKTVDMTVNTIYLVGGGKGGVGKSVVALALVDHLQRRGVNTVLV
FT                   ENDTSNPDVMRAVHEEIACASFDLDTAGGWIDMVNYCDGHRDAVVVVSTAARNQDGVTR
FT                   YGATLGSTLDELGRRLVVFWVINRQRDSLELLRQFSETFPDATVHVVRNGYYGAPERFV
FT                   LYQDSKLRKSIEAKGRSLDFPELADRVADDLRSHRLSVRKAVETLPIGQRAELLRWRAC
FT                   YDAMFSQVTDDA"
FT   gene            492943..493665
FT                   /locus_tag="Bxe_C0475"
FT   CDS_pept        492943..493665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36379"
FT                   /db_xref="GOA:Q13HR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR0"
FT                   /protein_id="ABE36379.1"
FT                   /translation="MRERRSRRTRPADPLARLFLEVSGAPPDDASLLRMRRVSAALNLR
FT                   DNDALWSVLAVLEYYVRLYEAMPERIRQAGAGGVDAARAEAYAATQALMVQHREALARC
FT                   KETITLAERMTAEHEARYRAALAALSDEALSALTQHAADRIARVAGNRIVGAAAVAARE
FT                   QRQRLDAALASFERVAMRRLVRACYGLVAGGLVVVLLAAGAGCVAGWWAGIHWTQADGS
FT                   PPVRTGDTSPVPRPTMRQ"
FT   gene            complement(494180..494425)
FT                   /locus_tag="Bxe_C0476"
FT   CDS_pept        complement(494180..494425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ9"
FT                   /protein_id="ABE36380.1"
FT                   /translation="MFNRIRMTVVAINAEGSPDLYLTFVHATDLQNGHGLHYDMAIARA
FT                   EDEGYRAPMIAFDHNDAAAGALRHALAFKQGETDEV"
FT   gene            complement(494552..496816)
FT                   /locus_tag="Bxe_C0477"
FT   CDS_pept        complement(494552..496816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0477"
FT                   /product="Putative ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36381"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ8"
FT                   /protein_id="ABE36381.1"
FT                   /translation="MQAQVETPVVDTAGSATPLETSFGNEQPVVAVPYSSLHPSPLNAR
FT                   TRPLSGIEGLAANIHAKGLLQNLVVHEMKGGRGKQRKYGVCAGQRREAALDLLYAQKHI
FT                   AADYPVPVRIVSDGEALAISLIENSEREGLDPFDVLRAYRMLAEEGRSVDYIAALFSAS
FT                   PLTVKRRMKLANVSPKLLGLLREDAITLDQLAALALADDHETQEHIWFDANEWQRQPNY
FT                   LRQAITRAEIDASRSRLVRFVGLAAYEAAGGYVRRDLFSDDENAGYIADAELLQKLVAQ
FT                   KLDAAAEEVRAEGWGWIKTRVERDFLELNRYGRLRPVQRPYTDDEQKQMDALTAQQDEL
FT                   AEKLEALSEDDESAYEEADRLNEEIERVNAALIALESVALVWDETQMGGAGVFVVVGPQ
FT                   GELVIERGLVRREDASVLEAAGADVTGTPEAQAHDPASAQAPKLRPIHNAKLCQRLTAH
FT                   RTAAVHAELLAQPAVALAALLHYLVPKALPEHFGRMSAPDFLALTGTNNQDSLLRAADD
FT                   LGTSPAWSAVEAQRARWVAELPAKRADLLPWLVQQDPGATLLDLLAFCTGTLLDGITGE
FT                   ERPHAINALAGALNLDMTRYWTPTRATYFDHVSKARIAEVVATAVSPKAATDLEKMKKA
FT                   DAAAAAELRLAKVAWVPEIFTDREIPAVPSWGGRDGEEDEEDRDEDNDSGTDGDGADSA
FT                   DGTDAQDGDDADTEPGSGAEHINDTPPDTAAVNAPTSPHSTSPSPTTDGVSIGQSGPLA
FT                   A"
FT   gene            complement(496940..497773)
FT                   /locus_tag="Bxe_C0478"
FT   CDS_pept        complement(496940..497773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0478"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36382"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ7"
FT                   /protein_id="ABE36382.1"
FT                   /translation="MQLASSFRYGSPMLRSDSPLSDDQIRRVAPSIFADGKHESRSDRY
FT                   TYIPTIDVLRGLRNEGFQPFMVCQTRVRAQDKREFTKHLIRMRPASEITGEDVNEVILL
FT                   NSHDGSSGFQLLGGVYRFVCQNGMVAGETIGEVRVPHRGNIVQNVINGAFDVLDGFDLI
FT                   REQKDGMKAVTLDRDEQYAFARSALALRYDPSDTEAPAPVTESQLLAPRRFEDRRDDLW
FT                   TVFQRTQENLTKGGLHGRSRSGRSMSTRPITGIDQNVKLNRALWMLADAMRQMKS"
FT   gene            498310..498573
FT                   /locus_tag="Bxe_C0479"
FT   CDS_pept        498310..498573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36383"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ6"
FT                   /protein_id="ABE36383.1"
FT                   /translation="MGETACHAQPEAGAGLIVRGRSTRFASRVSPSGETAVPRITVAVP
FT                   VTGANGVTAWDESGDRAMAIAADERIPGGTAAGSSQGACLLQ"
FT   gene            498630..498896
FT                   /locus_tag="Bxe_C0480"
FT   CDS_pept        498630..498896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36384"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ5"
FT                   /protein_id="ABE36384.1"
FT                   /translation="MKPRTFPRAADRPRRLTLASALAQRERTSAFIGSRIHADVFELEV
FT                   VDIGPYPDRDGNVVTFLARPVGDAVPRTGDILRTAWGICRIVE"
FT   gene            complement(499022..499381)
FT                   /locus_tag="Bxe_C0481"
FT   CDS_pept        complement(499022..499381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0481"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36385"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ4"
FT                   /protein_id="ABE36385.1"
FT                   /translation="MGTPGYDGYVFGQEQAMKVIRSREFTPDRAWGALDIATMQGISVR
FT                   LHWTDQPYRWHVNDGEEVFAVLDGTVDMHYREAGEEQVATLAAGDVFYAGVGCEHVAHP
FT                   RGEARILLVESVGSV"
FT   gene            complement(499440..500234)
FT                   /locus_tag="Bxe_C0482"
FT   CDS_pept        complement(499440..500234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0482"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36386"
FT                   /db_xref="GOA:Q13HQ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ3"
FT                   /protein_id="ABE36386.1"
FT                   /translation="MPRRDAWDPQPKRVPTRKEPVMAHLRLPPPDGIIEWHRHTWGQLA
FT                   CPRVGSIRVSAPGMMWIVPLWRAVWIPPGIDHQVVMLGHVEFHALYIEPGASPLPPDAC
FT                   SVIEVSDLMRVLTESVAGSTPASPRHRSLAMQLLLEEIREAPTLPLGLPLPSERRLRTL
FT                   CAAMMEEPGSDRTLQEWARVVGASDRTLARLFQSELNTSFAIWRRQLRLSRAIDLIGRG
FT                   VPLHVVAAELGYANAPAFSTMFRHALGFPPSQLAGTSGARRL"
FT   gene            500346..501806
FT                   /locus_tag="Bxe_C0483"
FT   CDS_pept        500346..501806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0483"
FT                   /product="Na+/divalent cation symporter, DASS family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36387"
FT                   /db_xref="GOA:Q13HQ2"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ2"
FT                   /protein_id="ABE36387.1"
FT                   /translation="MGELKAARVEVEGPARKPGRRSVHARYGEQIGTGLLILWVVAALI
FT                   LTRYVPLIRGYPVAMSQAAILVFFTVCSWALGLLKEPVTTLLFFLFAMLFSVAPAQTAF
FT                   AGFSSPAWWLVFGGAITGVAVRVTGLAGRFSHVLLAARIDTYGHYVAAVALGAVALAFV
FT                   MPSTTGRVLLLTPLALTLADRLGFGPGRRGRTGLVMAVAAGSYMPPTTILPANIPNSVL
FT                   LGAAQSLYGVHLHYGPYFLLHFPVLGALKTVVLVWLICRLFPDRVESVSGPEAIDGRLS
FT                   GREWTLTVILGLSLLCYATDFWHGISPAWVSLAAGVACLLPQTGIVPAKDFSEQVHVTP
FT                   LVYVAGFLGLGALISESGLGGWAAGLILHWVHMMPGHTLANVIWLELTGACIGLLTTLP
FT                   GLPAVLTPVAGQFAHASGLPLYTVLMLQVPVFSTVFLPYQSPPMMIAMHMGGVSLRDGT
FT                   KLCIPLAAITVIALLPLDWMWWRLLGMV"
FT   gene            501944..502504
FT                   /locus_tag="Bxe_C0484"
FT   CDS_pept        501944..502504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0484"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36388"
FT                   /db_xref="GOA:Q13HQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ1"
FT                   /protein_id="ABE36388.1"
FT                   /translation="MLDLRRLRYFVALADELHFGRAAQRLHVAQPPLTRQIGLLEAELE
FT                   FPLFQRTSRTVQLTTAGARFLPFARAIVDDCVRAEDYARKLAQGTAGSVTIGYSASVSL
FT                   DAGFGAALRSAALQFPDIGWSLVEMPSGILNESVRGGQVDIGISRLAPGTERADVRIER
FT                   HLTEHVVAALALDDPLSTHEGKR"
FT   gene            502700..503698
FT                   /locus_tag="Bxe_C0485"
FT   CDS_pept        502700..503698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0485"
FT                   /product="Putative transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36389"
FT                   /db_xref="GOA:Q13HQ0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ0"
FT                   /protein_id="ABE36389.1"
FT                   /translation="MNRTAVGVDIAKSVFQVHYVDPETGEIVNKPIKRAKFLEFFANRA
FT                   RCLIGMEACGGAQHWARQLMKMGHEIRLMPAEFVKAFNIRNKNDAADARAIWLAVQQPG
FT                   KPVAVKTEMQQAMLALHRMRRQLVTFRTMQINGLRGLPTEYGEVMGRGRAALDKAIPEV
FT                   LRRVAERLPAVVIDTLREQWNGLTKLDEQVACIERRMREWKKQDKAVQAISEIPGVGLL
FT                   TATAAVAMMGDAKAFSSGREFAAWAGLVPKQTGSGGKVNLHGISRRGDTYLRTLLIHGA
FT                   RSVLTHAKDPGPWVEQMKKRRPLNVVVVALANKIARTIWAGTFLRYSYNFP"
FT   gene            complement(503776..504471)
FT                   /locus_tag="Bxe_C0486"
FT   CDS_pept        complement(503776..504471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0486"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP9"
FT                   /protein_id="ABE36390.1"
FT                   /translation="MRTTIIYAALVVVLSLLMATGCTSGDSGSRLQGVSTTTIAEPCCG
FT                   PISPAAQTILGMLDNSNVEHLWPNHRHINWETGEPDEPEGYAGPGKHTHCSAFAAAIGE
FT                   RLNVYMLRPPEHSQILLASAQTHWFNSPEGRGAGWFAIADLRQAQSLANQGKLVVVAYE
FT                   SPNLKTPGHIAIVRPSAISSDALRDRGPEVTQAGAENYLRIDARTAFAYHPGAWPEGVR
FT                   YFGHDVPRR"
FT   gene            complement(504637..504885)
FT                   /locus_tag="Bxe_C0487"
FT   CDS_pept        complement(504637..504885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36391"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP8"
FT                   /protein_id="ABE36391.1"
FT                   /translation="MMPTRGFRRSLGTGKSLSFSNSKSNFNQVAVVTDYFFSKTTHLFF
FT                   MAGWQRAGGATHQAQLSGTASSNNHQILLTAGIGKKF"
FT   gene            504939..505964
FT                   /locus_tag="Bxe_C0488"
FT   CDS_pept        504939..505964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0488"
FT                   /product="Putative transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36392"
FT                   /db_xref="GOA:Q13HP7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP7"
FT                   /protein_id="ABE36392.1"
FT                   /translation="MPIVTIGIDLAKNIFAVHGVDEAGKAMLIKPRVPRDQLATLIAQL
FT                   PACLIGMEACSGAHHWARLFQQHGHTVKLMAPNLVAPYRMSGKRGKNDAADAAAICEAV
FT                   ARPSMRFVPLKDEHQQATLCLHRTRQGFVEERTATYNRLRGLLPEFGVVLPQSPEKLRR
FT                   YVTEHLDALPGWAKRSIGDLLEHAGHIEDRLLEYDRAIAEIAREDARSKRLMQLRGVGP
FT                   TTASALLASIGAGRDFRNGRQVAAWIGLTPGQYSSGGKARLGSITKAGDAYLRGLLVNG
FT                   ARAVIANLGEKQDRFSRWVRTLIERRGYWRAAVAIAAKNARLAWASLKYGEDFKLEPAA
FT                   D"
FT   gene            complement(506300..507106)
FT                   /locus_tag="Bxe_C0489"
FT   CDS_pept        complement(506300..507106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0489"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36393"
FT                   /db_xref="GOA:Q13HP6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP6"
FT                   /protein_id="ABE36393.1"
FT                   /translation="MPERKPYPTDVSDEEWSFAAPYLVLMNEGAPQRRYELREMFNALR
FT                   WMARAGASWRMLPTNFPPWELVYQQTQRWLNAGCFKAMVNDLRSVLRVAQERQGQPSAV
FT                   ILDGRTLQSTCESGPRAGYDGHKRKRGSKVHMAVDTLGLLLAVHITPANEQERAQVGEL
FT                   ARQVQHVTGQTVKLAFADQGYTGDTAAQAARDEGMELQVIKLPEAKKGFVLLPRRWVVE
FT                   RSFGWLNRFRRLARDYERLPETLAGLHFVVFAMLMLVHAVPIIQST"
FT   gene            complement(507569..508720)
FT                   /locus_tag="Bxe_C0490"
FT   CDS_pept        complement(507569..508720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0490"
FT                   /product="Putative transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36394"
FT                   /db_xref="GOA:Q13GS0"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13GS0"
FT                   /protein_id="ABE36394.1"
FT                   /translation="MDTPDTALRGQNTTAGGRLYMAFELGERNWKLSLGDGQRAPSRCT
FT                   VAAGDTAAVLTAIANARARCHLGADAPVYSCYEAGRDGFWLHRWLAEQGIVNLVVDSAS
FT                   IEVNRRARRAKTDRLDSDKLLSMLMRYYAGERRVWAVARIPTPEQEDDRRLHRELERLR
FT                   KEQTAHTNRIRSLLVLHNLRIRSVGGRIWTHWWTSQRELLAPGLRAEIDRECERLVLVH
FT                   QQIRLLEVQQERQVRSGAHPGMALLAQLAGIGAGSAWTLVRELFGWRQFRNRREVAGCL
FT                   GLTPTPYASGTSEVELGISKAGNRRCRWLMVELAWSWLRLQPGSQLSHWFNERFAGTGK
FT                   RMRRIGIVALARRLAIALWRYLEHGEIPVGAIFKPRDVNTVRA"
FT   gene            complement(509292..509606)
FT                   /locus_tag="Bxe_C0491"
FT   CDS_pept        complement(509292..509606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36395"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP4"
FT                   /protein_id="ABE36395.1"
FT                   /translation="MPVADHSAIVAFETLKGRYQKAGRHLRFANIDTQSTCSQTRGCFR
FT                   YQRPTPVESQNLCGRCASKATLSKEACQTTELGRQNAVVKAEAAPGDVLIGGEAAVAVC
FT                   "
FT   gene            509759..510181
FT                   /locus_tag="Bxe_C0492"
FT   CDS_pept        509759..510181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36396"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP3"
FT                   /protein_id="ABE36396.1"
FT                   /translation="MTASSREARFPVSRVGPYRRMLKESSETKVVADIRSEHLFPVTDG
FT                   DTARDSAGGWVQGRIELVEPPGSLVMVQVMVGYSVIVAQFERPPGFDVGRAIILQHKIY
FT                   APHAFDVGTERSVLAAPLRVPCGVWQCMSERFEPYS"
FT   gene            510311..510556
FT                   /pseudo
FT                   /locus_tag="Bxe_C0493"
FT   gene            510546..511448
FT                   /pseudo
FT                   /locus_tag="Bxe_C0494"
FT   gene            511282..511758
FT                   /pseudo
FT                   /locus_tag="Bxe_C0495"
FT   gene            511957..512220
FT                   /locus_tag="Bxe_C0496"
FT   CDS_pept        511957..512220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP2"
FT                   /protein_id="ABE36397.1"
FT                   /translation="MAVISAAEHEIPPVKKHSSKWRRIMTQRRCGERLKRSSATDVGPT
FT                   TAHVAAPLERIGRLFWNQPASHKSPDFYNSSLKKSDFSKIKK"
FT   gene            512438..513619
FT                   /locus_tag="Bxe_C0497"
FT   CDS_pept        512438..513619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0497"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36398"
FT                   /db_xref="GOA:Q13HP1"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP1"
FT                   /protein_id="ABE36398.1"
FT                   /translation="MPLVAAVLTAITGTAHAQSSVTLYGLIDEGVLYNTNAKGGHQYAI
FT                   TNSTAQGDRWGLIGREDLGGGLQAIFRLENGFNIETGALEQGGAEFGRQAYVGFAGKFG
FT                   QVTFGRHYDPIVDSVSGYILAGSTHQGGAGQVGGVFSSHPGDMDNLDNSYRVNNSIKYY
FT                   SPVFDGFQSVALYSVGGVAGDYSRNQIWALSASYNSGSFSAGAAFEKINEPNFSLFGNN
FT                   PSSSATGNNMAATPVYSGYASAKSQQIATAGASYAVGAFSIAAIYSNVRFSDLGSVGGG
FT                   VLNPNNLSGTAVFNTGELNVGYRITSSWMVGLGYTYTQGTSFDSLPAAKYKQINIGTDY
FT                   ILSKRTDLFAMCSYQRASGYDSTLKPAVASIYTATPSASNTQLVATVGIRTKF"
FT   gene            513681..514931
FT                   /locus_tag="Bxe_C0498"
FT   CDS_pept        513681..514931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0498"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36399"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP0"
FT                   /protein_id="ABE36399.1"
FT                   /translation="MLAELILVTKMAFLRRLFDCRISRHVLSLGVLILGIGTLLALPVM
FT                   AVEPFKIVGIVALSGTYGIYGDDMRKGLDLAVAQRKTVLGRPIQVVWEDTQSKADVASQ
FT                   KAIKAASSGADLIFGSVASSETLALEQISESRKIPLLITQSSADAITAKPHRYVFRTRE
FT                   KFSNEVLMVQHYIEKNKSASVYAVVADASVFRDGWTEIQHGLVADGVALKGDDVVPFGA
FT                   TDYSVVVGKAAASGANTLVLFLAGSDAVTFIKQAAAVRLMDHMRVVGPTIMDDSMAKAA
FT                   GDAALGVVSAVGYHHSIDNDANRKFVSEYRKSYSGIAPSFGAGEAYEGINWMLDVIERT
FT                   HSSDPAVWISAMEKSADPNSIEGAKRMRWCDHQADRVSYMVEGVKGSGAQPELKIIGAW
FT                   TDGELGQKPCPVGQGRP"
FT   gene            514928..515788
FT                   /locus_tag="Bxe_C0499"
FT   CDS_pept        514928..515788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0499"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36400"
FT                   /db_xref="GOA:Q13HN9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN9"
FT                   /protein_id="ABE36400.1"
FT                   /translation="MSTIVIGLSIGMLLFLLASGLTVIFGTLGVVNFAHGAMYSFGAYL
FT                   TWQAISWTNSFWLGLAFAPLVMAAVGFVFEILCLRKTYSRDHVLQLLVTFGLVLILEEV
FT                   AKVIWGLDYKNVSTPGILAGTWSVAGTEVAIYRLFVIAFGSVISFALFAVIDHSRAGMI
FT                   LRAAETHAPMVRCMGIKVDWVRTAVFAVGSGLAALGGAIASPLLPVQPGAGFTIIIDSF
FT                   LVVLIGGLGNIRGAIFSALAIGMGRALGQRWLPDWVDILTYAILVGVLMLSPQGLFSRG
FT                   PGRKG"
FT   gene            515785..516729
FT                   /locus_tag="Bxe_C0500"
FT   CDS_pept        515785..516729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0500"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36401"
FT                   /db_xref="GOA:Q13HN8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN8"
FT                   /protein_id="ABE36401.1"
FT                   /translation="MKIRYTGLIVVAVGLIAIGFQYLRGDGGAAFLVGLMLVWAIAALG
FT                   YDLVFGLSGLLSFGHAAFLGSGAYAVAILTTQWMLPFPVALFISAVLGALLALVFGAAA
FT                   LRASGIYCGLLTLALAQLTNILLTVRLQGLTGGDDGISGVSRPIKYLQFLTDDLNYVVY
FT                   VGCIFLGALALSALLRLSPFGQVLRAASQNEVRAEQLGWNVRRYRLAIFAVSGAYTGIA
FT                   GGLIAGLTQFAGPQLMQWSNSGDLIIMTLLGGRDSLLGPVVGVVLTILLREVVGSYTEH
FT                   WAGILGVVFVLCTLYMPVGVIGLWRNFRGKGAT"
FT   gene            516726..517520
FT                   /locus_tag="Bxe_C0501"
FT   CDS_pept        516726..517520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0501"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36402"
FT                   /db_xref="GOA:Q13HN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN7"
FT                   /protein_id="ABE36402.1"
FT                   /translation="MNASPVSHIAGSIEPSPVLLCENISVDFAGFQALREVTVSVRSGQ
FT                   TIALIGPNGAGKSTLMNVMSGLLSPTAGSIRLHDRDVTSSSPSKLARLGVARSFQNISL
FT                   FASMTVYENLRLAVQRQLFDIAPFWKPVAGYRRLNEATDLALERSHLTTHRNRLAAELS
FT                   HGQQRALDLGMTLIGDPKILLLDEPLAGVGHDDLDFFLTLLRKVCSNRTVLLVEHNMDA
FT                   VMGLADEVVVLVGGQVLTKGSPAEIRANPKVRESYLGSGEES"
FT   gene            517517..518230
FT                   /locus_tag="Bxe_C0502"
FT   CDS_pept        517517..518230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0502"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36403"
FT                   /db_xref="GOA:Q13HN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN6"
FT                   /protein_id="ABE36403.1"
FT                   /translation="MNPVIALDGADVFYGSTQALYGVSIAVRPGETVALVGRNGAGKST
FT                   ALRALMGLLPCRRGRRLIDGMDGSLLGPEAVNRLGVAYVPEDRQVFSNLTVEENLRIAS
FT                   FVRRRCDAPQWRLDEIWELFPRLFERRSARGQTLSGGEQQMLALGRALLCNPRVILLDE
FT                   PTEGLAPLVVGSLVTAMKKIADSGVATILVEQNFVVPGHVANRFLIVDNGVVKWGGDRV
FT                   SFLAQREKLENLLSV"
FT   gene            complement(518851..519813)
FT                   /locus_tag="Bxe_C0503"
FT   CDS_pept        complement(518851..519813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0503"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36404"
FT                   /db_xref="GOA:Q13HN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN5"
FT                   /protein_id="ABE36404.1"
FT                   /translation="MDLRQIRTFVYIAELRSYTRAAAFLHVSQPALSRQMRLLEEELRL
FT                   KLFLRHGHGVELTNEGVAFFARCRDVLSEFEQLRHDFRSTGANKAVMGLVSVGLPAPAT
FT                   RFATPKLLHAARKSYPGLSVRFAEGFSALLHEWLLSGSLDLAVLFGSNTPKLLTSLPVL
FT                   VEDLVAISAATKTSRKKNFVNAQDLQNTPLILPHRPHILRELIDSLHLKKVEILEVDST
FT                   SLMIELARVGDGTTILPAGSAEQSIRAGHVVALPIINPTLSWQVSICYSSVRPLSVGAR
FT                   VVLDLMRREIAQKVTSGEWLSGRLIRPGTEMTEGLDAAP"
FT   gene            520117..520881
FT                   /locus_tag="Bxe_C0504"
FT   CDS_pept        520117..520881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0504"
FT                   /product="Putative carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36405"
FT                   /db_xref="GOA:Q13HN4"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN4"
FT                   /protein_id="ABE36405.1"
FT                   /translation="MDEALEQVQYPLFGKWGLIGEKGGNDIYADRCSVYIFGQYYGRDG
FT                   LDLKTRGLLVVSALGVLMREGVLPTWTNACRNLGWTEDQLKELGAVISHVGGFPVSRGS
FT                   LMMMDEVFEKRRKMTGEQVAEVGSGETRRDLYVAACETAQRLFGNPDGDFDDVALPEGD
FT                   NFRKQMVTWVFGYLFNERNLIPERAKVLSVIVMSTVIGRIPMAKRWMGAAQRIGLKRVE
FT                   VQESLLTAALYGGWPTAAEALGALAEVWPLGD"
FT   gene            520895..521296
FT                   /locus_tag="Bxe_C0505"
FT   CDS_pept        520895..521296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0505"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36406"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:2O8Q"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN3"
FT                   /protein_id="ABE36406.1"
FT                   /translation="MKLQTTIQHEPKDGSGFDRGLREFFEYRDTGVNEATGGMFGAHVI
FT                   RAIPGKEAKPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVMLEAGGSAFQPPGVRHRELR
FT                   HSDDLEVLEIVSPAGFATSVVDLEEARKP"
FT   gene            521293..521673
FT                   /locus_tag="Bxe_C0506"
FT   CDS_pept        521293..521673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36407"
FT                   /db_xref="GOA:Q13HN2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN2"
FT                   /protein_id="ABE36407.1"
FT                   /translation="MTMMYDWNRLPREVVRPGVERCGFRGDDSILVMNWISPAIDVRPH
FT                   QHEFEQLVVCVQGSFNYHVGDRVFHMAPGCMLRVPPRTVHYIEPVGHEVALNLDIFAPM
FT                   RDDYRHLVEYQAGEFPGNRGNA"
FT   gene            521676..522437
FT                   /locus_tag="Bxe_C0507"
FT   CDS_pept        521676..522437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0507"
FT                   /product="Putative HpcH/HpaI aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36408"
FT                   /db_xref="GOA:Q13HN1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN1"
FT                   /protein_id="ABE36408.1"
FT                   /translation="MVEGRALRERLRAGERLIGTFVKTPAPAVVEVLGRTGIDFAVLDA
FT                   EHAPFDRTHVDACVLAGYAVGLPVLVRLRAASAQAVQSVLDLGAAGVIVPRVNDVATAK
FT                   AMRQACEYSDAGRGFSNSPRVGNYGTLEQSALVAQERQRPIVICQVEDAAAVERIEDLA
FT                   ALDDVDGFLLGRADLAVSLGCGSLQDPAVQRAVDRVVAACRSAQRAAGIFLGQAAEIPE
FT                   YIDKGVHFFVVGSDQSAMLSYFRAVARSVED"
FT   gene            522440..524122
FT                   /locus_tag="Bxe_C0508"
FT   CDS_pept        522440..524122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0508"
FT                   /product="Putative dehydrogenase flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36409"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN0"
FT                   /protein_id="ABE36409.1"
FT                   /translation="MGDSRLTVNTGTLDEVDVVVVGSGAAGMTAAILAHDHGARVMIVE
FT                   RTDKVGGTTAVSGGGIWIPLNHRMGELGFSDSRAEALAYLTQLAMGRTDPELLETFVDT
FT                   AATMIKYLEDHTPLVFGAMTATDYQPELPGGKFGGRSLEPKPFDTNLLGDWRSRLRPPS
FT                   AFAFPLTREEAFGKYDTFFRPWLVPQDLAAERLMKGVVTIGQALAAGLLKAVLDRNIPI
FT                   MLETRVRQLLVEGDRVAGVIGEQEGTRQQIVRARAAVILASAGFEWNPRLQAQFLTAPI
FT                   ENPNSPPFNEGDGLLMAMEVGADLGNMAEAWHYPSLMIPGETYEGKPLSRPALAERNGP
FT                   HVIWVNRDGRRFVNEAANYNSVGRLFHEIRTDGPVFRNLPAWALMDSQYRSQYVLGTTM
FT                   PEDPDPQWLIKGATLEELAGKVGIDVKQLLATVQEWNDCVRQGADLRFGKGTSSYDRSQ
FT                   GDKQAMHPNLGTIEKAPFYAVPIHTGALGTKGGPRTNCRAQVLHVRGHAIPGLYAAGNV
FT                   AASITGPGYPGRGATLGPGMTFGYIAGIDAAGEAKRLVEKAAK"
FT   gene            524119..524673
FT                   /locus_tag="Bxe_C0509"
FT   CDS_pept        524119..524673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36410"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM9"
FT                   /protein_id="ABE36410.1"
FT                   /translation="MISTQREIVVQQPPAQAWIFVREIGNWAAQMPGYLKHEEKGPDDS
FT                   VWTLDIHLGPFSRPVELSVHVVRWLPGEGADFRLKATYEPFHGEGSFRLTAVPGGTNMV
FT                   MILGTEVTGSMSKLLTAMAAPVLEKVADEFSRNLVAVLGGAPELASPSDRPAQNDTRTS
FT                   IVSAFRGWLVGIHRRLTRAKT"
FT   gene            524735..525166
FT                   /locus_tag="Bxe_C0510"
FT   CDS_pept        524735..525166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0510"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36411"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM8"
