(data stored in ACNUC7421 zone)

EMBL: CP000283

ID   CP000283; SV 1; circular; genomic DNA; STD; PRO; 4892717 BP.
XX
AC   CP000283; AAKZ01000000-AAKZ01000023;
XX
PR   Project:PRJNA15749;
XX
DT   03-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Rhodopseudomonas palustris BisB5, complete genome.
XX
KW   .
XX
OS   Rhodopseudomonas palustris BisB5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Rhodopseudomonas.
XX
RN   [1]
RP   1-4892717
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Pelletier D.A., Kyrpides N., Lykidis A., Oda Y., Harwood C.S.,
RA   Richardson P.;
RT   "Complete sequence of Rhodopseudomonas palustris BisB5";
RL   Unpublished.
XX
RN   [2]
RP   1-4892717
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Pelletier D.A., Kyrpides N., Lykidis A., Oda Y., Harwood C.S.,
RA   Richardson P.;
RT   ;
RL   Submitted (14-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 05c01a372467cba27ef355c5f464dd7f.
DR   BioSample; SAMN02598336.
DR   EnsemblGenomes-Gn; EBG00001118361.
DR   EnsemblGenomes-Gn; EBG00001118362.
DR   EnsemblGenomes-Gn; EBG00001118363.
DR   EnsemblGenomes-Gn; EBG00001118364.
DR   EnsemblGenomes-Gn; EBG00001118365.
DR   EnsemblGenomes-Gn; EBG00001118366.
DR   EnsemblGenomes-Gn; EBG00001118367.
DR   EnsemblGenomes-Gn; EBG00001118368.
DR   EnsemblGenomes-Gn; EBG00001118369.
DR   EnsemblGenomes-Gn; EBG00001118370.
DR   EnsemblGenomes-Gn; EBG00001118371.
DR   EnsemblGenomes-Gn; EBG00001118372.
DR   EnsemblGenomes-Gn; EBG00001118373.
DR   EnsemblGenomes-Gn; EBG00001118374.
DR   EnsemblGenomes-Gn; EBG00001118375.
DR   EnsemblGenomes-Gn; EBG00001118376.
DR   EnsemblGenomes-Gn; EBG00001118377.
DR   EnsemblGenomes-Gn; EBG00001118378.
DR   EnsemblGenomes-Gn; EBG00001118379.
DR   EnsemblGenomes-Gn; EBG00001118380.
DR   EnsemblGenomes-Gn; EBG00001118381.
DR   EnsemblGenomes-Gn; EBG00001118382.
DR   EnsemblGenomes-Gn; EBG00001118383.
DR   EnsemblGenomes-Gn; EBG00001118384.
DR   EnsemblGenomes-Gn; EBG00001118385.
DR   EnsemblGenomes-Gn; EBG00001118386.
DR   EnsemblGenomes-Gn; EBG00001118387.
DR   EnsemblGenomes-Gn; EBG00001118388.
DR   EnsemblGenomes-Gn; EBG00001118389.
DR   EnsemblGenomes-Gn; EBG00001118390.
DR   EnsemblGenomes-Gn; EBG00001118391.
DR   EnsemblGenomes-Gn; EBG00001118392.
DR   EnsemblGenomes-Gn; EBG00001118393.
DR   EnsemblGenomes-Gn; EBG00001118394.
DR   EnsemblGenomes-Gn; EBG00001118395.
DR   EnsemblGenomes-Gn; EBG00001118396.
DR   EnsemblGenomes-Gn; EBG00001118397.
DR   EnsemblGenomes-Gn; EBG00001118398.
DR   EnsemblGenomes-Gn; EBG00001118399.
DR   EnsemblGenomes-Gn; EBG00001118400.
DR   EnsemblGenomes-Gn; EBG00001118401.
DR   EnsemblGenomes-Gn; EBG00001118402.
DR   EnsemblGenomes-Gn; EBG00001118403.
DR   EnsemblGenomes-Gn; EBG00001118404.
DR   EnsemblGenomes-Gn; EBG00001118405.
DR   EnsemblGenomes-Gn; EBG00001118406.
DR   EnsemblGenomes-Gn; EBG00001118407.
DR   EnsemblGenomes-Gn; EBG00001118408.
DR   EnsemblGenomes-Gn; EBG00001118409.
DR   EnsemblGenomes-Gn; EBG00001118410.
DR   EnsemblGenomes-Gn; EBG00001118411.
DR   EnsemblGenomes-Gn; EBG00001118412.
DR   EnsemblGenomes-Gn; EBG00001118413.
DR   EnsemblGenomes-Gn; EBG00001118414.
DR   EnsemblGenomes-Gn; EBG00001118415.
DR   EnsemblGenomes-Gn; EBG00001118416.
DR   EnsemblGenomes-Gn; EBG00001118417.
DR   EnsemblGenomes-Gn; EBG00001118418.
DR   EnsemblGenomes-Gn; EBG00001118419.
DR   EnsemblGenomes-Gn; EBG00001118420.
DR   EnsemblGenomes-Gn; EBG00001118421.
DR   EnsemblGenomes-Gn; EBG00001118422.
DR   EnsemblGenomes-Gn; EBG00001118423.
DR   EnsemblGenomes-Gn; EBG00001118424.
DR   EnsemblGenomes-Gn; EBG00001118425.
DR   EnsemblGenomes-Gn; EBG00001118426.
DR   EnsemblGenomes-Gn; EBG00001118427.
DR   EnsemblGenomes-Gn; EBG00001118428.
DR   EnsemblGenomes-Gn; EBG00001118429.
DR   EnsemblGenomes-Gn; EBG00001118430.
DR   EnsemblGenomes-Gn; EBG00001118431.
DR   EnsemblGenomes-Gn; EBG00001118432.
DR   EnsemblGenomes-Gn; EBG00001118433.
DR   EnsemblGenomes-Gn; RPD_R0001.
DR   EnsemblGenomes-Gn; RPD_R0003.
DR   EnsemblGenomes-Gn; RPD_R0004.
DR   EnsemblGenomes-Gn; RPD_R0006.
DR   EnsemblGenomes-Gn; RPD_R0007.
DR   EnsemblGenomes-Gn; RPD_R0008.
DR   EnsemblGenomes-Gn; RPD_R0009.
DR   EnsemblGenomes-Gn; RPD_R0010.
DR   EnsemblGenomes-Gn; RPD_R0011.
DR   EnsemblGenomes-Gn; RPD_R0012.
DR   EnsemblGenomes-Gn; RPD_R0013.
DR   EnsemblGenomes-Gn; RPD_R0014.
DR   EnsemblGenomes-Gn; RPD_R0015.
DR   EnsemblGenomes-Gn; RPD_R0016.
DR   EnsemblGenomes-Gn; RPD_R0019.
DR   EnsemblGenomes-Gn; RPD_R0021.
DR   EnsemblGenomes-Gn; RPD_R0022.
DR   EnsemblGenomes-Gn; RPD_R0023.
DR   EnsemblGenomes-Gn; RPD_R0024.
DR   EnsemblGenomes-Gn; RPD_R0025.
DR   EnsemblGenomes-Gn; RPD_R0026.
DR   EnsemblGenomes-Gn; RPD_R0027.
DR   EnsemblGenomes-Gn; RPD_R0030.
DR   EnsemblGenomes-Gn; RPD_R0031.
DR   EnsemblGenomes-Gn; RPD_R0034.
DR   EnsemblGenomes-Gn; RPD_R0037.
DR   EnsemblGenomes-Gn; RPD_R0038.
DR   EnsemblGenomes-Gn; RPD_R0039.
DR   EnsemblGenomes-Gn; RPD_R0040.
DR   EnsemblGenomes-Gn; RPD_R0041.
DR   EnsemblGenomes-Gn; RPD_R0042.
DR   EnsemblGenomes-Gn; RPD_R0043.
DR   EnsemblGenomes-Gn; RPD_R0044.
DR   EnsemblGenomes-Gn; RPD_R0045.
DR   EnsemblGenomes-Gn; RPD_R0046.
DR   EnsemblGenomes-Gn; RPD_R0047.
DR   EnsemblGenomes-Gn; RPD_R0048.
DR   EnsemblGenomes-Gn; RPD_R0052.
DR   EnsemblGenomes-Gn; RPD_R0053.
DR   EnsemblGenomes-Gn; RPD_R0054.
DR   EnsemblGenomes-Gn; RPD_R0055.
DR   EnsemblGenomes-Gn; RPD_R0056.
DR   EnsemblGenomes-Gn; RPD_R0057.
DR   EnsemblGenomes-Gn; RPD_R0058.
DR   EnsemblGenomes-Gn; RPD_R0059.
DR   EnsemblGenomes-Gn; RPD_R0060.
DR   EnsemblGenomes-Gn; RPD_R0063.
DR   EnsemblGenomes-Gn; RPD_R0064.
DR   EnsemblGenomes-Gn; RPD_R0065.
DR   EnsemblGenomes-Gn; RPD_R0066.
DR   EnsemblGenomes-Gn; RPD_R0067.
DR   EnsemblGenomes-Gn; RPD_R0068.
DR   EnsemblGenomes-Gn; RPD_R0069.
DR   EnsemblGenomes-Gn; RPD_R0070.
DR   EnsemblGenomes-Gn; RPD_R0071.
DR   EnsemblGenomes-Gn; RPD_R0072.
DR   EnsemblGenomes-Gn; RPD_R0073.
DR   EnsemblGenomes-Gn; RPD_R0074.
DR   EnsemblGenomes-Tr; EBT00001710032.
DR   EnsemblGenomes-Tr; EBT00001710033.
DR   EnsemblGenomes-Tr; EBT00001710034.
DR   EnsemblGenomes-Tr; EBT00001710035.
DR   EnsemblGenomes-Tr; EBT00001710036.
DR   EnsemblGenomes-Tr; EBT00001710037.
DR   EnsemblGenomes-Tr; EBT00001710038.
DR   EnsemblGenomes-Tr; EBT00001710039.
DR   EnsemblGenomes-Tr; EBT00001710040.
DR   EnsemblGenomes-Tr; EBT00001710041.
DR   EnsemblGenomes-Tr; EBT00001710042.
DR   EnsemblGenomes-Tr; EBT00001710043.
DR   EnsemblGenomes-Tr; EBT00001710044.
DR   EnsemblGenomes-Tr; EBT00001710045.
DR   EnsemblGenomes-Tr; EBT00001710046.
DR   EnsemblGenomes-Tr; EBT00001710047.
DR   EnsemblGenomes-Tr; EBT00001710048.
DR   EnsemblGenomes-Tr; EBT00001710049.
DR   EnsemblGenomes-Tr; EBT00001710050.
DR   EnsemblGenomes-Tr; EBT00001710051.
DR   EnsemblGenomes-Tr; EBT00001710052.
DR   EnsemblGenomes-Tr; EBT00001710053.
DR   EnsemblGenomes-Tr; EBT00001710054.
DR   EnsemblGenomes-Tr; EBT00001710055.
DR   EnsemblGenomes-Tr; EBT00001710056.
DR   EnsemblGenomes-Tr; EBT00001710057.
DR   EnsemblGenomes-Tr; EBT00001710058.
DR   EnsemblGenomes-Tr; EBT00001710059.
DR   EnsemblGenomes-Tr; EBT00001710060.
DR   EnsemblGenomes-Tr; EBT00001710061.
DR   EnsemblGenomes-Tr; EBT00001710062.
DR   EnsemblGenomes-Tr; EBT00001710063.
DR   EnsemblGenomes-Tr; EBT00001710064.
DR   EnsemblGenomes-Tr; EBT00001710065.
DR   EnsemblGenomes-Tr; EBT00001710066.
DR   EnsemblGenomes-Tr; EBT00001710067.
DR   EnsemblGenomes-Tr; EBT00001710068.
DR   EnsemblGenomes-Tr; EBT00001710069.
DR   EnsemblGenomes-Tr; EBT00001710070.
DR   EnsemblGenomes-Tr; EBT00001710071.
DR   EnsemblGenomes-Tr; EBT00001710072.
DR   EnsemblGenomes-Tr; EBT00001710073.
DR   EnsemblGenomes-Tr; EBT00001710074.
DR   EnsemblGenomes-Tr; EBT00001710075.
DR   EnsemblGenomes-Tr; EBT00001710076.
DR   EnsemblGenomes-Tr; EBT00001710077.
DR   EnsemblGenomes-Tr; EBT00001710078.
DR   EnsemblGenomes-Tr; EBT00001710079.
DR   EnsemblGenomes-Tr; EBT00001710080.
DR   EnsemblGenomes-Tr; EBT00001710081.
DR   EnsemblGenomes-Tr; EBT00001710082.
DR   EnsemblGenomes-Tr; EBT00001710083.
DR   EnsemblGenomes-Tr; EBT00001710084.
DR   EnsemblGenomes-Tr; EBT00001710085.
DR   EnsemblGenomes-Tr; EBT00001710086.
DR   EnsemblGenomes-Tr; EBT00001710087.
DR   EnsemblGenomes-Tr; EBT00001710088.
DR   EnsemblGenomes-Tr; EBT00001710089.
DR   EnsemblGenomes-Tr; EBT00001710090.
DR   EnsemblGenomes-Tr; EBT00001710091.
DR   EnsemblGenomes-Tr; EBT00001710092.
DR   EnsemblGenomes-Tr; EBT00001710093.
DR   EnsemblGenomes-Tr; EBT00001710094.
DR   EnsemblGenomes-Tr; EBT00001710095.
DR   EnsemblGenomes-Tr; EBT00001710096.
DR   EnsemblGenomes-Tr; EBT00001710097.
DR   EnsemblGenomes-Tr; EBT00001710098.
DR   EnsemblGenomes-Tr; EBT00001710099.
DR   EnsemblGenomes-Tr; EBT00001710100.
DR   EnsemblGenomes-Tr; EBT00001710101.
DR   EnsemblGenomes-Tr; EBT00001710102.
DR   EnsemblGenomes-Tr; EBT00001710103.
DR   EnsemblGenomes-Tr; EBT00001710104.
DR   EnsemblGenomes-Tr; RPD_R0001-1.
DR   EnsemblGenomes-Tr; RPD_R0003-1.
DR   EnsemblGenomes-Tr; RPD_R0004-1.
DR   EnsemblGenomes-Tr; RPD_R0006-1.
DR   EnsemblGenomes-Tr; RPD_R0007-1.
DR   EnsemblGenomes-Tr; RPD_R0008-1.
DR   EnsemblGenomes-Tr; RPD_R0009-1.
DR   EnsemblGenomes-Tr; RPD_R0010-1.
DR   EnsemblGenomes-Tr; RPD_R0011-1.
DR   EnsemblGenomes-Tr; RPD_R0012-1.
DR   EnsemblGenomes-Tr; RPD_R0013-1.
DR   EnsemblGenomes-Tr; RPD_R0014-1.
DR   EnsemblGenomes-Tr; RPD_R0015-1.
DR   EnsemblGenomes-Tr; RPD_R0016-1.
DR   EnsemblGenomes-Tr; RPD_R0019-1.
DR   EnsemblGenomes-Tr; RPD_R0021-1.
DR   EnsemblGenomes-Tr; RPD_R0022-1.
DR   EnsemblGenomes-Tr; RPD_R0023-1.
DR   EnsemblGenomes-Tr; RPD_R0024-1.
DR   EnsemblGenomes-Tr; RPD_R0025-1.
DR   EnsemblGenomes-Tr; RPD_R0026-1.
DR   EnsemblGenomes-Tr; RPD_R0027-1.
DR   EnsemblGenomes-Tr; RPD_R0030-1.
DR   EnsemblGenomes-Tr; RPD_R0031-1.
DR   EnsemblGenomes-Tr; RPD_R0034-1.
DR   EnsemblGenomes-Tr; RPD_R0037-1.
DR   EnsemblGenomes-Tr; RPD_R0038-1.
DR   EnsemblGenomes-Tr; RPD_R0039-1.
DR   EnsemblGenomes-Tr; RPD_R0040-1.
DR   EnsemblGenomes-Tr; RPD_R0041-1.