FT                   /protein_id="ABE36411.1"
FT                   /translation="MKDETNQEARPVRPHPVMTMDTEFFWNAAREHKLAIQRCCNCGKL
FT                   RHPPMPSCPHCYSFEWDTVESAGNGTLLSYTVVYAPLVTPFTKPYAVGLVALDEGTRLV
FT                   AELVDANFDELRIGMPAMLDFMDCEGDLTLPVFRVQRER"
FT   gene            525181..526350
FT                   /locus_tag="Bxe_C0511"
FT   CDS_pept        525181..526350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0511"
FT                   /product="Putative acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36412"
FT                   /db_xref="GOA:Q13HM7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM7"
FT                   /protein_id="ABE36412.1"
FT                   /translation="MDISQAAIAGIGATAFTKKSGVSEWRLAVEAVKAALDDAGIAPTE
FT                   VDGLVTYSMDTNPEVYIAQALGMKDLTFFSRIHYGGGAACATIQQAALAVTSGVAKVVV
FT                   CYRAFNERSGLRLGSGVMAETQAVTTESLRYGWVAPYGLKTPASWVALFAQRYMHVYGA
FT                   TSESFGHVAVSSRKYAATNPKAHFYGRPITLEDHQQSRWISHPLRLLDCCQETDGGQAL
FT                   VVTTLDHARTLRHKPARIVASAQGSAPQQHPMTSFYRDDLTGLAEMGVVARQLWAQSKL
FT                   KPSDIDAAIIYDHFTPLVLMQLEELGFCERGEAKDFVKGHTFDLTGELPMNMNGGQLGE
FT                   AYLHGMNGIAEAVRQIRGNAVNQVSDVNHVLVTAGTGPPTSGLILAAEH"
FT   gene            526388..527368
FT                   /locus_tag="Bxe_C0512"
FT   CDS_pept        526388..527368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36413"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM6"
FT                   /protein_id="ABE36413.1"
FT                   /translation="MGADYASAVSYTRTGSGDDLPDWVGREFVIHAPFPVESSRIADFC
FT                   AMLEDPNPLYWDIEAATQKFGRPIAPPATLTAWRWPAPWNPYGRPEHGFPATVEVPCPT
FT                   DTLVNVEFACEYLQQIGVGDKLTYVDRIAAISDEKMTALGRGYFVTADTVVTNQENQEV
FT                   ARYRNVMLRYKSGTGKAADSQKVQQPAPEKVPTDSERPIPALSIPVTWTLCTQLTAATR
FT                   DYFPGHHDPDYARSQGVLNPYPNTGYYCGLMDRVALEWANFDGVLKRRVLRMFTPAPIG
FT                   TTLRTSGRVLSRQTVEGTEHVELQIEVRNEEALIAQARITLKMGA"
FT   gene            527370..528533
FT                   /locus_tag="Bxe_C0513"
FT   CDS_pept        527370..528533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0513"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36414"
FT                   /db_xref="GOA:Q13HM5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM5"
FT                   /protein_id="ABE36414.1"
FT                   /translation="MNSNLIETSAEHQQIYDSVAKITRAYGHAAFAKAGRRGEEARELW
FT                   QNLAEAGYLGISVPEEYGGSGQGVEELAIVLEATAAQGCPMTSFVVLPIIVFVLSKHAT
FT                   EAQKREILPAIATGEKRLAFAITEPDAGTNTHNLKTNAVRTANGGWRLSGSKYYITEAE
FT                   VADALLVVARTGVDEATGRGKLSLFLVPKHLKGVTLQNLPTELIVPERQASVFFDDVEL
FT                   PADALIGAEGEGLRNVFAGLNPERIAVAALCNGLTTYALTKACEYAKVRKVWKTPIGAH
FT                   QAVAHPLAEAYARLQLSKMATQRAAQLYDAGRDAGDASNIAKLTASDTAVFALDRAIQT
FT                   HGGNGFSQEFGLGDLWFVARVQQTAPVSREMVLNHIAQHNLGLPRSY"
FT   gene            528575..529777
FT                   /locus_tag="Bxe_C0514"
FT   CDS_pept        528575..529777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0514"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36415"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM4"
FT                   /protein_id="ABE36415.1"
FT                   /translation="MIYGIRNAIAALMLGVTFPCMAQISENVIRIGVLTDLSGPYMDVD
FT                   GPGGVEAIRMAIADAGGTIDGRRIELLVADHQNRTDLAVSKAREWIDTRGVDVIFAGGA
FT                   SAAVLGMAQVAKEKKKPLIVNGAGSARLTNEDCSPYTVHYAYDTVALAKVGGAALVRQG
FT                   LKSWFFVALDTAFGASTVSDTSEVLRANGGKVIGVVRHPVNLPDFSSIMLQAQGSGAQV
FT                   LALANAGSDAVNAIKSAKEFGVMRSMKVAGLNLFIGDVYSFGLPTAQGLYLTENWYWDI
FT                   SPESRAWSKRFFEKMKKMPAGTQAAQYSAASHYLAAVKETRSDDGDKVMAAMKSMPIND
FT                   MYAKNGRIRADGRMIHEMYLMQVKTPAESHYPWDYYRIAERVPAEEAFTTKAQSKCPLW
FT                   K"
FT   gene            529974..530774
FT                   /locus_tag="Bxe_C0515"
FT   CDS_pept        529974..530774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0515"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36416"
FT                   /db_xref="GOA:Q13HM3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM3"
FT                   /protein_id="ABE36416.1"
FT                   /translation="MKSNKQYSSLGISESNGVLRCVLAPGHRLNLIDAATHEELEEFFA
FT                   DLVHREDVRVVVLTGAGNVFSSGGDLRSVANDEYHKGLPGGATTRAGLRMIRNLVSVPQ
FT                   PVIAALNGDCCGLAASIALHCDIIVAHERARIGDPHVSVGAVAGDGGAVVWPLQVSLSR
FT                   AKEYLMLGELIPAREAERIGLINHVYDDATYDAAVERLATRLASGAMYAIRWTKAAINK
FT                   VLIERVNMVLDTSLALEGLSFTTQDYKEGMSAFLEKRQPMFKGR"
FT   gene            530779..532350
FT                   /locus_tag="Bxe_C0516"
FT   CDS_pept        530779..532350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0516"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36417"
FT                   /db_xref="GOA:Q13HM2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM2"
FT                   /protein_id="ABE36417.1"
FT                   /translation="MTSILDQPDILFPDVIRHNARFHGIKTAVVCGDDRLNWREFHLRT
FT                   NKVANALVRAGLQKGDRVCFFMQNSMAAFELIWGTIKAGGVVSPLNVMMAADSLPAMID
FT                   NAAPRFIFVDSELAGAVDAVRGAVRNKPDIFYAESGAVEGWQSYVELVEAGSEAEYFPD
FT                   LKLSDTMTVLYSSGTTGVPKGSEHTHAARHFYSLGCGPALRMDPYSVALCATPLYTNGT
FT                   WITLLPALYLGGTVVLARKLTPQAWLELVARERITHAFLVPTQCIGIVERASPEYDVSS
FT                   LQGILYGGAPMTSQTAAAMAKTFPNTRMYEIYGMSEGWCTLAYPEDRAHGRSSTVGKPV
FT                   FGGDICVIDPEGRELPPGEQGELAGWSAGLMKGYLGDPQRTADIVWKGPHGRTYLRSGD
FT                   IGYMDTEGFFFVNGRVKDMIISGGINVFASDIEEVFMQHPAVAEAAAIGIPHDKWGETP
FT                   IVMVILRQGHQIDAVALKEWGNHRLGKFQRVSEVKFVDDFPRANYGKILKRVLREPYWE
FT                   GRERSI"
FT   gene            532507..533040
FT                   /locus_tag="Bxe_C0517"
FT   CDS_pept        532507..533040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36418"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM1"
FT                   /protein_id="ABE36418.1"
FT                   /translation="MNQEDDAKLAYLMAVNAIQMTKARYCRFVDTKQWDRLRTLFTADC
FT                   RFEGLGSAPDRADLDIFIQGISRRLAHVVSVHHCHMGEIELVGADEAKVIWAMEDHLEW
FT                   QDSGEVVEAPGNRGFRGYGHYEECYVRQGDTWKISLLRLTRLGIHPIPDAQPRLGTGRL
FT                   GANPDWLPSDRRLR"
FT   gene            533037..533594
FT                   /locus_tag="Bxe_C0518"
FT   CDS_pept        533037..533594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0518"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36419"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM0"
FT                   /protein_id="ABE36419.1"
FT                   /translation="MTAERKHLHSRCITCEAYLCEDGSVELEGMLTDTKSHPFNVGDQG
FT                   VLPTGHPVHQMLVRLRVASDFRITEAEARTIHGPYRVCGDIAPQYSKLVGLTIGPGFNA
FT                   LVKRMFRERLGCTHLTELLPVIATVAYQAIWSEFRSFEKFDPANAAERRSTPLGGCHAL
FT                   QPDGEVVRLHFPDRYKPPDPSA"
FT   gene            complement(533591..533971)
FT                   /pseudo
FT                   /locus_tag="Bxe_C0519"
FT   gene            complement(534128..534847)
FT                   /locus_tag="Bxe_C0520"
FT   CDS_pept        complement(534128..534847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0520"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36420"
FT                   /db_xref="GOA:Q13HL9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL9"
FT                   /protein_id="ABE36420.1"
FT                   /translation="MLKEDNRNGNHLLAVLPQTEWARLAPHLVPVDMALGQVVYESGNR
FT                   LDHVYLPSTAIVSLLYVMEDGASAEIAIVGNEGMIGIALFMGGETMPNRAVVQSAGRAY
FT                   RLDARILKEEFHRAGPAQRLLLRYTQALITQMAQTVVCNRHHSIDQQLCRWLLLSLDRL
FT                   PSNELNMTQELIANMLGVRRAGVTEAAVKLQDAGLIRYSHGHIEVLDRPGLEKRVCECY
FT                   GVVKRECDRLLPDLEAI"
FT   gene            535106..539140
FT                   /locus_tag="Bxe_C0521"
FT   CDS_pept        535106..539140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0521"
FT                   /product="Multi sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="contains CheB and CheR domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36421"
FT                   /db_xref="GOA:Q13HL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL8"
FT                   /protein_id="ABE36421.1"
FT                   /translation="MNDASNISPTPGAATGPRIVAIGASAGALHALSLFFRAACTIPHD
FT                   IAFAVVVHLAPGAESHLPELLAKDTSFAVSAIEDGATLRPGHVYVIPPKVSVVIEQGAF
FT                   RLRPAVERPTIPMPIDAFFTSLATDQHDRAIGIVLTGANADGSAGLRAIKAAGGMVMAQ
FT                   APETAEHDSMPTHAIATGLVDYVLPVEKMPAVLFDYIARSTEEMSSVSGKLEVQTDLEP
FT                   VLRALAAAGSDFRGYKRGTLGRRIARRMAVNQVDSLDAYCEILRTSVEEAQALSLDMMI
FT                   GVTEFFRDPEAWKALAERVVDSLLGEQKGDQPLRIWVPGCATGEEAYSMAMLLTEEIEK
FT                   RKITRSFMILASDVNRIALARARQGIYPPGVALPVGEERLERFFRAHGDGYQIDQALRE
FT                   TILFTPQNLIADPPFSRVDLISCRNLLIYLEPAAQQRVFEVFHFALNPKRYLFLGRSES
FT                   TDPDSSQFQEVSRTWRIYQRSPAATAVVSGYRFSATGGRREEFPSASRGGARSKGYAEL
FT                   VNGTLLAEHHAASVLINSAHQVLYVSGSTDEYLRQPAGEPTGNILDMAREGLRLKLRIV
FT                   LRRATQDQTVSPVSEVVSDGGAPGVKITVTQPFDTAHTGKALLVVFARVAVADRPASLA
FT                   PTGVDSDLWHLESELRTTQVELGSTIEELEESNSELRVSNEEILSMNEELRSANEELET
FT                   SKEELQALNEQLNVVNSQLGQKVHELEMLSEDVTNLLASTEIATLLLDGHAVIKRFTPR
FT                   AARIFGLALADIDRPITNVLGNPLGDALLEDVQRVLSAQTGQAEKEIETVTGEWYVRRI
FT                   TPYIAVKGASPAGVVVTWNDITHVKASDERSRRLAAVVQDSNDAMTVFDLNGRLMAWNR
FT                   AATAMYGYTEAEALGMTVSDMLPPGARQDHLDFIRYAAHNEALHSYETQRVTKGGRVVD
FT                   IWITLSILSDDQGHAVAIATTERELTDRSLSNAQLRERAERLAQADRRKNEFLAMLGHE
FT                   LRNPLAALCSSGDLLASETIDPRQKSWAVGVIQRQGRSMTQLVNEMLDLTRITSGSIEL
FT                   RRQAVTLKAVIQSAVEVCQPIIDERHHTLSVSLPDEPVLMYVDPTRLSQVVENIVINAA
FT                   RYTEPGGHISLTATRTGRRLSLRVKDNGRGIPASMLSTLFDMFVQGPVPYGQLHNGLGV
FT                   GLSVVRRLVELHGGSVRAISDGRTGSEFIVDLPLGMIPPGVEQAGTPQEPVNAGPRKIL
FT                   IIDDNADASEALAMLLAAEGHVVETRLDGPGGLEAASTFRPDVVLLDIGLPGMDGYEVA
FT                   KQLRDSVATYDTMLIAVTGYGQPGDQLRSAEAGLDYHLVKPVDINALTRLLAVQVKPRG
FT                   R"
FT   gene            complement(539348..539644)
FT                   /locus_tag="Bxe_C0522"
FT   CDS_pept        complement(539348..539644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36422"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL7"
FT                   /protein_id="ABE36422.1"
FT                   /translation="MNERKKLDLRVAAQGLDEAGAEDVSRDIALSQDGNRYGAVLSVNL
FT                   RQDIRRRLRFTTGIVAAMRSQQHSCAVAFRIAGNVSRRQSVAIAPSPEEQSAR"
FT   gene            539899..541281
FT                   /locus_tag="Bxe_C0523"
FT   CDS_pept        539899..541281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0523"
FT                   /product="Putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36423"
FT                   /db_xref="GOA:Q13HL6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL6"
FT                   /protein_id="ABE36423.1"
FT                   /translation="MTYQSVNPNTGKTLKSFDELNDQQLEKALSTAQSCFHVWKKTSYA
FT                   QRAAIISRAAGLMRANVDEFAKLATLEMGKRIDEARGEVNFSADILDYYARHAEAFLAP
FT                   TKLHPKVGEAHMETSPFGVLFCVEPWNFPYYQLARVAGPQLMAGNVLVVKHAGCVPQCA
FT                   IAFEKLLIDAGAPVGAYTNLLISHKQAERIIDDPRIQGVALTGSVAAGRSIAARAGQNL
FT                   KKTSMELGGSDAFIVLDDADLEKTIPWAVWGRMYNAGQTCCAAKRFIVLDSIADRFLEK
FT                   FKAALNELKPGDPMDEKTTHGPLSTEAALTQLLKQVDDAVAKGATLVMGGKRIDRPGSF
FT                   MQTTILTDIKPDNPAFRDEFFGPVVSFFRVKDEAAAIALANDSDFGLGGSVFTADAARG
FT                   KRVASGVDTGMMFINNIDWSDAELPFGGIKYSGYGRELGNMGIQEFVNTKLVRTAHLNA
FT                   PA"
FT   gene            541303..542472
FT                   /locus_tag="Bxe_C0524"
FT   CDS_pept        541303..542472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0524"
FT                   /product="Putative NAD(P) transhydrogenase alpha-1 subunit"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36424"
FT                   /db_xref="GOA:Q13HL5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL5"
FT                   /protein_id="ABE36424.1"
FT                   /translation="MYINVAVLTETRAHERRVALVPSVAQKLIKLGARLHMQPGAGAAI
FT                   HLDDAAFENVAFIADRTALVKDADVVLAVQPPALDVVSAMKEGAILVSFIYAHHEPALV
FT                   KRLLEKKITCFAMERVPRITRAQAMDALSSQSALAGYYAVQLGSTHLARVVPKVTGAAG
FT                   SIGPARVLVMGLGVAGLEAIATAHRLGAIVEGYDVRPETREQALSLGATFVDTGVDARG
FT                   KGGYARELHADEKIKVAAVLTKHIQSADLIITTAAIPGKASPKLISHTQVLGMKAGAVI
FT                   VDLSAEGGGNCDDTRPGETAQIGQITIVAPLNVPSLLGEDASELYAKNQYSLLALMMKD
FT                   NVIEIDWSDEVLARTVLTHAGENKAEADGKTMKVATPPASAPAVAPTQA"
FT   gene            542492..542854
FT                   /locus_tag="Bxe_C0525"
FT   CDS_pept        542492..542854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0525"
FT                   /product="Putative NAD(P) transhydrogenase alpha-2 subunit"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36425"
FT                   /db_xref="GOA:Q13HL4"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL4"
FT                   /protein_id="ABE36425.1"
FT                   /translation="MNFQISISGFVALYIFMLAGFGGWVIIGRVPAILHTPLMSGSNFV
FT                   HGIVVVGGIYALLNASTVQEQVIGFFAVLLGAGNAAGGYAVTDRMLAMFRTSGHPAGPA
FT                   HHRKAGSIKSVHVKKH"
FT   gene            542865..544316
FT                   /locus_tag="Bxe_C0526"
FT   CDS_pept        542865..544316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0526"
FT                   /product="Putative NAD(P) transhydrogenase beta subunit"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36426"
FT                   /db_xref="GOA:Q13HL3"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL3"
FT                   /protein_id="ABE36426.1"
FT                   /translation="MLTLLPQLGIGIADLAAAFLFLYGLHRMSSPVTAPSGIFVAGIGM
FT                   AVAVLASFLYAFGVDAAARPDLPVNLVLALVALAIGGGVAWWGGRKVAMTAMPQMVAIY
FT                   NGMGGGAAGAIAAVELFGNKARGVTELVATLAGAFIGAVSLSGSLIAWAKLDGVINKPV
FT                   RVKGQQVFNGLVLLATVAVGACIVVASLDQRALILAMPAWIYVFFGCALAVGILMTLPI
FT                   GGADMPVVISIFNAFTGLAVGIEGYVLQNPALMIAGMVVGAAGMLLTLLMAKAMNRSVS
FT                   NVVFTNFGEVASRKQGKIKGSLKPVQPGDAGIAMRYAASVIIVPGYGLAVSQGQGKLFE
FT                   FVKLLQAGGVSVKFAVHPVAGRMPGQMDVLLAEAGVPYDMIFQLEDINEQFASTDVALV
FT                   IGANDVVNPAARTDKSSVIFGMPILDADKAKQVFVIKRGEGNGYAGIVNALFYADTCSM
FT                   VYGDAQGVLVKMIEAVRGLGLPAVA"
FT   gene            544348..545382
FT                   /locus_tag="Bxe_C0527"
FT   CDS_pept        544348..545382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0527"
FT                   /product="Putative Zinc-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36427"
FT                   /db_xref="GOA:Q13HL2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL2"
FT                   /protein_id="ABE36427.1"
FT                   /translation="MKTHMQAAVVEQFGKPLVLKELAIPTPGPGQVLVKTEACGVCHTD
FT                   LHATNGDWPLKPGLPFTPGHEGIGIVAALGAGVTAVKEGDRIGVPWLYSACGHCEYCLA
FT                   AREPVCAEAQFGGYTKNGGFAEYIVADPNYVAHIPAGLAAREAAPLICAGITSYKGIKE
FT                   TQARPGEWVVISGVGGLGHLGIQYAKAMGLQVCAVDIDDGKLAHAKRLGADAVVNANDG
FT                   DPIAAVIRATGGGAHGVLITAPSLGAFKQGVGMTRKCGTCVLVGLPPGEFPTPLFDVVA
FT                   NCITIRGSFVGNRRDMAEALAFAADGKVRADIELQPLSAINNVFQRLGHGDVPSRVVLE
FT                   FASH"
FT   gene            545418..547250
FT                   /locus_tag="Bxe_C0528"
FT   CDS_pept        545418..547250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0528"
FT                   /product="NAD(P)-dependent nickel-iron dehydrogenase
FT                   flavin-containing subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36428"
FT                   /db_xref="GOA:Q13HL1"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL1"
FT                   /protein_id="ABE36428.1"
FT                   /translation="MAVEPDLQLSPGPASLKSGSVDALLLRARHDPHALVQILREAQAR
FT                   HTWLSRELLGYIAGALGLTLAHVEGVATFYRFFHTSPAGEYRVLFSDNITDRMQGNAAL
FT                   LDDLCRRLGVQRGQMREDGRVSVDFCSCTGLCDQGPSLLINHHQVVTRLDAGRVAQLAE
FT                   FIESRVPAAQWPAHWFRVDDHVRRADVLLGTPLIPGAAIAAALARGVPALFDEMNRSNL
FT                   RGRGGAGFVTGMKWRLCRDAPGTEHYIVCNADEGEPGTFKDRVLLTRHPDMVVEGMTIG
FT                   ALAIGARRGMLYLRGEYRYLLEPLLDVLQRRREAHLLGASILGHAGFDFDIDIHVGAGA
FT                   YVCGEESALIESLEGKRGTPRIRPPFPAEHGYLQQPTVVDNVETLCAATHVALQGGAWW
FT                   SAIGTPKSTGTSLHSVSGDCERPGIYEYPLGTSVDRILEDCGARDTQAVQVGGPSGKCL
FT                   SAIEFGHRIAFEDVPSAGAFMVFDRSRDMFEVARNYAGFFAEESCGFCTPCRVGTALVV
FT                   KSMDKLAAGRGSRHDVELLSDIDILMHGTTHCGLGGSACNALHDTIVKFRPAYERRLKS
FT                   LEFEPAFDLDAEIEAARRVTGRDDDTVTQRESAA"
FT   gene            547247..547987
FT                   /locus_tag="Bxe_C0529"
FT   CDS_pept        547247..547987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0529"
FT                   /product="Putative NADH dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36429"
FT                   /db_xref="GOA:Q13HL0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR016214"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL0"
FT                   /protein_id="ABE36429.1"
FT                   /translation="MSTPANAGNTNGTSHAFPLDGEDVPFEPGDTILQAARRAGRYIPH
FT                   LCWHPDFHPQGSCRVCTVKVKGRPGSACTMHAADGQKVESNTDELNAERKMLLQMLFVE
FT                   GNHFCPSCEKSGNCLLQATAYEMNMEGVLFDEFYPRRPIDASHPDVMIDFNRCILCELC
FT                   VRASHDIDGKDVFAIAGHGSGTHLVVNSVSGRLADTEMDLADRATSICPVGAILPKRRG
FT                   FLIPIGERRYDPQTAADPDTQEAS"
FT   gene            547984..548565
FT                   /locus_tag="Bxe_C0530"
FT   CDS_pept        547984..548565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0530"
FT                   /product="Hydrogen dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36430"
FT                   /db_xref="GOA:Q13HK9"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK9"
FT                   /protein_id="ABE36430.1"
FT                   /translation="MSTATSAEVDAAHRPRKLKVATVSLAGCFGCHTSFLDIDERLLEL
FT                   VQHIEFDRSPLTDIKEVGQCDIGLIEGGVCNSENVEVLRAFRAHCKTLVAMGACAINGG
FT                   LPAERNRFALADVLNEVYRDRAGLREGSAIPDDPELPVLLQQVRPIHAVVHVDYFLPGC
FT                   PPSADAFWSFLNDLMAGRTPHLGHALMHYD"
FT   gene            548593..550107
FT                   /locus_tag="Bxe_C0531"
FT   CDS_pept        548593..550107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0531"
FT                   /product="NAD(P)-dependent nickel-iron dehydrogenase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36431"
FT                   /db_xref="GOA:Q13HK8"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK8"
FT                   /protein_id="ABE36431.1"
FT                   /translation="MSFDLETAANPKGLRRVAIDPVSRVEGHGKVTILLDEQQRVQQVR
FT                   LHIVEFRGFEKFIEGRPYWEVPVMVQRLCGICPVSHQLAASKAMDRVVGARPVTRSAEK
FT                   IRRLMHYGQVMQSHALHFFYLASPDLLFGFDSEVDLRNIVGVAQAYPDIAKQGILLRKF
FT                   GQELIRATSGKRIHGTGSIPGGMNRYVSQADRDMLYRDVDQMTGWAADAVDIAKQLHAQ
FT                   NPALYDSFGSFRSNMLSLVRADGAMDLYDGVLRARDADGGIIFDGASDQDYMSLIEEET
FT                   RPWTYMKFPHLRSLGRDTGWYRVGPLARVQNCDFIPSPLAEAQRKEFVDWGKGSPVHAT
FT                   LAYHWARMIEVLHAVEVIKDLLDDPDILQGELMASGERRAGGVGIIEAPRGTLIHDYRV
FT                   NADDLVTHCNLIVSTTHNNQAMNEAVRSVAREYLDGQRLTEGLLNRIEIAIRAFDPCLS
FT                   CATHALGRMPLDVVLLGPGGEPFDHMTKSHDGEVMRHSPAGMGAMA"
FT   gene            550104..550598
FT                   /locus_tag="Bxe_C0532"
FT   CDS_pept        550104..550598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36432"
FT                   /db_xref="GOA:Q13HK7"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK7"
FT                   /protein_id="ABE36432.1"
FT                   /translation="MNAPLLIFGWGNLSRGDDALGPLFVQQLRLLAGTGAGSRVDFLED
FT                   YQLQIEHALDLAFRERVLFVDGSVNCATPFEVTALRPSRDTSFTTHAISPQAVMHVYRD
FT                   LYHAEPPACTLLAIRGMHFELGAPPGSLALDHLARALAWGQSWIERRAVAPSGLSGIAH
FT                   A"
FT   gene            550591..550938
FT                   /locus_tag="Bxe_C0533"
FT   CDS_pept        550591..550938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0533"
FT                   /product="Putative hydrogenase expression/synthesis protein
FT                   HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36433"
FT                   /db_xref="GOA:Q13HK6"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK6"
FT                   /protein_id="ABE36433.1"
FT                   /translation="MHELSLAGGIVSMVEAAAAREDFRRVAQLRLEIGALAGVEPQALR
FT                   FALTAMMPGTCLAGGEITIDEIAGMASCLHCGASVEIESHTEACSRCGQFTLKATAGTG
FT                   LRVVDILVFDD"
FT   gene            550958..551860
FT                   /locus_tag="Bxe_C0534"
FT   CDS_pept        550958..551860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0534"
FT                   /product="Hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36434"
FT                   /db_xref="GOA:Q13HK5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK5"
FT                   /protein_id="ABE36434.1"
FT                   /translation="MCVVCGCGTGADPETVHADDEEAGTSHVAPTSLNGELHYGAGVAR
FT                   LSVPGMSEARAIRIETDVLDENRRHANRNRAHFASHRVTALNLVSSPGSGKTTLLCASI
FT                   EALKIRRPGFAVAVIEGDQQTSVDAERIRATGAPAIQVNTGRGCHLDAQMVGEAFAHLD
FT                   LHTAAHHARHAGAMLFIENVGNLVCPALWDLGEAAKVVVLSVTEGDDKPLKYPDMFAAA
FT                   TLMIINKIDLLPYVSFDVTRCIEYARQVNPSIDVLRVSATRGDGMDDWLGWLLPPRVEP
FT                   RFRTWKASSQRRTVLQRVR"
FT   gene            551866..554304
FT                   /locus_tag="Bxe_C0535"
FT   CDS_pept        551866..554304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0535"
FT                   /product="Hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36435"
FT                   /db_xref="GOA:Q13HK4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK4"
FT                   /protein_id="ABE36435.1"
FT                   /translation="MPTRVHTVRDDEPLVSKWGGEAIRVRGLVQGVGFRPAVWRLAHDC
FT                   GVSGTVCNDGEGVLIRAWADRPVLERFVAGLHGRCPPLGRIDSVERRAVPDVAPAPGEF
FT                   TIVESGGGPAHTGVVPDAVTCRACLDETLDPSGRRYRYPFTNCTHCGPRLSIVGAIPYD
FT                   RCATTMAAFPLCGACRREYDDPGDRRFHAQAVACPACGPRIWIEQADGSRERGDPLEVA
FT                   CRYLRLGGIVAIKGLGGFQLACMATAQAAVTKLRVLKHRARKPFALLARDVTMAERYCS
FT                   VSNADAALLRSAAGPIVIMPAIGRTTAADLSGVAPGTATLGFMLPSTPLHHLIMRALDA
FT                   PIVLTSGNVADEPQCTANDDARIRLAGMADVFLMHDREIASRIDDSVARVLHGVPRLLR
FT                   SSRGYAPAPLRMPHDFAAAPPVLAMGAQQKNAFCLLREGEALVSHHIGELENGETYRDY
FT                   KASLARYEKLFGHDARVVAVDLHPEYLSRKLGIDIARQRSLPLAEIQHHHAHFAACLAE
FT                   NDIGLASNILGVVLDGHGMGTDRRLWGGEFLLGGYVDCTRVASLTPVALPGGMRAVLEP
FT                   WRNTYAHLRASLGWEWVARRYAKLDLVRFLAGRPLALLEQMIEGGVNSPVSSSAGRLFD
FT                   AVAAAAGVCRERVQYEGQAAIEFEALIDRRTLHDEDDALAYPFRIGEASDAAYPLLIDA
FT                   KPMWLALLDDLMRATPAPVIAARFHKGFTIAIVQMVKRALGSRLHGSAPAVRTVALSGG
FT                   VMQNAALFEQLSERLAACGLVVLAHRQVPANDGGIALGQAAIAAGRALAHVEQRNTLCA
FT                   "
FT   gene            554295..554597
FT                   /locus_tag="Bxe_C0536"
FT   CDS_pept        554295..554597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0536"
FT                   /product="Hydrogenase expression/formation protein,
FT                   HupF/HypC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36436"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK3"
FT                   /protein_id="ABE36436.1"
FT                   /translation="MCLGIPGQIIAIHDAVNKLALVEVSGVRRLINIAFIVDEDLPAAA
FT                   YVGDWVLIHVGFAMSRLDEAEAMHTLALLRELGESDELDDRRIATDAFSATGSTP"
FT   gene            554594..555784
FT                   /locus_tag="Bxe_C0537"
FT   CDS_pept        554594..555784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0537"
FT                   /product="Hydrogenase formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36437"
FT                   /db_xref="GOA:Q13HK2"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK2"
FT                   /protein_id="ABE36437.1"
FT                   /translation="MKYVDEFRDPDRARALTHEIRRLVERIARTRGGLERPLQIMEVCG
FT                   GHTHSIFRYGIHQMLPPEVEFVHGPGCPVCVLPMGRVDDCVALARRPEVIFTTFGDAMR
FT                   VPGSSTSLLKAKADGADVRMVYSPVDALAIARANPHREVIFFGLGFETTMPGTAMTVLQ
FT                   AHAGRVENFSLFCNHITIVPTIKAILDSPDLRLDGFLGPGHVSMVIGTRPYRFIAEQYR