DR   EnsemblGenomes-Tr; RPD_R0042-1.
DR   EnsemblGenomes-Tr; RPD_R0043-1.
DR   EnsemblGenomes-Tr; RPD_R0044-1.
DR   EnsemblGenomes-Tr; RPD_R0045-1.
DR   EnsemblGenomes-Tr; RPD_R0046-1.
DR   EnsemblGenomes-Tr; RPD_R0047-1.
DR   EnsemblGenomes-Tr; RPD_R0048-1.
DR   EnsemblGenomes-Tr; RPD_R0052-1.
DR   EnsemblGenomes-Tr; RPD_R0053-1.
DR   EnsemblGenomes-Tr; RPD_R0054-1.
DR   EnsemblGenomes-Tr; RPD_R0055-1.
DR   EnsemblGenomes-Tr; RPD_R0056-1.
DR   EnsemblGenomes-Tr; RPD_R0057-1.
DR   EnsemblGenomes-Tr; RPD_R0058-1.
DR   EnsemblGenomes-Tr; RPD_R0059-1.
DR   EnsemblGenomes-Tr; RPD_R0060-1.
DR   EnsemblGenomes-Tr; RPD_R0063-1.
DR   EnsemblGenomes-Tr; RPD_R0064-1.
DR   EnsemblGenomes-Tr; RPD_R0065-1.
DR   EnsemblGenomes-Tr; RPD_R0066-1.
DR   EnsemblGenomes-Tr; RPD_R0067-1.
DR   EnsemblGenomes-Tr; RPD_R0068-1.
DR   EnsemblGenomes-Tr; RPD_R0069-1.
DR   EnsemblGenomes-Tr; RPD_R0070-1.
DR   EnsemblGenomes-Tr; RPD_R0071-1.
DR   EnsemblGenomes-Tr; RPD_R0072-1.
DR   EnsemblGenomes-Tr; RPD_R0073-1.
DR   EnsemblGenomes-Tr; RPD_R0074-1.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC2587559; 19020098.
DR   EuropePMC; PMC2786518; 19801478.
DR   EuropePMC; PMC3907030; 24279426.
DR   EuropePMC; PMC4393458; 25710371.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000283.
DR   SILVA-SSU; CP000283.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000372
CC   Source DNA and bacteria available from Caroline S. Harwood
CC   (csh5@u.washington.edu)
CC   Contacts: Caroline S. Harwood (csh5@u.washington.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4892717
FT                   /organism="Rhodopseudomonas palustris BisB5"
FT                   /strain="BisB5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:316057"
FT   gene            649..2067
FT                   /locus_tag="RPD_0001"
FT   CDS_pept        649..2067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37241"
FT                   /db_xref="GOA:Q13F98"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F98"
FT                   /protein_id="ABE37241.1"
FT                   /translation="MSNMEHDRWSRVKGRLRSSVGEDVYSSWFARMDLEAVQQESVHLS
FT                   VPTRFLKSWIQTHYSEKVLTCWQAEMPEVCRIDLTVRSPMRAAVTKEAPAPAEHRRDEH
FT                   RPAADARSHAAAPAPSNHDALGGSPLDPRLTFASFVVGRSNTLAHAAAKQVAEGRRGDP
FT                   VMFNPLYIHSGVGLGKTHLLQAVTWAGNSGTERKVLYLTAEKFMYGFVASLKTQTSLAF
FT                   KEALRGIDVLVIDDLQFLQGKTTQAEFCHTLNALIDAGRQVVVAADRPPADLESLDERV
FT                   RSRLAGGLVVEMAPLGEELRLGILKSRVVAARTHHASFDVPQSVLEYLARAITHNGRDL
FT                   EGAINRLLAHSKLNAQPVTLEMAEHEVRDLIRPQEPKRIKIEDIQRVVARQYNVSRSDL
FT                   LSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEGLVSKDVT
FT                   LSDEVESLKRQLQE"
FT   gene            2329..3447
FT                   /locus_tag="RPD_0002"
FT   CDS_pept        2329..3447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37242"
FT                   /db_xref="GOA:Q13F97"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F97"
FT                   /protein_id="ABE37242.1"
FT                   /translation="MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAQLALK
FT                   ATDLDLEVIETLPAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGR
FT                   SRFTLQTLPESDFPDLAAGEMSHSFSLAASDVKRLIDRTQFAISTEETRYYLNGIYLHT
FT                   AGSAKAATLRAVATDGHRLAQVDLAQPAGASGMPGVIVPRKTVGEVQRLIEDNDAEIAI
FT                   ELSAGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKEFEAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEGE
FT                   VAVLKLADPGSPTLIQDRDTKNALYVLMPMRV"
FT   gene            3622..4758
FT                   /locus_tag="RPD_0003"
FT   CDS_pept        3622..4758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37243"
FT                   /db_xref="GOA:Q13F96"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F96"
FT                   /protein_id="ABE37243.1"
FT                   /translation="MTASRITRLTLTHFRNYRAAALHTRGERVVLVGANGAGKTNCLEA
FT                   ISFLSPGRGLRRATLDDVSDHQGDGSWAVSAEVEGALGLATLGTGIDPPRADAATTRRC
FT                   RIDREPVGSATAFGDHLRMVWLTPAMDGLFMGAASERRRFFDRLVLAIDSQHSSRVSAL
FT                   DRSLRSRNRLLEERNADRHWLDAIERETAELAVAVAAMRGQTAARLAAMLDARGAASAF
FT                   PSAKIMLDGWMESALLTEPATAVEDRYRAILRDGRLRDAAAGRTLDGPHLTDLQVIYAP
FT                   KAMPARDASTGEQKALLIGLVLAHAQLVSEITGITPLLLLDEVVAHLDPARRRALFAEL
FT                   ERLGAQVWMTGADPAGFAEIGPDAEIFTVESGRIAPQK"
FT   gene            4985..7426
FT                   /locus_tag="RPD_0004"
FT   CDS_pept        4985..7426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37244"
FT                   /db_xref="GOA:Q13F95"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F95"
FT                   /protein_id="ABE37244.1"
FT                   /translation="MTEPARQPIAETPPSVPAEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGHATAVEVVLNADGSVTVRDDGRGIPVDIHKGEGIS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLILRVWRNGKEHIIEFAHG
FT                   DAVAPLSMVGDANGRRGTEVTFFASPETFTHIEYDFATLEHRLRELAFLNSGVNIVLSD
FT                   MRHAVEKREEMRYEGGVTEFVKYLDRNKKPIVPAPIVLAADLNGIGVEVALWWNETYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRAALTRQVNGYADSNAKKEKIALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVLNEALAAWFEEHPSEAKVIVGKVIEAAAAREA
FT                   ARKARELTRRKGALDIASLPGKLADCQERDPSKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERARFDKMLGSEQIGTLITALGTGIGRDDFDLSKLRYHKIILMTDADVD
FT                   GAHIRTLLLTFFFRQMPALIEGGFLYIAQPPLYKVTRGKSEQYLKDERALEDYLISTGL
FT                   DDCIFRPASGEERSGRDLLALVENARIVRGTLHNLHSRYNRSVVEQAAIAGVLNPRITS
FT                   DIPTANEAAAYIARRLDALADEVERGWVGRFTEGEGFSFERTVRGVKDVAIIDDALLGS
FT                   ADARKLDEYAAILQEAYPRPGVLRRKDTETAIHGPVSLFEAVTDAGRKGVSLQRYKGLG
FT                   EMNPSQLWETTLDTNARSLLQVKVREVDEADDLFTKLMGDVVEPRREFIQENSLSATVD
FT                   V"
FT   gene            complement(7691..8461)
FT                   /locus_tag="RPD_0005"
FT   CDS_pept        complement(7691..8461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37245"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F94"
FT                   /protein_id="ABE37245.1"
FT                   /translation="MDSPGKQIHGGAMESDRLWAAASRLADYVKSPSLRHIRDPQNIQK
FT                   LAREILQAVDQAGSVWSKWTAAREDIVKAAANCWVPPEDLRAFLNSLPGPALTATDVAQ
FT                   RLRAIWEEPWTSYPKEELQAGCRALYDAEKAAGTEMRAIIGALEEFLEVEEERLRQEQN
FT                   EAYQQFREQDRIRRQQRFLSGADCGWTPIDGSKELFCRRNGRAFRVGQAKDKRWKLYRI
FT                   AAVDDAGELLGTYAGRREASKALEQIAYQAEILR"
FT   gene            complement(8475..8738)
FT                   /locus_tag="RPD_0006"
FT   CDS_pept        complement(8475..8738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37246"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F93"
FT                   /protein_id="ABE37246.1"
FT                   /translation="MRYVAILAIVAVVPGPSAAQEPKPLKTLRIQQAAPGATELFVVDD
FT                   DGTVRIDWEKVETLARLKTDRIALPTAQVMLAIRDRTWKPMK"
FT   gene            complement(8751..9092)
FT                   /locus_tag="RPD_0007"
FT   CDS_pept        complement(8751..9092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37247"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F92"
FT                   /protein_id="ABE37247.1"
FT                   /translation="MIRTVAALIVLLLNAEVRSETVDVKYRGPVDLRTFECRDITRSSF
FT                   IQRVCYDQAQAYMIISLKGTYYHYCELSRATFDSLMGAPSMGQFFNQTIKGTGSDGPFD
FT                   CRTHRTPSY"
FT   gene            complement(9267..10505)
FT                   /locus_tag="RPD_0008"
FT   CDS_pept        complement(9267..10505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0008"
FT                   /product="Divergent AAA region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37248"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F91"
FT                   /protein_id="ABE37248.1"
FT                   /translation="MFVREIGAWRLVGGETDRIECKAGFRLQPEDRFSKALRAIAGLAN
FT                   NKGGYILFGVTDGTYQADGLSDDVFTKSDISLLNRILASALDPVPHVTKGLIELGGKQV
FT                   GVLYVEKHDHGPVIAVKNVSQDVKEGGIYFRYVGETRLIKPGELRQIIAAREQRAVAEF
FT                   SARMNRVAVGKEATIDLDSGEVAGTSGKFLIDKSLLSSIQFVREGEFDEKKGAPALRLI
FT                   GDVEPVSAVERERTRVIRENVTPDAVVRNFLRNEKVAEPTQYIHFQAHSQRKWFPVWFY
FT                   IDQTRSTASEVAEDLRKQVATYPSSRDALVDRLAGKDAAFRQSTGKAEALRAKLARGDI
FT                   KAPTDIDADVVFAGAVQALPTTMKPKDLESIRTALLDCLDRAQDTDPRSSNRRGAIYRA
FT                   ACRLDELLYSKKR"
FT   gene            10961..11476
FT                   /locus_tag="RPD_0009"
FT   CDS_pept        10961..11476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F90"
FT                   /protein_id="ABE37249.1"
FT                   /translation="MLSGSYIWRHLPSAAQRALMATMAPKHHPTPLSGGDRKALQKELG
FT                   KSRAMTGILARQAEEARSEGEALIRKADNLACQSWNERMWSDGGPAQPSPTIGQAINGG
FT                   YPWLEVQCSRCKTISSVDLCEIKRPPETFVHTLEEALRCRKCSRSKWRPRGVLHQLAPN
FT                   QRHTPPET"
FT   gene            11481..12173
FT                   /locus_tag="RPD_0010"
FT   CDS_pept        11481..12173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0010"
FT                   /product="protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37250"
FT                   /db_xref="GOA:Q13F89"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F89"
FT                   /protein_id="ABE37250.1"
FT                   /translation="MCNLYSITKNQDAIRQIFRIARDTTGNLPPLPAIFPDGLAPIVRA
FT                   AGERELTMMRWGMPGPPQFGGIPVTNIRNTKSPHWRRWLKPENRCLVPATSFSEYNATA
FT                   NPKSLTYPDGSPHPMAGKKDVVWFALSPERPLFAFAGIWTEWTGTRGTKANPVEGAHLL
FT                   YGFLTTEPNAIVAPIHPKAMPVILTTEEERDVWMRAPWGEAAALQRPLPDGPLQIVARG
FT                   ANKEDRST"
FT   gene            complement(12201..13025)
FT                   /locus_tag="RPD_0011"
FT   CDS_pept        complement(12201..13025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37251"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="InterPro:IPR008306"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F88"
FT                   /protein_id="ABE37251.1"
FT                   /translation="MKATFIGFDSAWTDNPKRPGAICSIDYDGSEFSEFRGPTLVGFKQ
FT                   ALEFIQSAYDANRLTLVAVDQPTIVNNLTGMRAAERVAAAAVSWLGGGVQPASRSRSGM
FT                   FDDNAPIWKFLRELGACDDPERCKASRDGLFIMEVFPALALPAFHPGFCGRLSAPRYNP
FT                   ARSKTFRQSDWEKVTKVVGEQVDAMQCPSFNDWCASLSSVPKPKKSDQDKLDASICLLI
FT                   ALHWMVQPRESSVMIGDLTSGYIVAPVVDEIRRRLTDKARSEYVAIDGKIPG"
FT   gene            complement(13025..15799)
FT                   /locus_tag="RPD_0012"
FT   CDS_pept        complement(13025..15799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0012"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37252"
FT                   /db_xref="GOA:Q13F87"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F87"
FT                   /protein_id="ABE37252.1"
FT                   /translation="MDVKPLGRSTGLVGGGNLQRFSSRLGRLSHVYLKDQLRGASEYRR
FT                   IAGYFRSSIFDLVNEEIEGIGKVRIVCNSDLDPEDINAAKQARTQLLKEKWNEVDDAVE
FT                   SFFRRPRYQRLFDILTKGNVEIRVVSRADAPFVHGKAGVIYRPDGTSSAFMGSLNETRE
FT                   GWSANYEFVWEDTSADGVAWVEDEFEYLWERGKPLPDAIIEEIGRSARRVEVQLADLTP
FT                   AEVAPAALVEADIYRKGEELMPWQRAFVSLFLEHRETYGQVRLLLADEVGVGKTLSLAG
FT                   SALVSALLGDGPVLILCPATLTAQWQIELKDRLNIPSAVWLSQEKAWLLDPDEIPMPSV
FT                   GPEGVVKCPRQIALVSTGLIFHKTEERELLMSRRYGMVILDEAHRARGKTESDEEERKA
FT                   NNLLSFMTEIAKKTTHVLLGTATPIQTDVEDMWDLLKILGMGAEHVIGDAWSEWRSTEK
FT                   VVPVITGKRKVTDDRDAWSLFRNPLPASAENEVIFGLMRGAIEMPPTRYVTQKGFSDIN
FT                   DDFCREQFIDDVLTPKGDLGFFQRNNPVVRHVVLRKRSTLEQMNLLPRIPVDIHPLPGQ
FT                   HMPALFDGLGLRTSSAFDAAYEAADKFTKVLRKRKKSAGFMRSLMLQRLCSSYASGLST
FT                   AEKLLAGRSLDDEELMLDLGPNGVELIDEERLHLQTIIDVLSPHPTDPKLDAVLYFLED
FT                   KGWLEKGCIIFSQYFDTTRWIGETLTGRLPREPVAVYAGAGKSGIYIGGEWKSVEREQI
FT                   KKAVKERTIRLVVATDAACEGLNLQTLGTLINVDLPWNPSRLEQRIGRIKRFGQRRERV
FT                   DMLNLVYHGSQQLTVDEKVYQKLSSRMKDRFDIFGTLPDVIDDDWIDDEEEFDARLNDF
FT                   TEKRKRANAFDLRYASDVDPKGERWELCEKVLARADVTKRLSRGWGERERADG"
FT   gene            complement(15807..18746)
FT                   /locus_tag="RPD_0013"
FT   CDS_pept        complement(15807..18746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0013"
FT                   /product="DNA methylase containing a Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37253"
FT                   /db_xref="GOA:Q13F86"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F86"
FT                   /protein_id="ABE37253.1"
FT                   /translation="MDAKVMKSKVVPFSLKDAPSLIERVWPAQMISVEAQRERKAVHGQ