FT                   RPITVAGFEPLDVLHSVFMVLRQIAEGRSEVENQYARIVPENGNAQALSAIGQVFEPRE
FT                   FFEWRGLGSIEHSGVRIRDAFAAFDAERKFPVANLQLADPQACQCGEVLKGVIKPPQCK
FT                   VFGTACTPDRPLGALMVSSEGACAAHYRYARIDTSALTAAAAVCPGPAPAALRVQA"
FT   gene            555781..556827
FT                   /locus_tag="Bxe_C0538"
FT   CDS_pept        555781..556827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0538"
FT                   /product="Putative hydrogenase expression/formation protein
FT                   HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36438"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK1"
FT                   /protein_id="ABE36438.1"
FT                   /translation="MNDRVNKLRDVTINLGHGGGGRAMRDLIEDVFVAAFDNPALAALE
FT                   DQAVFPLAELARHGDRLAFTTDSYVVDPLFFPGGDIGALAVSGTVNDLAMSGARPLFLS
FT                   CGMVIEEGLAVDTLRRVAASMQRVAIEAGVSIVTGDTKVVERGSADKLFINTAGIGIVP
FT                   AGVNISARRAQVGDAVIVNGFLGDHGVAILIARQQLALQADVASDCGPLGSLVATMLGA
FT                   CDDIHCMRDATRGGMATVLNEFAVSSGVAIHIRETAIPVRDEVRGACEILGLDPLYLAN
FT                   EGKLIALVPARCAQRLLAAMRRHPAGRDAAIIGEVVALPAGIVVLQTEFGGQRIVDMLV
FT                   GEQLPRIC"
FT   gene            556898..557602
FT                   /locus_tag="Bxe_C0539"
FT   CDS_pept        556898..557602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0539"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36439"
FT                   /db_xref="GOA:Q13HK0"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK0"
FT                   /protein_id="ABE36439.1"
FT                   /translation="MITLYEFDDQQSQSNALAKAVGDALQVSLTAQAASAAKGPGHVTL
FT                   AVSGGSSPRPFLQTLSTQPFDWARIAVTLVDDRWVAETDSASNARFVREALLQHAASSA
FT                   VFWPLVDTAQALDAHVAALNADPARLLPDIAVLGMGEDGHTASIFADSPEWDDAITTTA
FT                   HFIAVHPGSAQHARVSLSLSALKRIDHLFLLIAGPRKRDVLKAATSTLQRNAISQLAHA
FT                   SEAQLNVYWSAN"
FT   gene            complement(557620..558144)
FT                   /locus_tag="Bxe_C0540"
FT   CDS_pept        complement(557620..558144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ9"
FT                   /protein_id="ABE36440.1"
FT                   /translation="MRPAAILTGKLDVLFGTRPDCLTASCTDDSPYDARNGPECRYGPV
FT                   PRRFNRDDGATSRRNALHLRAVAMPSYLLTLASTLAGIRGAATRAHNTPGAHGSPRRDT
FT                   PASSPLRGGTRIAQRQQSLLDVGKPGIGDLSVKLHRLNQKLNVDVLAFRSEIVELREYS
FT                   LVGIGVHGRSL"
FT   gene            558638..559255
FT                   /locus_tag="Bxe_C0541"
FT   CDS_pept        558638..559255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0541"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36441"
FT                   /db_xref="GOA:Q13HJ8"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ8"
FT                   /protein_id="ABE36441.1"
FT                   /translation="MSDSTTVRLEAFSDGVFAIAITLLVLEIKVPSASDLSQVSGLWHA
FT                   LAERWPSYVGFVASFFIVGVMWANHHALFEYIRRVDRRMLLANLFLLMGVSFLPYPTAV
FT                   LAQNLANPATRTDATVFYGVTLVFTALTYNVVWWLGRYGQARLEPHVHETGLRMITRRY
FT                   NMTLLGSLVATGFAFVNIWLSLVMHLSLYVLSARSEPLKERD"
FT   gene            complement(559394..560113)
FT                   /locus_tag="Bxe_C0542"
FT   CDS_pept        complement(559394..560113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0542"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36442"
FT                   /db_xref="GOA:Q13HJ7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ7"
FT                   /protein_id="ABE36442.1"
FT                   /translation="MTNEQDPKQNHLLSVLPEAEWARISPHLVRIDMPLGQVIYESGDR
FT                   LHHVYFPTTSIVSLLYVMEDGSSAEIAIVGNEGLIGIALFMGGETTPNRAIVQSAGEAY
FT                   RLDARILKQEFHRAGPVQRLLLRYTQALITQMAQTAVCNRHHSIDQQLCRWLLLSLDRL
FT                   PSNELRMTQELIANMLGVRRSGVTEAALKLQDAGLIRYSHGHIEVLDRPGLEKRVCECY
FT                   NVVKQEFDRLLPDLKAL"
FT   gene            complement(560413..561279)
FT                   /locus_tag="Bxe_C0543"
FT   CDS_pept        complement(560413..561279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0543"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36443"
FT                   /db_xref="GOA:Q13HJ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ6"
FT                   /protein_id="ABE36443.1"
FT                   /translation="MSVHPTSFRWPTSAHGARHADERDEIIEPAVRQPTVVAFNASRTV
FT                   GDHASASKLKNQVLAMVAHELRGPLTPLQLATQLMRRASADRPEVLRSLDMIDRQIAQI
FT                   ARLAQDLMDATRIDRNVLRISRDHLDVVGFLAAPLAAAALATAKRGQTFTLQFADRTLR
FT                   VEGDAVRLAQAIDNLLHNAAKYTPDHGCITVNVHSDGKDLIVSVTDNGLGISRALLPHI
FT                   FDLFAQSSRTIAASAGGLGVGLAVVKAVAESHGGTVSATSAGPGAGSEFTLRLPIVIER
FT                   RGADEPA"
FT   gene            561745..562617
FT                   /locus_tag="Bxe_C0544"
FT   CDS_pept        561745..562617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0544"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36444"
FT                   /db_xref="GOA:Q13HJ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ5"
FT                   /protein_id="ABE36444.1"
FT                   /translation="MNPITLFLSVALVLAGAVAGQWLSIYLAPPLIIVGILIGLSVKVA
FT                   NVWEKFVILRLGKLQSVRGAGFFMIIPLLDHIVAIIDERIQTTAFNAEQALTKDTVPVN
FT                   VDAIIFWHVADAKKAALAITDYRQAIDRVSQTTLRELIGSSMLAMLLSDRIYADAHLRD
FT                   VIGSKTAEWGIAVGSVEIRDVAIPVALQDAMSRQAQAEREKQARVILGSAEAAIAANFV
FT                   EAARVYENQPGALQLRAMNIIYETTKERGATILMPTSMVDSLNPALALAIAGRDPATGA
FT                   AVSPLKTAA"
FT   gene            562730..564415
FT                   /locus_tag="Bxe_C0545"
FT   CDS_pept        562730..564415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0545"
FT                   /product="Phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36445"
FT                   /db_xref="GOA:Q13HJ4"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ4"
FT                   /protein_id="ABE36445.1"
FT                   /translation="MELAMNISPLAGKRLPDAMLVNVPRLVTAYYTDKPDAAIPAHRVA
FT                   FGTSGHRGSAFARSFNEWHVLAITQAICYYRKQQAIDGPLFIGIDTHALSEPAYASALE
FT                   VLAANGVEVMIAQNGEYTPTPAVSHAILAYNRGRSAGLADGIVMTPSHNPPESGGFKYN
FT                   PPNGGPADETVTGWIERAANGLLESRLDGVLRICLSKALRATTTHRHDFLNAYVGDLVN
FT                   VLDMDVVRGAPIRLGVDPLGGAGVHYWGPIAERYNLNLSVVNDEVDPTFRFVSVDWDGR
FT                   IRMDPSSPYAMQTLIDQKDRFDVAFACDTDHDRHGIVTRHAGLLPPNHYLAVLVHYLYA
FT                   NRPQWRAHVAVGKTIVSSQMIDRVTEKLGRTLYEVPVGFKWFVDGLLDGSLGFAGEESA
FT                   GASCLRLDGTAWSTDKDGIVPALLAAEMTTRTGRDPAEIYRDLTQRLGEPVERRVQAAA
FT                   TAPQRALLARLSPAQFPHTELAGEKIEQVLDRAPGNGAAIGGIKVVTKSGWFAARPSGT
FT                   EDVYKIYAESFRGEAHLTRIVGEAQAMVDSVFEAQVATDDGARP"
FT   gene            564487..564900
FT                   /locus_tag="Bxe_C0546"
FT   CDS_pept        564487..564900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36446"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ3"
FT                   /protein_id="ABE36446.1"
FT                   /translation="MPAHAVRPRTNCPVSNLSLQSGSTLPIAWFPARSISVQTRERVGG
FT                   MINASRRLRSRDFGAAHAIPAVCPSKMASRSIAAAFPDFPGADVCENSFEELERDAQDK
FT                   VQQMHDSKRVRYSRAACVRVCCRISTRRHGRGT"
FT   gene            565068..565847
FT                   /pseudo
FT                   /locus_tag="Bxe_C0547"
FT   gene            566352..566681
FT                   /locus_tag="Bxe_C0548"
FT   CDS_pept        566352..566681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36447"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ2"
FT                   /protein_id="ABE36447.1"
FT                   /translation="MSKKRTDAELARTQTTQAALVALASHIQTLVADQSLDSRCAAKLV
FT                   RRLKKEAATLEDSSAGTKASRKMLAMTLDALDTALFDQGAMLLVAANATLRADDVSDGA
FT                   TTQRT"
FT   gene            complement(567652..568044)
FT                   /locus_tag="Bxe_C0549"
FT   CDS_pept        complement(567652..568044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0549"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36448"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ1"
FT                   /protein_id="ABE36448.1"
FT                   /translation="MKSHIAPPLATLLILALTSGTLRAQGTPQPINAQHVDMVQLATGY
FT                   RASKIDGSPMFNRTQDKIGTIDDLITSPNNPIPYAILSVGGFLGMGTHLVAVPWNSLQI
FT                   VNRQMRLPDATKESLKALPEFRYAPD"
FT   gene            complement(568328..568627)
FT                   /locus_tag="Bxe_C0550"
FT   CDS_pept        complement(568328..568627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36449"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ0"
FT                   /protein_id="ABE36449.1"
FT                   /translation="MDDGNGIWIFVDIDLTRVTSKSVGIQANLLESLLQQVDARAKERR
FT                   MTRYAFVTLALIDELKQHDNHRLAIQFMNVVAGASLLVAPGVERAIPRHHRGLS"
FT   gene            569598..570983
FT                   /locus_tag="Bxe_C0551"
FT   CDS_pept        569598..570983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0551"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36450"
FT                   /db_xref="GOA:Q13HI9"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI9"
FT                   /protein_id="ABE36450.1"
FT                   /translation="MTFLKSPPPTPDAVADEYAAMISGSSLPKYRIPEASSDRRAVFDL
FT                   VRDELFMDGNSRQNVATFCTTYADDEVRRLMDLSIDKNMIDKDEYPQTAEIEMRCVHML
FT                   ADLWHATKSWKTTGCSTTGSSEACMLGGLALKWQWKKRREAQGKPTGKPNFVCGPVQVC
FT                   WAKFARYFDVEMRQVPLSGDATGLRPEDLAQYCDENTIGVVATLGITFTCVYEPVKALA
FT                   GALDALQANVGLDIPIHVDAASGGFVAPFIQPDLEWDFSVPRVKSINASGHKYGLAPLG
FT                   VGWIVWRSTQDLPDELIFRVDYLGGDMPTFALNFSRPAGQIIAQYYMLLRLGREGYRHI
FT                   QQECADTAQALADGLAKIDALDMIYDGRGALPAVCYKLKHPDTAGFTLFDLSDRVRMRG
FT                   WQIASYELPAGREDTIVQRVLIRRGVTRDMAAMLLEDIKHAIAHLTKNPVPNSTAGPTF
FT                   HHD"
FT   gene            571011..572531
FT                   /locus_tag="Bxe_C0552"
FT   CDS_pept        571011..572531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0552"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36451"
FT                   /db_xref="GOA:Q13HI8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI8"
FT                   /protein_id="ABE36451.1"
FT                   /translation="MDNTVATAAALPAANAAKRGKYLSVTSIGLMTAAAVVTSLRGLPL
FT                   LAKEEMTMFVYLAFTVVFYLIPASLISAELGGAFADRRGGIYTWVAEAFGTRWGFLAIW
FT                   LQWIQNVVWYPVALTFGAAALAYTIGRPDLAKNGVYVGIFCIVAYWLSTWLVLQGVEVF
FT                   ARIANWTFVIGTIVPGVVLLALLGYWISSGHPLGWQHLNDAALSQGGHARFWPAIHGFG
FT                   TISFLAGIVLLFAGVEVQAVHVIDMRSPSRGYPAAIGLGALISVLIFALGALPIAAILP
FT                   YEKISLQSGVFDAFSAVLVDLWHMGWAVSALSLLVGVGAISGVLAWLGSPSRGLLETAH
FT                   EGELPPILQAKNRKGMPTHILLVQGLIVTVISCFYFVIRDVSVAFFLISAMTIALYLIA
FT                   YMLMYAAAIRLRYSAPALTRPFTVPGGLAGMWLTAGIGFVGVLFSFVVSFFPPDQLPVG
FT                   SPWLYTGLVVLGIVVFAGIPLIIHHVRRSGWATAHDAPLTGPAATPLK"
FT   gene            572538..572840
FT                   /locus_tag="Bxe_C0553"
FT   CDS_pept        572538..572840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36452"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI7"
FT                   /protein_id="ABE36452.1"
FT                   /translation="MASLAGLRYEIQRLLRSAGRAAQRDAGRYHAYFEPPPPWEVKFTL
FT                   LELCRVSGASEMQIFEWIAHGAIEPTCVSEKDGPHFDSVSLRRVRRPPSRAGSRD"
FT   gene            complement(572926..574215)
FT                   /locus_tag="Bxe_C0554"
FT   CDS_pept        complement(572926..574215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0554"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /function="Natural resistance-associated macrophage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36453"
FT                   /db_xref="GOA:Q13HI6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI6"
FT                   /protein_id="ABE36453.1"
FT                   /translation="MDTLTHDPVKQPARPKLLQVMGPGLITGASDDDPSGIATYSQIGA
FT                   QFGYGLAWTLLFSYPLMAAIQEISARIGRVTGSGIAGNLRQHYPRWLSTSVVGMLLVAN
FT                   IINLGADLGAMGSALKLLIAGPALLYVCGFGLLSVVLEIFTRYARYVSILKWLCLSLFS
FT                   YVICAFVVKVPWDQVGRAVLLPALSIKPDYLVAIVAVMGTTISPYLFFWQAEQELEDEK
FT                   ERPGAHPLIHAPWEAPAEFARIRVDTYLGMALSNVVAFFIVVTTATTLHAHGLTNIQTS
FT                   AQAAEGLRAVAGPFTFFVFAAGIIGTGLLTLPVLAGSGAYALGELFAWRVGLARLPSQA
FT                   KAFYGVIAAATAIGAGLNFTSVDPVKALYWSAVLNGVVAVPVMIVMMHLSMRTRIMSGL
FT                   TLPPALRILGWVATGVMAATVVAMGVTWFA"
FT   gene            complement(574258..574809)
FT                   /locus_tag="Bxe_C0555"
FT   CDS_pept        complement(574258..574809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0555"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36454"
FT                   /db_xref="GOA:Q13HI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI5"
FT                   /protein_id="ABE36454.1"
FT                   /translation="MTPYDVVIAVFNDHHQADAAVRKLIDGGFDMKNFSVVGKGYHTEE
FT                   KIVGLYTVGDRMKMWGKYGAFWGGLWGLLMGGVFLTIPALGPIVVLGHLAVVIVSAVEG
FT                   AVVVGTLSALGATLVNVGLPKESVVHYEAAIKADGFIVMAHGTPDEMARAKAVLATHQP
FT                   ARLDLHEGVTPTDAATPETI"
FT   gene            complement(575063..575872)
FT                   /locus_tag="Bxe_C0556"
FT   CDS_pept        complement(575063..575872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0556"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36455"
FT                   /db_xref="GOA:Q13HI4"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014747"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI4"
FT                   /protein_id="ABE36455.1"
FT                   /translation="MLRSISDLHGSTVHALDGDIGSVNQVYFDDESWGVRYLVVETGNW
FT                   LNDRQVLVSPYSVKHTDPGSSVVHVNLSRQQVRDSPILDTHKPVSRQHEIEYLRYYSYP
FT                   TYWGGPNLWGMGAYPAYDPTGVAPDSLLDEPSRPTLHTNKPQADVHLRSTGEVKGYHLK
FT                   TADGGIGHVSDFIYDDTDWAIRYLVVETHDWWPGGKAVLIAIHWIDVVDWLDSTVSTAL
FT                   TRDVIWNSPAYDDSMPIDRHYEVMLHRFYDRHGYWSDADTGERVALE"
FT   gene            complement(575927..576430)
FT                   /locus_tag="Bxe_C0557"
FT   CDS_pept        complement(575927..576430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0557"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36456"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI3"
FT                   /protein_id="ABE36456.1"
FT                   /translation="MRAAGSRWTSATPSMQASTRRSHACTTSRAARVNWSATRTEPWCS
FT                   PSGLDAGFVVGGQYGEGSLRVGGHTVRYYSTATGSIGWQICAQSRAIVVVFMSDESLSR
FT                   FRVVQTDRSAGGDTSVAVLRIGANGNLDTSTATGQVNAFVLTSHGLMVGESLEGSKVTR
FT                   LALL"
FT   gene            576520..577320
FT                   /locus_tag="Bxe_C0557a"
FT   CDS_pept        576520..577320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0557a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0557a"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36457"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI2"
FT                   /protein_id="ABE36457.1"
FT                   /translation="MIFAPLIDDRSQATRKRARLRYVNVQTSVYLRMHDPHESSADFPK
FT                   FLSGQDQRRLTCALRNMRMSCNSSWLLDQETDHGVKADELATLFESLFAWLEAKAVVFS
FT                   QWTAPTRSASAGSGNWASAVRSRAFALSAAAAASWLSLALELWRAARPDLLGTLMRHCW
FT                   PWTAGANGAGCGPDEEPGEQAAGWNDAYFAAALTAAVSIGDSGIKEYVLDQLGAPVSPA
FT                   VLDSAELTAVGDILVQCGKPLASALEERLATDVASAQNGPISAP"
FT   gene            577952..579010
FT                   /locus_tag="Bxe_C0559"
FT   CDS_pept        577952..579010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0559"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36458"
FT                   /db_xref="GOA:Q13HI1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI1"
FT                   /protein_id="ABE36458.1"
FT                   /translation="MTPTLPDRKQNPPSAPAATVSLRLLEIFMLVAQEGSVSAAANRLN
FT                   LTQAAVSQAITVLEQALDVKLLDRSVRPPLLTLRGSTALQYAREILAKVHEFEDAMRYS
FT                   GSGRVPLLRIGMLNSFASTAGAFVLNQLRDIAAEWTVASGFRETCIQALLDRQSDVIIT
FT                   TDETPAPSEIEVFPIFSEPFVAVVPASFDGKTERLQDIADKLDFIHYGHDSHMGSKITN
FT                   YLKKIGTVPARRYQFDTTDAALHMVAGGFGWAIVTPLIYLKSRVEGSGVRVVPLTRLPI
FT                   HRTFIVGMRRGEGSDIAQRVRTAAIITLRDVILPQIEAVLPEASKGVSVAEIEPKASTG
FT                   KRKGSRRDSAGS"
FT   gene            complement(579114..579947)
FT                   /locus_tag="Bxe_C0560"
FT   CDS_pept        complement(579114..579947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0560"
FT                   /product="Putative HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36459"
FT                   /db_xref="GOA:Q13HI0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI0"
FT                   /protein_id="ABE36459.1"
FT                   /translation="MPKSSLFPNQSFLFVPGNRPERFEKALASGADAVIIDLEDAVPPD
FT                   AKDDARNAVASWVSPDRPVLVRVNASDTPWFAQDARLGHLRGIAGMVLPKTGSADDVIT
FT                   LIAGSRARIPVYPMIETGKALWNALEIAKAPFVKQLLFGTLDFIADIGMSGHGEELAAF
FT                   RSQLALVSRVAGLEPPIDGVSPDIGDAGQLIKETLAGKRLGFGGKMCIHPKQVSIVNQC
FT                   YRPSDAELEWAHTVLEAVGNASGTVITVDGKMVDRPVVLRAERMVALARTRRHAG"
FT   gene            580743..581927
FT                   /locus_tag="Bxe_C0561"
FT   CDS_pept        580743..581927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0561"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36460"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH9"
FT                   /protein_id="ABE36460.1"
FT                   /translation="MALYSKVLCRLLACVVAATAVTDSTVYADDMKTIDIGMISSRSGV
FT                   YQAFGIPAEDGVRLAVSEINRTGFEVGGQHYKLNLIIRDDRSTEVGATTIATEYVRDQN
FT                   IKFIFGGIGRLAPLIVQITGPEKAIFATASGAAASQFSGKPAGRYLISTLPPIESRARI
FT                   VAEAMRYYFPNAKSVQRLGPQTADNQAIFPLLPEPLRAKGFSNIPDPIYYQPDTTDFSG
FT                   ILTNLKQSRPDVIFLGQLDPARASAIIKQNDDIQATGGWFAWGLDCNANATAGTKTPYV
FT                   GFPTVGAMVDTPQTPQAREFVEKMKKMTGTLPPYLYAATYDYDFVFTLVEAMKKSNTVT
FT                   DTDRIIGALRGLTYNGLVGQITFDAENRAQYGLDACKITSAGVSEVRHFNMSRN"
FT   gene            581940..582812
FT                   /locus_tag="Bxe_C0562"
FT   CDS_pept        581940..582812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0562"
FT                   /product="neutral amino acid ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36461"
FT                   /db_xref="GOA:Q13HH8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH8"
FT                   /protein_id="ABE36461.1"
FT                   /translation="MSYIGQQLVNALTLAGLYSLVALGVSLTFGLTRLVNFAHGEILML
FT                   GGYMTFSCMSLGVPFSLALVLAFLGTFLVGLILERSLFRFTLSKPINGFIISLGLIIVI
FT                   QNAVIMFYGSEPQMISSPLKTVWSLDGVRIPSARLVVFIVAAALIAGYLAFTKYSRWGR
FT                   ALRACNEDREGAALLGIPTNRIIMWTFAAGSGVAGLGGGLLAAMLPISAGEGGLVIVKA
FT                   FAIALVGGLGSPNGVVAGSLIVALLETFLPGAVMPVEWAPAVPFILIVIVLLVRPQGLF
FT                   KGGEGSPVS"
FT   gene            582809..583807
FT                   /locus_tag="Bxe_C0563"
FT   CDS_pept        582809..583807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0563"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36462"
FT                   /db_xref="GOA:Q13HH7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH7"
FT                   /protein_id="ABE36462.1"
FT                   /translation="MKHMNIWTQRTFCIAIVLIVVVGFALPWTGVSNSALFLTTMIMIY
FT                   AIVAQGTNFLYSTAGILSVAQGALWGVGAYVAAIGLQRYNIGFGFALLLSIPAGAIVAI
FT                   LTGYPAKRVQGHYFAIVTFAFAEIFVIVGNNAVGWTGGNQGLIVAGRPLAGLSFLSDLQ
FT                   ANYLVAFLCFLGSLIAAVLLQRSGFGTRLAAAKTNSALAVSLGMNVVRDRLIAFAVSGA
FT                   AAGIGGVLYAYLTRYAQPGSFDVWAGITSLLIVMLGGRGYLLGPFIGSAVTLYVPAALD
FT                   LNPNLNQILYGLLLVGVMLVLPQGLLGVTAQLLGASRRVTTRVAGQRSEPR"
FT   gene            583804..584535
FT                   /locus_tag="Bxe_C0564"
FT   CDS_pept        583804..584535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0564"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36463"
FT                   /db_xref="GOA:Q13HH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH6"
FT                   /protein_id="ABE36463.1"
FT                   /translation="MTLKIERLVKRFGGLVAVNGLTFEYTGDAPLGIVGPNGSGKTTSF
FT                   NLITGFLKSDTGTIRLGDRDITNLAPAAIARLGLRRTFQQTMFFAGRTVRESLEIGMYA
FT                   IGSGARDAAFGGEPDPIDFLLDMCGLSQQAERIADELPFGYSRLLGIAMALTGPCRVLL
FT                   LDEPAAGMSDAEADTLARVVRQIGARGVGIIIVDHNTSFLFDLCPRVLVLDKGELIADG
FT                   GPAAIRNDPKVGAAYLGVADA"
FT   gene            584528..585232
FT                   /locus_tag="Bxe_C0565"
FT   CDS_pept        584528..585232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0565"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36464"
FT                   /db_xref="GOA:Q13HH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH5"
FT                   /protein_id="ABE36464.1"
FT                   /translation="MLDLGNVNVAYGRRPVIHNMHLKVGEGEAVSVLGPNGAGKTTLLR
FT                   AISGMIPVKTGSIRLNSQELANASPNAVARHGVMHVAEGRRLFGNMTCRENLMLGGYMR
FT                   SGPAVNQDFRRLLDVFPEIEPKLDVRAGALSGGQQQMLAIARGLMSRPKILMLDEPTIG
FT                   LSPLVVQRLKTVLTSSAREFFGSLLLVEQDLSLALAVTSRVYVIRNGRIVHEGAVQNIQ
FT                   RENLVEQYFGVA"
FT   gene            585645..586466
FT                   /locus_tag="Bxe_C0566"
FT   CDS_pept        585645..586466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0566"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36465"
FT                   /db_xref="GOA:Q13HH4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH4"
FT                   /protein_id="ABE36465.1"
FT                   /translation="MQIMSDENAPEFLYILYEVRNRVGYITLNQPQKLNAFHLPMYHEI
FT                   RRAFDMSAADDAVRVVVIKGAGRAFCAGRDFKYSADLQLEGGLSAWRREYKLFGGVTWF
FT                   HPKLVIAQVHGYALGGGGSLALLCDLTFAATGTKFGYPETRHGIASKTMVWPWTLGVKV
FT                   ANEVVASGRLVSADDCKHLHLVNEVFPPDELGERVDAIAQSIASSPVGVPELVKRMVNW
FT                   VMRDQGRVTQQDRQYDVDTAHWDAAGVVPSDWMQSAIAARRTALLDSLKNH"
FT   gene            586500..587303
FT                   /locus_tag="Bxe_C0567"
FT   CDS_pept        586500..587303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0567"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36466"
FT                   /db_xref="GOA:Q13HH3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH3"
FT                   /protein_id="ABE36466.1"
FT                   /translation="MSASEVEYAVKDGVATITLARPDRANAIDLSMYGAICERLAQAGA
FT                   DTEVRAILLEARGADFSIGEDFEYLGELEKNQRYGEWSQNYKGWIPVTWHNPKFVVASV
FT                   RGRAFGIACELALLADVTYASEGASFGHPETRVGMVSHTVWPWLVGPKIAKEYLASGVS
FT                   MSASVAHSKGLINAAFREEELDEHVHAFVADLATMPAGTPGANKKRINWAFRDVSRILH
FT                   DDRFYDVDFEWTTAAREVDYAFYNSVANEGVTKAIKARDRKFEDK"
FT   gene            587306..589432
FT                   /locus_tag="Bxe_C0568"
FT   CDS_pept        587306..589432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0568"
FT                   /product="Putative CoA ligase"
FT                   /EC_number="6.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36467"
FT                   /db_xref="GOA:Q13HH2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH2"
FT                   /protein_id="ABE36467.1"
FT                   /translation="MHAEFFNYLMAPGSMAIIGASERNFYSRNALQRLQDCGYAGKVHL
FT                   VNPGTSEVFGKRCHANVKDIGESIDMALVVVPRTAVIGALRDCVEAGAKAAVVVSTGFG
FT                   ESHDAVGLALQRELSEFLDEHPIALCGPSCLGVVNMIDGFQAFGGHPGTEILPGSIGLV
FT                   SQSGANVHSYIGAASARNLGFSYVVSSGNEAGMDATDYIDCFLRDPDTKVVCAYIESFK
FT                   SSDALIRVAEQALKVSKPLIVIKIGRSPSAVRAALAHTGAMTGPDHYFDTLFRQYGIIR
FT                   ANTIEESLDRACIFASSQEAYWPSGRRAGVVSVSGGFAATLSDLSRDGGFDVPELDASS
FT                   VRKLLEVLPANVNPQNPIDISTQVRRDRSDAWERTVNCMADDPNVDFVLNGEAVPLDDD
FT                   RLQELTSIRLRTGKPVLLASTSPHIQILNDAQRAWCREHRLPVVVGVEGCHRAIQSTLD
FT                   FTAKVVLARDSVKRSEMPVAALPRPAGHVLHEVKARELLLRFGIRGPESECVSDASEAS
FT                   SAAARIGGRLAVKIVSDSITHRTDRGLVHLNVSPATAFEVASEIELRVKQEEPANPRCQ
FT                   ILVQKMVEEGVAELFIGVTRRSGHRPTLLVGMGGILVELFGDHVSRICPVDPVQAGEML
FT                   RELRGFPLLDGFRGRPKADLQSVIRTLCAMSDFAMAASQWLGEAEINPLIVLPEGRGAL
FT                   AVDALVVVDSNESH"
FT   gene            589534..589956
FT                   /locus_tag="Bxe_C0569"
FT   CDS_pept        589534..589956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0569"
FT                   /product="Putative carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36468"