FT                   TLTSLGSYWKGRKPLVLVRACILGALLPSTGDDEKDLAIFEKLMGMSDDQVACRFKEKV
FT                   SVEEVQKFGTVSQQSALIDDDGQGTTLRKLPKAQRESLMGSVIQRMPYDVRAQKLLRPE
FT                   EVDESVLTGPALDEVNKHLGTDASNLSELLEQLGLMRFGRRPVVVDTFSGSGSIPFEAA
FT                   RLGCDVFASDLNPIACMLTWAALNVVGGSDASRKEIQQEQAALAKAVDEEITRLGIEHD
FT                   SHGNRAKVFLYCLEARCPQTQWLVPLAPTFVVSEARRVVARLVPNKSKKQFDLEIVSGA
FT                   NAKEMAEAAAGTVRDGKMVYSLDGETYSTPIKTIRGDRREAGGIAANNLRLWEKSDVAP
FT                   RSGDILSERLYCIQWIEQETVGKSRQVTFFASPTAADLKRELKVKNLVSHKLKEWQEGG
FT                   FVSDMEIETGKENEGPIRTNGWKFWHQMFMPRAILTAALIAEHGQGRAHAALSLCKYLD
FT                   NNSKSCRWKVSQSGGDGGAVSTFDSQALKTIFNWAFRALNVAPWQLGEFARSPIRTNAT
FT                   IECVDARNFRHSMDLSITDPPYADAVNYHEITEFFIAWIRKNTPTEFEEWTWDSRRPLA
FT                   IKGDGEDFRHGMVDAYKAMSEKMAPNGLEIVMFTHQSASVWADMAQIFWGAGLQVMAAW
FT                   YIATETTSDLKKGGYVQGTVILVARKRREREAGYKDEIVQEVKAEVADQIDTMSGLSQN
FT                   LKGRGRIENLFEDADLQMAGYAAALRVLTKYERIDGTDMTKEALRPRRAGEKNIVGEII
FT                   DFAVQVANEHMVPEHMPPKLWGDLSGAERFYFKMLDIETTSLRKLDNYQNFAKAFRVND
FT                   YSALMGSMEPNKARLKSAKEFKKAGFEIPDFGPSSTRSALFAIFELESDVEGDDVLSHL
FT                   KDLMPNYHNKREDLAAIADYIARKRETVDETESRAARILHGLIRNERLG"
FT   gene            complement(18758..19339)
FT                   /locus_tag="RPD_0014"
FT   CDS_pept        complement(18758..19339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37254"
FT                   /db_xref="InterPro:IPR024220"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F85"
FT                   /protein_id="ABE37254.1"
FT                   /translation="MSERKTIGFGVPNDIDPHHFTVEIPAVRANPVIITEHFGLSGGAN
FT                   GLPDSIERCRLPQEAWNAIRRELERVFNERLKEKKLTAARWKTGKNPVERLLGRELCVL
FT                   AWGVETAPKDTIPNAIRNWGAFKPEERWWLFAMAASLTGTSQDVDIGWRKAIRIALTET
FT                   PTGEEVVAIRSKRPKSEGDRPRLPLFDDVK"
FT   gene            complement(19336..22488)
FT                   /locus_tag="RPD_0015"
FT   CDS_pept        complement(19336..22488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37255"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F84"
FT                   /protein_id="ABE37255.1"
FT                   /translation="MLQTIKDACQFDPKAIDYALSDQIENLDDLVGHDPVAAEAFFRKT
FT                   YVTGGMKTLLRQGLQRLAGSSGQAVFELKQAMGGGKTHSMLALGYLAANPKLFELVAKD
FT                   ITQGIKAEPAQVVAISGRSISRDQHLWGDIADQLGKADKFLEFYKGMPQAPNEKDWIGL
FT                   IGDAPTLILLDELPPYFKNAITQNVGGGTLADVTTYAVSNLLSAALKLPRLCIVISNLS
FT                   GAYEGATKSITTMVAKATRDLQNETGRQAKGITPVELGSDEIYNILRTRLLTKDPDQKV
FT                   INAVSTAFSDSISDAVKSKTIAKSATQIADEIAASYPFHPSFKHILALFKENERFRQTR
FT                   GLMTMAALMVKSALGRPTNDVYLVGCQHIDLAQPDVRDVITNVYDLSGAITHDIAGTAT
FT                   ERAHAQTIDDVADTDAASQVARLVLMSSLSEANDAVKGLTKSQVVENLVAPQRSPHEFD
FT                   EAFEKLRIECWYLHRKENDAWYFSKNENLKKKIEKYASTAAQPKIDAEMERRLQMVFEP
FT                   KRRNAYSSVQALPKIEDIKPSGDRVLLVLSPDKRVPPEDAQRLFDAIVEKNNFCVVTGD
FT                   GTDLAKLEDKVRRIWATAKVLQEDGGDRSPNLAELQEETETAEFEFNSTLIALFNRVYY
FT                   PSRLPKPLPNGANEGLTYAALKLVERRTRENGPTTIDGEAAVEEALSATGASKLILTPA
FT                   DEGNAASLRNRAQDVLWGTTERKTRWKDVEERAISNVRWPWLPPKSLDEIKRTAVSIGE
FT                   WRDSGDGYIEKGPFPQAKTSVKVVTRAYNDDTGMATIEPTPVDAGPNARVHFAPTKDVS
FT                   GSSPVVPDTIFDRDDTVLWFLAVDPDGKHETGDPVKWSNTLTLTHQPKEVMGKRTVELT
FT                   VKPRGTIRWNIDGTNAREGKAYSGPIALNGDDEVKIYAYAEDAGVEVTKVFPIRAAAED
FT                   EFKIDPELPVAIKKRQKIVSTKDVFATLKALKEARGLLKGSLSATVGQGDVNATTRFGP
FT                   QTNLNSAAIETFLGAARLSIAQEAAEVEIGFSEVHFETGREMEEFVKAVGWIVSPNEVE
FT                   QQ"
FT   gene            complement(22544..22762)
FT                   /locus_tag="RPD_0016"
FT   CDS_pept        complement(22544..22762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37256"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F83"
FT                   /protein_id="ABE37256.1"
FT                   /translation="MVRKSIEKNIAPGRPGRKPPPGDRRQFLLTMSQDVIKAVKQAGLE
FT                   DDRPAWEIMEEAAKDWLERRKSKAKKA"
FT   gene            23030..23581
FT                   /locus_tag="RPD_0017"
FT   CDS_pept        23030..23581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37257"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F82"
FT                   /protein_id="ABE37257.1"
FT                   /translation="MTQNPSTSAWQAALVARHPNAFNVEFNGRITTPGYPSVGDGWREL
FT                   VETAVGRMVEAAAPRGSVTIVQIKEKFGGLRIYWHGRNLSAVSTRAIEEAVALAEARSA
FT                   CTCEVCGAEGRLHKHGGWFATACPEHARGDPVRVKPGFDNIRIVRSFEPGKPPILSCRR
FT                   YDRATDTFVDVDPASLGIKE"
FT   gene            23793..24572
FT                   /locus_tag="RPD_0018"
FT   CDS_pept        23793..24572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0018"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37258"
FT                   /db_xref="GOA:Q13F81"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F81"
FT                   /protein_id="ABE37258.1"
FT                   /translation="MRLWILSDLHLELTRGWDLPAGDARPAFDMLVVAGDLIPRMERGV
FT                   RWLAERVTDRPVIYIAGNHEFYGTDIDRTVEKARDAAAGTNIHVLQNESLTIDGVTFLG
FT                   ATLWTDFDLFDNQDYAMAAAGEVMNDYRKIRIDDYQRRLRPAHTLQRHWESRDFLAHGL
FT                   RGGGRNVVVTHHGAHPEAARRGYERDITSAAYTSDLEALILEGAPELWIYGHTHESRDF
FT                   RVGATRMISNAKGYGPWLPSDPTWDNAQFAPNFVIEI"
FT   gene            24633..25244
FT                   /locus_tag="RPD_0019"
FT   CDS_pept        24633..25244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F80"
FT                   /protein_id="ABE37259.1"
FT                   /translation="MPSEFESCPMLFTNPAQRDLFVSAKSTTAIPARHPLVRDALIQAS
FT                   LDPQVRSLEFVPAATVGATQVALNAIVVVRDDGRFHLDVVEARQVRDVEMEGLFLIALD
FT                   DLKLVPLTLTADDITRQPRFANAKTVWAYRFHTVGIEMRMRVLSVLTEDGPLQLGCLLK
FT                   RTRGPRDPAPAVMALACSDLLELDIISRPLGPATMVRSRS"
FT   gene            25241..27334
FT                   /locus_tag="RPD_0020"
FT   CDS_pept        25241..27334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0020"
FT                   /product="AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37260"
FT                   /db_xref="GOA:Q13F79"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F79"
FT                   /protein_id="ABE37260.1"
FT                   /translation="MTRTNAKANVKRARANVRRRAAVAKKPPRKIASKAGRKPARKGVG
FT                   RKVAAARPRGPWTTLVQPIEQPEGTNEVAESASSDPPLPRERPTARCALVAAAWTLATT
FT                   GEIRARLKEGGSLAVVVVVPTSAWVASVKSMFEKRFGRGWEIFSIDDTTAKSPREQAAQ
FT                   NICAANELMKGHAVVGIAAQRDALPPALTTAADITIRIEPLRGSVIRRAIRLFTGLPVG
FT                   QVEDDIAAGGDFLDLLAAFRSGSTPTDILLRLRRATARSVDEGQRLPALESAVEYGAAR
FT                   EWGLALARDIADYRAGRLDWREVDRGAVLHSEPGLGKTLFAQILARACGLPLIATSVAD
FT                   LFASSPGYLDSVIKASRAVFDRAAASAPCILFLDEIDALPNRATMSPRGADWWTPVITD
FT                   FLLRLDNAVANQRAGIVVIGATNNIAGVDGAMLRPGRLERSIEILRPDHAGVINILRHH
FT                   LERDLATAELTDVGHLLHGGTGAEIMMVVRQARRLARHDRRTLEVADLLRAVVPIEEIA
FT                   PDLLFRISAHEAAHAVGTLVLGCGSLLRSTVTPRGGRTTVAQDLGVASTRATVESEAVM
FT                   LLCGRAAERLILGDVSLGSGGTGASDLALATKMVAALHASSGLGETLTYLSSHEDALET
FT                   LRFDVGLRMRVEREMIAVQERADELVRRHRAAILAVAEQLRARRQLTGTEIRQILDEMP
FT                   PKS"
FT   gene            27411..27716
FT                   /locus_tag="RPD_0021"
FT   CDS_pept        27411..27716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F78"
FT                   /protein_id="ABE37261.1"
FT                   /translation="MLVVKIEPAPSGFVPMRRCICGLAVANVSDLADIADYRVIGGESP
FT                   NGLKNRPAGIAETMFLNHPGRHRVWALVERPCGVIMKAGWVGLSNPHFDPNFVIEI"
FT   gene            27805..28395
FT                   /locus_tag="RPD_0022"
FT   CDS_pept        27805..28395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37262"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F77"
FT                   /protein_id="ABE37262.1"
FT                   /translation="MFVHPKARASAHQFFVSAKTRTAIPTRHSLVREALVQASLDPLVR
FT                   DIGFVPSARVAAAQVALEAVVIVRDDGQFYLDIVPGRPLRDAEAEGLMLSALDELRLAP
FT                   LTITEEDIRRQPRYTNARTVWHYQSTAVGIGMRMRIQRILIDAGPMRLGDLLMRDWCSD
FT                   PRPAVMSLACQDLLELNLMTEPLGPQTIVRCRS"
FT   gene            28823..29248
FT                   /locus_tag="RPD_0023"
FT   CDS_pept        28823..29248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37263"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F76"
FT                   /protein_id="ABE37263.1"
FT                   /translation="MMSTEVLIRATEYPLDQVECVAERVVGENGDIVQVTCTDIASKVI
FT                   MGRLFVASEPAVWSVGLDLKDVVARVGGGYRHASITVDLATRELACRDEHLTRELRMRK
FT                   RLWRRRRRDPTSHNIRELAPSLAPSLAPSLPKGTIED"
FT   gene            29308..29997
FT                   /locus_tag="RPD_0024"
FT   CDS_pept        29308..29997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37264"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F75"
FT                   /protein_id="ABE37264.1"
FT                   /translation="MVVRNKAAKITRSDATRRVVTYRSGHFTGYVASRKSSTVVQYESI
FT                   LERDFIYLLETDRDVLWFSEQPAPLKFSDGIAHHTWTLDFEIERSSGRYLVEVKPLSKV
FT                   KKYRLDVIYGFARAAAKASGYQNLELWTDRELKALPRLPNAEILVGSDTTYHDPAYDLA
FT                   LLSTIAEIAKVSERTTVRELRSLSRLGPLSYRAVMRQIAIGGLIPADSTVFLGDDAILL
FT                   IPGGGGF"
FT   gene            29997..32429
FT                   /locus_tag="RPD_0025"
FT   CDS_pept        29997..32429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0025"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37265"
FT                   /db_xref="GOA:Q13F74"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F74"
FT                   /protein_id="ABE37265.1"
FT                   /translation="MSMEQSFEPHVPLIRLHKNDQVVIDEVWYRETHRTKHAVTLHPIG
FT                   GTLPRVFTGRQLRELYFDPAKRMRIVRGPNEKLDPEVAAAASRPFESFSAGQQAEMLKR
FT                   YDYVLACDRFFARKLFTKRPETGYARIAEIVARYRRLVRAHQENRPSCRFDLETVGGST
FT                   LRDWYGRWLHSGRQLGALAPLLHSRGSKEKKMDPAVRALIADCVNEKYLTAEAPPLTVV
FT                   WDYICGRIDDLNEDGRHALAKPSEMAVRRWIKDNVDPFTEVFYRKGRKKATHQFRLTNN
FT                   APLATRPLQIVEFDETPLDIMLVDDNGKNPRRAVLTAGICVATGMIVGWHIGYEHPSWV
FT                   TVMKALRMAVLAKDTSGSGAESPYPVYGVPEMIKVDNGPAYRSHSLVAAAGQLQFEIRL
FT                   CPVAKPNLKGKVERFFREVTRDFLSIFPGRTFSNIQERGDYDSEGNARMTLQTVQRLFT
FT                   RWVVDIYHNRPNSRCFGQTPLERWEALSGFGVRVPPQSDDLTPLIGLIVNRTIQADGIT
FT                   FMGLTYRDAALKLMRQKSHMGREWMVKIDPNDLRWIYILNDEAQCWVRAGCQRADLIEG
FT                   LSLKMWMEVVKAAKEATAARQRVSIATLRRARVALLREAEAMGNKPHGKITARDQMWIE
FT                   ANMNQPAYLISVDPDELDAMPNRMLPRRRAKPAENEAKRDPSMVEPASRAGGHPIADQD
FT                   LPDAPLDVAERELDDEVREQQERDDLRQWRKRAAALSSAVSTTQKTDAQPLRTVTEAAP
FT                   PIIPDQQEDVSQARQEAPVGAFERLATAACTRTPTRLADEDDIESWNPNNDQKEIDQ"
FT   gene            32426..33565
FT                   /locus_tag="RPD_0026"
FT   CDS_pept        32426..33565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37266"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F73"
FT                   /protein_id="ABE37266.1"
FT                   /translation="MSRAIQKGSVVSLETALPAKASKPAVCGQPRKGPEEDAMRPQPRR
FT                   DVRSKNPSRNARADRLKGLSDVAVRTGKLAVAEQMFDELVVAYYSKVEGNLMVVYGSSG
FT                   SGKTHVLRQLRKDEDLQLDETDPECARRPLLMIEAPSPCTLKTLGLAVLQGLGYEEAGF
FT                   ANLREHEVWRRARANLSNQGTGILVIDEMHNVLAGRSNMESVKIAMTLKSLMVSEVTPI
FT                   QIVISGLKTVRDFAEHFKELQRRSQFLEMTPLTSPRDDKKLVLFLEGLEKELKFRTCGF
FT                   TRHDLPVRFMMASRGLIGRVAYFVKMAAKLAITLGDDEIKQEYLGKVYERIYRVSANQN
FT                   PFLMANVASFVMPREKEADELTFVRGVKEVSRRNGDAAD"
FT   gene            33552..35345
FT                   /locus_tag="RPD_0027"
FT   CDS_pept        33552..35345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37267"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F72"
FT                   /protein_id="ABE37267.1"
FT                   /translation="MLPTSPHRNVGEGAIGFLMRLGETHGVRKFCDMLRDLGIRRFDLS
FT                   QGIGVDRVARAAMVARAALQFDSGTRTRQGVMLRGELLRPRQWSVHAGRRGCPACFAGD
FT                   RDGTVLPRQWHRAWWDIRAVTVCPLHGLLLIDACPRCGVPLDFKVNAIGQCRNGHPLWD
FT                   SSPERVTGFAGDEYIVGRLVGSDRIPNSLLDAGRLGEAIDALDLVGRCVLAGHHTGGSG
FT                   GLRRHVVLAAGFECFIDWPAAFDPLLDGLLRSSKQGVGKWGAAAAYGPLHYGLQELGCG
FT                   RIAMEMKAHLRRHAAANGVSISKPVFGTVPNVTGIYSVRHAARRFGMGFEGTRTLLARE
FT                   GVVPEETRRGTPIRISTAVVDRLATERSLTVGLGRLADHLALGRGQTRRLVGAGFLGDR
FT                   RPRPSLADADAMLAKLCIGAPANWDRSETASLPDACRSARCSIEVAVRSILAGAPDVKG
FT                   YRPGAGLRGIFVRVSDLRAVGKLSRGRLTLADAAAALRVKWETARALAADGLLVTADDG
FT                   VHPSALDNFQRDFIAAADLAKVARVRSQSLIKQLSGMGVSPAAGPPNCRQVFYRRSSLR
FT                   AVRALRRKLPGVYARALGQSR"
FT   gene            35342..37240
FT                   /locus_tag="RPD_0028"
FT   CDS_pept        35342..37240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37268"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F71"
FT                   /protein_id="ABE37268.1"
FT                   /translation="MNVINRSTAVRRPLACRGPLWTDEPAYARANRLALMNGINSLASF
FT                   GGEMRIPYRQIIWGWRNAEIAALAGMDPANLGAVTFRVGDDDRVRLGDEVLHIDDWSYN
FT                   VLRVCPACLRSDFERESRFPDLLPHIRSWWNLDAIEVCPLHRTPLLGGNPDIFGHRNDP
FT                   KILDVRFVAGVDCDLSSLQVEVGIVEDVRAESYILGRLGFMPRVRSEILDDLPLWNAIR
FT                   LMDRFGAVAAAGVRGFTSLGGSVSKREALSAGYAVFADGKDGLFCLLDRLVADADVARG
FT                   KWGPRVAYGRIYEWLSHDTREEAYDPVRELVRQHAIDNIPMAAGDLVFDRPIGDRHVFT
FT                   LWHVSRELKTTPSATRRILKAMGHLSPDDDVKENWQVLLRKPVVDQVTADLADWLGFNE
FT                   ARALLGLPRAPMDALLQSGVLKAFLSVSTGVAEHIFRRRDLDAFMTSLVGGAPFSRKTE
FT                   GLCDVVQAGRRSGTSTTDVVAALLAGRLTCCGRLSSATGMMQVLVDIEAVRALRASGEV
FT                   RRPGMTVEDARRKLGVTWPVVSNLIGLGLIKTIETRAGPKNRKQSFIEDSELEAFTAEF
FT                   VSATEIAEARKTHVRVLVPALRKQGIEPAIEKTAVGQYFYTREKFTLSRAVVESEH"
FT   gene            37353..37691
FT                   /locus_tag="RPD_0029"
FT   CDS_pept        37353..37691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37269"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F70"
FT                   /protein_id="ABE37269.1"
FT                   /translation="MTFFRRLLSAFLSFFRRRGKPRERARDLSRSAVQLKRWNGDDRPP
FT                   PLMWKDCHPRTQAIFKAELTCSNGHSISLRGHSISLEGHVTPSVVCQASGCDFHDYVRL
FT                   AGWTAGAL"
FT   gene            complement(37697..38431)
FT                   /locus_tag="RPD_0030"
FT   CDS_pept        complement(37697..38431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37270"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F69"
FT                   /protein_id="ABE37270.1"
FT                   /translation="MPSVAAEDAPLVHWSGSAYRLIPSRFPPVSIYDGLIASDRQEELV
FT                   AVENLTNPRLRSLGRFQEAGSPGPCADPKLQNWNLAPFAYGNPDGSTFFGEERPCLELA
FT                   MEQQTALAVSVAKRQAFMEATNEAPIGLDMRMLCHPVDGIFWDLRDVPISWSELGQAKR
FT                   YELGAKMPIGAQGILFRPVERPTGTCLVVLTGDILQRSQQTVHFRFVWDGKKISQLYVF
FT                   NNEGTRIDADKLAGREDVLAAT"
FT   gene            complement(38412..38798)
FT                   /locus_tag="RPD_0031"
FT   CDS_pept        complement(38412..38798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37271"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F68"
FT                   /protein_id="ABE37271.1"
FT                   /translation="MPTRAPVPQGEAERSKIPAELEAFFEVAERWRLSAEEQIVLLGSP
FT                   GRSTFFKWKKEGATLPADTRERLSHILGIWKSLRILFTQDDRGEAWIRAKNRYFDGASA
FT                   IDVMLEGMVGLIRVRRYLDAQRGG"
FT   gene            38941..39660
FT                   /locus_tag="RPD_0032"
FT   CDS_pept        38941..39660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37272"
FT                   /db_xref="InterPro:IPR027802"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F67"
FT                   /protein_id="ABE37272.1"
FT                   /translation="MDGQVEILERRSRGMEYPVNGAMAAFPDNVVNGREVLTRSGLVPA
FT                   SEYRLILVRNGRTRLIGTDDDVDLDKEHGGSFRAFLSDRDFGFTVDEVGQVWGTADMEV
FT                   DEFLRIWPQHPEHRWVLERDDEPDTVLTPGGVLSFGPKGVEHVVSRKDAHPDKVMVTVV
FT                   TTAGVYPAEGAKRYPRSTRISDVLNDAARKLDIRDSSTWIVTVAGRDVSPTLTFAQANL
FT                   TGTVELEWGPREGGGGA"
FT   gene            39653..40090
FT                   /locus_tag="RPD_0033"
FT   CDS_pept        39653..40090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37273"
FT                   /db_xref="InterPro:IPR025873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F66"
FT                   /protein_id="ABE37273.1"
FT                   /translation="MLEALSKATFDRDIGRIDPRSVRMYDWAIVQANYPVFDVIFNHAQ
FT                   VAPLRLRLVCDDWDEIPPSIELLNKEGQPLATAPPNVGNVFNGSTHPNTGRPFVCMRGA
FT                   REYHTHGSHTSDLWDNYRGQSGMDLGGIVVQLWRAWKRSVG"
FT   gene            40087..40557
FT                   /locus_tag="RPD_0034"
FT   CDS_pept        40087..40557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37274"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F65"
FT                   /protein_id="ABE37274.1"
FT                   /translation="MSSIICTRSVLERTISIIRRDGNRGEERVALWLATAAQRSPAAIV
FT                   EVYEPEQVVEVDSFYIPPASMRALMNHLRSTRRRIAAQIHTHPGRAYHSDADAKWAIIR
FT                   HSGALSLVLPHFANATTVENFLEEVMTYEYSPAGEWIHCPNVGAGARVVVTA"
FT   gene            40554..41921
FT                   /locus_tag="RPD_0035"
FT   CDS_pept        40554..41921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0035"
FT                   /product="UBA/THIF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37275"
FT                   /db_xref="GOA:Q13F64"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR025221"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F64"
FT                   /protein_id="ABE37275.1"
FT                   /translation="MNKATQQNAMMLASLLGVGEAEAGERLARTVLITAAPGWKSGWAV
FT                   EVGELIGRTVQVSHQQEPTDPDLELVIGDVTPRTSARRVYADLGSEGAAASLEPVAKLA
FT                   GEPHGLYAAAAACAVSAVVVHAVIDAADLPQARLPMRLDYAQLGVPNGALDLRVDVGHA
FT                   VMAGAGAVAHAFLKAARHIDIHGDLAIVDPKVVQGGILNRCLYLEDNDVDRQKAEVLAE
FT                   RAQRDFPHLRLLPFVTDFKAYVRQLGHPPETVFVTVDSRLVRRSIQLEVPRRIIDASTT
FT                   DASGVIVHSNVLPTQHACLACIYRHVPEEHARERSIAEGLGVDLADVQAGLITAEVARR
FT                   IVRTHKSIDGDAIVGLAFDSLFRQLCSEQALATPEGRQVLAPFAFVSAWAGVMMAVEML
FT                   RSFAGAAKTNYWSVDPWNTPKARGRMLRQRHPECQFCSKPEYEPIIQSLWGELAEA"
FT   gene            42301..44961
FT                   /locus_tag="RPD_0036"
FT   CDS_pept        42301..44961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37276"
FT                   /db_xref="GOA:Q13F63"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F63"
FT                   /protein_id="ABE37276.1"
FT                   /translation="MRASRRTVVVHTVLAGRMERTAAARSNELGVQIVTMGQLAARLAG
FT                   GLLRPVDSEALQEAVFAALPVVDMGELEPIKLLPGMPGAVTATFDKAWRAGVDLSSAAH
FT                   PRLAALAALEQEVVGRLPASMKRPAELVAMAKERIAQASTVIGSLEIHGHSEMSPCWRP
FT                   LLEALANVVPLTWVAGPRHVPAWLEGTGVTVAKTDPTATATASYSCANQQHEVIEAFRW
FT                   VRKLLAEGVQAADIAIAATGPADYDDHMFAQVQESNLPVHFVSGVKALTTADGQAAAAL
FT                   AEVLAKGLSQERVRRLFALLRGSPALERIPREWTRLLPLGAPLTEMERWERVFARVEAS
FT                   DWPEGQDLSALVLEVLRLLDRGLAAATDVGEALLTGVPLSLWRRSLREGPPAALPVTLG
FT                   RLRTPDALEPAASVIWCSAIDLASSPRPHVWLLGMNAGRWPRRISEDRLIPNHVLPIEE
FT                   LDPLPIADGDKRDFGTILATATEVAMSHSRRDAGGRLRGRSPLIKSFAVTYLDRGRTPE
FT                   HAASEADRLLACPAEFAKLPVAVSGIGCWRDWFSGGLTAHDGLVAANHPRITKLFERSL
FT                   SATSLKLLLRDPIRFVWRYGFRWTAPEDADEPLTLDGLAFGNLVHAVLQNAVDGLSEAG
FT                   GLAAADRAAIDARIAAAIGGTVAAWEAEFPVPPAVIWRSAVERASTTATAALTYPMAAL
FT                   PDQRSWTEIPFGKPDEAEGERDLPWPTEKTVEIPGTGLLIDGKIDRLDLAGDRSKARVL
FT                   DYKTGKLDRKMAEKVIDGGRELQRCLYAFAVRTLVEAGVGVEAALFYPNAPEGEQAVFP
FT                   LTDAALEAALAKVTQAVSLSRDALLAGAAVPGEDAADKYNDLRFALPANAGYLPRKKLP
FT                   AIDRLGQAAAVWSET"
FT   gene            44958..48305
FT                   /locus_tag="RPD_0037"
FT   CDS_pept        44958..48305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0037"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37277"
FT                   /db_xref="GOA:Q13F62"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F62"
FT                   /protein_id="ABE37277.1"
FT                   /translation="MKPIPDLVARARALTAIENTLLVEAGAGSGKTSVMAGRVAVLFGK
FT                   GVEPKNIAAITFTELAASELRLRIEKFTTALSLGDVPPDLTQAFPEGVPEAEKANLYRA
FT                   CQSFDQLACTTIHGFAQSLIKPYPAEAGIDPGADIVDPDEAELAFGERYDAWLKQRLSV
FT                   DDADGLVAQLVLADEGGGLKLIEEVAQFLRKNRDARCAPAAWAEKTMADVIAAVKRFED
FT                   ALAAVGFEEEDTGLRCRTLIALVDILNPGKLSAGAPDTAALIAALNFPRHTSCFTEKGT
FT                   RRQLRNGTKWQDAAAKVGLKKADGKKTSDALVPLYDGCHNALETLLAAIAGELLSRLCA
FT                   EMQGLLLEWRDYKRDAALLDFDDLLFTARDLLAGHPEVRRALSQRYRYVLVDEFQDTDP
FT                   LQTEILWMICGEDCEGADGAPLKRPLRPGALFMVGDPKQAIYRFRGADVNAYLAARSAV
FT                   PQDARLAITANFRSVEPILAFVNKRFERVLSEEAGQPGFAELSPVRPPNGDAPAVVALD
FT                   VTLPQGASGVSAIRDAEAAALAELCCRLVGNLQVHDPETKELRPCRLGDIALLAPAGTE
FT                   LWRFEEVLEDRGIPVATQAGKGFFRRQEIHDLIALVRTLADPRDTLALGALLRGPLIGL
FT                   TENELLDIMEGLPVDPDRPARLPTLTVGTNPEHIAHAVARKAIENLQALRRRIRITTPY
FT                   ALLADAMSDFHVRPHLRQRFRTGAERAVANVDLFLEFARAYDVRGLRAFSRDMTAKWED
FT                   DEDQAEGRPDAEEESVSLITVHAAKGLEWPVVIPINMTGKPFAGGVLMQDRPNSRFSIP
FT                   VLGTEPSDYAAMKTMNALERDRERVRLWYVGVTRSRDLLVLPRHTELPKECWATLVDLD
FT                   VGALPAVDPESFGPAGTRAARIEANEQTREIFAAEAGRIFAAREKIVWRQPSRSEVDGE
FT                   GEKPDIRIDHSEPPGPAEVEKPVVVGSAQRGVILHKLMEEIINGEVGEHMSEIESRAAL
FT                   LKQHLGIEPTAEPQPVELAATVLKTLALPAIKALRPRMVAELPVFGSVAGADEEVLISG
FT                   QVDVVALDDAGEIDVVVDWKSDVDPSAAAVDHYRQQIGDYRRLTGAKKALLVFMTAGQV
FT                   VEILLRSR"
FT   gene            48319..49446
FT                   /locus_tag="RPD_0038"
FT   CDS_pept        48319..49446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37278"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F61"
FT                   /protein_id="ABE37278.1"
FT                   /translation="MLIYRFCFSAGGEQIAMARTKTLNSNGKKISKKNGPRYPTQVIDI
FT                   GFNFAGYPIFSATAAALLRKMHTQKVRPPQPDHISGMAPYSRIPFAETSFIIGHWFLET
FT                   ALNETAMFFVRRAYQQTKQFASETEAVKQIDDFFSLSVSSPVKKVEAYDKICGTQIAGK
FT                   ADLMEKIWTICAIRDLLYHHEANRYRGGKAPACVAKLFGYISDTPDQRSWIKAGWSPVL
FT                   GSKSAFDFVVQTVIDFTDTMSAELGHKHRFQTVDHLAKKPGIVSLCAEPGLVPPKETIK
FT                   SIQEKYTDPKTKAKVIAFDGTRRGTYYLFSKNKKYYVVHVTNRGRERTVPAWEILKIKN
FT                   ADRIGWIPIPWKGMDSELKRSVRERVSDIEIYRSA"
FT   gene            complement(49431..49802)
FT                   /locus_tag="RPD_0039"
FT   CDS_pept        complement(49431..49802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37279"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F60"
FT                   /protein_id="ABE37279.1"
FT                   /translation="MSSKKRIKPQRKDRDAAAGVQGLVQGSKQRARGDLRWRHRHQIRK
FT                   NGLLLNKIHHAAYDADLRVHISERLLSQQGDPLLAKAVAAMKGAKQRLPRRDKTNKIQI
FT                   GWRKGSSKNKQRCDRYAER"
FT   gene            complement(50548..51813)
FT                   /locus_tag="RPD_0040"
FT   CDS_pept        complement(50548..51813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0040"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37280"
FT                   /db_xref="GOA:Q13F59"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F59"
FT                   /protein_id="ABE37280.1"
FT                   /translation="MMPEVYVIGTACTPFGKRPQTSFKALTREAYLAALADAGMADGRD
FT                   IAMAWFGNCGMGTFGQRNIRGQVCLSPLVREGLFPERIPTMNVEGGCATASQALHGAWK
FT                   DIASGDAQLSLAIGVEKTFVPDDPARTQEIFDGGIDQLDPGEWLAYYRDAGEVSGKPFQ
FT                   PDDKRGTIFMDTYAMQAAYHMKRYGTTQRQIAIGAAKNHHHGSLNPLAQYRFTMTADEV
FT                   LADRPISYPLTRSMCAPIGDGAAAALVCSKDYLASLPRGVRERAVKIRASAMSGGKYRS
FT                   LDEPGLSRIAADRAYKMAGISPSDIDIAEVHDATSFCEIYQVEMLRFCAEGQGGAYVAS
FT                   GATALGGDRPVNLSGGLVSKGHPVGATGLSMIHELVLQLRGEAGERQAKNARLALAENG
FT                   GGVVGFDEAACAITILERLEPN"
FT   gene            complement(51851..53074)
FT                   /locus_tag="RPD_0041"
FT   CDS_pept        complement(51851..53074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0041"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37281"
FT                   /db_xref="GOA:Q13F58"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F58"
FT                   /protein_id="ABE37281.1"
FT                   /translation="MPNLDFADPKINADPFPVFAQLRESDPVHWSPVLKAWVITRYDDV
FT                   RRVAVSNADMSAERLAPFFATVPAESQSGFANLMTYLGKWMVFRDPPEHTRLRRLFTKA
FT                   FTSRSVMALEPNVGEIVALLFDEMEQKARSTGVVDWIADFAYPLPATVMMDLLGVPRDD
FT                   LHRVKDWSNDIALFIGTSRATADKYLRAEAGAKAMAEYFRGIIASRTVDPQDDIISQLV
FT                   TEPDKREALTDDEVIATCILLLFAGHETTTNLLGNGFYYTMNAPEQWARVKDDPSLAET
FT                   AVEEWLRYDGPSGALVRVVTADVEFGGRTMLQGQRVFAFINSANRDPEQFGDADRLDLG
FT                   RSPNPHLTFGHGIHFCLGAQLARLEGQIALRALIERFPGISLATDSAPGWRDSIILRGM
FT                   QSLPIRLR"
FT   gene            complement(53163..55085)
FT                   /locus_tag="RPD_0042"
FT   CDS_pept        complement(53163..55085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0042"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37282"