FT                   /db_xref="GOA:Q13HH1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="PDB:2QEU"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH1"
FT                   /protein_id="ABE36468.1"
FT                   /translation="MDQESNATSQDILKQHAAHYESDMGGLPEALVQLAEYAPETFDAY
FT                   SRMRTTMLKSEADGAKLPLKYKHLILVVLDAIRDEPIGIVNHTRAAMNAGLSVDELIEG
FT                   ILLGIIVYGMPAWGKTGRKAVTFAVEFEKELAGKRT"
FT   gene            590521..591621
FT                   /locus_tag="Bxe_C0570"
FT   CDS_pept        590521..591621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0570"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36469"
FT                   /db_xref="GOA:Q13HH0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH0"
FT                   /protein_id="ABE36469.1"
FT                   /translation="MKSYLFLFLAVLAADVHAQSSITLYGVIDDGINYVTNENGHSAWQ
FT                   MASTVMQGERIGFRGVEDLGGGVKAIFTLEDGFDVNSGGLLQGKRLFGRQAFVGLSSDV
FT                   GTITLGRQYDPTVDYVQPLSNNAFYASYGGHPGDNDNLQDNFRINNAVKFKSATYHGAS
FT                   FEAMYAFSNAAGAFSGNSAWSLGTGYSQGPISAGAGILKLNHPASNTSGAVGSSGEGIG
FT                   SDYVSFANTFVAGTVNDEIIADGGINYLFSKGSVGVVISHVLYDLSVSRVTFNNYELNA
FT                   SYFFTPALRLAGSYTFTDGRVPVIHESPKYHQLSFALDYFLSKRTDVYVMLAAQKAIGT
FT                   FADIIDIAPSNSDKQLVARLGMRVKF"
FT   gene            591711..592073
FT                   /pseudo
FT                   /locus_tag="Bxe_C0571"
FT   gene            592082..592789
FT                   /locus_tag="Bxe_C0572"
FT   CDS_pept        592082..592789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0572"
FT                   /product="3-oxoacid CoA-transferase, subunit A"
FT                   /EC_number="2.8.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36470"
FT                   /db_xref="GOA:Q13HG9"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG9"
FT                   /protein_id="ABE36470.1"
FT                   /translation="MANILYADAASALEGLLFDGMTIAAGGFGLCGIPETLIDAICASG
FT                   VGQLTVISNNAGVDDYGLGILLASRQISKMISSYVGENREFERQYLAGELELEFNPQGT
FT                   LAERMRAGGAGIPGFYTRTGVGTLIAEGKEIRVFSGESCLLETGLTADLAIVKAWRGDP
FT                   YGNLVYRKSARNFNPLAASCGRVTVAEVEEVVEAGGLEPDHIHTPGVFVQRLIRATRNE
FT                   KRIEKITVRQESR"
FT   gene            592790..593425
FT                   /locus_tag="Bxe_C0573"
FT   CDS_pept        592790..593425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0573"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36471"
FT                   /db_xref="GOA:Q13HG8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG8"
FT                   /protein_id="ABE36471.1"
FT                   /translation="MAWTRDEMAARAARELRDGDYVNLGIGIPTLVGNHIATGIDVTLQ
FT                   SENGMLGLGPFPARSQVDADIINAGKQTITELDRTSYVSSADSFGMIRGGHIDLSVLGA
FT                   MEVAGNGDLANWMIPGRMIKGPGGAMDLVAGVKRIVVLMEHVARDGAPKFRKACTLPLT
FT                   GANVVDMLVTDLAVFVRNNRYGRFRLIELAPGIDAGQVRALTEADYED"
FT   gene            593431..594228
FT                   /locus_tag="Bxe_C0574"
FT   CDS_pept        593431..594228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0574"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36472"
FT                   /db_xref="GOA:Q13HG7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG7"
FT                   /protein_id="ABE36472.1"
FT                   /translation="MSTLAGTERGRRYLARIAAIEGGCSEGIPAFNVNRRCGSGLRPVI
FT                   SASQSIVPGDTEIAIGGGAENMSRTPYIAAAARWGARMGDSTMIDMMPGALHDPFHGIH
FT                   MCVTLEDMMRLKPAFVMENGTVTAGNASGINDAAAALVLMEHIAAEERGTKPLARLVAY
FT                   AHAGVDPRYMGMGSVPLTRLALQRAGLAVDGLDVIETHEAFAAQACAVTRALGLDPAKV
FT                   NPNDSEIPLGHPVGATGAVITIKGPARTATDRRPLRAGDDVYR"
FT   gene            594489..595337
FT                   /locus_tag="Bxe_C0575"
FT   CDS_pept        594489..595337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0575"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36473"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG6"
FT                   /protein_id="ABE36473.1"
FT                   /translation="MENYSSWIGRNETRQDVATLQPALALGATLDRATIFLNGRSELPP
FT                   LSHWLYFLSTAPMSRLGTDGHPRRGDFLPPISLPRRMWAGSRIDFLVPIVIGAPIERTS
FT                   TIVRVNEKRGRSGTLCFVTLLHEVKVDSILAVREEQDIVYREASPLGDPLTKGVAVTES
FT                   AALASPDWTRTVMPDPVLLFRYSALTFNGHRIHYDRDYATKEEGYPGLVVHGPLQATLL
FT                   LDLISRSRPAATVRKFSFRAKNPLFDGKPLELCASLSGHMVKLWTVQSAHVGIEADAEL
FT                   E"
FT   gene            595494..596417
FT                   /locus_tag="Bxe_C0576"
FT   CDS_pept        595494..596417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0576"
FT                   /product="Putative hydrolase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36474"
FT                   /db_xref="GOA:Q13HG5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG5"
FT                   /protein_id="ABE36474.1"
FT                   /translation="MEEDGRLPTGKLPSAIGKNHRIAVVDTHFHLWKSQEIAPPSGIMA
FT                   DPSLFRDFDWSDYELAMQGVALEAAIHVQVHHGSEKAKSEYGRVERFAAEHAPIAGMIA
FT                   WAPLESPGVEREIAELAQSPLVAGVRRLTQQEPDELFCARPQFVAGAKLLASYGLVCEV
FT                   CVLEHQLKGVIALASACPELTIILDHLGKPHLAEPPTEHWLENMRILGMLENVVCKVAP
FT                   TPLWASDPPLTAAHAAPFIEYVAEHFGWDRLIYGSNWPPLRILTDDASQWADIVFKTLH
FT                   WAKADELGRLFSENARRIFRLNKGHR"
FT   gene            596650..596856
FT                   /locus_tag="Bxe_C0577"
FT   CDS_pept        596650..596856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36475"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG4"
FT                   /protein_id="ABE36475.1"
FT                   /translation="MAAGERFSRDLEKQREVAERAEERLRASEKRALLEIDREQSTATK
FT                   VQKKLDEAVRFLLSWPSALSGMA"
FT   gene            complement(596866..597480)
FT                   /locus_tag="Bxe_C0578"
FT   CDS_pept        complement(596866..597480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0578"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36476"
FT                   /db_xref="GOA:Q13HG3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG3"
FT                   /protein_id="ABE36476.1"
FT                   /translation="MNRKLQGLATREKILDAAELAFSAYGTEHTSLEDVARAALVTRGA
FT                   IYGHFDDKAALLDALLKRAALPLDPFMVPVLENCDSPLERLRQDLQTRLHTVLCEGTTR
FT                   RLYRILLARPMNNTIASAETLDEAGQIAQARIATALRAAQDMGEISEDIDSRHEASMIH
FT                   ALLTGYFRRSLLRAAESRPREQAAEVVHHALVPLHSHSVVR"
FT   gene            complement(597512..598759)
FT                   /locus_tag="Bxe_C0579"
FT   CDS_pept        complement(597512..598759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0579"
FT                   /product="Putative FAD-dependent pyridine
FT                   nucleotide-disulfide oxidoreductase"
FT                   /EC_number="1.18.1.3"
FT                   /note="Citation: J. Bacteriol. 177:676-687(1995)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36477"
FT                   /db_xref="GOA:Q13HG2"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG2"
FT                   /protein_id="ABE36477.1"
FT                   /translation="MSVQHLVIVGAGQAGFQTAASLRQAGFTGGIALVGDEPGVPYQRP
FT                   PLSKAYLLGKIGTAALRFRPDEWFDQQHVERLQATVAAIDRDARCVVLADGARLAYDHL
FT                   VLATGARNRVPSVDGIELDGVFGIRTLADADALSSRVDAARNVVVIGAGFIGLEFAAVA
FT                   AAKGLSVRVIELGQRPMARALSEPMSALFGDAHRSWGVVFDFGQTVTRFIGKDGKVTAV
FT                   ETGSGEWVPADLVVYGIGVLPNTEIAAAAGLCVDNGICVDEQLVTSDPAISAIGDAVSF
FT                   PCAWSATRVRLESVQNAVDQARAVAARLVGTPAPYNALPWFWSDQGDLKLQIAGLSGGH
FT                   DEAVVIGSIEQRQFSVLCFREDRLIAVESCNRATDHMAARKLLARGTALRVADARTPGF
FT                   DFRAYESSSRDVPVCQ"
FT   gene            complement(598766..600028)
FT                   /locus_tag="Bxe_C0580"
FT   CDS_pept        complement(598766..600028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0580"
FT                   /product="putative major facilitator superfamily
FT                   (MFS)transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36478"
FT                   /db_xref="GOA:Q13HG1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG1"
FT                   /protein_id="ABE36478.1"
FT                   /translation="MPRSRRSRLTAIDPGEFLGAWRIVLVAVLGLGVSASASLLYSFGA
FT                   LVIPLQHAFGWSRAELQPAISCLFAGTIVSTQAVASLNARFGMLRVTALSLVGMGLCYA
FT                   LMTQLGHSIGWLYLMCVLLPLAGAGATQVTWAHLIILWFSRNRGLALAAMLSGTGLAAM
FT                   VYPSAVTWAISRWHWQGGFVLLALAPLAVLPLAMAWMRVPVPRPAAIAVAAPIRSEEGV
FT                   CFRTAVLSTRFWTLNIALALVVAAVVAMISNTVPLLCDKGLSAAGASRIFGSFGVSLIV
FT                   GRLIVGYLFDRLWAPGVAAVTLAIPAFGCVLLSSAAASQTGLLTLATMLVGVGAGAEFD
FT                   IGAYLVSRYFGMRDYGRLFGVHVSLITAAAALAPWCSARLYASTGTYAAMVAACGAAFL
FT                   CGALLLLPLGRYPKFDPVTLA"
FT   gene            complement(600077..601264)
FT                   /locus_tag="Bxe_C0581"
FT   CDS_pept        complement(600077..601264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0581"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Citation: J. Bacteriol. 182:3784-3793(2000)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36479"
FT                   /db_xref="GOA:Q13HG0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG0"
FT                   /protein_id="ABE36479.1"
FT                   /translation="MERLFEKNVAITGIGQSEIGRPSNRSAIQLSVDAALEAIADAGLE
FT                   RSDIDGIASWPGDNDNGNPFSPVGPNALMNVLGLNVNWYGAGYEGPGPLTGIVNAAMAI
FT                   ATGLCRHVLVFRTITEATARQRSKSASALTNKTAGRDSSYFWQWYTPFNVISAVNLMAL
FT                   YAQRHFHEYGTTSGQLAQIALTCRSNAALNPKAVMRKPMTMDDYLASNMISSPLRMFDC
FT                   DVHCDASTAIVLSRTDLAREGPHPPIRIEAIGSALHQRWSWDQISLTEMAAFDVGRMMW
FT                   SRTDLKPKDVGTAQLYDGFSILTMLWLEGLGLCPRGESGAFVEGGERISRRGQLPVNTN
FT                   GGQLSGGRTHGLGYVHEACTQLWGRAGERQVAPHDVALAAAGGGPLGASLLLVRE"
FT   gene            complement(601264..601677)
FT                   /locus_tag="Bxe_C0582"
FT   CDS_pept        complement(601264..601677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0582"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36480"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF9"
FT                   /protein_id="ABE36480.1"
FT                   /translation="MERKLPSLTPETAPFWQGGSKGVLNIYHCARCERFFHPPAPICPR
FT                   CLSAEVGARPVSGRGHVFSFTVNQQRWTPDLAVPYVVAIVELSEQPGLRFVSNVVGSPV
FT                   DEIHIGMPVRVTFEQIEDVWLPLFELDDERSHA"
FT   gene            601850..602545
FT                   /locus_tag="Bxe_C0583"
FT   CDS_pept        601850..602545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0583"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36481"
FT                   /db_xref="GOA:Q13HF8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF8"
FT                   /protein_id="ABE36481.1"
FT                   /translation="MDTRQLAHRTIIVTGGLGALGRSVGAVLAARGARVVLIDRAEPTA
FT                   VAGVAAVVGKVDLGERESTAHAFADVARQLGGFNALVNVAGGFAWETLEGGSVETWDRL
FT                   YAMNLRSAVVASREALPHLLRQPPGRIVNVGALAAQKAGAGMGAYAASKAGIARLTEAL
FT                   ADELKDRNINVNAVLPNVLDTPANRADMPDADATRWVSTEALAAVIAFLLSDDAGAVTG
FT                   ACLPVAGRM"
FT   gene            602545..603042
FT                   /locus_tag="Bxe_C0584"
FT   CDS_pept        602545..603042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0584"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36482"
FT                   /db_xref="GOA:Q13HF7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF7"
FT                   /protein_id="ABE36482.1"
FT                   /translation="MAARALANGHSPVAAEETFGWSDRFLLGFAAMDETHREFVDRVAA
FT                   LKRASDAELPARLAEFAQHAVAHFAQEERWMTTTAFPAAQCHADEHAAVLRSVREVEQM
FT                   LRDGAALTLARDLTQALIDWFPAHADYMDAALSHWMSKRTHGGLPVVLRRGVAGPARVS
FT                   HF"
FT   gene            603057..604055
FT                   /locus_tag="Bxe_C0585"
FT   CDS_pept        603057..604055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0585"
FT                   /product="Putative hydrolase"
FT                   /note="Citation: J. Bacteriol. 182:3784-3793(2000)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36483"
FT                   /db_xref="GOA:Q13HF6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF6"
FT                   /protein_id="ABE36483.1"
FT                   /translation="MRLVTFQTADGVQRAGALFDNDQAVLDLRAALMLTRGGDGLALAS
FT                   VQALIEGGDAALDEARALLARAPSGAVLERRTLKLLAPIQPPTQMRDCSCFELHLRQSF
FT                   AAARRARALRTPDPEATLKAMNTRADDRVIDTFNRQPIYYKCNRFAVIGPDDDVIWPDY
FT                   SNALDFELEFGCYISTRAKDVPRDLARAHIFGYTIFNDISARDAQAIEMGGMLGPAKGK
FT                   DFDTANVMGPCLVTADELGDPYDLTMIARVNGEEWGRGTTRDMRWTFEDVIAHISRSET
FT                   LYPGEFLGSGTVGNGCGLEQLRYLKPGDVVELEVERIGVLRSRVVRPAKRA"
FT   gene            604144..605550
FT                   /locus_tag="Bxe_C0586"
FT   CDS_pept        604144..605550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0586"
FT                   /product="Rieske-type ring hydroxylating dioxygenase alpha
FT                   subunit"
FT                   /note="Citation: J. Bacteriol. 181:2675-2682(1999)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36484"
FT                   /db_xref="GOA:Q13HF5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF5"
FT                   /protein_id="ABE36484.1"
FT                   /translation="MLTKSGPTLADGTKVADLVNLETREVQMRTLSDPELYELEMERIF
FT                   GKTWLLLGHESEIPAQGDFMVRDMGSDSVLVTRDKAGEIHVLLNVCSHRGMRVSTVDAG
FT                   NTQIHTCIYHGWAFTTNGSFLGAPVEKECMHGKIRSKAELGLKKARVTLYGGLIFATWN
FT                   IDGPSFEDFLGDAKWYYDMLFQRSDKGLEVLGPPQRFVVRANWKAAGEQSAADGYHTLT
FT                   LHRWLGEVGNYSHVKDKDSGANDLTQQMYGVEISSPHGHALRCQDLARKIRRLTGKEPA
FT                   DLTPEERFRVLPPPGMTADMVPQLLRHLGKEQIDVMASMPPQVGGIFPNVLFAFLYLPQ
FT                   PDGSSLGAIALHTYVPRGPDKLEFTNWVFVEKDTPADVREKMRKQSTQLLGTTGMVEQD
FT                   DSDTWPHMTLAAKGAMGRKMTLKYQAAYETGAPEGWPGPGIVNEGFTKDDTQWHWWQYW
FT                   LELMTADTDA"
FT   gene            605583..606143
FT                   /locus_tag="Bxe_C0587"
FT   CDS_pept        605583..606143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0587"
FT                   /product="Rieske-type ring hydroxylating dioxygenase beta
FT                   subunit"
FT                   /note="Citation: J. Bacteriol. 181:2675-2682(1999)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36485"
FT                   /db_xref="GOA:Q13HF4"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF4"
FT                   /protein_id="ABE36485.1"
FT                   /translation="MSAVNAGIESADVGARVRIGSPVYNGVLEFLYEEAAMLDDLRLQD
FT                   WVATLAEDLIYTAPTRQTRPLAKLEQSVVRTMQHYDDDYRSIRGRVMRLTETKSAWAED
FT                   PPSRTRRLVTNVRVSEAGRPGEYEVRSNLLVTRSRFNFDAFDLVSAERRDLLRAHGESF
FT                   LLARREILLDQVVLGTPNLAIFL"
FT   gene            606217..606633
FT                   /locus_tag="Bxe_C0588"
FT   CDS_pept        606217..606633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0588"
FT                   /product="Putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36486"
FT                   /db_xref="GOA:Q13HF3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF3"
FT                   /protein_id="ABE36486.1"
FT                   /translation="MTFIRRMDHFTVVTDKLDDTRAFYEMLGLKVGPRPDFPVPGLWLY
FT                   TAGRAVLHLVAVGKMPQPRRGALDHMAFYGEDIAATLALLRSKRIRYRLVRAPRPFSTW
FT                   QVFFEDPNGVEVEVDFDPQESVPPHLKDGDAAAT"
FT   gene            606694..607473
FT                   /locus_tag="Bxe_C0589"
FT   CDS_pept        606694..607473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0589"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36487"
FT                   /db_xref="GOA:Q13HF2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF2"
FT                   /protein_id="ABE36487.1"
FT                   /translation="MDLGIDGRRAIVCASSRGLGKACALALAREGCEVFINGRDEARLG
FT                   QAAREIEQASGRRPTPVVADLDSDAGRAALLAACPQPDILVNNNAGPAPGELEQWDHAA
FT                   WLAALEANLLAPILLMSAVVPGMRTRKFGRVVNITSAVVKSPRLGMSLSTTARTGLTAF
FT                   AKGLSREAVADNVTINNLLPQHIDTDRQEYMARRIMEDRGITFAQARSLQVKSVRARRL
FT                   GRPEEFGDACAFLCSAQASFISGQNLQLDGGSYDGLF"
FT   gene            complement(607495..608226)
FT                   /locus_tag="Bxe_C0590"
FT   CDS_pept        complement(607495..608226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0590"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36488"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF1"
FT                   /protein_id="ABE36488.1"
FT                   /translation="MFRRRIIISNRTDGSQTVTRAALEDDFHHFRVEVTGIGGRVSKIG
FT                   GEAPRKPYTLCSQAIGQLEALIGMPLAGNSHEVTRITDPTVQCTHLLELAGLAIAAASR
FT                   GTPRRQYDVAVPARVADRTHPTLARDGIPCLEWNVAGSVIEGPAPYAGVSLYHGMARWA
FT                   LSTLDAEQAEAALVLRRGTGISRGRGMNLDAQVHAQPAGNCFVQQPQRAPQAIRVVGST
FT                   LDFAARPADLCADDLAWLAFA"
FT   gene            608337..609137
FT                   /locus_tag="Bxe_C0591"
FT   CDS_pept        608337..609137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0591"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Citation: J. Bacteriol. 182:3784-3793(2000)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36489"
FT                   /db_xref="GOA:Q13HF0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:5JY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF0"
FT                   /protein_id="ABE36489.1"
FT                   /translation="MGLLEQRVALVTGAGGGIGRGVARSFGNEGAAVIIAEINESTGRQ
FT                   VEQEIREMGGRSLFVKTDVTSKASIEAAVRSAVEQFGSLDILVNNAFVPTPNVLLEEKT
FT                   DEMLEQTLTTSLWATWWAMRAAFVPMRERRWGRIVNFYSIDTETGAWLHGDYNTAKAGI
FT                   VGLTRSAASEWGRFNITVNAIAPTAMGATFFELAAKNPEFAERSAAARPLGRSGDPEQD
FT                   IGPAAVFFASEMSRFVTGETLHVDGGLHLPGYNSRPAGIKPREY"
FT   gene            complement(609227..610858)
FT                   /locus_tag="Bxe_C0592"
FT   CDS_pept        complement(609227..610858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0592"
FT                   /product="Putative AMP-dependent synthetase and ligase"
FT                   /note="Citation: J. Bacteriol. 182:3784-3793(2000)
FT                   J.Bacteriol. 186:3631-3639(2004), Can. J. Microbiol.48:49-
FT                   59(2002)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36490"
FT                   /db_xref="GOA:Q13HE9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE9"
FT                   /protein_id="ABE36490.1"
FT                   /translation="MAGTGRSDTWSLGEQDTVIAALDRAVAAHPDRVLLDFSGDLYTYA
FT                   QVDGLSTRLANSLAELGVTAGQTVVTMLDNNLDAVITWLAINKLCAVSVPINTALRGEF
FT                   LRHQLDDASARLVICEGDYVERIAAIADQLKEATRVLHRGATTVRKCGALALAPLDQHR
FT                   GSDDTPLSRKPNPWDLASLIYTSGTTGPSKGCMISYNFMCNLARQQLRAGPATANDITI
FT                   TPLPLFHMNALAVGVLSNILVGARVAIVPRFSVSKFWSEVERSGATIASILGGMGGLLA
FT                   NAPDDEAAKRCYGQIHTVRGNPFTEATKQIWRERFGARQVGGNGYGLTEACVITSLPAG
FT                   EYAAPGSSGKRIPEFDVRIVDELDRELPANQAGEIVCRPLHPDVMFMGYWHRPEDTLKL
FT                   MRNLWFHTGDIGKFDDDGFFYFVDRKKDYLRRRGENISSFEMESAFSRHPDIAEVAVHA
FT                   VPSDKGEDDVKVTAVLNPDAALTAEALFHWATDAVPYYALPRYIEFRDTLPKNPQGRIL
FT                   KYQLRDEGKTPDTWDLEATGIKVARR"
FT   gene            610988..611794
FT                   /locus_tag="Bxe_C0593"
FT   CDS_pept        610988..611794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0593"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36491"
FT                   /db_xref="GOA:Q13HE8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE8"
FT                   /protein_id="ABE36491.1"
FT                   /translation="MSKNLTPPKAAAAVRHATGDARSSPEPVSAKGPRRNSHTSDGAPK
FT                   ARRRAAVKRVEDDAPAAPPTPAPAPRRRRSNRRSGQTIENIFAATEKVVLESGAERISI
FT                   LQVCENAGISRGTFYRYFASQDELLEGFSRHRREHFHRMAVALLESDEDPDRRFLALIH
FT                   YLHDYLRAGSPRRLIVVAPEFALRFYKRIFHDSAIRFQVLLAPVFDVWDGRLGVKLDRE
FT                   LVCDLIIRFVMSEQIIDSEADLDEMPRRIGRLIDALRSGGLTRTRR"
FT   gene            611971..613056
FT                   /locus_tag="Bxe_C0594"
FT   CDS_pept        611971..613056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0594"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36492"
FT                   /db_xref="GOA:Q13HE7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE7"
FT                   /protein_id="ABE36492.1"
FT                   /translation="MLIDLHAHAPHPGYYNQHPHWGPFFERHEDGDVKLRVGDWILTLG
FT                   SPERKALVRAGKGPTVEEYQARWADPKVRLAGMDAAGQNAQVVSVPSHCYMYWAEKEFS
FT                   VPFATKVNDTFAEYCSAAPDRLMFWAHAALNAPEQAALELRRACTELGAKGLVAGGANF
FT                   GGLEFDSPELDPVWKVLCDLDLPMFIHGYNQSVTWGKKANDDRYETTAIVGMQYDETRC
FT                   FWNLVCGGVLDRFPGLKVYITHGGGYVPYQLGRLAQCNGNLDVAHNKKPVLEYLKNNFY
FT                   FDVELHEVPMRQALIDIIGADRVLYGSNFGGSDAVRHDLTEGLRLSDDDLQKIRWKNAC
FT                   KLLHLDPAKIGEPAKKQAVSA"
FT   gene            613053..613904
FT                   /locus_tag="Bxe_C0595"
FT   CDS_pept        613053..613904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0595"
FT                   /product="Putative hydrolase"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36493"
FT                   /db_xref="GOA:Q13HE6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE6"
FT                   /protein_id="ABE36493.1"
FT                   /translation="MKLARCSDGGTPFWAVVDTARAALRPITGGPADWGPALARGEGES
FT                   ALTFTGAQRLLAEVRLLAPIEPTNRVVVAGANYAKHLKADFGMRSHSQPVAFLKAYGAL
FT                   IGAHDPIRYPPLTKELDHEVELVAVIGAEKVDRNDPLSGVLGYTVGNDVSARDLQRSGP
FT                   PGVGMDLFAAKSQDRSTGLGPWIVTRDEFPDGSPVLRMTLKVNGETRQDASCGEMTWNV
FT                   AELVRFVDERSSFAPGDVLFTGSPEGTGQGTGRFLNPGDVVEAEIEGIGTLRNVVTVIE
FT                   SA"
FT   gene            613918..614820
FT                   /locus_tag="Bxe_C0596"
FT   CDS_pept        613918..614820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0596"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36494"
FT                   /db_xref="GOA:Q13HE5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE5"
FT                   /protein_id="ABE36494.1"
FT                   /translation="MTLKNDKVVVAGAGLMGTGIAHAFVSSGFSTVLVDTDDNALEHAR
FT                   QAIGKILDDGVRLGKVQAADAQAALSRLSIELELKKGAAGARLLVETVTEKLPVKQAVL
FT                   AEAAAVMADEALYATNTSALSVTEIATAVTKPERVIGMHFFNPVHKMKLVELVRGLATS
FT                   DETVAGAREYSDALGKTSIIVNEAPGLTTSRMSALLGNEAMWMLQDGTASAEDIDTALR
FT                   LGFNHPMGPLELGDLTGWDTRLSVLKYLHQTLGEKFRPCPLVIKMVAAGRLGRKTGHGV
FT                   YRYEDGQRVPGSGLKGSAL"
FT   gene            614817..616001
FT                   /locus_tag="Bxe_C0597"
FT   CDS_pept        614817..616001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0597"
FT                   /product="Thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36495"
FT                   /db_xref="GOA:Q13HE4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE4"
FT                   /protein_id="ABE36495.1"
FT                   /translation="MTRDTRDVVIVDAVRTPIGKFRGALAGVRADHLGALVIDELIRRA
FT                   GVKPQAVNDVVFGCVTQIGEQSANIARTSVLGAGWPETIPGLTIDRKCGSGEEAVHIAA
FT                   GLIAFGAADVIVAGGAESMSRVPMGSNRDLHGEAFGWMASERFELTSQGEAAERLCDCW
FT                   ALTRAQLDAYSVESHRRAAAAAAEGWFAREIVPVPVGQVREKSLEGEAALFAADETIRP
FT                   GTNADKLATLKSSFRSDGRLTAGNSSQISDGAAALLLMSSDKARELGVKARARVRAVTT
FT                   VGSDPTLMLTGPILATCQVLEKAGLGLSDIDLFEINEAFAPVPLVWMKEFGVPHAKLNV
FT                   NGGAIALGHPLGASGARIMTSMLHELERRGARYGLQAICCAGGMGTATLIERLD"
FT   gene            616036..616545
FT                   /locus_tag="Bxe_C0598"
FT   CDS_pept        616036..616545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0598"
FT                   /product="Putative carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36496"
FT                   /db_xref="GOA:Q13HE3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE3"
FT                   /protein_id="ABE36496.1"
FT                   /translation="MALLPLIPLAQFPNELADAVRRGLSTRMLSSTTPVQVWAHRPEVA
FT                   AAWLAVLDQMHNHGVLDERLRELVRLRIASFTTCRACQTARKSATVTDADLACLASSDP
FT                   RFSEAERAALRFAELFAADPLAIDEAIFADLRAWFSVAQIVELNMFCALMLAGGRMTRA
FT                   QQAYEA"
FT   gene            616591..617868
FT                   /locus_tag="Bxe_C0599"
FT   CDS_pept        616591..617868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0599"
FT                   /product="Cytochrome P450"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004), Can.J.
FT                   Microbiol. 48:49-59(2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36497"
FT                   /db_xref="GOA:Q13HE2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE2"
FT                   /protein_id="ABE36497.1"
FT                   /translation="MTSPAKSNALESAFESTASNYRGSDVDLNAIYRDMRRNSPVIAQD
FT                   FMASLGVPNIAKLDPNRPTFTLFKYKDVMSVLRDAANFTSGFIAEGLGSFFDGLILTGL
FT                   DGEAHRRARALLQPVFLPEVVNRWRESKMEPIVRNEFIGPMVPQRRADLMHFGLHFPIR
FT                   LIYSLIGFADDRPEQVEQYAAWALAILAGPQVDAQKAAIARKAAMEAAEALYAAIRSEV
FT                   AVVRAKGAEGEDLISRLIRAEYEGRRLDDHDIATFVRSLLPAAGETTTRTFGSLMTLLL
FT                   ERPALLERVKADRSLVSKAIDEAVRFEPVATFKVRQAAVDTGIGGVSIPKGAMVQCIVS
FT                   SANRDEEVFENSETFDIDRKPKPSFGFGFGPHMCIGQFIAKVELQVAVNAILDLLPNLR
FT                   LDPDRSPPKIVGAQLRGPDAVHVVWD"
FT   gene            complement(617955..620192)
FT                   /locus_tag="Bxe_C0600"
FT   CDS_pept        complement(617955..620192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0600"
FT                   /product="Putative acyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36498"
FT                   /db_xref="GOA:Q13HE1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE1"
FT                   /protein_id="ABE36498.1"
FT                   /translation="MSKGILQGVRVLDLAAGAAGSVAALQLSEAGAQVIKIEPPGGAPL
FT                   RGSPGFAVWNRGKKSVVLDLATAEDRASLDRLLAASDVLIHEFTPREASARGLDDAALR
FT                   TRFPHLIVSAASGWPSSHPDAERPPRETLVLARLGLMAEQPGHRAGPVFIRMPYASFCT
FT                   AWLCAIGVVARLIQRGRGRGVGPAHTSLAQGALIPMTMHWARAETPSASFARGLDKSVA
FT                   VAIHQCSDGEWIHVHYAPDAAPYMREALDALGPDGVAAANARWGKNHTAPNFGANREIF
FT                   ATRPAREWLEHLWAHDVAAQPAAPFGAVYFDEQARVNGYIAEVDDPQFGMTLQPGPAYS
FT                   VTPPARVAHDGLRPLGADTQAVFETLAPRPTAAMAGAATAPPLEGIRILDFGAYLAGPF
FT                   GAMLLADLGADVIKVEPTSGDVMRYLDRVFCGCQRGKRSVALNLKDPRIRPVVEALARW
FT                   ADAFHHNMRLPAARKLGLDYESLRAANPALVGCHISSYGPAGARADWPGFDQLFQAACG
FT                   WEVENGGDGNPPMWLRFGVCDHLAALASAYALLLGLYHRDRTGAGQMTSASLLGATILS
FT                   TGETVVHADGGVDAFARLDREQTGVSSFHRLYACKDGWVAVAALTDDEQIRFAKLVQDD
FT                   AQAFFAARDRYAVEALLEDAGIAASVVREDQHDAFLDDPGNRAADLVMSAQHTTQGQLE
FT                   QIGAFWNLGDARALPERAAPALGEHSREVLAALGLPEAEIEALAGAGLIAG"
FT   gene            complement(620243..620566)
FT                   /locus_tag="Bxe_C0601"
FT   CDS_pept        complement(620243..620566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0601"
FT                   /product="Putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36499"
FT                   /db_xref="GOA:Q13HE0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HE0"
FT                   /protein_id="ABE36499.1"
FT                   /translation="MPKVSFTSHDGVTTEVEAADGVTLMQIALERGIGGISGDCGGACQ
FT                   CCTCHVFVDEAWQPRLPSMDEMEDAMLDSTAEPRRANSRLSCQLTMRAELDGLVVHLPA
FT                   TQI"
FT   gene            complement(620609..621733)
FT                   /locus_tag="Bxe_C0602"
FT   CDS_pept        complement(620609..621733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0602"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36500"
FT                   /db_xref="GOA:Q13HD9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD9"
FT                   /protein_id="ABE36500.1"
FT                   /translation="MRTVFREDHELFRQQARRFIENEIVPHLHEWEHAGIVPKELWRKA
FT                   GEIGLLCSTVPEEYGGSGGDFGHSAVMIEELARVNATAVGFTTHSEIVAPYIVAYGTEE
FT                   QKRRWLPRMAAGELVGVIAMSEPGIGSDLRSMRTTAQREGNDYIVNGQKTFITNGGNAG
FT                   LVVTATKLDPQSRDLTLICVEEDMPGFSRGKLLEKIGLKGQDTAELFFDNVRVPAGFRL
FT                   GEENNGFRYLTHQLAWERTIIGIRAAASIDSLLDETVGYTRDRQVFGKRLFDFQNTRFK
FT                   LAEVKAQATMLRAFVDDCLGKAMSGELTAEVGAMCKLVGSELQGKLLDELLQLHGGYGF
FT                   MSEYRISRAWVDARVARIYGGTSEIMKEIIGRSL"
FT   gene            complement(621783..622586)
FT                   /locus_tag="Bxe_C0603"
FT   CDS_pept        complement(621783..622586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0603"
FT                   /product="Enoyl-CoA hydratase / short chain enoyl-CoA
FT                   hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36501"
FT                   /db_xref="GOA:Q13HD8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD8"
FT                   /protein_id="ABE36501.1"
FT                   /translation="MTEPFLIVEHEGAVLSARLNSPQTRNALSEPAQMDELVELCNRVR
FT                   RDRTVKAVVLSGEGSAFCAGGNVKDMRERGGIFAGSPHDLRESYRNTIQRIPLALYELD
FT                   VPVIAAINGPAIGAGLDLACMCDIRIASDKALFAESFVKVGIVPGDGGAWLLPRAIGMQ
FT                   RASLMAFTGETIDAAKALEWGLVAEVVPADRLITHALGLAQRIAGNASHALRLTKRLLR
FT                   EGQHMRLDSLLEMSAAYQALAHHTHDHLEAVNAFLEKRAPQFTDR"
FT   gene            complement(622583..623656)
FT                   /locus_tag="Bxe_C0604"
FT   CDS_pept        complement(622583..623656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0604"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36502"
FT                   /db_xref="GOA:Q13HD7"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD7"
FT                   /protein_id="ABE36502.1"
FT                   /translation="MKAIFESTIERVLIDTVTPDLLHRCEAGEWSSPLWSALEESGFAV
FT                   AAAPEVAGGAGASWDDLFGVVRVAGRYCLPAPLPETLLANALLGECGLDAINAPLGIAG
FT                   SGRLTLAQGRVSGTLVDVPWGREVRHVVAIAGANEPMVVLLDAGDAQCTRRLNTAGEPR
FT                   DELRFERAACVSCAPLPSDLQPDALHLGGAMLRCAQIAGALQAIVDLTVRYSTERVQFG
FT                   KSIASFQALQQQIAVLAEHAAATAVAAECAFASSLNGAGCFAMLPIAAAKICAGEAASI
FT                   GAAIAHTVHGAIGFTHEHALHSSTRRLWSWRSEFGNTTAWAQRLGTAICAGGSPALWPA
FT                   ITAGRLDRYVQTKGAAA"
FT   gene            complement(623662..624810)
FT                   /locus_tag="Bxe_C0605"
FT   CDS_pept        complement(623662..624810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0605"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36503"
FT                   /db_xref="GOA:Q13HD6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD6"
FT                   /protein_id="ABE36503.1"
FT                   /translation="MSVTEFRYHPIPLDDEPLRKEVREFLADALCDRAPLQRAESWMGA
FT                   DPAFSRKLGERGWIGMALPKRYGGREAGPFARYVVIEELLAAGAPVSAHWIADRQSGPL
FT                   ILRYGTDAQRERYLPAICRGESYFCIGMSEPNSGSDLASIRTHAQHAGDGWVLNGHKLW
FT                   TTNAHYSHYMIALVRTAAKTASRHEGMSQFVIDLKAPGVTIRPIRDLAGGEHFNEVFFD
FT                   DVELGPDALIGTEGQGWEQVTAELAFERSGPERFLSSIALLHTMIDAIGKRPDALQARE
FT                   IGRLAARLFTLRQMSLSVTAELAAGRNPAWAASCVKDLGTAFEQEIPEVAQLLLDVPPS
FT                   TAGGSDHARVLAYLMQMAPSFSLRGGTREILRGIIARGLGLR"
FT   gene            complement(624933..626246)
FT                   /locus_tag="Bxe_C0606"
FT   CDS_pept        complement(624933..626246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0606"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36504"
FT                   /db_xref="GOA:Q13HD5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD5"
FT                   /protein_id="ABE36504.1"
FT                   /translation="MKLEDLILVSVDDHAIEPPNAFAHHMPARYKGREPKVVQRGGRDV
FT                   WEFEAKATGYMGLNSVVGRPKEEYGMEPLSYEHMRRGTWDIKARVDDMNANGVLGSLCF
FT                   PTFPGFAGQRFQVHEDRDISLAAIQAYNDWHLHDWCNAAPGRFIPLMLTPWWDMQAAAA
FT                   EVERLAKQGVHALTLSDNPTVHGYPSIHNDYWDPLWKACADNDVVICCHIGTGVKAAHA
FT                   SDESPIDAWITSMPIAISNSAADWIWAPMWKKFPRLRMALSEGGIGWIPYLLERADFTH
FT                   RHHHAWTMSNFGGKMPSDIFNEHFITCFIEDRFGLKNLDSINLDKVTWECDYPHSDCTW
FT                   PNSADVFWEQASAQNISDDVINRITHLNAMREFSYDPFAILGRENCTVGALRAQAKHVS
FT                   IEPALGLGGAAPVRDPNKPVTSGDINRMFAAADAQTAL"
FT   gene            complement(626579..627421)
FT                   /locus_tag="Bxe_C0607"
FT   CDS_pept        complement(626579..627421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0607"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36505"
FT                   /db_xref="GOA:Q13HD4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD4"
FT                   /protein_id="ABE36505.1"
FT                   /translation="MRKSTATAQKTEVAETAPATVPAPELRKNGPTNAVIVKPVASAIQ
FT                   ILRYLTQTGTPERATDIARHLKINPSTCFNILRTLVAEDVVDFDPLAKTYSAGIGLARL
FT                   VEQLVTQGQKLQLAAPLMHDLAAEFGVTVTLWRRLGTDRIVLVCSESSPTDLHIGMPAG
FT                   QRLPILMGASGRLFAAKLDFTEEQMRAEFARLRWVRPMSFEAYQREVNRARRRGWASDD
FT                   GYFATGVRAIAAPVCDRAGNIVFTVSTVMIRGDRADEQVDALGEAVRELGQRLESVLL"
FT   gene            627788..628672
FT                   /locus_tag="Bxe_C0608"
FT   CDS_pept        627788..628672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0608"
FT                   /product="Putative hydrolase"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36506"
FT                   /db_xref="GOA:Q13HD3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD3"
FT                   /protein_id="ABE36506.1"
FT                   /translation="MKLARVREASGEAFWAQVDAAAQHVRRVRAPFDVWAPALAQYGEA
FT                   ALDLDGALRPLVALQLCPPVHPGARVFGVGLNYLTHLTRLGRKEPPPHTIAYIKPSSAL
FT                   VAPGGEIQYPAVTGQLDYEVELVAVVARPLAGEPQASACLLGYTVGNDISARDAGKLLG
FT                   SLDLFTQKALDRTAPVGPWITTLDEFGGAGQPRVTISLRVNGEERQSDTTDHMIFPLDE
FT                   LLNYVDARIELQPGDLIFTGSTCGVGLEDGRFLQPGDTVEAEIEGIGVLRNTIGAKRVL
FT                   ASARRAGRLGIAG"
FT   gene            complement(628750..630168)
FT                   /locus_tag="Bxe_C0609"
FT   CDS_pept        complement(628750..630168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0609"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36507"
FT                   /db_xref="GOA:Q13HD2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD2"
FT                   /protein_id="ABE36507.1"
FT                   /translation="MPLCPLTTETDLQPAPISRTPDERWASSAAQTAAQYPSASYAWYV
FT                   IGVLFVVTLMSQMDRQLPSLVVGPLRREFGISDTAFSLLQGYAFAVFYTLAGLPLGRLV
FT                   DRGSRRNLICAGLVFWGVATALFAFGQTYTQLLLARVGVGIGEAVLAPAAYSLIADCVE
FT                   PARRGRALAVYYTSLAIGSGTSLLLGGWLLAIIPAAGIAVAGFGEVPAWRVAFVAAALP
FT                   SLPLALLMLASVREPVRHETTASVADERAASVREFAHYLRTHAGTFTRVLTYPALLSII
FT                   GYGALAWAPALFARSFGMPPSHSGALLGIIVAVAGAAGTLASGALSDRWAARGIVAARF
FT                   RVALAGACLFAVPSALWPLMPNAPLALALLFVNLLGLSIAQAAAPTSIQAVVPNRLRGQ
FT                   AIALYLLLAGLLGIGLGPTAVALLTEHLFHQDTALRYSLALTAAPSALLGLWLIGSGLR
FT                   PYARTYAALHSASR"
FT   gene            complement(630207..631067)
FT                   /locus_tag="Bxe_C0610"
FT   CDS_pept        complement(630207..631067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0610"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36508"
FT                   /db_xref="GOA:Q13HD1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD1"
FT                   /protein_id="ABE36508.1"
FT                   /translation="MHIDLRNKRVIVTGASRGIGRAIARAFAAEGARVAICARTAADLE
FT                   AAGADLQSRGAGDVIARAVDVTDTAGVRQFVEDIAARWGGVDVLINNAGQGRGGNLETL
FT                   TPEQILEHANVLQMGHFRFVQAVVPHMRQQRWGRIVEINALAGVVPTPDGIPSVVNRAA
FT                   CIAMSKSLGMSLAKDNILVNTLNMGWIDTGQWDRHYREMPAGCSREEFDQMVLKVVPLG
FT                   RFGKPEDVAGMALFLASDYASFISAASIDIAGGMGGQIAYYPTLKRDFYEAVKARGAVP
FT                   QPEAG"
FT   gene            complement(631196..631693)
FT                   /locus_tag="Bxe_C0611"
FT   CDS_pept        complement(631196..631693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0611"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36509"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD0"
FT                   /protein_id="ABE36509.1"
FT                   /translation="MKCLPCFPDICLRTVSSILFSRRDALIHCVTGLRGIQRIARHSKT
FT                   YTLIRFVSTVYHPDGRPKRMPHGGLLDGTSNDRSGHALAIPPNRQHVHSAHYNANSVGP
FT                   ALMNGAAHPLSSFSDDSDDDANNAITAIRPVIPKMPPLTRTDFHFVQVSRDRLQLRLSL
FT                   AQ"
FT   gene            632029..633648
FT                   /locus_tag="Bxe_C0612"
FT   CDS_pept        632029..633648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0612"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36510"
FT                   /db_xref="GOA:Q13HC9"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC9"
FT                   /protein_id="ABE36510.1"
FT                   /translation="MLKNLSIRSRLAVFAAIFVVLMLMVIAIASGTLKLTNGTLRDAQR
FT                   SSAAMMSLKSSAEQLLRVRVELGGYETETLFGAGKSTEGLLQRAHQMLIESNDEFRAYA
FT                   NGPFHSEDEARLARAAAQARTAFVEHVLEPEHKALVDNDFNTFRSIEGEGAARYYAAYT
FT                   KTIDELEQYQTQVQQRDTDTATARFHYSLVVFAVLAALGVLMALAASRRVTAAIVNPVD
FT                   QAIRHFESIAAGDLTIDVRVRSRDELGRLLTALMQMREGLSNTVSRVRGSTDAIALGAN
FT                   EIAAGNADLSSRTSQQAAALEETAASLEELSAMVRQNTASAKQANHFAQGAFDTVTRGA
FT                   DFVTRVTETMSEISTSSRKVAEITGIIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   SEVRSLAQRSGTAAKEIKDLIAESGASVEQGTMLVHDARRTMEEAREAVGRVTGIMGEI
FT                   EAAALEQSDGIEQVNKSIAQIDKVTQRNAALVEEAAAAANSLEEQADVLRNAVAVFRTG
FT                   GDAGAQHGSAAYLAGSVEPALS"
FT   gene            complement(633848..634762)
FT                   /locus_tag="Bxe_C0613"
FT   CDS_pept        complement(633848..634762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0613"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36511"
FT                   /db_xref="GOA:Q13HC8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC8"
FT                   /protein_id="ABE36511.1"
FT                   /translation="MAKDITLRQLRYFIAAARAGQFSMAATNEHVSQSAITNAVIALEQ
FT                   ALGTKLFDRGAHGVTMTVDGHDFYHHARHVLDSVRDAMHKPRAGARATSGTVRIAASYA
FT                   VLGYFLPELLARFRASFPAIELDLRDMDRAVIENAVLDGTIDLGVTLVSNTPRLDAFEH
FT                   RILIRSRRQLWTAPSHPLAHAASMSLADIAMHPYILLTVDEGEASTTRYWQAKGMQPNI
FT                   AFRTGSMEAVRGLVANGFGVTVLSDMLFRAWSLDGTRIDARPVVDSIPPMEVGLIWRPG
FT                   AALAPAAQQLRHFLIQVNSGEAD"
FT   gene            634857..638435
FT                   /locus_tag="Bxe_C0614"
FT   CDS_pept        634857..638435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0614"
FT                   /product="Putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36512"
FT                   /db_xref="GOA:Q13HC7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC7"
FT                   /protein_id="ABE36512.1"
FT                   /translation="MNAPVSPSHAAELAAVTLDDKYTLERGRIYISGTQALVRLPMLQK
FT                   ERDRRAGLNTAGYISGYRGSPLGGLDLALWNAKQHLHEHDVVFQPGVNEDLAATAVWGT
FT                   QQINLWPGARYDGVFGMWYGKGPGVDRSGDVFRHANSAGTDARGGVLVLAGDDHGAKSS
FT                   SVAHESEHTLIASGIPVLYPSSVQEYIDYGLHGWAMSRYSGLWVAMKCVTDVVESTASI
FT                   DIDPERVQIRVPDDYPLPDGGLNIRWPDPPLVQETRLLDHKWYAALAYVRANRLNRIVI
FT                   DAPNPRFGIMTAGKAYLDVRQALLDLGLDDATCARVGIRVMKVGCVWPLDAQDARRFAQ
FT                   GLEEILVVEEKRQVLEYALKEELYNWREDVRPKIYGKFDERDNEGGEWSVPRGDWLLPA
FT                   HHELSPALIAKAIARRLAKADLPPEVAARIAGRVAVIEGKERDAAQPRLAAERPPWFCS
FT                   GCPHNTSTKVPEGSRALAGIGCHYMAMWMDRRTETFSQMGGEGVAWLGQMHFTGEQHVF
FT                   VNLGDGTYFHSGSLAIRAAVAARANVTYKILYNDAVAMTGGQPVDGVLSVPQIAFQAVA
FT                   EGVARVVIVTDEPQKYTSAVRLPEGVGVHHRDRLDAIQHELRATPGTTLLIYDQTCATE
FT                   KRRRRKRGTYPDPARRAFINDAVCEGCGDCSVQSNCLSVEPLDTPLGTKRRINQSSCNK
FT                   DFSCVKGFCPSFTTAEGAQPRKPSGVGGAAPLPDFTQLPQPRIEATDRPYGILVAGVGG
FT                   TGVVTIGGLLGMAAHLERKGVVVLDMAGLAQKGGAVTSHVQIAPTPAHLHATRIGTGEA
FT                   RLVIGCDAIVSASAEALSKMRRGITRAAINSGATPTAGFVQNPDWTFPGAQTEQLLREN
FT                   IGEDCSFVDANQLALTLLGDTIYTNPLLLGFAWQKGWLPLGYASLTRAIELNGVAVEKN
FT                   RLAFDWGRFVAQHGADEAARAAGRRDAQQAIVLRLPETLDALIANHAQWLTDYQNAEYA
FT                   ARYLAMIERIRAKEVALGIGKSLPLTRAVAQNLAKLMAYKDEYEVARLYAAPAFMDKLR
FT                   AQFEGEPGKNYTLSFYFAPPLFARRDEHGHLVKQRFGPWVLPMLRVLAKLKVTRGTVWD
FT                   LFGKTAERRTERRLIGEYMALVDQFCVSLTATNRDVAIRLAQLPAAIRGFGHVKERNLL
FT                   AVGKQREALMAEYLASGDETGERRAV"
FT   gene            complement(638473..639741)
FT                   /locus_tag="Bxe_C0615"
FT   CDS_pept        complement(638473..639741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0615"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36513"
FT                   /db_xref="GOA:Q13HC6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC6"
FT                   /protein_id="ABE36513.1"
FT                   /translation="MSLSDSSRGAALDLTEFRTGWRTVLMAMLGLGVAANASLLYAFGS
FT                   LVIPLHNAFGWSRGELQPAVSFLFGGAVIGAQLVGWLNARYGMRRVTVVSLLALSATYA
FT                   LMPLMGRSIVWLYLMCALLPVAGMGTMHITWTHLVNLWFERNRGLALAVMLSGTGLSAM
FT                   LIPSAVTWVIGRWNWQAAFLLLAFLPVVLVLPLVLWWMQTPDEERASAAQHMTRATQRA
FT                   GLVFREAVRSTRFWALNAGLSLVVAATVAMVSNTVPLLRDKGLSAADASHIFGSFGIAL
FT                   IGGRLIVGYLIDRLWAPAVAAAALAMPALGCLLLSTASAGQTGLLTMATLLTGVGAGAE
FT                   FDIAAYLVARYFGMRDYGRLFGVHVALITLAGALSPWLFGYLYILTGSYTVMLSICGTA
FT                   YLLGALILLPLGRYPKFDSLNLA"
FT   gene            640104..640841
FT                   /locus_tag="Bxe_C0616"
FT   CDS_pept        640104..640841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0616"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36514"
FT                   /db_xref="GOA:Q13HC5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC5"
FT                   /protein_id="ABE36514.1"
FT                   /translation="MNELDFSGKTVLVVGGSSGIGNGIARAFLERGATVHVWGTRRSAS
FT                   DYADSPDSSLTDLHYAQLDVSDAASVERCVLPFASLDVLVQAQGTVLYDRQEFKAPAFR
FT                   KVLDVNLTSLMACADRCFEALKAARGAMIIVSSAAAFHSTRGNPAYNASKTGAFGLTRT
FT                   LAEAWARDGIRVNGIAPGLVDTKLTRVTTADPKRLDAALRRIPLGRLGTAADMAGGALF
FT                   LASPLSAYMLGQTLLLDGGMLLA"
FT   gene            640866..642155
FT                   /locus_tag="Bxe_C0617"
FT   CDS_pept        640866..642155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0617"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36515"
FT                   /db_xref="GOA:Q13HC4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC4"
FT                   /protein_id="ABE36515.1"
FT                   /translation="MSWDFETDADFQAELDWIDQFVREEVEPLEHVLGSPWNIHDPAFK
FT                   ALVKPLQQRVKERRLWACHLGPELGGPGYGQVKLALMNEILGRALFAPIVFGCQAPDSG
FT                   NAEILAHYGTEAQKERFLKPLLAGDIVSCFAMTEPQGGADPKVFTTRAVRDGDAWVING
FT                   RKWFASNARYADFFIVMAITDPEVSAYKGMSMFIVPANTPGLSIIRNVGMADEPEATHA
FT                   YLAFDDVRVADEQMLGAPGDAFVVAQVRLGGGRVHHAMRTIGLAQKALDALCERALSRH
FT                   TQGGALADKQMVQEKIADSWLELEQFRLLVMRTAWRIDRYQDYQKVRKDIAAVKAAMPR
FT                   VLHDIAARALHVHGSIGASSEMPFAGMISRAFQMGLADGPTEVHKVTVAKQLLRDYAPC
FT                   EQMFPAYHRPTAAAAARRKFAAALAQGAAR"
FT   gene            642152..643204
FT                   /locus_tag="Bxe_C0618"
FT   CDS_pept        642152..643204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0618"
FT                   /product="Putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36516"
FT                   /db_xref="GOA:Q13HC3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC3"
FT                   /protein_id="ABE36516.1"
FT                   /translation="MTNEAWQSAVNVERLAHWMDAQRLGRGPITGARLLTGGTQNILLR
FT                   FTRGAHEFVLRRPPLNARPEVCATIAREARVLAALAGTEVPHPTLHASCTDDDVLGAPF
FT                   YLMAPIDGFNASAGVLPELHRDPAIQQRMGRSMVDALLRLGEVDPQAVGLGDFGKPQGF
FT                   LERQVARWRGQLEHYQVHAGWPGPSSLPGVTDVAQWLEANRPAPSRTGILHGDFHLANV
FT                   MFCTKSAELAAIIDWELATVGDPLLDLGWLVATWPDASGQGAGTIRVTPWHGFASASEL
FT                   VGYYRERSTRELSAIDWYVVLARFKLGILLEGSYARACAGQSPAGLGQRHHASALRLIE
FT                   QARERIAQLA"
FT   gene            643201..644049
FT                   /locus_tag="Bxe_C0619"
FT   CDS_pept        643201..644049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0619"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36517"
FT                   /db_xref="GOA:Q13HC2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC2"
FT                   /protein_id="ABE36517.1"
FT                   /translation="MTGAAGPDAPAARSRREYDENKETGVVNLEGKRVIVTGCASGIGA
FT                   SAVKALVRAGAEVAALDLSDEAGRAVAADASAAGPGVAHYFSCDVSRKDQVDEVFRSAV
FT                   TRLGGLDALINIAGVERKAPAEAVTQDDWDLMFDVNARGTLNTNQAAFAWLREHGGRIV
FT                   NFASAAGVMGVPGLAHYSASKAAVLGWTRTAAKEWGKYGIAVNAVAPAMWTPMYEKFRA
FT                   RLDSAQLAAHDAMMAQQVPLGGRLGDPDKSMAPVLVFLVSDGANFITGQTLAVDGGLMI
FT                   P"
FT   gene            644063..644896
FT                   /locus_tag="Bxe_C0620"
FT   CDS_pept        644063..644896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0620"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36518"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:5K9Z"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC1"
FT                   /protein_id="ABE36518.1"
FT                   /translation="MSERLKDRVALVTGAASGIGAATARLMAQEGAFVVLADVDEHAGQ
FT                   ALARELRDATFAYTDVSVEAQVAAAVDEALRLHGRLDCMVNNAGFVGAYGSILETSAAA
FT                   WHATLGVLLDGVFYGIKHAARAMVKQGSGCILSVASTAGVMGGLGPHAYTSAKHAVIGL
FT                   TRSAASELAPRGVRVNAVAPGTTVTEMMVQGRGSRQAAIDAATRASPLGTPLMPQEIAA
FT                   ALVYLASDDARHVNAHTLVVDSGVTVAGASGGAVFHNRPAGFMGRMPGGANADAR"
FT   gene            645066..646091
FT                   /locus_tag="Bxe_C0621"
FT   CDS_pept        645066..646091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0621"
FT                   /product="Putative hydrolase"
FT                   /EC_number="4.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36519"
FT                   /db_xref="GOA:Q13HC0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HC0"
FT                   /protein_id="ABE36519.1"
FT                   /translation="MLIDVHAHLFTPGMLKRHDFWGPFMKTRGLTVGHFSLGTTQPSKA
FT                   RDDDEAEANLLARMTHAARRKLMAERGVDKLVLSTPSHAFMYWAGEFGDEYASICNDEL
FT                   SAFCAQDPEHFAFWAHANLANPAQAVREIGRAVTQLGAKGVCVGGANFNGLEAHSEELF
FT                   PVWEALSKLDAPIMVHGFNQSIYWGEKHTDDKFETTSIVGDCVDETLFFWNLINGGALD
FT                   TFPNLKTYITHAGGMAIFQLGRLNDLNRVMAPDSRNQRELIEYLPNFYFDLDVHAPGLR
FT                   RGVVDVVGVDNLVYGTNFGGAYEHGDLTEGLGLTDGEREKIRSGNARRLLKLDAHEPVA
FT                   A"
FT   gene            646149..647093
FT                   /locus_tag="Bxe_C0622"
FT   CDS_pept        646149..647093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0622"
FT                   /product="Putative Rieske (2Fe-2S) protein"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36520"
FT                   /db_xref="GOA:Q13HB9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB9"
FT                   /protein_id="ABE36520.1"
FT                   /translation="MTTGSWWAAALAESVDASRPLAVVCNGEALVLFRDASGAACALED
FT                   RCPHRRVPLALGKVTPKGLQCGYHGWTFDGKTGACTAIPNLSADERVPPRYGARSYRVA
FT                   EASGFIHVWLGDGEPDDARLPGSLYHPQGEEHTGASIVNVAAHEYLDAMLDGPDCLVSF
FT                   DGVRITDFFLGDARTGDGWLTVDRGAVWKTRMLPPAFVTDHPLIVRTSVSLAGGAALVG
FT                   LLDADETPLVTVFVASSANRRGTTSLCWRGFRHDARVASAPLRWQIARATGRAPFTVRE
FT                   QIDGAALAALLVAPSRDLAAARTAIRAPIASIA"
FT   gene            647160..648236
FT                   /locus_tag="Bxe_C0623"
FT   CDS_pept        647160..648236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0623"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36521"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB8"
FT                   /protein_id="ABE36521.1"
FT                   /translation="MNTALDSGAPAPAGNADAQGPGDATPRKAGRRDWTPVNYDLRDAW
FT                   FPVSHSRDVTQRPIRRIIHSQPYYLWRDDGKPVASEFRADTPQSARARASAFTGGSGFY
FT                   PVVERYGYVWAWYGNPDCADVSLLPHIPFLPLDDSLPRYTQRTVRFDAASALSVENLLD
FT                   LTHADFLHAGTIGDGISQSDIVEVEWTSETVTRTRIVTQKSVAPIMRWVGGVRARYQDF
FT                   RAVLHVHLRSNVCISYPRFRPGYDVPNLQPFLPVGRHRSRCDVTFNTTAAPVPLRYVMP
FT                   RIAFVIQPQDNSVVRPQNERYFDPDERRDLHSRFDTPGTRYRFQMELLAQRQQRGDFSY
FT                   GPDADPGRDISGLLGMND"
FT   gene            complement(648299..649189)
FT                   /locus_tag="Bxe_C0624"
FT   CDS_pept        complement(648299..649189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0624"
FT                   /product="Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36522"
FT                   /db_xref="GOA:Q13HB7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB7"
FT                   /protein_id="ABE36522.1"
FT                   /translation="MPISPDLEAQYNLRALRPDFEAGMLQEWLARSDRFRRSCGGSLDL
FT                   AYGDGERDRLDYFPAAATDAPLLVFFHGGYWQRGDKSVYSFVAEPFVAAGISVALVNYT
FT                   LCPAVRIGDIVTQSQRALTWLWRHADALGCARARWIVSGHSAGGHLAARLMATQWPAVG
FT                   ADLPPQLLDGAILISALFDLEPLCETSINHGLGMGRGEARAASALAHPPASDAPQLIAV
FT                   GGAETAAFHQQARAYATAFGTALRPMPGYTVEDCDHFDVVQAFADPRHAFFDLARQFIH
FT                   STSPPVHTAFHGGRT"
FT   gene            complement(649357..650130)
FT                   /locus_tag="Bxe_C0625"
FT   CDS_pept        complement(649357..650130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0625"
FT                   /product="Putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36523"
FT                   /db_xref="GOA:Q13HB6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB6"
FT                   /protein_id="ABE36523.1"
FT                   /translation="MKIARYRLNDAVHYGVLEGKSLQRLNGSPFASLTPAGPRDALADA
FT                   QLLCPLPAPRLFAVGMNYVGHIAEAGAKTPVIPQFFMMPTTAAIGPGEAIVRPREAQVV
FT                   HHEAELAIVIGRRGRRIDVERALDHVFGYTCANDVSERVIQNREMGYGCLLVGKAFDTF
FT                   CPLGPVIATGLDAGNLRVRASVNGSPRQDGNTSDLLFTVPHIVSYLSQAVTLLPGDVIL
FT                   TGTPSGVGPLLSGDVCEITIDGIGTLCNPVIDEAA"
FT   gene            complement(650142..650882)
FT                   /locus_tag="Bxe_C0626"
FT   CDS_pept        complement(650142..650882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0626"
FT                   /product="Putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36524"
FT                   /db_xref="GOA:Q13HB5"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB5"
FT                   /protein_id="ABE36524.1"
FT                   /translation="MARPLCAGSRHPSEARPSPAIALSGSENPTMTSLADQLATCNTPG
FT                   LFDVLRSHGLPVRELPREIRGLSPAMKLAGPVFTVTGRSDPTISVAESLELFISRVLSG
FT                   APAGHVVVCQPHDHARSAMGDLAAEALKQRGIRGYYIDGGSRDADEIESIGFPVFARYT
FT                   SPIDIVGSWRLEATNVPVVIGGVTISPGDYVLGDRDGTLLIEREHAGFVITETVKTMST
FT                   DSRMRTAIRGGRDPYDAFLEFGKL"
FT   gene            complement(650923..651306)
FT                   /locus_tag="Bxe_C0627"
FT   CDS_pept        complement(650923..651306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0627"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36525"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB4"
FT                   /protein_id="ABE36525.1"
FT                   /translation="MSIFTHFTLGTRDLDRAKAFYDRVLEPLNLKSLFSIEGKVCGWGK
FT                   EAPQLMVLYPRNGEPATAANGLTVGLAAPDREAVREFHRRALELGAVCEGPPGPRPFAP
FT                   NAYAAYIRDLDGHKIVASCRTPE"
FT   gene            651586..652374
FT                   /locus_tag="Bxe_C0628"
FT   CDS_pept        651586..652374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0628"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36526"
FT                   /db_xref="GOA:Q13HB3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB3"
FT                   /protein_id="ABE36526.1"
FT                   /translation="MAKAMASSKTRTRKADAAPPAKPRTAAGKRPKAVAQAVVEAPKAR
FT                   RRRAPEPAVAEPPVAAPAPRRRRSNRRSEQTIDNIFAATQKVVLESGAERISILEVCET
FT                   AGVSRGTFYRYFSSQEELLEAYSRHARERFHRTLSELLAPYTDPNERLARLIRYLQDFL
FT                   DAGTAQRMLVVAPEFALRFLKRIFHDSVVRFQDLLAPMFDAWDEELGVKLDRELICDLL
FT                   IRLVMSELLVSGESEGGVMPRRIGRLIDALRFGGVTRARR"
FT   gene            complement(652402..652749)
FT                   /locus_tag="Bxe_C0629"
FT   CDS_pept        complement(652402..652749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36527"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB2"
FT                   /protein_id="ABE36527.1"
FT                   /translation="MADTGHIEAFLLAQTDHWNAGDKQAFLDDYRRAAPDGLTIEYVGR
FT                   PPQDGWAVLDHMWRQQRDRIRVEPVAKIVNGNEAACYVRNVIIGTGSAIETIELYRFDA
FT                   GRLHVRYFIRQ"
FT   gene            complement(652804..653835)
FT                   /locus_tag="Bxe_C0630"
FT   CDS_pept        complement(652804..653835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36528"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB1"
FT                   /protein_id="ABE36528.1"
FT                   /translation="MKSFKTVPQRGDFRYQTLVAPHKVSGRAMHDLRGFYGLQLTKGMP
FT                   FGCVRDEDGEIYAFVRAVNEPGSTPNPTRFIYLSTRVDGQHLRIDKSRIEPRATTLFPR
FT                   RWLEGDTACWSSLEGEPGAGWQLSASGERLSWTEEGLFELGGPLLGQGMQWYLPGVDWG
FT                   TFYVSQIYDIAGICDGRRVKGLMCFDQAYMAEGGAIHFSKDLVVNHQMHVIWWSFATVY
FT                   KDGSWDVGSFMVGHDHLGYAIFQNDKGEIRTTTDIDGRVQHKDGSYFVESARIVLDGEE
FT                   EWEFLPCPKGEMIDFVGGFPITAQQEGRWRRVGDTREADRWVGWGESDRRNGTARNVRG
FT                   IQP"
FT   gene            complement(653926..655209)
FT                   /locus_tag="Bxe_C0631"
FT   CDS_pept        complement(653926..655209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0631"
FT                   /product="Cytochrome P450"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004), Can.J.