FT                   /db_xref="GOA:Q13F57"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F57"
FT                   /protein_id="ABE37282.1"
FT                   /translation="MGAWEVKGPAKGTCRSWRDAYPELAGMVARITAPRGRGIAWEGTE
FT                   IWAYRDRPSSISECLAANVARWPDREAYVFHPGGERLTWGEVGAQVDRVAAALRQEFGF
FT                   RKRDRLCLLTAGCPEYVIAYLAIVQLGGVAVPVNLGLTDEGLAAQINKVGAKGLVVSSE
FT                   VWSGKLDAVRGGLDSVEAVFVIGGAAPQGTLAFSELSSLRTTPVDHEAVDEWDLCAISF
FT                   TSGTTGVPKGTMAMHINALGCAQNVVIAAKGLGPDDVNLCMPPLYHNTAVYADFLPALL
FT                   SGGKCVIMSAFTPLEAIKLIEAERATWAVAAPIMLWMMMNHPEFRNHDCSTLKKILFGG
FT                   HASSETFINQLNREFAPIAMVNAGSVSESTAVGFALPTEDAIRKITSCGLATPNTDIAI
FT                   FDDAGNEVLEPNVIGEVAYRGQQTNAGYWEEPGKTAEVFRRDGFVLSGDWAKIDEDGYL
FT                   WLLDRKKDMVVRGGQNVYCIEVENKLYLHPKVLRAAVVGVPDHVFSERLKAIVVLKPGE
FT                   SATADEIREHCAKHLAKYETPEYVVFGASLPANAAGKTLKRPLVDFWGDSPGTPLARFS
FT                   AFCASLPPALFDTPHLKLDGRPMTPREALGELQQGSERGQHLARMIEQQGVCGLTTPDE
FT                   ARFRK"
FT   gene            55237..55872
FT                   /locus_tag="RPD_0043"
FT   CDS_pept        55237..55872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0043"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37283"
FT                   /db_xref="GOA:Q13F56"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F56"
FT                   /protein_id="ABE37283.1"
FT                   /translation="MIAKSRRTRTASQTRQAKPARENRAADKRPALSGDRRQALISEAA
FT                   RLFGNKGYENTSMRDIAAAVGILPGSLYHHFSSKEELFVAVYSFAVSQSVDAVTAAIEP
FT                   RSAPWIRLEAACIAHMQSLLDKSRFAAVLVSHLSVSGLPEQVVALRDSYEAVFKDLIAE
FT                   LPLPAGTDRRIFRLGLLGSMNWAITWYRPGGETPASIARKLLNAIRRD"
FT   gene            complement(56111..56848)
FT                   /locus_tag="RPD_0044"
FT   CDS_pept        complement(56111..56848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0044"
FT                   /product="pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37284"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F55"
FT                   /protein_id="ABE37284.1"
FT                   /translation="MKLEPGTTLDGADLSGFELSELDLSGATFNACTIADANVSGGCFE
FT                   GARFAKCRIIRCRFANADFRDAIFEECDFADDQGHLGVQFAFSRIEQARFHRCNLSFAK
FT                   FERSDLFGMEMETCNLRGAVFKKVDFARAFGGKVVKWAGAMKGCNLELADLSEIRMPDC
FT                   DLNNSRFREAVLFDADLQGADLRGCDFAQAFAAGAKLARADMRGANLSGINLVELGNFD
FT                   RLMVSADQMHPLLAALGVDVSSE"
FT   gene            complement(57042..57812)
FT                   /locus_tag="RPD_0045"
FT   CDS_pept        complement(57042..57812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0045"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37285"
FT                   /db_xref="GOA:Q13F54"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F54"
FT                   /protein_id="ABE37285.1"
FT                   /translation="MEHLTLSRPAPDLAVVQLRGAGRVNLMSYAMLEELWRVANDLQSD
FT                   RAVRVVIVTGSEQAFSAGMNLRQKEVSEFESYSIEERLQIHSIGARACKAWEDLHAVTI
FT                   GAIEGYCIGGGLAFASALDYRVASSMATLSAPELRHGMNMSWQSVPRLVALVGPAKARR
FT                   LIMLAEQVAAADALAWGLVDVVCDPGAALASAEAEAQRFLAMPAAPLRMTKQAINQAAG
FT                   ALNHAASYMDLEQYVLCQSTQAHRDSIDAFTGRS"
FT   gene            complement(57862..58605)
FT                   /locus_tag="RPD_0046"
FT   CDS_pept        complement(57862..58605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0046"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37286"
FT                   /db_xref="GOA:Q13F53"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F53"
FT                   /protein_id="ABE37286.1"
FT                   /translation="MRESMNQSSDPDQDIAQQPPAEAVEAAGEDLISSADRAYKIIEAR
FT                   IVQLKYPPGHALSEHQLSRELGISRTPVREAFRRLAVEQLVEILPRKGAFVTEIKINQY
FT                   LHLLDLRQQLETFMAVRAAKRATPQQRQAMATLAQELRDGIMEPEQAIFVFADRAYKDI
FT                   LVEASRNPFVGGIIAPMHALSRRFWYYYRDQWTEGEAEVAIKRHLALMDAVAIGDEAAT
FT                   HTAVQNLFSYLEGFARRIMDSEYKI"
FT   gene            complement(58602..60155)
FT                   /locus_tag="RPD_0047"
FT   CDS_pept        complement(58602..60155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0047"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37287"
FT                   /db_xref="GOA:Q13F52"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F52"
FT                   /protein_id="ABE37287.1"
FT                   /translation="MTDIAIYDWIASHAKSRPDRIALVDDFSGRSFSYAELDRRVGALA
FT                   AFMLDTLGIAVGDRVATLGHNSTNILEIQFACMRVGALFVPLNVRLAAPELIEVIRDCG
FT                   ARVVFHDCEFRAVVADIAAAVGATPVEMNESGQACAYEEAIAGHVPRGPRHGGTLGDTW
FT                   TLIYTSGTTGRPKGVLISYQMVLYHAVNYGFSTGLTPDSHGLTFLPMFHTSGLNLPANP
FT                   ALHAGATVTVMRRFDPPRALALMGRKESPVSHTFGVPANYLFMRLLPEFAEADLRGVRS
FT                   LGVGGAPMPIPLLQAYADKGVSMQQTFGMTETGPTVTILSAERGFDKLGSAGLPIVHVE
FT                   TLIADKDGAAVAPGDIGELCVRGPSITTGYWNRPEESRSAFRDGWFRTGDMARQDEDGY
FT                   FYIVDRSKNMYISGGENVYPAEVERVIEKLAGVVEVAVVAEADEKWGEVGRAYVVRDPS
FT                   VALTEDDIIRYCRAEIAGYKVPRYVSFIGALPHNATGKLDRLHLRKIADKESENACTPV
FT                   "
FT   gene            complement(60305..61537)
FT                   /locus_tag="RPD_0048"
FT   CDS_pept        complement(60305..61537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0048"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37288"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F51"
FT                   /protein_id="ABE37288.1"
FT                   /translation="MTTKMTRLLRNAALAGAALLATAAQAQDTIKVGALLPLSGNYGFL
FT                   GVTERLGIDMAVEEVNSAGGILGKKVVVVYEDAGTPAQTTRKATQMLEQDKVAFFVNGG
FT                   GSAVSATMFEFAQRNKVIDLAIDPNAEELVTTKAGKYAFLVPAPSSMIANAVIPEAIKL
FT                   GKTAMFLTHDYSFGHAQTGEQRRVLKDKGGVKEVGEIKIPLNTRDFSSQIIAIRNAKPE
FT                   MLIINVAGVDATALLEQIWEFELYKQTKIVVPLLDFEDSWAIGREKNQLIALAGIEWHY
FT                   NVPAADALAFKERYQKQFPKAEYPVPTTNTVNAYLGVRETLRAIQRAGSLDSAKIVAAL
FT                   ENHEVKDSLKPNPLVIRAKDHQWMQDFFVYKMKNPASSKELGDIYELITVAKGADIVVP
FT                   EAQRTTDLNAQ"
FT   gene            complement(61605..63122)
FT                   /locus_tag="RPD_0049"
FT   CDS_pept        complement(61605..63122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0049"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37289"
FT                   /db_xref="GOA:Q13F50"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F50"
FT                   /protein_id="ABE37289.1"
FT                   /translation="MTTKTTKKPEPSRDDWHERGLKVTPRNQLYIDGGWQPAASGGTFA
FT                   CISPIDGRTITDVAAGDAEDIDRAVKAARTAFESGVWSRQTPAQRKKVLLQFAKLVREH
FT                   RDELALLETLDVGKPIRFSRAVDIPQVEEAISWTAEAIDKLYDEVAPTGDKSLALVRRE
FT                   AVGVVGAVVPWNFPLLMAAWKFAPILATGNSLVLKPAEQSPLTALRVAELATEAGIPNG
FT                   VFNVVTGFGETAGKALGLHPDVDVLAFTGSTQVGKYFLGYSAQSNMKQVWLECGGKSPN
FT                   IIFDDVYDIDAAVKAAAMGIFFNQGQVCNAGSRLLVHKAVKAQFMEKLVAFTKRMTPAD
FT                   PMDPATILGSIVSVEQARRILDYIEIGAGEGARLVAGGKPVQPVEGGCFIEPTIFDGVG
FT                   AAMRIAQEEIFGPVLSVIEFESDDEAISIANDSMYGLAAAVWTRDLNRAHRMGQRLKAG
FT                   LVWVNCYDAGDMTVPFGGVKQSGFGRDRSLHALEKYTQLKTVWINLR"
FT   gene            complement(63145..63843)
FT                   /locus_tag="RPD_0050"
FT   CDS_pept        complement(63145..63843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0050"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37290"
FT                   /db_xref="GOA:Q13F49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F49"
FT                   /protein_id="ABE37290.1"
FT                   /translation="MLEVRDINTYYGNAHILFDLSLTIAAGECVALLGRNGAGKTTTLR
FT                   SIMGLSPPRKGAIEFRSAEIQGWVPYRIAQAGIGFVPEDRRIFPVLTVEENLKLGQKRG
FT                   TSETTWSLERVYQVFPKLKQIRDRAGGNLSGGEQQMLSIARALMGNPDLLLLDEPTEGL
FT                   APIVVEELVHAIARLKQDAMTVLLVEQNINVALALADRCYVLDHGAIVAEGSAEFIRNN
FT                   EKLRSDLLGI"
FT   gene            complement(63836..64612)
FT                   /locus_tag="RPD_0051"
FT   CDS_pept        complement(63836..64612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0051"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37291"
FT                   /db_xref="GOA:Q13F48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F48"
FT                   /protein_id="ABE37291.1"
FT                   /translation="MSGLRTENLSVQFGAVKPVDGVSVEIAAGKLTSIIGPNGAGKTSF
FT                   FNLLTGLYLPTRGKVYFDGNDVTDMPVHQKVRCGLTRTFQILNVFDALTVEENIRVAVQ
FT                   RRHGRSRKLFCAADVHGPVEDEVAEITERIRLPDKRKVRACDLSHGHRRHLEIGLSLAT
FT                   RPKTLLLDEPMSGLGMYESSIMGEFVRELAQSLTVVLVEHHMSVVLSISDTILVLSQGR
FT                   LLASGTPAEIQANPAVQEAYLGSGRYDLPQERAAHA"
FT   gene            complement(64609..65649)
FT                   /locus_tag="RPD_0052"
FT   CDS_pept        complement(64609..65649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0052"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37292"
FT                   /db_xref="GOA:Q13F47"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F47"
FT                   /protein_id="ABE37292.1"
FT                   /translation="MNALISNPTARRTPIRMFVGLLALFAVLPWLLTAIGLGVNLATEV
FT                   LIIALFAMSYNILLGTTGLASFGHAAFFGSGAYAVGILQRYGLNGIVISLAAAIAAGLV
FT                   ASLFVGLLVRKKRGIYFGLLTLSFGQMFYIVALRWDELTGGETGLTGLKRPAPFGLDLS
FT                   SHINFYYFTLAIFMVALWLIWRITNSPFGSLLTAIKSNEVRTQYLGYDTALYKLAAIVI
FT                   SGSFSGLAGGLYAWFQYAAYPQNLFWIESGNIVILTLLGGGLSSFFGPILGAAVFVGAQ
FT                   DLISGYTQHWMFFFGLIFIVVVTTFPNGLPEAFAKFVASARRRFGRTAGETVISAQSSS
FT                   RYGADQ"
FT   gene            complement(65655..66530)
FT                   /locus_tag="RPD_0053"
FT   CDS_pept        complement(65655..66530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0053"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37293"
FT                   /db_xref="GOA:Q13F46"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F46"
FT                   /protein_id="ABE37293.1"
FT                   /translation="MPSLAEVVSQLTNGVILGLILALVASGFTMVLSVMGVINFAHGLL
FT                   FALGAYLALSLHKVVGYWPALLIAPLVVGALGVMLEQTFIRRLYGKDPLFVLLLTFGIA
FT                   MAGEDVIQMIWGKLAYSISPPDLAKGSIDLGFMVYSKYRLFMGGFALVAIFSVWLFLAK
FT                   TPYGAMIRAGSHDSEMVGILGKNLPRIRALVFGLAAAMAALAGIIAAPLWSVRPQMGLD
FT                   ALLPAFLIVVIGGMGSFWGSVLAGLLVGVANSFAVMVVPRFSDLMMYVLAVVVLIYRPR
FT                   GLLGTRSVLE"
FT   gene            complement(66611..67423)
FT                   /locus_tag="RPD_0054"
FT   CDS_pept        complement(66611..67423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0054"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37294"
FT                   /db_xref="GOA:Q13F45"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F45"
FT                   /protein_id="ABE37294.1"
FT                   /translation="MSFSQLTYEVDGQVAVISLNRPERMNALTQVLENELRDAIEQADA
FT                   DSAVRAIVLTGKGKAFCAGMDMDELEVLPPDDIQRRDWMRPYDMNRRADYQTRYSYFPA
FT                   SNKPIISAINGAAAGLGLVMALYSDFRLASEKAVFATAFAKRGLIAEHGIAWILPRVVG
FT                   HANAIDLLLTSRKIDAAEAREMGLVGRVLPPDQLMPAAMALAAVLATEVSPRSVQVMKR
FT                   QLWEAPYQELGDAISDANREMFLSIQSDDFREGVAHFIERRPARFTGK"
FT   gene            complement(67486..67848)
FT                   /locus_tag="RPD_0055"
FT   CDS_pept        complement(67486..67848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37295"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F44"
FT                   /protein_id="ABE37295.1"
FT                   /translation="MRLAPSWIIRQSQLLASTERAAEQSVAPTFAECGHSPLEGWTPHS
FT                   ARQKMQLPVSSHPHRDIVLSAAAPGHIVDACEKSRPNQPRSRIDVVDICLQTTPSPASA
FT                   VSPHRSREPRKSLTSN"
FT   gene            68026..69015
FT                   /locus_tag="RPD_0056"
FT   CDS_pept        68026..69015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0056"
FT                   /product="Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37296"
FT                   /db_xref="GOA:Q13F43"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F43"
FT                   /protein_id="ABE37296.1"
FT                   /translation="MDFLLLEWLGKPAWMWLGFLAIVGLLLAFDLGVLHRKQKEIEVGE
FT                   SLALSAGYIALGTAFAGLVWWQLGETAGIQYLTGFVVEKSLALDNVFVIALIFGFFAVP
FT                   RKYQHRVLFWGILGVIVLRAIMIGIGATLVAEFAWVLYLFAAFLILTGIKMLVIGDKET
FT                   DLAKNPVLRFIRRRFRVTDALHGERFFVKLPDPKTGQLVRYMTPLCLALILIEIADVIF
FT                   AVDSVPAVFAITSDPYIVYTSNIFAILGLRALYFALAAVLHRFAYLKQALAVLLIFIGA
FT                   KIFVADLLGLEKFPAAWSLGATFAILAAGIAYSLWRTRNPAPHLKGET"