FT                   Microbiol. 48:49-59(2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36529"
FT                   /db_xref="GOA:Q13HB0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB0"
FT                   /protein_id="ABE36529.1"
FT                   /translation="MSTTLENPMLDLEAAYHAVSDTYRGPDIDLQALCREMRHKNPVMK
FT                   GDFVATHLGIPTNAGASAAKCEVTLFRYQDVLAVMRDATTFTNGFIAEGLGGFFDGLII
FT                   LAMDGDAHRRARGLLQPVFMPETVNRWRPELDRVIREDFLAPLVPNRHADLMDFGLYFP
FT                   IREMYALMGFPTDDTAKFNQYATWALAMVAGNQIDPGKIRIFGPIAAAAVKHLYDAVME
FT                   VVLQRRAAGADGNDLISRLMRAEYEGHKLDDHEVTTFVRSLLPAAGETTTRTFSSVITL
FT                   LLERPALVERVRNDRSLIPRLIDEAVRYEPVATFKVRQAARDIEIGGVKVRSGGLVQCM
FT                   VMSANRDEDVFENADTFDIDRKPKPSFGFGFGAHMCIGQFVAKIELQCAVNAILDLFPN
FT                   VRLDPARPAPKIAGAQLRGAKSVPVIWD"
FT   gene            655490..656473
FT                   /locus_tag="Bxe_C0632"
FT   CDS_pept        655490..656473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0632"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36530"
FT                   /db_xref="GOA:Q13HA9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA9"
FT                   /protein_id="ABE36530.1"
FT                   /translation="MESAVSDLYTVAGDDHLVRRPRMPSSRLSVDAHICTPRFEVNVRT
FT                   LRLDDPLDAYFRPPAGYLDMSLDERSQGRYGAFRGDAGDTDFAPLGASVFVPAGQTFHV
FT                   RCAPMRRRVICCMFDADWLDELRDWPWEPSRLGRCRDLRIPAVREAMFKLAHEALAPGF
FT                   GARVLAESLLLAILVQLARHFHDRGGDARERGGTQLASWQLRLIRERVEGARGPSPGVT
FT                   ELARACRISARHLARTFRNSTGSTLGAFIADARVRQAKALLAQRDVMIKAVAFECGFQS
FT                   PAAFGAAFRKITGRTPREYRLDMLGLQTAHDTKCPFEDSLTVRSDN"
FT   gene            656553..657971
FT                   /locus_tag="Bxe_C0633"
FT   CDS_pept        656553..657971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36531"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA8"
FT                   /protein_id="ABE36531.1"
FT                   /translation="MSTLYSRLLDEPTALVGACYDEAFRLTPQQILDIQLSGARRRFTD
FT                   LRARIPVLDRLGSEQGIDDIQRIEDVAPLLFAHTVYKSYPMSYLERGQFDRLTRWLNGL
FT                   TAEDISHVDASGIKLIDDWIDLLDAQTNLRVFHTSGTTGKLSFLPRTDREWRQNIALSA
FT                   NRIRDWRGPGSGPDLLAQERPLIAPAYRLGASAAARGGGYQVEMYAGGEENALFMYPDA
FT                   RFSADVASLSGRLSVAQAQGELGALQISPALLAKRDELVRIERERPEQLRRFFAEAIRR
FT                   FGGKDVYIGAVWSILYDTATEGLARGARGVFGKHSVLHTGGGKKGKNMPENWRDRLVEF
FT                   LGFDNFYEFYGCSEQMGFCMRCEEGHYHVPPTTIAFLLDPATGKPLPRKDGLTGRFASL
FT                   DLLPGTYWAGLVTGDEITMGGLEKPCRCGRSGAYLLPAIRRYTEKEGGDDKVICAGAPA
FT                   AHDEALNFLTELSE"
FT   gene            657979..659436
FT                   /locus_tag="Bxe_C0634"
FT   CDS_pept        657979..659436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0634"
FT                   /product="Long-chain-fatty-acyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36532"
FT                   /db_xref="GOA:Q13HA7"
FT                   /db_xref="InterPro:IPR008670"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA7"
FT                   /protein_id="ABE36532.1"
FT                   /translation="MTSTWKVPLIIRGNVIESDEQHFGGRRGGVSFTAPDVRRHADELT
FT                   LRGPSMMADLYTLSLDEIVDFLVELGQHLNFADNRHLQHAFELACTTSGLSESILRFHY
FT                   ARTPRLFQRDELYAIVARSVGADYLEGWVEQPGKLIPGVTARTRAFGARCVHVIAGNAP
FT                   VVAVLTVIRNALTRSDAIIKAPSNDPLTATAIARTMIDMAPNHPLTRHLSVAYWKGGDE
FT                   AVEQRIYDPRRIEKLVAWGGFDSVKHITRYLQPGIDLITLDPKLSGTIIGKEAFADDAT
FT                   LASVAKRLALDIGAQNQEACVSARVAYVQSGTDEAGLARCARLAGLTFEALQRLPDTLS
FT                   TPHKAFDPVLKEELDGIRMFADEYTVYGGRGNEGAVIVSRDGTPVSFSRILGCRVGNLV
FT                   PVDDISTAVRSVNAYTQTIGIFPETLKAALRDRLAWQGAQRLVSLGAAATLQHNLERQD
FT                   AIEPLRRMVKWVTEESADPALIESLAG"
FT   gene            659473..660213
FT                   /locus_tag="Bxe_C0635"
FT   CDS_pept        659473..660213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0635"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36533"
FT                   /db_xref="GOA:Q13HA6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA6"
FT                   /protein_id="ABE36533.1"
FT                   /translation="MHMNPIEDKVVMITGASSGIGEATARRLAQQGAKLVLAARRSERL
FT                   SRLAAQLGGADRVLWDATDVTKPEALQQLAATARERFGHLDVLVNNAGIMPVSLIAQGR
FT                   VDDWNRMIDVNIKGVLYGIHAVLGAMLERGVGHIINISSVAGLSVGPGGAVYSATKFAV
FT                   RAISEGLRQECAGKVRVTSICPGLVASELPDSITVPAFRERAQKLFEGAMPADAVADAI
FT                   VYALTQPEQVAVNEIVVRPLTQSF"
FT   gene            660321..661073
FT                   /locus_tag="Bxe_C0636"
FT   CDS_pept        660321..661073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0636"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36534"
FT                   /db_xref="GOA:Q13HA5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA5"
FT                   /protein_id="ABE36534.1"
FT                   /translation="MSSPSADTASPNSSTSPSRKRATIARLLKEARRAFSAHGLAGARI
FT                   DDIARAAGVTKQLVYHYFTSKEALFASVLDESAQDVLADLLALELDHLPPVDGLRVLLR
FT                   HGFDQYRRDPTLGSLAQESLRFHEHHACATQRNRFVDLAPALVAQMERILLRGIASGDF
FT                   RSGVDARMFYAASALLTTGGFTNHYTVSAVAGFDTTSADGAVAWREYSIDFVLSTVLAH
FT                   ERPPLTRPRAPSSRSADAPRAEDGGHDA"
FT   gene            complement(661029..662675)
FT                   /locus_tag="Bxe_C0637"
FT   CDS_pept        complement(661029..662675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0637"
FT                   /product="Putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36535"
FT                   /db_xref="GOA:Q13HA4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA4"
FT                   /protein_id="ABE36535.1"
FT                   /translation="MSTSQTHDVVIVGGGHNGLSAGCYLAAAGKKVLVLEALEKVGGMA
FT                   SSGYLLPEAPEHLIHPCALDMMSMRVHSRVPRELELERHGFRQVEMTPGYVYLHPDGTS
FT                   LVFWRDPGKTAQEIRRYSPKDAESFLAFIKVVFAFLDLALPMMRVDPAERNLGARFESL
FT                   RAALRNRKLKPELMALLTGSAYQAALEHFEHPVTISAMCSLTGLAGPITADGSGIYYAL
FT                   LGFLHRFGVGRVVGGMQALSNAMAARLRELGGEVLTSARVEEIVADERALRGVRLADGR
FT                   TFGARAVIASCHPQVALELVSPGRIDQRLLTRIRHAPANAHGASPLKLDMALRGQISLA
FT                   RFEAKRGDGLDLRKTCLLIGTAEAVLENFRASARGEVPTLPYLSLAAPGAIDPSQAPAG
FT                   QDTVYIYPPAMPAHPREGWDAIRERVAQQVIDQASEYVDGLKEFEIARRMEAAPDFTRR
FT                   LNTVNGCVVHIDTTTMRSSKLRPAYGLGGATLPVPGLYFGGAGIHPGGGVNGMPGRIAA
FT                   HRVQRWLGRNERRGTRALGVVTAVLGAWGIG"
FT   gene            662976..663206
FT                   /locus_tag="Bxe_C0638"
FT   CDS_pept        662976..663206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0638"
FT                   /product="Ferredoxin"
FT                   /note="Citation: J. Bacteriol. 181:2675-2682(1999)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36536"
FT                   /db_xref="GOA:Q13HA3"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA3"
FT                   /protein_id="ABE36536.1"
FT                   /translation="MGSEIRETAVLYVRADRSRCCGYGLCAQLCPQVYKLDENGIVYLE
FT                   SDTVPRELESDAREGAAACPAEALTIEAAGA"
FT   gene            663217..663993
FT                   /locus_tag="Bxe_C0639"
FT   CDS_pept        663217..663993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0639"
FT                   /product="Putative dehydrogenase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Citation: J. Bacteriol. 182:3784-3793(2000)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36537"
FT                   /db_xref="GOA:Q13HA2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA2"
FT                   /protein_id="ABE36537.1"
FT                   /translation="MTRRWRMGRLEGKVALISGTGGGQGRAAALRFAREGAKVFGCDVD
FT                   AAAQQETVALARAGGLEVAGGGSVDLGDAQAARAWVEEAVAAYGRIDILYNNASAARFG
FT                   AVGDMSVDDWRWTIRNELDLVFYSTHYAWRHLAERGGVIVNISSVAAWGASGTTGIGAH
FT                   SAAKAGVVALTRQLAVEGARHRIRAVSISPGVVATPGTRPFLDNPATRAALLAGVPVER
FT                   AAEPEEIVAVALFAASDEASYLTGADIVVDGGMLSL"
FT   gene            664080..664985
FT                   /locus_tag="Bxe_C0640"
FT   CDS_pept        664080..664985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0640"
FT                   /product="Aromatic ring-cleavage dioxygenase"
FT                   /EC_number="1.13.11.39"
FT                   /note="Citation: J. Bacteriol. 182:3784-3793(2000)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36538"
FT                   /db_xref="GOA:Q13HA1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA1"
FT                   /protein_id="ABE36538.1"
FT                   /translation="MDEWRTYGPEVLGWQIGESPQTDRDSLYFRMDDRRHRFAFHPGKT
FT                   DRLAYIGWEARGKLEFQAAVQRLREAGVEVTEGDAGLRGVREVVRFRDPVGYQHELFYS
FT                   QKWMPRSFIPGRPHGGFTAGARGLGHIVVITPEFPPELEHFLTVVMGFHYYGAGAGKGK
FT                   TAFYRSKLNNSTSHDIAYGHGPNRMGVQHVGLFVNNLRDVGETYDIVKQRNLPMMMTLG
FT                   QHTQDPHVSFYHFSPGGFAFEIITELEPWHDDGFELNPEKLSTWGHEQVGPILGPSVRA
FT                   PEEVLDPQGLEILARWRQPA"
FT   gene            complement(665023..665808)
FT                   /locus_tag="Bxe_C0641"
FT   CDS_pept        complement(665023..665808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36539"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA0"
FT                   /protein_id="ABE36539.1"
FT                   /translation="MRPAARAGRLSHGTPRVTDQPIIVLVHGGQHRRTCWDPTVAALNT
FT                   LNPHAPVLAVDLPGHGNEPGDLARLTIAQCVESVLAQINASRASSGAKSVVLVGHSLAG
FT                   ITLPGVAAKLGTALKRMIFVACCIPPNGQCVLDTLGPPMNFIAKRAARREAVSAPLPAF
FT                   VASWVFGNGMTRDQKQQVIRGLCAESTKVTTEPVDRSMLPDVPRSWVLTKRDRALRPDL
FT                   QRRFIANLGGVDEVIELDTCHDAMISEPVELAQIILGRC"
FT   gene            complement(665836..666660)
FT                   /locus_tag="Bxe_C0642"
FT   CDS_pept        complement(665836..666660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0642"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36540"
FT                   /db_xref="GOA:Q13H99"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H99"
FT                   /protein_id="ABE36540.1"
FT                   /translation="MSNEKAGGKLENKVAIVTGAGAGLGAACARALAQHGARVAVVDIN
FT                   GEAAAAVAADIGERAMSVRTDVSSEAQVKAMVSAVLEHFGRIDILHNNAAVLDDAQRAG
FT                   DRDVINMSVEVWDRAMAVNLRGAMLCCKHAIPAMLRGGGGSIIHSSSGFGAQGDFTMSA
FT                   YAASKAGLAMLSKSVAAQYGKERIRSNTIQIGLVVADHPLPEDIKGVILDGHLTPYLGD
FT                   PKHVADVVCFLASDEAAFITGDTLAVDGGFSSHAPTLAPLRALFAARGKAAY"
FT   gene            complement(666667..667464)
FT                   /locus_tag="Bxe_C0643"
FT   CDS_pept        complement(666667..667464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0643"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36541"
FT                   /db_xref="GOA:Q13H98"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H98"
FT                   /protein_id="ABE36541.1"
FT                   /translation="MDAKTNNAAVRVERNGRTAWIVLNRPEQINAINDEIREAVPRALL
FT                   ELDADPAVSVIVIRGEGPRGFCAGADIKEKRGPESSLQVRRRMEHSRWIETLDRVAKPV
FT                   IAALHGFCMGGGMELALACDIRYAAPDTVMALPETGLGLIPGGGGTQRLSRLVGHGMAM
FT                   DMLLTGERLDSRRAQEIGLVSRIAAAPASLFEEVQALADRIAVRSPMATAYAKQAARTA
FT                   LELDLRRGLDRELDLFALLAPSQDVKEAALAFKEKRVPVFTGE"
FT   gene            complement(667493..668467)
FT                   /locus_tag="Bxe_C0644"
FT   CDS_pept        complement(667493..668467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36542"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H97"
FT                   /protein_id="ABE36542.1"
FT                   /translation="MFDLLMTADMMVPDPDRMTELLVNKLGIHKHPNWRQAFDNHPYIA
FT                   HFLRVHKSLAVAPTRVEPQVHLDRPNPGDPLFHDFLKSLETYQGKHRPILTHSIVVASR
FT                   KPHFEQTVERLARLRQPFRLAQRTPEMPFDRLWVGVTPERPCYEPSVDGGLCIEIMPVE
FT                   PLQLPPETFAIPAPQPRDLQPGQLVRVTARGYLVRDLDDTLRRCSTNLGWDPAGPVEQL
FT                   DVEGYRRARMGFTLQNSASLDVIEPTRWNSDAGLYLNNWGPGPYFVRIAVNGLQVKAEE
FT                   LKSRGVRFDWIEACEAVGGRSLLRIHPSELDGQLFEFEEFQAP"
FT   gene            complement(668498..671002)
FT                   /locus_tag="Bxe_C0645"
FT   CDS_pept        complement(668498..671002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0645"
FT                   /product="putative transporter, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36543"
FT                   /db_xref="GOA:Q13H96"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H96"
FT                   /protein_id="ABE36543.1"
FT                   /translation="MDKPQDSAAAQEQRPSVAQQPFDRRSGGPVERLIFNHRAFIVVIC
FT                   ILLTALFGVRAMRLEVNANFLNMIPQSHPFVRNYLDNEGSLRSLGNSLRISVENTNGTI
FT                   YDANYLRTLEKINDNVFLMRGVDRTWMKSLWTPSVRWTEVTEDGFKGGPVMPEGYDGSV
FT                   KAMAELRRNVARAGLGGSMVANDERSSMIFVPLLDKDPVTGQPLNYRELSHELQRQIET
FT                   LGAPGIKVHVVGFAKLTGDLIDGLDRVIIYFGISALIAALALYGYTRCARSTLLVLLCS
FT                   AAAVTWQLGIVQLLGFPLDPYSILVPFLVFAIGVSHGAQKMNGITRDVARGAHRYAAAR
FT                   FTFRRLFLAGLTALLADVVGFAVLMIIDVPVIRNLALAASIGVGVLIFTNLVLLPVLLS
FT                   YTGVSASAIRRARNSENPGARRSFAVRGYQAFERFSTRRWAISALLGALVLFAGGYAVS
FT                   LHLQVGDLDAGAPELKANSRYNLDNAFINAHYNLSSDVFAVIVKTPPGGIESFPTLIEM
FT                   DRLETQLRNTPGVRGTESAASVVRQYVAGSFEGSPKWLSINRDPFVTGDAFAQVVVALP
FT                   ELTNADRTVGPLLVFLTDHKAETLARVVRVVQDFAAGHDTAERHFMLAAGSAGIEAATN
FT                   IVVEQANREMLALVYASVAILCFITFRTWRAVVVALIPLMLTSVLCEALMVMLGIGVKV
FT                   ATLPVIALGVGIGVDYALYLLSVQLARQRAGATLREAYRDALQFTGKVVMLVGFTLAGG
FT                   VVTWVWSPIKFQADMGILLTFMFIWNMIGALVLIPALSWFLLRPKTERLRRDADPEPAA
FT                   PMAQPGAKTPARMTQVSVTSGR"
FT   gene            complement(671036..672127)
FT                   /locus_tag="Bxe_C0646"
FT   CDS_pept        complement(671036..672127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0646"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36544"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H95"
FT                   /protein_id="ABE36544.1"
FT                   /translation="MFIRTLQRAAAVGLALIGACVPGLAAGSGKPAFVDPLDAPAAVAV
FT                   SPARQPMTAVAYAGSRLVAVGQRGVIVVSDNRGQTWRQVPSPVQSDLTAVTFPSATEGW
FT                   AVGHDGVILHSSNGGQTWVKQLDGRIANARFVAFYRAAAASGNTNAAPLLQQEERNAKA
FT                   GASLPWLDVWFDTPQRGYAVGSFGIVAVTTDGGKNWLPGLEYVDNPDFLNLNAIRGING
FT                   DIFIAGERGTVFRLDRSSGRFERLSSGYTGSFFGIAGNGKRLFAFGLRGTVYESTDRGD
FT                   TWQQARSGTDSSLNDAATLADGTVVICGSRALLLAGDPVTGELRRVSADTPMMFAGIAT
FT                   NGDGQVALSGSSGVMIESIPARR"
FT   gene            complement(672222..673586)
FT                   /locus_tag="Bxe_C0647"
FT   CDS_pept        complement(672222..673586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0647"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36545"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H94"
FT                   /protein_id="ABE36545.1"
FT                   /translation="MKRVLILTTLASALCVSAHAIAAVSAEEAKELGHKLTEFGAEKAG
FT                   NADGSIPPYTGGVKDLAIPADFKPGSGHYPDPFKDEKPLVSITKANEAQYAEFLMPGTK
FT                   ALLERLPGFRIDVYKTHRTMAYPDWVLKNTVGCARTAKLVGSVTGDGVEGAFACIPFPI
FT                   PKNGYEVMWNQNLRYQGVRTDFRFRTILIDESGHKTLMGDNETQFIYQYYDRNGSKLPD
FT                   NFFRTGFTRFYGPPSEVGMMTLAKYSINDGTDDDTTWIYMPGQRRVRVAPEYKYDTPMA
FT                   AIGGTLLFDEVGGFQGRMDRFDFKLVGKKEMFVPYNNYRAYNSSDLVGDKYANPDDVRW
FT                   EKHRVWVVEATLKPGERNIYSHRTYYIDEDTWLIVGYEAYDQSNALYRAGYTLDIVPYD
FT                   KPRVGQPNAIMYDLTKGNYSVTADQGTPSQHMIPFDDLPNMGNYNTQALLNAGVR"
FT   gene            complement(673699..675405)
FT                   /locus_tag="Bxe_C0648"
FT   CDS_pept        complement(673699..675405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36546"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H93"
FT                   /protein_id="ABE36546.1"
FT                   /translation="MNGMTSRARLKRNRVSVGVAAALGCWAASASAMPLGAIPDWDINW
FT                   DNTISYNIGMRAQGINPNIGNNPTFSESDYKFAHAGDIVTNRVSDLSEFDAVFQNKFGF
FT                   RVSASFWKDFAYGGGVSNNPGMAYPGTPYSTLNSYANNRYSSYTERYYQQGAELLDAFV
FT                   FYNFNLGSAPSSIKVGRLTQYWGNALFFSGIAYGQNAIDGIKGAAVPGTQLKELTVPRA
FT                   QVLFQTNITPTVSLAAQYFAEYKPSMFPQGGTYLGTAGFLFQGPNLLDGQIPQGAPVQP
FT                   TNGFHSDYGLKATWSPTWLNGTMGFYYRNLTETNPWVLLGVNPATGATNYHLGYASDVK
FT                   LYGFSLDKQIGPYSTGLDVSYRHNTALNSSTGPLPGDLSGQAGARGDVLNVIGNVMAGL
FT                   TRTPLWDTGSAVVELGYTQKLKTTSNGALYNGVGNSLACPGGNKWDGCSTNSAVAIAVQ
FT                   FDPQWLQVYPGIDLDMPIFLEYGIWGNQATVEPSPGQGTLQYTIGVHALIQNKYNVTLQ
FT                   YNGYHAHAGGQTNFGLANGLPGGGPSYYAGGNSTYFYNDRGWVSLTFSAAF"
FT   gene            complement(676740..677435)
FT                   /locus_tag="Bxe_C0649"
FT   CDS_pept        complement(676740..677435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0649"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36547"
FT                   /db_xref="GOA:Q13H92"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H92"
FT                   /protein_id="ABE36547.1"
FT                   /translation="MTRTKTAAPEQGKQAQKTAPGAIRLRPDERERLILEEATKLFAEH
FT                   GFEASTPELASRLGVTQPLLYRYFHTKDELIRRVYEHVFPVDKLLVEWKSMLDDRTRDP
FT                   RERLVTFYTQWATGSWVDIFLRLVMWARLTRPELIQPYAAATDTRLIPLVQKALYEASG
FT                   LDGTYGGLKDTHEVARAFHALMVDVRLSMIDADYTVERVQTVIRFRLELFIEGLAQRTQ
FT                   RPARREKRK"
FT   gene            677997..679091
FT                   /locus_tag="Bxe_C0650"
FT   CDS_pept        677997..679091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0650"
FT                   /product="Putative hydrolase"
FT                   /EC_number="4.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36548"
FT                   /db_xref="GOA:Q13H91"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H91"
FT                   /protein_id="ABE36548.1"
FT                   /translation="MLIDLHAHAPHPGYYNQHPHWGPFFEEDDRGHIRMRVGHWVLTLG
FT                   QPERKAAEAAGTAPRLDEWMSAWADPSTRIKAMNAAGQDAQVVSLPSHAYMYWTDPEFS
FT                   VRFARKVNDTLAEYCSAYPDRLFFWAHAPLNAPVEAAREIRRAVTTLGAKGLVAGGANF
FT                   GGLEFYDEAMHPVFETLCELDVPMFVHGYNQSVTWGEKANEDRFETTAIVGMNYDEARC
FT                   FWYLVCGGVLDRFPDLKVYLTHAGGFVPYQIGRLAMTNPNLEDALNKRPVEEYLKNFWF
FT                   DPELHELSMRQSLVDIVGANHLVYGTNFGGSDAIRSDMTEGLRLSQEDLDRIRYRNACD
FT                   LLHLAPASIGRCPGQNETTAGIRS"
FT   gene            679088..679924
FT                   /locus_tag="Bxe_C0651"
FT   CDS_pept        679088..679924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0651"
FT                   /product="Putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36549"
FT                   /db_xref="GOA:Q13H90"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H90"
FT                   /protein_id="ABE36549.1"
FT                   /translation="MKLLRCENGDVSFWGVLENSGSTVRPISGRFAEWAPALTRSLDME
FT                   TLVFSGEAVPLERIRLLPPIERTSKVVVAGANYMKHLTDFGLERPKQPFAFLKSYGALI
FT                   GANDPIQYPPLTHELDHEVELVAVVGADRVDPQCPMAAVLGFTVGNDVSARDLQRSGPA
FT                   GIGMDLFSAKSLDQTTGVGPWIVTRDEFPTELPDLRLTLRVNGEIRQDSFTSRMIWSVP
FT                   ELLHFINARCRFECGDILFTGTPERTGEGHISYLNPGDVVEAEIEGIGKIRNVVNG"
FT   gene            680118..681431
FT                   /locus_tag="Bxe_C0652"
FT   CDS_pept        680118..681431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0652"
FT                   /product="major facilitator superfamily (MFS)
FT                   anion(tartrate)/cation symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36550"
FT                   /db_xref="GOA:Q13H89"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H89"
FT                   /protein_id="ABE36550.1"
FT                   /translation="MRTVAQQTVRLVTRRLGVFMLVVYLLSSMDRVNVSFAALTMNDDL
FT                   HFDPGIYGFGVGLFFVSYMLFQLPGAALIRRFGAARPLAIMMVAWGFCASLMSCINGRF
FT                   DFYVLRFLLGLAEAGVVPAATFYLANWVPRQNLGRIMTWAALSLPMAVIIGAPLSGWLL
FT                   TQHSIVHSLPGWRWMFFVEGLPTVILGVVAYFRLTESPAEVRWLTHEQREWLMRELEKD
FT                   RPKQSLSTYSSGQTAGLWTVLSDRNILTIALAYFCIAMGTYGLLYWLPQVIKAASTGLS
FT                   PMAVTLVSTMPWIAAAAGMLLNGWHSDRNQERCRHVATGALIGALGLILSCAFSSPWLA
FT                   LLGLVATGFGQGAAQGLYMAIPIDLLRGNPAAPTAFALINMIGNCAGLVGANLIGWLRN
FT                   ATGSFSMPIEVLAAVLVVGALLLVSLPRLTPGRQLAHQ"
FT   gene            681606..682910
FT                   /locus_tag="Bxe_C0653"
FT   CDS_pept        681606..682910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0653"
FT                   /product="Carbohydrate-selective porin OprB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36551"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H88"
FT                   /protein_id="ABE36551.1"
FT                   /translation="MSCIAMTGAAAEEVAPSPVVQPAPAAETTDCARLDALNTRSRSAE
FT                   VQMPVCQTMLSDIGGWRTWLADRGIGFQASALAGVNYDVLGHARTPQLYGGQSPTYNTS
FT                   SYALFTYDLTRLGMPGDAQLTVKADWYTNSYFPSIRYSGFTAVAINQRFLNGDVELQYG
FT                   YFDLSHSFYGTVLGGNPAVASFGPQSNVLYSAGISSESPTPAAQIILRDPATQHFYNNF
FT                   IVSRSTSPDGQLVENRANPVGLRFSIPGDGALFVDEVGYKRDASVSSRSLWVRGGAVIN
FT                   TSDYPALDKTRSQTSSLHNRAFYGAATAQLTSPYSDARGLYVDAKVDYSPSDVALFAHD
FT                   YSLTAFILGPFSTRRKDMVSLSWSQSFFSPEERRTLQARGADSAHSTSSLEISYALNLA
FT                   RGVYLISSLTRTWNPVFAPLQPPALFVNESVSVTF"
FT   gene            683727..684014
FT                   /locus_tag="Bxe_C0654"
FT   CDS_pept        683727..684014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36552"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H87"
FT                   /protein_id="ABE36552.1"
FT                   /translation="MIRTWFSAHERGKAIGLFMTSSSFAVVVTDMSVPVMTQYLGWQNS
FT                   YRVLGATTIVRALHSRVLGMGECFNDQRSSRIHSGRGNRQCDFRSRSSCL"
FT   gene            complement(684303..685463)
FT                   /locus_tag="Bxe_C0655"
FT   CDS_pept        complement(684303..685463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0655"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36553"
FT                   /db_xref="GOA:Q13H86"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H86"
FT                   /protein_id="ABE36553.1"
FT                   /translation="MHIENDSYQDIRDAIRDLCSQFPADYFRRIDEERGYPEQFVDALT
FT                   RAGWLAALIPQEYGGSGLGLTEASVVMEEINRCGGNSGACHGQMYNMGTLLRHGSDEQK
FT                   NRYLPRIASGDLRLQSMGVTEPTTGTDTTSIKTTAQRNGDRYVINGQKVWISRVQHSDL
FT                   MILLARTTPLAEVGRKSEGMSIFLVDLHEAIGHGMTVQPIRNMVNHETNELFFDNLEIP
FT                   AENLIGEEGKGFRYILDGLNAERALIAAECIGDGYWFVDKVTEYTKQRVVFGRPIGQNQ
FT                   GVQFPIARAFVNIEAASLMRYKACERFDARQPCGAQANMAKLLAADASWEAANACLQFH
FT                   GGFGFAAEYDVERKFRETRLYQVAPISTNLILSYVAEHILEFPRSF"
FT   gene            complement(685485..686321)
FT                   /locus_tag="Bxe_C0656"
FT   CDS_pept        complement(685485..686321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0656"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36554"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H85"
FT                   /protein_id="ABE36554.1"
FT                   /translation="MNDETISIEDVVTLAPASALEATLDHPVSLRTGDALPPLWHWLYF
FT                   WPRARQSALGADGHPLKGSFLPDLGLPRRMWAGGRLRFIAPIAIGEAIMRRSAVTSFTE
FT                   KAGRSGRLGFVTVRHEIAGAKGLLIDEEQHIVYREPPQPGSSAPAPIPARTDATWRRLI
FT                   EPDETLLFRYSALTFNAHRIHYDRTYVTQVEGYPDLVVHGPLQAALLADLVQRHLPGRA
FT                   FETFLFRAVRPLFLGQPFSVCGRPAADGSTVELWVSDHEGALTMSAQATLAGASRA"
FT   gene            complement(686318..687496)
FT                   /locus_tag="Bxe_C0657"
FT   CDS_pept        complement(686318..687496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0657"
FT                   /product="Putative acyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36555"
FT                   /db_xref="GOA:Q13H84"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H84"
FT                   /protein_id="ABE36555.1"
FT                   /translation="MRPLDGIKVVTFEHAIAAPFCTRQLADLGARVIKIERPGTGDFAR
FT                   QYDERVHGLSSHFVWVNRSKESLTLDLKQAEAMQIVHALLAGADVFVQNLAPGASRRLG
FT                   LDYASLSQRYERLVVCDISGYGLDGPYRNKKAYDLLIQSESGFLNATGTAHEPAKAGCS
FT                   IADISAGMHAYSSILAALLQRARTGKGTHIDISMFESMVEWMSHPLYYTYGGQAAPQRH
FT                   GASHATIYPYGPFAAGDGKSLMLGLQNEREWEVFCRMVIQRPELFQDPRFSSNSRRHEN
FT                   RRLLEQIILESFSVLKVEQIVERLDAAGIANAHMRDVSELWNHPQLGARERWTQVSTPV
FT                   GPIPALLPAGMTAASQPRMDPVPGLGEHTQAILRELGYGDAQIEALQRRRTI"
FT   gene            687631..688617
FT                   /locus_tag="Bxe_C0658"
FT   CDS_pept        687631..688617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0658"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36556"
FT                   /db_xref="GOA:Q13H83"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H83"
FT                   /protein_id="ABE36556.1"
FT                   /translation="MDTRQLKYFVAIVECGSMGKAAEKLYVAQPSLSQQMGRLESEFGT
FT                   SLLLRSQRGVTPTAAGQALYARSRAILRQMEQLKQHVKEGASAESGTVAVGLPTTMVSV
FT                   LAMPLIERVQQRYPGIHLQLIESMSGAITELLASARLDLAILFRASDTLGVTAWPLLEE
FT                   QLFVMGEPGDGVAAEAQSCALSALNGVRMVAPGATNGLRLLLERVFARENLELNIVADI
FT                   DSLPTLLSIAESGHACTILPVSALAQREAARCPKIRAIVAPELRRPASVCWSSTTMMSS
FT                   ATVAVCRMIVELVEDLTASGVWKGISLPDEQSRRTLAEALRAPERHA"
FT   gene            complement(688701..689669)
FT                   /locus_tag="Bxe_C0659"
FT   CDS_pept        complement(688701..689669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0659"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /EC_number="4.1.3.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36557"
FT                   /db_xref="GOA:Q13H82"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H82"
FT                   /protein_id="ABE36557.1"
FT                   /translation="MNNPKIQKMRALLAAGDVIVSPGVYDGYSARVIERMGFEAASTTG
FT                   AGLANSRLSEPDIGIFTLTENVEACKWLARSVSIPMMADADTGYGNPVSVYHTVQLFEE
FT                   AGVVGVNLEDQVSPKRCGHMRGKEVIDAREMAKKIEAAVKAKSDAGFIINARTDAIAVE
FT                   GIDAAIERARLYAAAGADMIYPDAIASEEQIKRFVDAVKLPVSINMGFGIRSRPTTPLI
FT                   PVRRLKELGVARVTLARMLPAASIMAMKQALELFRDGMEKGIAHDRPDLLASIDDITDL
FT                   MGYPFIDQLESEFLLPEEMERKYGAEKSGYVVHEKSQAKSS"
FT   gene            complement(689718..690602)
FT                   /locus_tag="Bxe_C0660"
FT   CDS_pept        complement(689718..690602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0660"
FT                   /product="Putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36558"
FT                   /db_xref="GOA:Q13H81"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H81"
FT                   /protein_id="ABE36558.1"
FT                   /translation="MTRSESIAPGTAPEPPLCQSPDASPVAPGFELPELACDCHAHIYG
FT                   PPERYPYRENRRYTPAPVGLAQYRQALDMLGIRRAVIVQPTIYHDNQATLDVLQEMAGQ
FT                   WRGIAKLKADVSDAELTRLDVAGFRGVRLHAGASIEEIDAMARRVAPLGWHLQLHLNGR
FT                   ELALLGARLTQLPVDVVIDHFGRLTVEDGIDQPAFRGLLAMLETGRCWVKLSAPFRLGD
FT                   PVPPYAAVAPYARAMIATRPDRLVWGSDWPHASFKGTMPNMGVLLGLLSEWAPDAHLRN
FT                   QILSGNPARLYRF"
FT   gene            complement(690642..691574)
FT                   /locus_tag="Bxe_C0661"
FT   CDS_pept        complement(690642..691574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0661"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /EC_number="4.1.3.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36559"
FT                   /db_xref="GOA:Q13H80"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H80"
FT                   /protein_id="ABE36559.1"
FT                   /translation="MSKKSELRRLIAAPEILVLPGIFDGYSTRLLKASGFAAGFITGAG
FT                   ISEASLGWADQGIMGLEENLRVSRALAACCDVPVIADADTGYGNAVNVHFTVRAFENAG
FT                   LAGVMIEDQVWPKRCGHMKGKQVISAAEGAGKIRAAAEARLDPETLIMSRTDALATHGL
FT                   DEAIRRLNLYAEAGADLLFADALLSREHIATVVKNVSKPLCVNMGFGIRQRSTTPLISA
FT                   KELQDLGVAVVVYPRMLTAAAIQGMKNAIAALQESLDTGAVVERPELLVSFEELNELVG
FT                   IEELEQIEQRYLTSEQYLQKYGDAAHEKK"
FT   gene            complement(691605..692180)
FT                   /locus_tag="Bxe_C0662"
FT   CDS_pept        complement(691605..692180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0662"
FT                   /product="Putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36560"
FT                   /db_xref="GOA:Q13H79"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H79"
FT                   /protein_id="ABE36560.1"
FT                   /translation="MASSTQQTKQPIDVVALFPQVADIQDEALRKAVVVVWQELWEMSA
FT                   WKRLEEVPTSPEIPYPTLPHNQCVLDMAMSVADLFERHHGLKVNRDYLIAAAVLQDASK
FT                   VVEMEPGAEGKVAATALSKHYPHAFWAAHLALRHGVPDEVVHVLLTHSPQSPKFPSTIE
FT                   GKILYYVDQIDVIGIFKDRWRKDLYITK"
FT   gene            complement(692467..693405)
FT                   /locus_tag="Bxe_C0663"
FT   CDS_pept        complement(692467..693405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0663"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36561"
FT                   /db_xref="GOA:Q13H78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H78"
FT                   /protein_id="ABE36561.1"
FT                   /translation="MDLRRLELMMQVAAAGSLSKAATVLGIAQPALGRQIRKLEEECGL
FT                   RLVYRHGRGVSLTPEGQALIERAGPLVKQLAAIPADLQLERQSPEGLVTVGLTPTVCHL
FT                   LGLELLTGLKQKYPRLVVHVVSGYSGYVLEWLVGGRLDMAILHDARRSPTVAVDPLAAA
FT                   ELFFVSPGAETTFERPAQPTLASLGKVPLALPTHNHGLRRTIEYAAAKEKIKLDVRYEV
FT                   DTLELLKQIVVAGLACTILARPAVLSELAAGTLNARLLHAPKLHTRLVLATAAQRPVTH
FT                   SMEVLEHELRTLFARLIDEGDLYGIVHPKDA"
FT   gene            693511..695196
FT                   /locus_tag="Bxe_C0664"
FT   CDS_pept        693511..695196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0664"
FT                   /product="Putative pyruvate decarboxylase"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36562"
FT                   /db_xref="GOA:Q13H77"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H77"
FT                   /protein_id="ABE36562.1"
FT                   /translation="MPLSSHLFIRNMNLPVPVSSASHAMLSVFAANGIDRVFLVPGESY
FT                   LGILDALGDFPSIDVVTCRHESGAGFMACADARLTRRPGVVMVSRGPGAANAAIAIHTA
FT                   EQDAIPLILVVGQVPKQRLRKGAFQEIDYGRMYGSVAKHVIEVTEPEALAAAAFDAIRI
FT                   AGAGTPGPVVLVVPEDIQQQAVEASAWRATPAVPTLPEPVRVLELAGRLERAQRPLVIA
FT                   GGVLDVPGGREALRRLAEHFAVPVAVSFRRHDLFPNDHALYAGDLGLANPEEQMRLFES
FT                   SDLVIALGSRVGDITTQGYRFPSHPVPAQSFVHCHPDSAVVNRHLAAEMGFVCDPASLA
FT                   AALVASNPSPSVGGRRAQWCERLRDFATGYARWPEPAADGAARAVDVARILAKQMPGDA
FT                   AICLDAGAFAAPVYRHFPFCFPRRLMAPLSGAMGYGVPSAIATQLRYPGQKTVCLVGDG
FT                   GFLMTGNEIIAAVERRLPILFILVNNQCYGSIRIHQNRHYPGRHVGTSLSNPDFVRIAE
FT                   AYGLQARRVTRECELDEAIAQAFAADEPCLIEVVTEPPGGPLPS"
FT   gene            695269..696303
FT                   /locus_tag="Bxe_C0665"
FT   CDS_pept        695269..696303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0665"
FT                   /product="Isocitrate dehydrogenase (NAD+)"
FT                   /EC_number="1.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36563"
FT                   /db_xref="GOA:Q13H76"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H76"
FT                   /protein_id="ABE36563.1"
FT                   /translation="MNAKARESIPATLIPGDGIGPEVTQATVRVLEALGAPFKWDIQQA
FT                   GMAGIDECGDALPQATLDSIRETKLALKGPLTTPIGGGFRSANVRLREAFELHANIRPV
FT                   RTIVPGRYDDIDIVLVRENIQGLYVAHEHYIPIGDDPRAVAVLTGMNTREGGRRIARCA
FT                   FDYALRHGRRKITVVHKANVLKALTGIFLEAAREVAADYAGRVALDDRIVDACAMQLVL
FT                   NPWQFDMLLCTNLFGDILSDQLAGLVGGLGLAPGANIGKDTALFEAVHGSAPDIAGRGI
FT                   ANPVSQLLAAGLMLDHVGLDEDAKRLRRAIADTLNEDKVRTPDLGGQATTRTFTDALIE
FT                   RLGH"
FT   gene            696381..697859
FT                   /locus_tag="Bxe_C0666"
FT   CDS_pept        696381..697859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0666"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36564"
FT                   /db_xref="GOA:Q13H75"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H75"
FT                   /protein_id="ABE36564.1"
FT                   /translation="MNEATARKPHPLDKLKDPSLLRTQAYVDGRSQGGAQEFAVFDPAT
FT                   GAEIARVPNLAAAEARQAIDAANAALPAWRALTGKQRAAMLRRWYELIVAHAADLAAIM
FT                   TAEQGKPLAEARAEALYGASFVEWFAEEAKRVSGDVLASPADDRKIVVIRQPIGVCVSI
FT                   TPWNFPLAMITRKVAPALAAGCTIVVKPAEQTPLSALALAELAHRAGLPAGVLNVLTGD
FT                   AANAIEIGKVFCESEIVRHLSFTGSTPVGRLLMQQCAPTVKKVALELGGHAPFIVFDDA
FT                   DVDAAVQGAMVSKYRNAGQTCVCANRFYVHDAVYERFVRQFAEASRGVKVGNGFLEGVD
FT                   QGPLIDDDAVAKVRQHVDDALAKGARQVMGGRIEGRFVEPVLLAEVTHDMLIAREETFG
FT                   PVAAVFRFRDEAEVTRLANDTQFGLASYFYSRDIGRVWRVAEALEYGMVGINTGLISNE
FT                   VAPFGGVKQSGLGREGSKYGIEEYLQIKYLCMGV"
FT   gene            698143..699312
FT                   /locus_tag="Bxe_C0667"
FT   CDS_pept        698143..699312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0667"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36565"
FT                   /db_xref="GOA:Q13H74"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H74"
FT                   /protein_id="ABE36565.1"
FT                   /translation="MKIRLAMFSTALAMGIAAPVFAQSSVEIYGIIDEGPEYSSNAGGH
FT                   PLYSITTAAQGGSRLGFRGTEDLGGGLKALFRLENGYDLGTGKLGQGGLMFGRQAYVGL
FT                   EASHYGTVTLGRQYDDIVDFIGPLTVGDQWGGTIGSHPGDLDNFDNSFRTNNSVKYASP
FT                   NYGGISFGGMYSFGGIAGDTSANRVWSMGAGYTGGPLQLGLGYLNVRNSNVSFFGNSGV
FT                   TATTNNIASPVYSGYASATTYEVFGAGVNYTFGPALVGLLYSNIRFLSLNNTAQSGPNP
FT                   NHLDGDAAFNDVEVSFRYHLTSALLLGLEYNYTRGNSMNGQDPAQYHQGTLGLDYFLSK
FT                   RTDLYVVVAYQKASGVDSTGKAAVASINTVTPSSSDRQTIVSLGYRHKF"
FT   gene            699388..700812
FT                   /locus_tag="Bxe_C0668"
FT   CDS_pept        699388..700812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0668"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36566"
FT                   /db_xref="GOA:Q13H73"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H73"
FT                   /protein_id="ABE36566.1"
FT                   /translation="MSTHLRTSVAARLERLPDSRYLRTAVILISLGTFWDSYMLFSVGP
FT                   ISAHFFAYLGQPHLATELPLALFLGTFVGAVCLSTVADTIGRRAAFTLDLCTLAVGALV
FT                   AAFSPNATVLLIALFVAGIGTGAELPLSTTYVQELSPAKARGKKSSFALTIGFFGGTVG
FT                   GFASLLLVPLTNLPIQGFRIALLLAALGGFSSLLLRIRLPESPRWLERVGRHEEADRVV
FT                   EEIERRVMRDTGLTALPPVPAGSHDVASGASPLRILISRAYLRRTISAGAIELLQGFGA
FT                   YGFATFVPFFLYSRGYSVIHALAYTAIIQISYPTGCLISAYITDRIQRKWGMALAYTIN
FT                   VVFGLCFLLVDSTFLIVLFGFLTETMIFINGPLLHTYEAEIYPTGVRARGAGICFALSR
FT                   LGGFLAPIVASILLAGGANGGWLIAIGAAAWFGCALVAAFVAVDTTNISLEDLEAKVGD
FT                   ASEADAAAGYGMVKKR"
FT   gene            700949..701773
FT                   /locus_tag="Bxe_C0669"
FT   CDS_pept        700949..701773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0669"
FT                   /product="Putative HpcH/HpaI aldolase/citrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36567"
FT                   /db_xref="GOA:Q13H72"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H72"
FT                   /protein_id="ABE36567.1"
FT                   /translation="MSRIGRQQHRSFLFVPGNRPERYLKAWESDAGAVIVDLEDAVPIE
FT                   EKDRARAAVANWISPERPVLIRVNGLATPWLEEDARVARLPGVAGVVLPKAANASDVAA
FT                   LLARIKRDIPVYPLIESAAGMWNVLEVASAPGVRQLMFGTLDFCVDMGMTLESGTLSPF
FT                   RADMVMASRVAGIRPPVDGVTPDIDDDELLRTETVEGRKWGFAGKLCIHPRQAPVVNGC
FT                   YAPSETELAWARRVLEAFERANGAAVAVEGKMVDRPVILQARRILEEDEPEA"
FT   gene            702211..703599
FT                   /locus_tag="Bxe_C0670"
FT   CDS_pept        702211..703599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0670"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36568"
FT                   /db_xref="GOA:Q13H71"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H71"
FT                   /protein_id="ABE36568.1"
FT                   /translation="MRELDRLKVIQAIVDMGLKPGRAAERLGLTVRQVERLVIRYQESG
FT                   AAGLASRRRGRSGNRKLDEGLAQRALAIIRERYADFGPTLACEKLWECHGIRMAKETVR
FT                   RLMTDAGLWIPRRQRPPKIYQPRARRACLGELIQIDGSDHRWFEERAPACTLLVYVDDA
FT                   TSRLMALHFTATGSTFSYFEVTRAYLEQHGKPVAFYSGKAGVFRSTQTATTGGKGVTHF
FT                   GRAMFELNIDGLCANSSQAKGRVERANLTLQDRLVKEPGLRGIDTQEAANAYAPRFIAD
FT                   YNTRFGKVPRSAFNAHRPLREDENLDTILTWREPRRVTRSLTLQYDRVIYLLDDTEADR
FT                   RLVGRYIDVYEYPDGRIEVRADGVALPCRPYDRLSEIDQGAVVDHKRLGHVLQVAQLVQ
FT                   ADRDNRRASGSPSRTNQGQAPKLKERKAGTKKQREITVGDLNTAIGRTPVSLQDSVLKT
FT                   SSRR"
FT   gene            complement(703909..704730)
FT                   /locus_tag="Bxe_C0671"
FT   CDS_pept        complement(703909..704730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0671"
FT                   /product="Putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36569"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H70"
FT                   /protein_id="ABE36569.1"
FT                   /translation="MKERLASKVAVITGAAQGIGASVARSFAQNGCFVYVTDINDELGR
FT                   TVATSIGDCAAYLPLDVREEGDWQRVTTHVLEKHGRLDVLVNNAGITGFEARVVPHDPE
FT                   HASLEEWRAVHRTNLDGVFLGCKYAIRAMRRHGQGSIINISSRSGLVGIPGAAAYASSK
FT                   AAVRNHTKTVALYCAGQNLEVRCNSIHPAAILTPIWEPMLGTDAGREERMAALVRDTPL
FT                   RRFGTPEEVAALALLLASDEATYITGSEFNIDGGLLAGSAATPAVIDDGEN"
FT   gene            complement(704727..705716)
FT                   /locus_tag="Bxe_C0672"
FT   CDS_pept        complement(704727..705716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0672"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36570"
FT                   /db_xref="GOA:Q13H69"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H69"
FT                   /protein_id="ABE36570.1"
FT                   /translation="MSGRESVYTPAYVSLLFMLYRMHRLGLREFAGFMHDYWRGRGVAL
FT                   PVASFGHLSDLFAALDMTIRKQCARAAERLKEGEPVTVIVDSTGLRFSHAGAWYEKKYG
FT                   KQAPCTPWRVMHLAMDAEGDVLAGEITDTETGDSSGLDVLLPQVGEIDRLIVDTAYYQI
FT                   ERNEQLPASGVVPVIPPKSDAVDDPDQNRWHDQLVCYRNEKGQYAFQNKYGYGLRARVE
FT                   AQFSRIKRCLGDALLTRRIASQVQEGLVIANLINQWNSFGQARCVKFWRIFHLKILPHL
FT                   VIATKPFRVQPCTEPLHASRMWHSKRSCSFLSLNDCRKARFNSPRTFI"
FT   gene            complement(705743..706594)
FT                   /locus_tag="Bxe_C0673"
FT   CDS_pept        complement(705743..706594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0673"
FT                   /product="Putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36571"
FT                   /db_xref="GOA:Q13H68"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H68"
FT                   /protein_id="ABE36571.1"
FT                   /translation="MKFAWIDTQCRQYPVLALCEVLGVSVNGYRAWKRGGTPERQRLTD
FT                   AQLLTLIRTIHAEVKGAYGSPRMTEEIRSRGFPASKARVERLMSANGIRACHKRRYRVT
FT                   TDSRHKLPVAPNVLNRNFAPAGPNQLFTSDITYIWTDEGWLYLAVTLDLFNREVVGWSV
FT                   KPRMTTELVIDALTMAWLRRRPAPGALHHSDRGSQYASHDFQRKLNSYGMQCSMSRKGS
FT                   CWDNAPTESFFNSLKNERVHGTRYRTQREAVHARLGCGSADKGCGCITRGLWKAKNRGN
FT                   LS"
FT   gene            complement(706591..706881)
FT                   /locus_tag="Bxe_C0674"
FT   CDS_pept        complement(706591..706881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0674"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36572"
FT                   /db_xref="GOA:Q13H67"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H67"
FT                   /protein_id="ABE36572.1"
FT                   /translation="MFKVPHQVYTTEFKEAAVQRVKDGQGLSAVSRELGMSTQTLRNWL
FT                   KASEAGKLNGPGAKVVRAEQMELSRLRAENKRLQMELEIAKSVAFFAKDLL"
FT   gene            707152..707433
FT                   /locus_tag="Bxe_C0675"
FT   CDS_pept        707152..707433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36573"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H66"
FT                   /protein_id="ABE36573.1"
FT                   /translation="MHREPRGVVSLGLLHSVHTIGNQSNQQQRIYQVALRCGECFVVVC
FT                   GCVDGDSWQALQPAPSLPCSNDFSKHRQLSRGAACVCVRLFLTFLRVP"
FT   gene            complement(707568..708101)
FT                   /locus_tag="Bxe_C0676"
FT   CDS_pept        complement(707568..708101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36574"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H65"
FT                   /protein_id="ABE36574.1"
FT                   /translation="MTTATTSTPSTRDEKRSTTVVEGRQHDLAGGAGAAGDCAVAGLCF
FT                   SSSYRGGIIKAADERACGAHDGPAGCCPAAVGSGPDNVKAMLVYWKLMNALPGHEAFTR
FT                   FGPADPRVDMTTLRKNVGALPVEPAEQNAFWYKLYRRVESEVPVVDARKMYLLWRDAAA
FT                   LSLPLVIALPLLLR"
FT   gene            complement(708061..708522)
FT                   /locus_tag="Bxe_C0677"
FT   CDS_pept        complement(708061..708522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36575"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H64"
FT                   /protein_id="ABE36575.1"
FT                   /translation="MGGITMSAFWNTYPQFIDTNNLSLAVFIKYRWFKILFAGDLEKAG
FT                   WRALLQQASFRAELAGTEVLVASHHGRENGFCEDIFAYFTPSCVVISDKAIVHATQETV
FT                   PDYRAVVRKQGAYVNTTGKRRHVLTTRRDGWIQFTVLDNGYNIDTEYKG"
FT   gene            complement(708597..708929)
FT                   /locus_tag="Bxe_C0678"
FT   CDS_pept        complement(708597..708929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36576"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H63"
FT                   /protein_id="ABE36576.1"
FT                   /translation="MPGEMRIRIWDVEHGACAMIQHVIQTGLGAQGGRLAMIDSGHGTS
FT                   FRPGEYITRTLGRNRLDYLFITNADEDHMSDLQGLWDAGIFVPVCTAIPARLRRRCASS
FT                   KSSVGH"
FT   gene            complement(708971..709408)
FT                   /locus_tag="Bxe_C0679"
FT   CDS_pept        complement(708971..709408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0679"
FT                   /product="Putative plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36577"
FT                   /db_xref="GOA:Q13H62"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H62"
FT                   /protein_id="ABE36577.1"
FT                   /translation="MFVLDTNVVSELRKAKAGKADRNVAFWAASVSPGALFLSAITILE
FT                   FETGVLLMERRDATQGAILRAWLDSHVLPAFAGRVLAVDIAVAQRCARLHVPDQRAERD
FT                   ALIAATALVHGMTVVTRNVGDFVQTGVDILNPWEPIGIHHD"
FT   gene            complement(709408..709662)
FT                   /locus_tag="Bxe_C0680"
FT   CDS_pept        complement(709408..709662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0680"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36578"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H61"
FT                   /protein_id="ABE36578.1"
FT                   /translation="MTITTLSSREFNQDASGAKKAANEGPVFITDRGRPAHVLLSIAEY
FT                   QKLIGGPASIIDMLAMPGVEQIEFDPPRAGTLSRPADLS"
FT   gene            710006..710365
FT                   /locus_tag="Bxe_C0681"
FT   CDS_pept        710006..710365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36579"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H60"
FT                   /protein_id="ABE36579.1"
FT                   /translation="MGTINRLLQQWKAGQARQTTAVLTLPPVQRVFDIVEDITGTRPAV
FT                   GTAPYFSDASALQPLINGAPTLILGPGELTAMHQTDEYCEVVKLRDAVRIYEALIHMSV
FT                   DADARLAALPAVAEE"
FT   gene            710418..711446
FT                   /locus_tag="Bxe_C0682"
FT   CDS_pept        710418..711446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36580"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H59"
FT                   /protein_id="ABE36580.1"
FT                   /translation="MSAQHSNASCLRAANVLLRDHFCTKPGENVVLTTDENSDTDLVRA
FT                   LADTAAALGAKTCVVDMPRLPFQGSLSDPYIPSPVEAAVMHSDVWLDLTFPYMAGSGAF
FT                   DRAMEHKRTRYLLVGDASAAGFARLYGSVDFDALFDLQEAADGFFREAQGKHCRVTSAA
FT                   GSDFSFVMGRPATRKDRRATQPGSQTIPGSAIFYPELETVKGKIVLEAAFHEYYTPLRE
FT                   PLVLEVDGRVRSVSGGSAAKVMDRALRRAGGGEYGNVIHLTVGLNPGAASTGRSFMEDI
FT                   RVIGCNAIGLGLPWWLPGGGENHPDGVVMNQSLWIGEQMIVENGLPTLAAPFSAEFEKL
FT                   VS"
FT   gene            711493..712308
FT                   /locus_tag="Bxe_C0683"
FT   CDS_pept        711493..712308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0683"
FT                   /product="Putative hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36581"
FT                   /db_xref="GOA:Q13H58"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H58"
FT                   /protein_id="ABE36581.1"
FT                   /translation="MISYPHNAGSAMTRVIQGGLDGPVVVLLHGLSARADRWKHNLDAL
FT                   GQAGVRAMAIDLPGHGFASKHEDFDYSAHGYSRWLDQFVQTLGVEKLVLVGTSFGGFVA
FT                   AHYAADHPERVAGLMAVGAIGLVPAGEARRMKTVQWLGEMQKEQIRSRMYRGVLDPQLI
FT                   SEELVEEDYRINNSAGAAEAFAALARYYRERLDDDAVAARLADAASRFPVSIVWGRDDP
FT                   SVSPDYGARAHQIIAGSTLTFVDDCGHFPYWERPAEFNALLTNFVKRCI"
FT   gene            712327..712992
FT                   /locus_tag="Bxe_C0684"
FT   CDS_pept        712327..712992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0684"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36582"
FT                   /db_xref="GOA:Q13H57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H57"
FT                   /protein_id="ABE36582.1"
FT                   /translation="MNYHFHWGIVGQNLGYLLHGIWLTLAVTAVSLAVAIVIGLVIGIM
FT                   RISSKGVLKRVAGVYVEVFRNTPTLVQLIWVYYCLPVLTGINLSPTSSCIFALSINSAA
FT                   YVAEIFRAGIQAVPSGQLEAARSIGMSYSKAMRKIILPQAVRQMIPPFVNEFVSLLKYS
FT                   SLVSVLGVADLTYQAQTLSTTTFRPIEIFTFIGVVYFLLCWAISAAAHVLEQKIRVIA"
FT   gene            712989..713735
FT                   /locus_tag="Bxe_C0685"
FT   CDS_pept        712989..713735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0685"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36583"
FT                   /db_xref="GOA:Q13H56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H56"
FT                   /protein_id="ABE36583.1"
FT                   /translation="MRHSPGDEPMVSIQGLKKRFGDHAVLKGVDLTVSKGEVLVIIGAS
FT                   GSGKSTLLRCINLMEVPDHGQVSVGGEPMGEMAGDGRFRMFPERIVNARRARIGMVFQH
FT                   FNLFAHLRVIDNVTIGPVEVNRMSRIDARELGMAMLEKVGMAAKADAFPSQLSGGQKQR
FT                   VAIARALAMRPRLILFDEPTSALDGGMPNRPETFYRQGSEKSPFRYPYFYPYSKGPVFP
FT                   LSRRSDPDFNPPKYGSNPNSTPPTDR"
FT   gene            complement(713988..714131)
FT                   /locus_tag="Bxe_C0686"
FT   CDS_pept        complement(713988..714131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0686"
FT                   /product="Putative PIN (PilT N terminus) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36584"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H55"
FT                   /protein_id="ABE36584.1"
FT                   /translation="MIVLDTNVLSEMLRRLPGVEVMAWLAAQPRAALFTTTVIRADILY
FT                   GL"
FT   gene            complement(714118..714429)
FT                   /locus_tag="Bxe_C0687"
FT   CDS_pept        complement(714118..714429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36585"
FT                   /db_xref="GOA:Q13H54"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H54"
FT                   /protein_id="ABE36585.1"
FT                   /translation="MKIMPSLIKVPPMTEAKMSSTTTRDIGEQLKARLRGEAAQHGLSI
FT                   GDEARDSLRAALSTDSIDLQHNLAESIRSRIEPLGGIDLEFPPRDGFGKEWTAAHDRS"
FT   gene            complement(714986..715354)
FT                   /locus_tag="Bxe_C0688"
FT   CDS_pept        complement(714986..715354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0688"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36586"
FT                   /db_xref="GOA:Q13H53"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H53"
FT                   /protein_id="ABE36586.1"
FT                   /translation="MTNEHILKVGIAPMEQFKARTMAIARGEYKPSPDEPKIWFSSPES
FT                   FAQVLSGKNQALLALIAKTNPASLTELSITSGRAKSNLSRTLKTMERYGIVYFEKGDGR
FT                   EVAPRVNYSGISLEMSFA"
FT   gene            complement(715347..715745)
FT                   /locus_tag="Bxe_C0689"
FT   CDS_pept        complement(715347..715745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36587"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H52"
FT                   /protein_id="ABE36587.1"
FT                   /translation="MSSDDNIQAMTDRDHSLDTLLELDGVMYTVDDTGCCWVKFEVARI
FT                   AVSPERPHGLKYSLTLHDEKGTRLLGFDNAHPVRDGCRPRRTDADRVRPQARWRAHPVL
FT                   RLHGCRETACRLLDRSRTVMKERSESDD"
FT   gene            715860..716531
FT                   /locus_tag="Bxe_C0690"
FT   CDS_pept        715860..716531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36588"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H51"
FT                   /protein_id="ABE36588.1"
FT                   /translation="MPVIRIAVDEDDPDAGRYAAAVMAATLAMAAEPLPELPAQGKQSK