FT   gene            69012..69314
FT                   /locus_tag="RPD_0057"
FT   CDS_pept        69012..69314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37297"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F42"
FT                   /protein_id="ABE37297.1"
FT                   /translation="MMPLLLCPNDNGSMQTVQRSGVEFDICPTCRGVWLDRGELEKLLA
FT                   VSRSDDSGDAQAHAQPVRDAFNARPAPRSEGRREWDDDDDYGRKRRRSSIFDIFD"
FT   gene            69369..69836
FT                   /locus_tag="RPD_0058"
FT   CDS_pept        69369..69836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0058"
FT                   /product="Tellurite resistance protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37298"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F41"
FT                   /protein_id="ABE37298.1"
FT                   /translation="MPNRRSPGRPSERLLEDFGDEVQQAQNEHLMEGIVAGCALVAYAD
FT                   GWVTPEEHDRMLSLIRGFEPITAFGLDEVTATFEALTKRFATDQRDGEAAAFAAVARVK
FT                   GAARYPALLVGVCCAIAAADGGFDAEERKAALRICEVLGLDPTEFDLADAP"
FT   gene            70113..70730
FT                   /locus_tag="RPD_0059"
FT   CDS_pept        70113..70730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37299"
FT                   /db_xref="GOA:Q13F40"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F40"
FT                   /protein_id="ABE37299.1"
FT                   /translation="MRDLDKALADIIAIRSQIAAGTAFRGYGPTALAATAGLALITAVL
FT                   QSLWLDEPDSHPLSFFSGWAATACLSGAIIWIEMRARSHRHHSGLADAMIHQAIEQFLP
FT                   AGVAGALLALTLWKFAPETLWMLPGLWQILVSLGIFASVRSLPRSVAFVGAWYFVAGFA
FT                   VLALASANHALSPWTMGLPFMVGQLLMAAFVHFASGEIDAEG"
FT   gene            70717..71097
FT                   /locus_tag="RPD_0060"
FT   CDS_pept        70717..71097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0060"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37300"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F39"
FT                   /protein_id="ABE37300.1"
FT                   /translation="MPKAEANNAPFSYDGLDRVIHEKARLGLLASLMAHPKGLAFADLK
FT                   KLCGLTDGNLSRHLQVLQEAGLVDVIKGYEGNRPHTFCRLTKTGRRRFLDYLAVLEQLV
FT                   RDAAKAAGQDDAAPTRLGILPA"
FT   gene            71131..71868
FT                   /locus_tag="RPD_0061"
FT   CDS_pept        71131..71868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0061"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37301"
FT                   /db_xref="GOA:Q13F38"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F38"
FT                   /protein_id="ABE37301.1"
FT                   /translation="MQRTLLSKQNAAKLHVGIIMDGNGRWATRRGLSRLRGHEAGVEAI
FT                   RRVVEAAPRQGVGTLTLFAFSSDNWRRPKAEVAALMGLLRIYLANEVKSLVRNGVRLTV
FT                   IGRRDRLPDGIAAAIAAAEVDTTGGETLNLRIAVDYSARDAILNAAAHAREIGNCSRET
FT                   FSDLVTGDPRLRDVDLIIRTSGEKRLSDFLLWESAYAELHFTERMWPDFDEDDLADALA
FT                   SFHRRERRFGGLQPIDPNLALSV"
FT   gene            71985..73535
FT                   /locus_tag="RPD_0062"
FT   CDS_pept        71985..73535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0062"
FT                   /product="Magnesium-protoporphyrin IX monomethyl ester
FT                   anaerobic oxidative cyclase"
FT                   /EC_number="1.14.13.81"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37302"
FT                   /db_xref="GOA:Q13F37"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F37"
FT                   /protein_id="ABE37302.1"
FT                   /translation="MRILLINVPHPSIGSRIPDDHLPPLGLLAIGGPLIDDGHDVRLID
FT                   GEFGPMSTSAIVEQAVAFLPDAVLFGHSGSTSGHPVIAEVAHDLANAIPGVHIVYGGVF
FT                   PTYHWRDIMADEPYVTAIVRGEGEETALRLMAALARGESLGDVPGIAYREADETRATKP
FT                   ATVIRDLDAYRIGWELIDHKRYSYWGGLRAVVVQFSRGCPHLCSYCGQRGFWTQWRHRD
FT                   PVLFAKELARLHREQGVKVINFADENPTVSKKIWRTFLEALIAEDVDLILVGSTRADDI
FT                   VRDADILPLYKKAGWVRFLLGLESTDEKTLELIRKDAATTTDREAIRLMRQHGILSMAT
FT                   WVVGFEEETDRDHWRGLRQLLSYDPDQIQLLYVTPHRWTPYFNSVAGRRVIQTDRRRWD
FT                   YKHQVLATRNMPPWRVLLWVKWTELVLQGRPKAIWRVLFHRDVRLREAMRWYTRMGRRV
FT                   WPYEIINFLLDRRLKNGPTVTQFWGASQDSEEQSMSSAGRGRPTGVKSRLRKTRTVIE"
FT   gene            73673..74686
FT                   /locus_tag="RPD_0063"
FT   CDS_pept        73673..74686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37303"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F36"
FT                   /protein_id="ABE37303.1"
FT                   /translation="MASRHFLKGLIKLSTREPWSDRFEQILEDHLILACDETGLEIDDV
FT                   VSTIGEDLFMSTVWACAFEDFLTREFDDGENAIDDYLKRRGWKESAAVVTYMAALRNST
FT                   MSLYEVSDLVPGASFRARDLIRGGEPVLISERSALQVYPGFHSTGATSWSWVAEGKPAP
FT                   ARSGAGESSTKSLTFESWLDDGALVLGDIRLEDQSLVLRVNSRQRSDRGCALLSEVLGP
FT                   RVGAPSVKMESVEQMMASRGVAAPDQLDIPEQEQCAIIHRSMDRHYRDVLDQPVAMLGG
FT                   KTPRAAVKTKSGRTKVVDWLKMIENQSAKSADPSSPMANYDFGWLWAELGISELRR"
FT   gene            complement(75240..76196)
FT                   /locus_tag="RPD_0064"
FT   CDS_pept        complement(75240..76196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0064"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37304"
FT                   /db_xref="GOA:Q13F35"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F35"
FT                   /protein_id="ABE37304.1"
FT                   /translation="MRRRFDSNWRTALAEPKRVSAVDRASEQVGRPPRSAIRSWSQRKI
FT                   EVGYWSIDWPGVVQREMSLSTKAFCELSMVLTPVDDMTLLCGETTIRTGPLQSGRFRVA
FT                   PANTTLSASVSASSTVKFLKVFFAEETARAIGSAIHSHSIDIEMEDPMLGTDDPFLVSL
FT                   GREVVENINDPRPTSRAFAEEAAILMAGRVVSHYSTARYCTSMAVRSRGLDPDLDRALQ
FT                   LMRDHICGTIDLGMLATSVDMPAFSFVRAFQKKYGLSPIRYHRHMRMEQAKTLLSTTAF
FT                   PIGKISNMLGFSESSHFVSAFRKATGRTPLAYRRTRS"
FT   gene            76970..79036
FT                   /locus_tag="RPD_0065"
FT   CDS_pept        76970..79036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0065"
FT                   /product="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37305"
FT                   /db_xref="GOA:Q13F34"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F34"
FT                   /protein_id="ABE37305.1"
FT                   /translation="MTIKTTRSSEPRTSGLLDLFTNRKIGTKVAVGFVLIQVLMVVLAV
FT                   LNYFSFENVRQAFVALDQRVQVVGIVRDVDRGFTAFRRFVREYSLTGDEALIHEAESRQ
FT                   NALRESIAQGLKEIHDPSRLAKMREISQTFEAYTTSFADVIRMRREQSTLIREVLDPTG
FT                   QKARLKLEQLQAATTAEVGGETTSLLVAEAVKQLLLLRIDVNKVLGRHDQAAADAAEKA
FT                   LVDLRGAMSALKIAIGSSAGRKQIGEIEVDIKNYADAYQKASRVAHEVEVLVNGAMPKV
FT                   ATVIADGAASIKQSGIADQQMIAKNTEALLDDTKSQILIITVGAVAIGLVLAWLIGRAI
FT                   SRPIIRMSGAMKELAGGNLRVDVPGSGRLDEIGLMACTVEVFKRNALEVERLKTEQEEA
FT                   ESRVAAEHKAEMHRLADNFEGAVGEIIQTVTSASTELEASAGSLTTTADRSQQLATTVA
FT                   AASEQASANVQSVASATEEMASSISEISRQVQTSARIAGEAVDQARKTNDRIGQLADAA
FT                   NRIGDVVDLINTIAGQTNLLALNATIEAARAGDAGRGFAVVAQEVKALAEQTAKATGEI
FT                   SQQVSGMQAATQDSVGAIREIGGTIERMSEIASTIASAVEEQGAATQEISRNVQQAAQG
FT                   TQQVSSNICDVQRGATETGSASTQVLAAVQSLSRDSNRLKDEVTRFVETVRAA"
FT   gene            79164..81395
FT                   /locus_tag="RPD_0066"
FT   CDS_pept        79164..81395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0066"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37306"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F33"
FT                   /protein_id="ABE37306.1"
FT                   /translation="MISAPLPDNEQARLAALRRYDILDTPPEDCFDIFPRLVVRAIGVP
FT                   SAVISFVDRERQWFKARINVGDQQTPRDIAFCAHAILLERPLVVADATIDPRFHDNPLV
FT                   TAPGGMRFYAGAPIRTADGFPIGVLCAIDKVPRLLGKAQLETLRELASLVADQLELRLA
FT                   NRRLARELAERERTENHLLSMSRTLELSNLRLDAALNNFLHGLCMFDGDRKVVVSNARF
FT                   SEIYSLEPDEIECGVPLSAIQSVCRERGTFVETWSERRLGRSSHEISEVSSLLDGRAIL
FT                   VRCQPVAGGGWMTVHEDITERYRSEQQIAHMARHDLLTGLLNRGAFHERMDEACARLRR
FT                   WGETFSVIMLDLDRFKLVNDSLGHPAGDALLRAVVSRLKACIRETDVLARLGGDEFAVL
FT                   QTRTKDSYEEAVAFADRIVNCLIDPIEIEGHQLVISTSAGIALAPQHGTDSDELIKNAD
FT                   LALYQAKAAGRNGYVTFETAMKDRANARQQLEGELRQAILHREFDLYYQPQVDARSGRV
FT                   IGAEALLRWRHPRRGFVPPSEFIPIAEETGLIEKLGEWVLTEATTEAIRWPAPIKLAIN
FT                   LSPIQLTRGKLVDTVTQALRFSGLPPGRLEVEITETVFLEDEVNNLAVIRQLRALGVSV
FT                   ALDDFGTGYSSLSYLTRFPFDQIKIDKFFSMNLIDRRDCAAIVSSVITLARGLGISTVA
FT                   EGVETVRQFELLREAGVDYFQGYLFGHPVPASALDFGTAQAVARITEVA"
FT   gene            complement(81952..82028)
FT                   /locus_tag="RPD_R0001"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(81952..82028)
FT                   /locus_tag="RPD_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(82163..83650)
FT                   /locus_tag="RPD_0067"
FT   CDS_pept        complement(82163..83650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0067"
FT                   /product="ATP-binding region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37307"
FT                   /db_xref="GOA:Q13F32"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F32"
FT                   /protein_id="ABE37307.1"
FT                   /translation="MQAADRQPETRVWRRGLEPKIGLSGKLLLLTIPLILIAEILIYVP
FT                   SIANFRLNRLNDRLAAASTAALVLDASASGTVPDTLARQVLDSIDARAVAIKMGQQRRL
FT                   LASSNVPTTIDYVVDMRNVTPWGAIIDAFVVMLESGNQTIRVMGPTEGNAQFIEVVIDE
FT                   APLRIAMYRFSSNLLLVSLTITSLTTALIYLALHFLFVRPMRRLTANMVNFRRDPESPA
FT                   SIVVPGPRGDEIGLAERELSDMQRDLVSMLHQKSRLAALGLAVSKINHDLRNLLASSQL
FT                   LSDQLSSVPDPRVQRFAPKLVRSLERAIAFCQSTLSYGRAQEAAPDRRVILIEPVVNEV
FT                   RETAGLASDTGVSSITWVSAIERGLTMDADPDQLFRVLLNLVRNAAQALEGQPRNEVAL
FT                   QQIRITGRREGSVTILEVSDTGPGVPQKARDHLFEAFHGSARAGGSGLGLAIAAELVRA
FT                   HGGDIKLVEGTLGATFRLSIPDRPVDLYSLRNERARA"
FT   gene            83786..84514
FT                   /locus_tag="RPD_0068"
FT   CDS_pept        83786..84514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0068"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37308"
FT                   /db_xref="GOA:Q13F31"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F31"
FT                   /protein_id="ABE37308.1"
FT                   /translation="MPNAGLARIGGPIRQKRRRAQLTRPGRSRISRANCPRWPGSTGAV
FT                   HFLGCLRLICEPHHRAYLNLLNNLPGLRRTTREADLSTEQIGAQAPSRLSCPSCHRWWP
FT                   KGAGGAPRPRTQASERLSGPSRDQIMDRLRQRADFIAVAGGLRISGPAFVLQGRRRDDE
FT                   GPVRVGFTVTKKIGTATERNRIRRRMRELVKRADRSFMLPNSDYVLVGRRAALSRDFAV
FT                   MLGDLRSALDRIARRSSKPD"
FT   gene            84531..86396
FT                   /locus_tag="RPD_0069"
FT   CDS_pept        84531..86396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0069"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37309"
FT                   /db_xref="GOA:Q13F30"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F30"
FT                   /protein_id="ABE37309.1"
FT                   /translation="MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAQQAQQQQEA
FT                   AKQQTPPAATTPGAPNAPAAPGAPGAPANQPAANAPVVSRDAAIAASPRIKVETPRLDG
FT                   TLSLKGARIDDLSLSQYHETVDPKSAPIHLFSPSGSANPYYAEFGWVGAAGSNVKLPDQ
FT                   NTLWEQEGSGALTPANPVTLKWDNGEGLTFRRQIAVDDRYLFTIKDDVTNVGGGPVTLY
FT                   PFALISRHGTPHVEGFYILHEGLIGYLGEQGLQEYGYAKIDEAKTVGFKATNAWMGITD
FT                   KYWASALLPDTNAQLQARFSSNQVGATRTYQTDYLEDAKTVPIGGTATATARLFAGAKE
FT                   ARVVGINFPFAGLGGYNQQLGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAI
FT                   LLVTVLVKLIFLPLANKSYASMAKMKAIQPQLLALKERHPDDKAKQQQEMMEIYRKEKI
FT                   NPVAGCLPVLLQIPVFFSLYKVLFVTIEMRHAPFFGWIHDLSAADPTNLFNLFGLIPYD
FT                   PSTLPVIGSYLVLGVWPLVMGFTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPA
FT                   GLVIYWAWNNTLSVIQQAYIMRRNGVKVELWDNLKSAVVKPKKTA"
FT   gene            86689..87342
FT                   /locus_tag="RPD_0070"
FT   CDS_pept        86689..87342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0070"
FT                   /product="GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37310"
FT                   /db_xref="GOA:Q13F29"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F29"
FT                   /protein_id="ABE37310.1"
FT                   /translation="MTDAINPTLIERGRKVFAGDWHFIWASPSIETLPPMAGIEVAFAG
FT                   RSNVGKSSLINALTGRNALARTSNTPGRTQELIFFDGPTDAGLRLVDMPGYGYAAASKA
FT                   KVASWTSLIHKFLQGRATLARVYVLIDGRHGLKDVDLDILKTLDKSAVSYQIVFTKADQ
FT                   VKAAELEQRIAATKTVLAKHPAAFPELLMTSSRTGAGMPELRAAMIRLLDERGA"