FT                   PEKPLPENKHQLTRKQHVFPVRSIERFVDQGGRVAVFDMLRVKERPARPEDIVFCARRA
FT                   WDQQTEDDMTQIENRFQEVVQPITEGLINTIAPEHKPAIDAMFALWVMRTRFRGLAAQE
FT                   LQLFGVPAYDMSKARAEHLESADRVFVRKGGKVPTRQINGAQLRMRVSGYTRDLAAALG
FT                   G"
FT   gene            717165..718460
FT                   /locus_tag="Bxe_C0691"
FT   CDS_pept        717165..718460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0691"
FT                   /product="Putative transposase, ISRS017"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36589"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H50"
FT                   /protein_id="ABE36589.1"
FT                   /translation="MNWETSFDEYLEHLCKVVGHSDRRAGLTGYCRGLMRPLGRKSVEP
FT                   LAAHLEPHRVSARHQSLHHFVSKSEWSDAALLEQVRRWVLPHMDPAKGLYWMIDDTGFP
FT                   KKGRHSVGVARQYCGQLGKQDNCQVAVSLSVATEAASLPVAYQLYLPQEWTDDPTRRQQ
FT                   AGVPDEIGFATKPQIAVTQLREARQSGAPDGVVLADAGYGNDTAFRDALGELGLQYAVG
FT                   IQSGTRVWPPGLAPLPAESSQGKAGRPRSLQRRIPGHDPVPVKDLALAPEPSRYHTASW
FT                   REGTRATLSSRFAAVRVRASHRDYWRATPRDEEWLLIEWPNGESEPTKYWLSTLPDDTP
FT                   VERLAYVAKMRWRTERDYQDLKQEFGIGHFEGRGWRGFHHHASLCIAAYGFLVAQRLIQ
FT                   GGSKKNAEIRNPVALPADYVPRGSPARAATRT"
FT   gene            718663..719694
FT                   /locus_tag="Bxe_C0793"
FT   CDS_pept        718663..719694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0793"
FT                   /product="Putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0793"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36590"
FT                   /db_xref="GOA:Q13H49"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H49"
FT                   /protein_id="ABE36590.1"
FT                   /translation="MMQIHPQARTTPVVRAEIARSTEPTSVVARRYGISAETVRKWRKR
FT                   GEQACQDRSSRPKRLRWRASEEERAIICAVRRATGFPLDDLGFVLGHFLPHLNRDSIYR
FT                   VLKSEGLNRRPPKPTSLPEKGQGRFKEYDLGYVHIDVKHLPKLRTADGEVRKRYLYVAI
FT                   DRCSRFVHLAVYDAENTTNAIAFLAQARKAFPFRITHVLTDRGSCFTADDFERACAKLK
FT                   VTRRVTKPYTPQTNGMVERFNGRVASEVLGINIAGHADLEVLLKSFNRAYNRRRQRVLK
FT                   GSSPIDKVDQRLKLNGCLANPLYKPPADQEYLLSKVDRILVYANEVSQPDNYCLAVYFK
FT                   SML"
FT   gene            complement(719773..720264)
FT                   /locus_tag="Bxe_C0792"
FT   CDS_pept        complement(719773..720264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0792"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0792"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36591"
FT                   /db_xref="GOA:Q13H48"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H48"
FT                   /protein_id="ABE36591.1"
FT                   /translation="MRGGGVVNGGNGNGAVRQRIRATGQSAPDNVAQGEDDMGGVVDYA
FT                   AGNSSASMSRAIRRSIVLIESSFAQPVSLATLAAAAGLSVSRFATLFRKEVGMPPHRYV
FT                   CLVRIGHARRLLRDGVPPCAVATEVGFFDQSHFGRHFRRVVGVTPGHFVASPESERALG
FT                   "
FT   gene            complement(720279..722291)
FT                   /locus_tag="Bxe_C0791"
FT   CDS_pept        complement(720279..722291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0791"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0791"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36592"
FT                   /db_xref="GOA:Q13H47"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H47"
FT                   /protein_id="ABE36592.1"
FT                   /translation="MQFDKAVLQIFANYCVAAAESMAYTLVRTAHSTFVKETEDFSCAI
FT                   TTPEGLTFASPKTLGATWYVGLDYSAVIGMIDDYEPGDIGMTNDAYSGFVATHTPDIVL
FT                   WKPVFYGGEIICFVGGHIHNTDMGGAVPASLSRTLTEIQQEGIRFPPCKIVRKGVVDES
FT                   LIRLMATNVRVPGQNTGDLHAQLASLHTGERRVLEIVERFGIDGFKAGMSALLDYSEEQ
FT                   ARTILRAIPDGDYFFAEFADEDSVNGKPMRVALTARIRDGLVEMDYTGSDPQLQSSLNM
FT                   PTGGRERHALALVGLVYVLYTLNPEILLNTGMLRVARCILPEGTVVNAQAPAAVGMRSL
FT                   TCKLTHLLTFGAFSQAVPERLGACPAGGLSILSVKTTGAQGATVMASIGPIGGGAGGGP
FT                   NDDGEDGSGANNAFLRNTPVEINEAEVPIRILRYGVAPGSGGAGQYRGGQGLVMEFKVF
FT                   SPNTLVTARNRDRTRFASWGVRGGHAGANARFTRNPDTPHAEELDNNDLVVCMPGDVIR
FT                   LIGAGAGGYGWPVDREPQRVRDDVLRGYVSADTAREVYGVVLAGDAVDEAATDALRHAM
FT                   RGRLTGAEVPEFTYGPYRDAFEAKWTHERYVALTDILARVPVQWRHFIKHRLFEALDAN
FT                   LAERTARGETDDGNAALVHRLFAQLCETYATLKVA"
FT   gene            complement(722312..724351)
FT                   /locus_tag="Bxe_C0790"
FT   CDS_pept        complement(722312..724351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0790"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36593"
FT                   /db_xref="GOA:Q13H46"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H46"
FT                   /protein_id="ABE36593.1"
FT                   /translation="MGLRIGVDIGGSFADFAVLDDASGELKTLKVFSRPDSPGSEVLRG
FT                   MEQLRERDGIDPADVMYFTHGTTVGVNAVVQRKGLRLGLITTRHFEDVLDLARLKGPDM
FT                   YSLLSKRPGPLVPRERVFGVVERLAADGSVETPVDEASVLDALARLKQSGCEGVVVALL
FT                   HAYRNPAHEHAVKALIERAMPDFFVSCSSDVWPIIREYERTSTAVIGGYVQPKVSHYLS
FT                   SLQRALVETGITADMKVTKSNGGVMSAEAGKTNCVQMILSGTASGVIGAAYVARQSGID
FT                   HCMSLDIGGTTADVALIVDGEPQYASGEYIGDFQIHIPSVSVSSIGDGGGSIAWVDDFG
FT                   VLKVGPESAGSNPGPVCYGRGGTRATITDAFVVLGVIGNASLGYNSVSVDHDAAHRAIE
FT                   VLAHRLGIGVYAAAEAVVDVAVSGMYTGVSRIVSRFGIDPRAFALLPFGGAGPMLACYF
FT                   ARALGMERIVVPTAPGVLSALGGLIADTRNDFVKTTYYDLDSGTLARLADDLHALDTAS
FT                   RAWLREQVGDDVRANLIVSADMRYKGQSFEIDTPLDAAWLAGGDLGALTEAFHREHERL
FT                   YGHRDVRATVQVIALRLVISAATPKPVPVPIAAGDGAPVPLGTIRVYMDGEFHDAALYR
FT                   RADLKAGEQFDGPAVVAQDDCTTSVLPGFRGRVDRFGNLVFTLI"
FT   gene            complement(724631..726628)
FT                   /locus_tag="Bxe_C0789"
FT   CDS_pept        complement(724631..726628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0789"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36594"
FT                   /db_xref="GOA:Q13H45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H45"
FT                   /protein_id="ABE36594.1"
FT                   /translation="MKAHLFRRAHAAFMARSGGAPLPSSNLVEVRGLRVVGSRAGEPDT
FT                   TIVHDIDFEIARGEVLALIGESGSGKTTIALSLMGHARSGCRIAGGAIQVGDTDVLGLS
FT                   PIALADLRGRKVAYIAQSAAAAFNPARTIMDQVIESALIHGTLAKRAAQEKAVELFRAL
FT                   ALPEPETIGRRYPHQVSGGQLQRLMAAMALITDPELVILDEPTTALDVTTQIDVLQAFR
FT                   RVIRQCGMTAVYVSHDLAVVAQMADRIVVLSNGEIRETGRTEQILHAPAHPYTQSLIAA
FT                   VTPVMPDMPFAPVPAGTAATAVADGSALQPRPAAAPLLELRRLTAGYGGTNAKGWPNKV
FT                   ILNDVDLVIGRGQTVGVIGESGSGKTTLAKVIAGLVPMARGTLLLDGKPLAADLRRRSR
FT                   EQFRCIHIVFQNADTALNPTHTVERTLARPLKFYHGMKGDAAKRRVAELLNLVRLPAEL
FT                   AQRRTGELSGGQKQRVNLARALAAEPQLILCDEVTSALDTVVGAAILELLRDLQKKLGV
FT                   SYLFITHDIAKVRAISDDIVVLYAGHRVETGTRDALSAPPYHPYSHLLVSSAPELRAGW
FT                   LEEADERCHRALPPIGEATHEPELCTFLARCPMRIDGVCNRTAPTERTLASGAQVLCHR
FT                   SEAELEQYQSMPGDDAAAVAVLAESASVRG"
FT   gene            complement(726628..727620)
FT                   /locus_tag="Bxe_C0788"
FT   CDS_pept        complement(726628..727620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0788"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36595"
FT                   /db_xref="GOA:Q13H44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H44"
FT                   /protein_id="ABE36595.1"
FT                   /translation="MTILPPSSQTPHRLGALEPVHRSSMLPQGTEPGRPWGSGGGPAPQ
FT                   RVRRRSVAQRMNLSTGGWIGLAMVGSALFVAAFAPWIAPHPVGAILTPDVFAGFSAKLP
FT                   LGSDYLGRDMLTRIIYGMRLTVVLALAAALLAALTGTMLGLLAAVAGRRIDETMSRLLD
FT                   AVTSIPSKMFALMIVAAFGSSLPLLIMTAAVSYMPGSYRIARSLAVNIGTLEYVQVAQA
FT                   RGESALYIACFEMLPNMIHPMLTDTGLRFTFVVLLLSSLSFLGLGVQPPYADLGSLVRE
FT                   NIAGLGEGVPVVILPAIAIAVLTVGVNLLIDGLPHRGRLKGAADADGGH"
FT   gene            complement(727617..728570)
FT                   /locus_tag="Bxe_C0787"
FT   CDS_pept        complement(727617..728570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0787"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36596"
FT                   /db_xref="GOA:Q13H43"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H43"
FT                   /protein_id="ABE36596.1"
FT                   /translation="MNRNIAQLIGRRVAVTALTLLIVSIIIFVITNLLPGDAAQAALGQ
FT                   SATAETVAALRQQFGLDQPAWLRYIHWLIGLLHANFGVSLSNNLPVTELIEGRLPKSLT
FT                   LAAITTAVSVPIAVSAGILAAVNRESLIDRIVSLGTLSLVATPEFLIATLAVLVLAVKL
FT                   HWLSALSYSGEIDSLHDFLRAYAMPVVTLCAVVIAQMARMTRAAVIEQLSSSYVEMAML
FT                   KGASPARVVLRHALPNAIGPIANAVALSLSYLLGGVIVVETIFNYPGLASLMVDAVSNR
FT                   DFPLVQACTLLFCLGYLLLVLLADLCAIISNPRLRT"
FT   gene            complement(728685..730265)
FT                   /locus_tag="Bxe_C0786"
FT   CDS_pept        complement(728685..730265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0786"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36597"
FT                   /db_xref="GOA:Q13H42"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H42"
FT                   /protein_id="ABE36597.1"
FT                   /translation="MYDDEIKKGGFSRRDMMRLLAAGGMLATGAGGLLAAANPAFAAPT
FT                   PKKGGKIRVAYDASSTADTLDPAKGSAGSDYIRFFMFYSSLTQLDASLTPQMNLAESVD
FT                   SSDAKVWVIKLRKGVIFHDGKALAPADVVYSLMRHKNPATASKVKTLADQFVDAKQTGP
FT                   NEVTLTLTSANADLPVILATPQFVIVKDGTTDFTTAVGTGPYKVKTFKPGVSTVGVRND
FT                   SFWKTGAGPYLDQIELIGIGDDAARVNALLSGDVHLINSVDPRSTQRISATPGYEVRET
FT                   KSGLYTDLIMRRDNPMSGNPDFVQGMKYLFDRDQVRSAVFRGYAVIGNDQPIPPGHRYF
FT                   NASLPQRPHDPDKAKFHFQKAGAIGTTLPPIYATTDANGSVEMGELLQQSAAKIGVNLN
FT                   INRVPADGYWSNHWMKHPLGFGSVNPRPSADVLFTQFFKSDAPWNESGWNNPKFDQLLG
FT                   AARSETDDAKRKQMYGDMQVLVSEHGGIGIPTFLSLLDANDKKLQGLAPVPTGAMMGFN
FT                   FAEYVWWNA"
FT   gene            730762..731652
FT                   /locus_tag="Bxe_C0785"
FT   CDS_pept        730762..731652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0785"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36598"
FT                   /db_xref="GOA:Q13H41"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H41"
FT                   /protein_id="ABE36598.1"
FT                   /translation="MSDPTTHALFTCRRLSPDDIPAAQRLSAAIGWPHRREEWRFSART
FT                   GIGFVAEMAGALVGTVVCWMFGSDRATLGMLLVAPEHRGKGIGEALFARALDELGERDI
FT                   TLYASDAARPLCEALGFEACGALDQMQGAAFRPPLVALPTNERLRPLGARDTAQLVALA
FT                   SRASGLDRSLVLPPLLDLADGIALDRDGELLGFSLFRRFGRGFIIGPVVAGDAPDGVHA
FT                   KALIRHWLALNEGALIRIDAPHGHGLDAWLSGLGIVRTETVVKMRRLADATRRRETDIA
FT                   DGALHQYAVIMQSLA"
FT   gene            732046..733446
FT                   /locus_tag="Bxe_C0784"
FT   CDS_pept        732046..733446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0784"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0784"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36599"
FT                   /db_xref="GOA:Q13H40"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H40"
FT                   /protein_id="ABE36599.1"
FT                   /translation="MSKTSLIAADRKHLIHPVINYRAHEARGATVLESGQGAYLRDIDG
FT                   NELLDAFSGLWCVNVGYGQQSIVEAATRQMTKLPYATTYFHFSSEPAIELADKLVALAP
FT                   ASLQHVYFTLGGSDAVDSAIRFITHYFNATGRPSKKQMIALERGYHGSSSVGAGLTALP
FT                   AFHRNFDLPLPHQHHLPSPYAYRQTHGDDAQALIAASVAALEAKVAALGTDNVAAFFCE
FT                   PIQGSGGVIVPPVGWLKAMRDACRRLDILFVADEVITGFGRTGPLFACEAEQVEPDLMT
FT                   VAKGLTSGYAPMGAVLMSDEIYQGIAGDARDTAIVGHGQTYSAHPVSAAIGLEVLRLYQ
FT                   EGGLLANGQAQAPRFAAGLDALLGHPLVGDSRHRGLLGALELVADKDSRARFDPALKLP
FT                   DRIAAAAYRNRLVFRAFGDSILGFAPALCFGEAEFEQMFGRLKRTLDEVLDETEVRAAL
FT                   RTAGRAAA"
FT   gene            733554..734057
FT                   /locus_tag="Bxe_C0783"
FT   CDS_pept        733554..734057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0783"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0783"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36600"
FT                   /db_xref="GOA:Q13H39"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H39"
FT                   /protein_id="ABE36600.1"
FT                   /translation="MTTSGDTKLDRIDLRILSQLQKKGRITNVELADAVGLSPSPCLIR
FT                   VKRLEKAGYIVGYGAHIQLQKLGDVQIVFAEVTLADHRREDFAKFEAAIRPVDEIVECH
FT                   LASGGYDYLLKFVTRSVNHYQSVIEGLLERDIGIEKYFSYVIIKTPFVKSEYPLETLFS
FT                   QQHQ"
FT   gene            complement(734172..734567)
FT                   /locus_tag="Bxe_C0782"
FT   CDS_pept        complement(734172..734567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0782"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36601"
FT                   /db_xref="GOA:Q13H38"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H38"
FT                   /protein_id="ABE36601.1"
FT                   /translation="MLSLSPISSASSWALSSPSTSSAPDRASRAVQRALDFIDACFADP
FT                   ISLSELAAVAGLSISRFAVRFSAEIGVSPQQYVRLVRVRHAQRLLRRGLPPSIVATEVG
FT                   FFDQSHLCRHFKRVLGRTPGEWLSASG"
FT   gene            complement(734579..735754)
FT                   /locus_tag="Bxe_C0781"
FT   CDS_pept        complement(734579..735754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0781"
FT                   /product="Putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0781"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36602"
FT                   /db_xref="GOA:Q13H37"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H37"
FT                   /protein_id="ABE36602.1"
FT                   /translation="MSVNHVQADVLIVGGGFMGASAAFFLRQRGRSVILLERQLVGQQA
FT                   SGTNFGNVRRQGRFLPQLPLANRSREIWGRLPELIQHDAEFLMSGHVRVCYRDEQADQF
FT                   ETYAKEAAHYGLKLDLLRGDALRSRFPFLGREVLAGSYSQMDGHANPRLAAPAFARAAA
FT                   RAGARIVENCDVVTVEKEGAEFRATSADGRMFHAPVLLITAGAWGSLLSQQFGEAVPIA
FT                   VNGPQMAVTEPVPYAIQPVVGVSSPQIEEVVYFRQVARGNIVIGGCARAPAFLDERRAK
FT                   VLPQSTLLQFRQAQRVAPMLRNLNIIRVWSGVEGYMPDDKPIMGASGTTSGLFYAFGFC
FT                   GHGFQLGPGVGDTMAELIDAGATSTPIEPFDIRRFAASRDAVPVPPASRAA"
FT   gene            complement(735751..737127)
FT                   /locus_tag="Bxe_C0780"
FT   CDS_pept        complement(735751..737127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0780"
FT                   /product="Putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36603"
FT                   /db_xref="GOA:Q13H36"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H36"
FT                   /protein_id="ABE36603.1"
FT                   /translation="MGEPRIVVVGAGPAGVRCAETLLAAGIRPIVVDEGRRDGGQIYRR
FT                   QPDGFTRPYVKLYGTEAARAENLHQSFERLRAQIDYRPQTLAWNVAQGKLHIVHDGHAS
FT                   ALAYDALILCPGATDRLMPVKGWQFAGTYSLGAAQIALKSQACAIGRQVVFMGTGPLLY
FT                   LVAHQYVQAGAKVAAVLDTSKTAARLRALPRLLARVDVLRKGRALVNGLKRAGVRVENG
FT                   IEPLEIVGNPDDGVHGVRYRNARGEVAQIECDAVGLGYHLRPETQLADLARCAFRFDAL
FT                   TRQWVPQIDELGRSSEKGVYLAGDGARVLGADGAEIAGRLAAYAALSDLGHAVPAVTLD
FT                   ALRREQHKIDRFRLGLAEAFAWPAAQAARLSDDTILCRCEGITAGELRRVVREEGAQEA
FT                   NRAKAFSRVGMGRCQGRYCGHAGAEVIAAAASVPLEQVGRLRGQAPVKPLAIATVEDTE
FT                   "
FT   gene            complement(737106..737417)
FT                   /locus_tag="Bxe_C0779"
FT   CDS_pept        complement(737106..737417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0779"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36604"
FT                   /db_xref="GOA:Q13H35"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H35"
FT                   /protein_id="ABE36604.1"
FT                   /translation="MSGRFVRIGETARATVELTIDGEHVAALAGDTLLTAMLCSVRHVR
FT                   QSEFGNERRAGFCLMGACQDCWVWTADGERLRACTTVVEAGMRVVTTQPEAQWANLAS"
FT   gene            complement(737414..738250)
FT                   /locus_tag="Bxe_C0778"
FT   CDS_pept        complement(737414..738250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0778"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36605"
FT                   /db_xref="GOA:Q13H34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H34"
FT                   /protein_id="ABE36605.1"
FT                   /translation="MIEITNVHKSFGAVPVLKGISLNVRQGEVVCLIGASGSGKSTLLR
FT                   CINALESYDEGEIRLLGQPVEQRARNINQLRTQVGMVFQRFNLFPHRTALENVMEGPVH
FT                   VKRMPRADAQREASELLMKVGLGHKLHAYPNQLSGGQQQRVAIARSLAMKPKAILFDEP
FT                   TSALDPELVGEVLGVMRTLAREGMTMLVVTHEMGFAREVADRVCFLHAGLIIEEGTAQQ
FT                   VLGSPREARTREFLRHVLTNRSDGHDAHDGGAPAGGALSGGAHDDLAPGGVGGAAI"
FT   gene            complement(738288..738944)
FT                   /locus_tag="Bxe_C0777"
FT   CDS_pept        complement(738288..738944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0777"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36606"
FT                   /db_xref="GOA:Q13H33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H33"
FT                   /protein_id="ABE36606.1"
FT                   /translation="MHWHDIVDFVPILIQGAVMSIVITLGCLLLSTVLGLTWALLKMSR
FT                   YPLVVRGVSTMINVVRGLPMIVLLFYIYFVLPEIHIQVSALQASIIGLGFGYSTYVAEI
FT                   FRAGIEAVDPGQYEAAQSIGMGRVKTMVRVILPQAIKVALPPYSNTLVMMLKDSSLAST
FT                   ITVAEMTREGQLIAASTFQNLTVYTLVAIGYLAMSLPLMSMTRTLERRFGRHKAR"
FT   gene            complement(739121..739933)
FT                   /locus_tag="Bxe_C0776"
FT   CDS_pept        complement(739121..739933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0776"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36607"
FT                   /db_xref="GOA:Q13H32"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H32"
FT                   /protein_id="ABE36607.1"
FT                   /translation="MLRFMFQPASAVRFNAVQRLAAGAGLAMSMMIGAAQVTHGAEAAT
FT                   LTAGSPPSSAPTTFMNVKTQQIEGLMPDVVKEIGKREGFNVSYDAVPFSALIQSVVSGK
FT                   IDIIVAGMTPTARRAEVVDFSQPVTAFGEGIIVKDTNKTNYKSVQDLKGMTVGAPTGTD
FT                   YGDQLKKLGIFTEVKMYDSPADMTRDVALGRIVAGFNDYPILKAQEAAGAMAGTRVDDA
FT                   YVPMEKFDIAVAVKKGNSALLAKINDALTKMKADGSLDAILKKWHLAG"
FT   gene            complement(740010..741287)
FT                   /locus_tag="Bxe_C0775"
FT   CDS_pept        complement(740010..741287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0775"
FT                   /product="Putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36608"
FT                   /db_xref="GOA:Q13H31"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H31"
FT                   /protein_id="ABE36608.1"
FT                   /translation="MKLDSYWLDTAPRFTKAAQGPLPQRVDVAVVGGGFTGLSAALELA
FT                   KRGMSVVVFEAGRLAAQASGRNGGHCNTGVAQDYAALSARIGSERASEFYRAYAGAVDT
FT                   VKAIIAEEQIDCDLRHSGKIKLAAKPQHFASLANSYEVLKREVDPDVELVPPERIRDEI
FT                   GSDGFFGGLVQRNGMQMHMGKFGVGLGEAAARRGAQIYENTPITNLKALGGNAFEVSSP
FT                   LGTLRAERVLIATGASQVGPLQWFRRRIAPVGSFIVATEPLGSARLDALLPTRRSYVTT
FT                   LNIGNYFRATPDERLLFGGRARFAMSNPRSDEKSGHILRDALARYFPQLADVGIDYCWG
FT                   GLVDMTADRLPRAGQHEGLFYSMGYSGHGVQMSVHMGRLMADVMFGAASRNPWRTLEWP
FT                   AIPGHFGRAWFLPLVGAYYRLQDVLH"
FT   gene            complement(741343..742011)
FT                   /locus_tag="Bxe_C0774"
FT   CDS_pept        complement(741343..742011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0774"
FT                   /product="HAD-superfamily hydrolase, subfamily IA,
FT                   variant2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36609"
FT                   /db_xref="GOA:Q13H30"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H30"
FT                   /protein_id="ABE36609.1"
FT                   /translation="MIDFEPKYITFDCYGTLTNFQMGQSARELYGDKLDPAKMDEFVEF
FT                   FRGYRMDEILGAWKPYRDVVVNSVRRTCERTGVPFDEATALKIYEAVPGWGPHADVPEG
FT                   LSRLASKYKLVILSNASDDQIHSNVGKLGAPFHKVYTAQQAQAYKPLQKAFEYMFSQLD
FT                   CNPEDVLHVSSSFRYDLMTAYDMGIRHKAFVNRRHEPLNPYYGVNEVSGIPQLASLLGL
FT                   "
FT   gene            complement(742118..743674)
FT                   /locus_tag="Bxe_C0773"
FT   CDS_pept        complement(742118..743674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0773"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36610"
FT                   /db_xref="GOA:Q13H29"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H29"
FT                   /protein_id="ABE36610.1"
FT                   /translation="MRRNLFSARGIADLNLLIRPGMSTPSLDFDPSAVPLPQGHFIGGA
FT                   YYSTGEAQIAVHRPSDGALLGHVPDATDATVDHAVSNALAAWKTSGWGTRSPRERAKVL
FT                   RRWADLIDRDAVSLAQLETVSSTRPVAESYASDVPFTAEAIRFFAELADKLGGDIAATR
FT                   RDSLGFVASEPYGVIGAITPWNFPLSMCSWKCGPALAAGNAVVLKPSEMTPFSTLRLAE
FT                   LAIEAGMPPGIFNVVNGRGATTGAALTRHPGISKMSFTGSTRTGAAIMSDAAMHGTKPV
FT                   TLELGGKSPQLVFEHVRDLDFTAGCIARGFTANGGQACVAGTRLIVHKRIAEPLVGAIQ
FT                   RQLQSIKPGPLWDSRTTYSPIISPAQARRIETLIDQSRDSGAEVIFGGGFFDGTDEGFF
FT                   HRPTLLANVTDATPAVREELFGPVLTVQTFDDEDEGIALAGHPIYGLAAGIHSSDIGQA
FT                   LRAMRRIAAGTIWINRYGRSGDMIIPTGGFGQSGIGKDLGREAMVASMRHKSVLIDFET
FT                   L"
FT   gene            complement(744139..744753)
FT                   /locus_tag="Bxe_C0772"
FT   CDS_pept        complement(744139..744753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0772"
FT                   /product="Transcriptional regulator, XRE family with Cupin
FT                   sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36611"
FT                   /db_xref="GOA:Q13H28"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H28"
FT                   /protein_id="ABE36611.1"
FT                   /translation="MQRTEAGKKRAVDLSHGDVGARLRALRVAQGLSVNELAMRAGVSV
FT                   GTVSQVERNKANPSVRILERLRQALEVPLTALLEEDDAVSDPITGDFVRKAAERPLFEV
FT                   GKNGMQKELLSPHGDHDLQMMIIMLPAGSGSEEVLVGIGEKAGLVLEGTVVLNVGDRRS
FT                   ELRAGDSFQFRSTVPHSVRNESNKTARLLWIMNTQPPVIHL"
FT   gene            745082..745966
FT                   /locus_tag="Bxe_C0771"
FT   CDS_pept        745082..745966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0771"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36612"
FT                   /db_xref="GOA:Q13H27"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H27"
FT                   /protein_id="ABE36612.1"
FT                   /translation="MSESSVKKSPAYRRFTSADIAAAHGLSLAVRWPHRADDWRFMFDA
FT                   GTGFVAEDNGNVIGTALCWKFGTDRGTLGLVIVSPDEQGRGIGRKLMELVLEELGSRVT
FT                   FLHATVAGKPLYEKLGFVTCGGLTQHQGTLASIAAVAPPAGEQLRAATPADTAKLIELA
FT                   SQASGFDRSATIPALLDFAQGVVLERDGEVLGFSLFRPFGRGYAIGPVVALHSSDDQRA
FT                   RALISHWLAQHEGDFVRIDVPGDAGIHDWLSGLGMSRVDSVEKMVRNASADLREAAPDT
FT                   TWRAYGIVNQAMA"
FT   gene            745973..746896
FT                   /locus_tag="Bxe_C0770"
FT   CDS_pept        745973..746896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0770"
FT                   /product="Putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36613"
FT                   /db_xref="GOA:Q13H26"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H26"
FT                   /protein_id="ABE36613.1"
FT                   /translation="MTLLYKADPVRGALWAERFAQLAPQIPFRVWPDLGDPAAIRYLVA
FT                   WQPGDLALTLPNLDVVFSVGAGVDQLDLSQIPAHLPVVRMIEPGIVDGMVEYVTEAVLA
FT                   IHRDLFDYALQQQARVWQPKPLRAAASRRIGVLGLGMLGTAVLDHLQLFGFACAGWSRS
FT                   QHRIEGVDCYAGDESLDAFLARTDVLICLLPLTDATRRLLGRRVFDTLPRGASLVHVGR
FT                   GPQLDSAGLIDALERGQLHSAVLDVTDPEPLPADHPLWAQPRVRITPHIASATRPESAV
FT                   DAVLENLRLFHAGERMNGQIDRTRGY"
FT   gene            747081..748169
FT                   /locus_tag="Bxe_C0769"
FT   CDS_pept        747081..748169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0769"
FT                   /product="Tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36614"
FT                   /db_xref="GOA:Q13H25"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H25"
FT                   /protein_id="ABE36614.1"
FT                   /translation="MTRKYRIAVIPGDGIGNEVMPEGLRVLDAACRRFDIGIEYRQIGW
FT                   ASCDYYAQHGQMMPDNWKEQLQDCDAILFGAVGWPEKVPDHISLWGSLLKFRREFDQYV
FT                   NLRPARLFEGVPCPLANRKPGDIDFMIVRENTEGEYSSVGGTMFEGTEREVVMQQSIFT
FT                   RHGTERVMKFAFDLAQRRAKKITVATKSNGIAISMPWWDARADEMAARYPDVKMDRQHI
FT                   DILCARVVLNPDRFDVVVASNLFGDILSDLGPACTGTI