FT   gene            87339..87707
FT                   /locus_tag="RPD_0071"
FT   CDS_pept        87339..87707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0071"
FT                   /product="protein of unknown function DUF423"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37311"
FT                   /db_xref="GOA:Q13F28"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F28"
FT                   /protein_id="ABE37311.1"
FT                   /translation="MTPLLRVLIVCAGIAGAAGVALAAAAAHVPDASRLGPASSMLLFH
FT                   ASAILAAVLLCERGGVHRIPGLAAGCGFVIGAALFAGDLSLRQFSGHALFPMAAPTGGV
FT                   LLIGSWLLLAVAGLWPRR"
FT   gene            87857..88816
FT                   /locus_tag="RPD_0072"
FT   CDS_pept        87857..88816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0072"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37312"
FT                   /db_xref="GOA:Q13F27"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F27"
FT                   /protein_id="ABE37312.1"
FT                   /translation="MLAVLPANRSENPTTQRKTRFMTDAPVISPIDQARILSEALPHMQ
FT                   RYDEETIVIKYGGHAMGAENDAKAFARDIVLLEQTAVNPVVVHGGGPQIATMLKRLGIK
FT                   SEFAAGLRITDGATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTASKATR
FT                   TMVDPDSRIEEVVDLGFVGEPEKVDLTLLNQLIGHELIPVLAPLATSATGQTFNVNADT
FT                   FAGAVAGALKAKRLLLLTDVPGVLDKSKQLIPELSIKDARKLIADGTISGGMIPKVETC
FT                   IYALEQGVEGVVILDGKVPHAVLLELFTNQGTGTLIHK"
FT   gene            88816..89970
FT                   /locus_tag="RPD_0073"
FT   CDS_pept        88816..89970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0073"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37313"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F26"
FT                   /protein_id="ABE37313.1"
FT                   /translation="MTGAKATSSCPGRGAARSAAPQTRDPGSAEPHKPGPRIISAPRRE
FT                   GRRAALHPGHACLFVATLLASLAGNTAAHADLKLCNRMSYVIETAIGIDDKATTATRGW
FT                   LRIDPAQCRVVLQGALSADRVMLHARALAVYGASPIPQNGTDRLCITPENFVIAAARQC
FT                   RSGQTLAPFTEIKPTQQDDGNMVAYLAEDSEYDDEQARLAAIQRLLVIAGYDAAPIDGV
FT                   DGPKTQAALAAFLKSRGLKPDIVSAPDFFDTMIKAVESPSATGLTWCNDTRSRIMAAIA
FT                   EDDGKTITSRGWYRIEPGKCLRPDLSALPKRVFSFAEAVDGNARPITLKDKPLNWGGAT
FT                   LLCTRESKFEISEQGDCSARGLNATGFAPVDLSGGGKTVRFATP"
FT   gene            89967..90668
FT                   /locus_tag="RPD_0074"
FT   CDS_pept        89967..90668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0074"
FT                   /product="Pyrimidine 5-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37314"
FT                   /db_xref="GOA:Q13F25"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F25"
FT                   /protein_id="ABE37314.1"
FT                   /translation="MTELSKRGFGHVDTWVFDLDNTLYPHHVNLWQQVDGRIRDFVADW
FT                   LKVTPEEAFRIQKDYYKRYGTTMRGMMSEHGVSADDYLAYVHAIDHSPLEPNPAMGAAI
FT                   AQLPGRKLILTNGSTDHAGKVLERLGIGHHFEAVFDIVAAELEPKPAAQTYHRFLTLHG
FT                   VDPARAAMFEDLARNLAVPHQLGMTTVLVVPDGSKDVVREDWELEGRDAAHVDYVTEDL
FT                   TGFLAGLNEAV"
FT   gene            90762..91607
FT                   /locus_tag="RPD_0075"
FT   CDS_pept        90762..91607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0075"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37315"
FT                   /db_xref="GOA:Q13F24"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F24"
FT                   /protein_id="ABE37315.1"
FT                   /translation="MSLSALENTINTAFDARDTISAATKGEVRDAVDQALDLLDRGEAR
FT                   VAERDASGTWTVNQWLKKAVLLSFRLNDMHTIAGGPGGATWWDKVPSKFEGWGESRFRE
FT                   AGFRAVPGAIVRRSAFIAKNAVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKRVHIS
FT                   GGVGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRRGAVLAMGVFLGASTKIVDRE
FT                   TGEVFIGEVPEYAVLVPGALPGKPLKNGTPGPSTACAVIVKRVDERTRSKTSINELLRD
FT                   "
FT   gene            91810..92097
FT                   /locus_tag="RPD_0076"
FT   CDS_pept        91810..92097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37316"
FT                   /db_xref="GOA:Q13F23"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F23"
FT                   /protein_id="ABE37316.1"
FT                   /translation="MELLMAEFRRIIIKTAEVMMVLLVIITILATAGLGAISGSETSGA
FT                   LAVAGFVLGGVGGLIVSSIFASSFFLILEIAENTRQVLRYYEPKVDGASR"
FT   gene            92115..93281
FT                   /locus_tag="RPD_0077"
FT   CDS_pept        92115..93281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0077"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37317"
FT                   /db_xref="GOA:Q13F22"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F22"
FT                   /protein_id="ABE37317.1"
FT                   /translation="MTSSRDALSIAQALLRCPSVTPADAGALGVLETLLKDAGFTAHRV
FT                   TFSEPGAADIDNLYARIGDGAPHLCFAGHTDVVPPGDADAWSHGAFSGDVEGGLLYGRG
FT                   AVDMKGGIACAVAAVLDHLAAHGGRPKGSISFLITGDEEDVAVNGTVKLLQWAADRGET
FT                   FDHCIVGEPSNVEAIGDTIKIGRRGSQSGMLIVDGLQGHVAYPHRASNPIPDIAALITA
FT                   LNDEPLDQGSAQFQPSNLEFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQDSLKALIE
FT                   QRLAAACGNRIRARIEWLPSNADVFVTKPGNFTDLVTASIADVTGRTPDLNTGGGTSDA
FT                   RFIAKYCPVVEFGLVGQTMHQIDERTPVADLDQLTAIYRGVLERYFKS"
FT   gene            complement(93536..94498)
FT                   /locus_tag="RPD_0078"
FT   CDS_pept        complement(93536..94498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0078"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37318"
FT                   /db_xref="GOA:Q12ZW2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q12ZW2"
FT                   /protein_id="ABE37318.1"
FT                   /translation="MAQDSFIEALLPAGFGRNERLERISGLIDWDRLAVLIRKVRPGET
FT                   GRPPYAPLAMFKALLLQQWYGLSDPGLEEALLDRVSFRRFCGFALDAQTPDETTLCRFR
FT                   NALQQAGLGDALFQEVLRQLEAAGYVLKTGTLIDATLVQSSGRTPPSGSTPREVESRSS
FT                   HDPQADWTRHGAGRRLFFGYKAHIAIDQGSGLIRARKLTGAKTYESEVADDLVLGDEKA
FT                   VYADKAYEKRARRQALKARGIKDRIQHRRNKHQKALPRWQAVRNKLIGRVRQAIERTFA
FT                   QLKGRYGFTRMRYAGITANAFHLDLISIAYNLRTAAAIR"
FT   gene            complement(94698..95435)
FT                   /locus_tag="RPD_0079"
FT   CDS_pept        complement(94698..95435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0079"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37319"
FT                   /db_xref="GOA:Q13F20"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F20"
FT                   /protein_id="ABE37319.1"
FT                   /translation="MPRYKLTIEYDGAPFCGWQLQPVLPSVQGALEAAALATCGEAVRV
FT                   HGAGRTDAGVHALGQVAHLDIAKPFRADRLRDALNAHVRPYPVAVLSTEIVPDSFEARF
FT                   SAIRRHYRYRIVNRRSNLALEIGKVWRVPKPLDTDAMHRAAQVLIGKHDFTTFRDTECQ
FT                   AASPEKTLDVLDVVRSGDCVDIITSARSYLHSQVRSMVGSLVWVGEGRWSADDLAAALA
FT                   ARRRSACGPVAPPDGLYLVKVDY"
FT   gene            complement(95609..96541)
FT                   /locus_tag="RPD_0080"
FT   CDS_pept        complement(95609..96541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0080"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37320"
FT                   /db_xref="GOA:Q13F19"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F19"
FT                   /protein_id="ABE37320.1"
FT                   /translation="MPLRLVFMGTPDFAVPTLLALSAYGHDIAAVYSREPKPAGRGMKL
FT                   QHSPVAQEAQRFGIPVLTPKTLKTDEALAEFRSHDADAAVVVAYGMILPQAILDAPRLG
FT                   CYNLHGSLLPRWRGAAPLNRAIMAGDAESGVMVMKMDAGLDTGDVAMAERIAITDAMTV
FT                   TDLHDSLARLGADLMVRAMAALERDQLQLTRQSEHGVTYAAKIDKAEAKIDFARPAQAV
FT                   LRHIHGLSPFPGAWCELPIDGEAVRVKILRCASATGGGAPGQVLDDRLTIACQDGAIRV
FT                   LQLQRAGKQPMQADEFLRGTPIAAGAVIV"
FT   gene            complement(96621..97148)
FT                   /locus_tag="RPD_0081"
FT   CDS_pept        complement(96621..97148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0081"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37321"
FT                   /db_xref="GOA:Q13F18"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F18"
FT                   /protein_id="ABE37321.1"
FT                   /translation="MALREIIILPDKRLREISKPVAEVTPEIRKLADDMFESMYDAPGI
FT                   GLAAIQIAEPVRLITMDIVRKEGNGKSDPRAFINPEIVGASAEMNVYEEGCLSIPEYYA
FT                   DVERPAVVRIRYTDLDGNVKEEDADGLFATCIQHEIDHLDGVLFVDHLSKLKRAMVVRK
FT                   FEKAAKRGIKYV"
FT   gene            97298..98515
FT                   /locus_tag="RPD_0082"
FT   CDS_pept        97298..98515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0082"
FT                   /product="protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37322"
FT                   /db_xref="GOA:Q13F17"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F17"
FT                   /protein_id="ABE37322.1"
FT                   /translation="MNETLFYLGDAPVSIGAALFGASAMALLLLLAIVLVIAHGLQSGS
FT                   AAALAQARRASDLEQRLSGLIRFQSEANGRVDAMGRALAGRQAEMARAVSERLDTVTHR
FT                   VGQSMTQSTRHTMESLQALHERLGIIDRAHDNLTELTDQVTSLRDVLANKQARGAFGQA
FT                   RMESIVQDGMPKGAYAFQYTLSTGKRPDCVVFLPDQRPLCIDAKFPLEAVTALRESRSD
FT                   GEKKAASQRLRLDVMRHVDDIAAKYLIPGETQDTALMFVPSESVYAEIHDGFDDVIQRA
FT                   YRARIVLVSPSLLMLAIQVMQQILKDARMRDAADQIRTEVLSLGDDLARLRERVTKLQT
FT                   HFGQVNDDVRQILISADKIERRAVRIEELDFSAVEPSTGTQAPLAPEARDLFASRAFKI
FT                   DEVASD"
FT   gene            98724..100097
FT                   /locus_tag="RPD_0083"
FT   CDS_pept        98724..100097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0083"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37323"
FT                   /db_xref="GOA:Q13F16"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F16"
FT                   /protein_id="ABE37323.1"
FT                   /translation="MTAPDASSNPEPLPPVAPASTWREAMTVYLQPRVLIVLFLGFSSG
FT                   LPLALSGSTLLVWMRESGVDLGTIGLFALVGTPYTLKFIWAPLVDALHVPLLSRLFGRR
FT                   RGWLVISQLLLIGAILLLALTDPAHAPLFVAIGALLVAAASATQDIVVDAFRVESLPEN
FT                   EQAAGMASYVAAYRIGMLISTAGVLFLVSAYEGIGLARSTAWMWGYVTMAGMVLIGTVT
FT                   ALLATEPEQSRRAEAATSGESAFTRVTRAAIGAFSEFLGRTDALAVLAFVVLFKFTDAF
FT                   SGTMTAPFVIDLGFSRNDYAAIVKGVGLAATLVGGFAGGYLARRYTLTTSLWIGAVLQA
FT                   LSNLAFAWLATVGVNQWALALAISVENFTGAIGTVIFVAYLSALCQNPLHTATQYALLT
FT                   ALSAVGRTYLSAGAGYVAQATGWPAFFMISVAVAAPSLVLLIWLQRRDHFAALGPVKV"
FT   gene            complement(100126..100554)
FT                   /locus_tag="RPD_0084"
FT   CDS_pept        complement(100126..100554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37324"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F15"
FT                   /protein_id="ABE37324.1"
FT                   /translation="MTDLILKPSMIFAAVLSLSAAPAYAQGTESRAALPKPMAMQVGDV
FT                   LNGELTAMRSRANGKGKKIPVYQLTSEPRRLPPPAGLCNLENGPETFQIVPAGDAQAAQ
FT                   LKSHLGKQIALKVEAVACAEEAGQYSEAVVTKWSMVAK"
FT   gene            complement(100574..101179)
FT                   /locus_tag="RPD_0085"
FT   CDS_pept        complement(100574..101179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0085"
FT                   /product="DNA replication and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37325"
FT                   /db_xref="GOA:Q13F14"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F14"
FT                   /protein_id="ABE37325.1"
FT                   /translation="MATAVAGPEIERLIQLLARLPGLGPRSARRAALHLIKKRDALMTP
FT                   LASALQVAIDKIEVCKSCGNIDTRNPCTVCTDPRRDPSIIVVVADVADLWALERASATN
FT                   GRYHVLGATLSPLDGVGPDDLTIDALVARAHDPAVSEIILALNATVDGQTTAHYVTDLL
FT                   QEAGVKVTRLAHGVPVGGELDYLDEGTLSAAMRQRTLF"
FT   gene            complement(101293..101613)
FT                   /locus_tag="RPD_0086"
FT   CDS_pept        complement(101293..101613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0086"
FT                   /product="conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37326"
FT                   /db_xref="GOA:Q13F13"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F13"
FT                   /protein_id="ABE37326.1"
FT                   /translation="MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGSSGGGLVQVRMSA
FT                   KMEVRGVSIDPSLLKPDEGGVLEDLLVAAHADAHRKAEAAMQEKMQALTGGLGLPPGLG
FT                   LG"
FT   gene            complement(101648..103522)
FT                   /locus_tag="RPD_0087"
FT   CDS_pept        complement(101648..103522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0087"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37327"
FT                   /db_xref="GOA:Q13F12"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F12"
FT                   /protein_id="ABE37327.1"
FT                   /translation="MTDSGPPAIPSGDSEQTGLGLGAAPAGAYRVLARKYRPNSFEDLI
FT                   GQEAVVRTVSNAFDTGRIPQAWILTGVRGVGKTTTARILARALNYEMPDGSVKGPTIHM
FT                   PVHGVHCKAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML
FT                   STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMKHLAGI
FT                   AAKEGVEVEPEALGIIARAAEGSVRDSLSLFDQAIAHAAGLVRADQVRQMLGLADRTRV
FT                   IELFDALARGDIASAFQEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPATADNVAFG
FT                   ETERLRGRDFAAKLSMRVLSRMWQMLLKGIAEVQGATRPAAAAEMVLVRIAYAADLPTP
FT                   DEALRMLAQDGGSATPLPSGGGAAPRGASSPPVSAASVASAYAAPAAAAMPPRSAPTMA
FT                   RGGADSMARPQISAPAAAPQQDAALKITTFPQLVALASEKRDVMTRMALEADVRLVRID
FT                   DGRLELALERTASRSLINDLGRKLEQWTGRRWTVIVSNEPGQPTLRSQSEAQKNERERA
FT                   AESDPRVREVLAKFPGAKFEVRRLATDLAEADAGIEDPAEPVDDDDES"
FT   gene            complement(103759..103861)
FT                   /gene="ffs"
FT                   /locus_tag="RPD_R0002"
FT   misc_RNA        complement(103759..103861)
FT                   /gene="ffs"
FT                   /locus_tag="RPD_R0002"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            103996..104481
FT                   /locus_tag="RPD_0088"
FT   CDS_pept        103996..104481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0088"
FT                   /product="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37328"
FT                   /db_xref="GOA:Q13F11"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F11"
FT                   /protein_id="ABE37328.1"
FT                   /translation="MDVSGSVPATTQEPACQRADGIDMPSDWSLSSQLEKDTINIGDLP
FT                   LSRVLVIKDAHYPWLLLVPRRADAVEIIDLDEVEQAQLMTEISRVGRALKEITKCDKLN
FT                   IAALGNMVPQLHVHIIARRSSDAAWPRPVWGVMPPLPHDPEEVQQFISALRRKIWLG"
FT   gene            104486..105418
FT                   /locus_tag="RPD_0089"
FT   CDS_pept        104486..105418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0089"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37329"
FT                   /db_xref="GOA:Q13F10"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F10"
FT                   /protein_id="ABE37329.1"
FT                   /translation="MSSAFPLGQPAFVSNILDRAAHLRADDARLMAMEDRSDTRAYVVH
FT                   RDSLVVKHEDGGPRALLSIKEALALGANPGTIFLGLRDGAAVFGMGIGAAAIETLVTRS
FT                   DAGIAELRGMAMQGMLPEEQLSAIAMAKSMVNWHQRHGYCANCGQRTAMAQGGWKRDCP
FT                   ACKAEHFPRTDPVVIMLVTSGDKCLLGRQKQFPVGMYSCLAGFVEAAETIEDAVCREIL
FT                   EESGIRCADVRYYMTQPWPYPSSLMIGCTAIATTEDITIDFTELEDARWFSRDEAAQML
FT                   NRQHPDGLVGPHPFAIAHHLVGRWLEQDT"
FT   gene            105415..106344
FT                   /locus_tag="RPD_0090"
FT   CDS_pept        105415..106344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0090"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37330"
FT                   /db_xref="GOA:Q13F09"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F09"
FT                   /protein_id="ABE37330.1"
FT                   /translation="MTDKAKRKPRILCIGIPVRDLTFRVEAVPGRGNKVPASAYKEIAG
FT                   GNALNAGIGIARLGGAATMCGPMGDAGETAATFMFDKLGEEGIATDRLIHMPGLVTPIS
FT                   AVLVDPTGERTIVTFRDPKLWNVGLPSAETLLADCDAIMIESRCAGFATALCAEAIRRG
FT                   IPVVVDIDSAMSLNEGLLTASSHLIFSAEALHATAGINDDAEALKKIATLTHAFVAVTR
FT                   GPKGTLWLDADQNFQETPAFPVHSVDTLGAGDIFHGGFAVAFSEGQDIPSALRFASAAA
FT                   ALKCTRPGGAFACPDRAEVEAFLAAQPR"
FT   gene            complement(106399..107100)
FT                   /locus_tag="RPD_0091"
FT   CDS_pept        complement(106399..107100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37331"
FT                   /db_xref="GOA:Q13F08"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F08"
FT                   /protein_id="ABE37331.1"
FT                   /translation="MTLAARKDLRLSSQIIDPAILYFGTPVVLIGSCNDDDSFNLAPMS
FT                   SAWWVGQRCMLGLASNSKTTGNILRSGECVLNLPSSDLVGAVDRLARTTGSDPVPQGKL
FT                   HRGYRFEADKFGVSRLTSQKGDAVAAPRALECPVQIEARLMQAHPMAEEDVVWRGHLVA
FT                   LELSVVRIHVHPSIMMDGQDDRIDPDKWRPLIMSFQQYYGLALGRLQHSVLGEIPEAYY
FT                   RPPSRPSQPAG"
FT   gene            complement(107176..107604)
FT                   /locus_tag="RPD_0092"
FT   CDS_pept        complement(107176..107604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0092"
FT                   /product="protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37332"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F07"
FT                   /protein_id="ABE37332.1"
FT                   /translation="MPSAAEMIARLKLQPHPEGGHFRETFRDPRCDASGRSFSTAIYFL
FT                   LASGERSHWHRIDAIEVWHYYAGAALALEIADADGHRAIRLGPDVAAGEQPQAIVPPHA
FT                   WQAAVTTGDWTLVGCTVAPGFAFEHFELAPPDWSPLRR"
FT   gene            complement(107613..108380)
FT                   /locus_tag="RPD_0093"
FT   CDS_pept        complement(107613..108380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0093"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37333"
FT                   /db_xref="GOA:Q13F06"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F06"
FT                   /protein_id="ABE37333.1"
FT                   /translation="MAADIRIVPCLTDNFGYLIHDPSSGATASIDAPEAAPLIAALEKE
FT                   GWKLTDILVTHHHGDHVGGVAELKKKYQCRVVAPHDANAKIADIDLRVEEGDVVRVGGL
FT                   SARVLETPGHTLDHISYVFDDDRALFAADTLFSIGCGRVFEGTYPMMWESLLKLRELPD
FT                   DFKLYCGHEYTASNVKFALTIEPDNAALQARAKQVEQQRAAGQPTIPVTLGEEKQANLF
FT                   LRADVPSVAAAVGLPGESAADVFGELRERKNNS"
FT   gene            108557..109321
FT                   /locus_tag="RPD_0094"
FT   CDS_pept        108557..109321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0094"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37334"
FT                   /db_xref="GOA:Q13F05"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F05"
FT                   /protein_id="ABE37334.1"
FT                   /translation="MTIDVVNLRDFYSNRLGLVARRLINRGIQTRWPDARGQRVLGLGY
FT                   PTPYLGLFRDDCERCIAFMPAAQGVLKWPTARATLSTLVEERALPLPDAAVDRILLVHS
FT                   LEMSEDPDALLREVWRVLAPSGRLLAVVPNRRGVWARSDNTPFGHGRPYSRSQISDLLR
FT                   RTWFTPVGWSEALFMPPLEQSWLLRSAPAWERVGAAASLPFAGVHVVEATKQVVRPIQA
FT                   KRERTRLIPALGPSLVPSPMQADDADLPARPR"
FT   gene            complement(109382..110107)
FT                   /locus_tag="RPD_0095"
FT   CDS_pept        complement(109382..110107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37335"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F04"
FT                   /protein_id="ABE37335.1"
FT                   /translation="MRNGQNNKRLRNRNSGSNNNNNNNNNRRGQNPMTRVFESNGPDIK
FT                   IRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQQQQR
FT                   VDNDMSDNDDEGEADYSNFGAEPGLVPVQQQPYQPREQPRAEQPQFAPREQPQPREHRP
FT                   QPQFTPRAEQPQPSVEAVDRLPSFITGPQPQISPAAFEGAGGAERFPPRRRRRPHVPRG
FT                   EGAAAAAPVPAEDATPGNE"
FT   gene            complement(110600..111478)
FT                   /locus_tag="RPD_0096"
FT   CDS_pept        complement(110600..111478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0096"
FT                   /product="modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37336"
FT                   /db_xref="GOA:Q13F03"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F03"
FT                   /protein_id="ABE37336.1"
FT                   /translation="MTESPAAKTIAAARRAIGRRLKDAGIESAELDARLLIGEVTGLDL
FT                   TGLIVQAERLLAPDQAELLDGFVARRLAGEPVARILGAREFWGLPLTLSADTLVPRPDT
FT                   ETVVEVALEYLRAEAPARPLILDIGAGSGAILLALLSECPAAFGVATDISLGALRAAQS
FT                   NAIRLGLSNRAGFAVCDYASALIGPFDLIVSNPPYIPARDIAALDREVRDHDPRRALDG
FT                   GDDGLDAYRRIVPESMRLLRPGGALVVEFGQGQSDEVAALMRAAGLTVSGPPRRDLGGI
FT                   FRALMGRNLIG"
FT   gene            complement(111521..112606)
FT                   /locus_tag="RPD_0097"
FT   CDS_pept        complement(111521..112606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0097"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37337"
FT                   /db_xref="GOA:Q13F02"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F02"
FT                   /protein_id="ABE37337.1"
FT                   /translation="MSKLPEAKLDVLLAHHASLEAQLLGEVGASEYVRITRELSELNPL
FT                   VEAVKAYREVRDELGDVDALLEDPDTDSEMRAMAEAERDALDAHRAELIQEIRVALLPK
FT                   DAMDERNVMLEIRAGTGGDEASLFAGDLFRMYEKFAALQGWSVEVISASEGSMGGFKEI
FT                   IAEVKGRGAFAKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEVEEVDVDIKADDL
FT                   KIDTMRAQGAGGQHVNKTESAIRITHLPTGIVVMMQDSRSQHKNRASAMNILRSRIYDA
FT                   EQQRLDAARSAERKEKVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGEALGE
FT                   LIDALTTEHQAAQLAAQGHAA"
FT   gene            complement(112658..114925)
FT                   /locus_tag="RPD_0098"
FT   CDS_pept        complement(112658..114925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0098"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37338"
FT                   /db_xref="GOA:Q13F01"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F01"
FT                   /protein_id="ABE37338.1"
FT                   /translation="MRSTSGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   STYVLRVDNTLELYATEGLNREAVHQTVLNAHEGLVGLVASEATPLNLSDAQSHPAFSF
FT                   RPETGEEIYHSFLGVPILRAGNTLGVLVVQNRAKRTYVEEEVEALQTTAMVLAEMIASG
FT                   ELSALAQPGAEPAARHSIHKTGAILSDGIALGHVVLHEPRVVITNYIAEDLPKEIKRLD
FT                   AALAKLRADLDRLLERGDVADGGEHREVLEAYRMFANDHGWSHRLHEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRDRLHDLEDLGHRLMRQLVGQNHAPSREQLPDNAILIARS
FT                   MGPAALLDYDRTRLRGLVLEEGTANSHVSIVARALGIAAVGEVPNAPGIADPGDAIIVD
FT                   ATSGSIYVRPSAEVEAAYGERVRFRARRQAQYSALRDLACVTKDGQPIDLMINAGLAID
FT                   LPHIDDTGSSGIGLFRTELQFMIGQSLPRSSDQLALYRTVLDAAGSKPVTFRTLDIGGD
FT                   KALPYMETVVEENPALGWRAIRLGLDRPGLLRSQIRALLRAGGGRSLRIMFPMISEVAE
FT                   FDAAKAIVERELTYLRQHGHTLPERVDVGTMVEVPALLYQLDELLKKVDFISVGSNDLF
FT                   QFLYAVDRGNSKVSDRFDTLSTPILRALRHIVRKAKAANRSVSLCGEMASQPLSALALI
FT                   AIGYRALSVSAVSHGPIKAMILEVDAAKAEAAILPLLDAPAGSVSIRHKLAEFAEAHGL
FT                   SL"
FT   gene            complement(115231..116484)
FT                   /locus_tag="RPD_0099"
FT   CDS_pept        complement(115231..116484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0099"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37339"
FT                   /db_xref="GOA:Q13F00"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F00"
FT                   /protein_id="ABE37339.1"
FT                   /translation="MGRLVMKFGGTSVANIERIQNVARHVKREVDAGHEVAVVVSAMSG
FT                   KTNELVAWCREASPMHDAREYDAVVASGEQVTSGLLAIALQAVGIQARSWQGWQLPIST
FT                   SDAHASARITDIDGSEIIKRFGDRKEVAVIAGFQGINPETGRITTLGRGGSDTSAVAIA
FT                   AALKADRCDIYTDVDGVYTTDPRVVPKAKRLDKVAFEEMLELASQGAKVLQVRSVELGM
FT                   VHNMPIFVRSSFDKPEDIDPHGTPPGTLICSEEIIMENHVVTGIAFSKDEAQISVRRIE
FT                   DKPGVAASIFGPLADANINVDMIVQNVSEDGKTTDLTFTVPAADFARAKQTITSAQEEI
FT                   GYARFDSETDVAKVSVIGSGMRSHAGVAAQAFAALAARNINIRAITTSEIKFSVLIDAA
FT                   YTELAVRTLHTLYGLDQV"
FT   gene            116843..117604
FT                   /locus_tag="RPD_0100"
FT   CDS_pept        116843..117604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0100"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37340"
FT                   /db_xref="GOA:Q13EZ9"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EZ9"
FT                   /protein_id="ABE37340.1"
FT                   /translation="MALQSESTGPVSPSVDPAEIAKFSRLSAEWWDPTGKMAPLHRINP
FT                   LRISFIRDAACRKFERNAKSLSCLSGLRMLDIGCGAGLLCEPFTRLGAQVIGIDPSATN
FT                   IAAAKLHADKSHLAIDYRCTTVEEIDPRERFDIVMAMEVIEHVNDVPAFLGRCAALMKP
FT                   TGIMLVATLNRNWKSFALAIVGAEYVMRWLPRGTHQWDKFVTPDELEQHLQGLGLVVTE
FT                   QSGLVFNPLADRWRLSPDMDVNYMVVAETAP"
FT   gene            complement(117713..118528)
FT                   /locus_tag="RPD_0101"
FT   CDS_pept        complement(117713..118528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37341"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ8"
FT                   /protein_id="ABE37341.1"
FT                   /translation="MLRCLAAFTALCAALMSPASAEDGFRGSECLAMAQAPPRVMPASL
FT                   RRLAAADQVLITYRGHSTYTIESPGGVMIATDYSGTYDTGRAPDVVTMNRAHATHYTLS
FT                   PDRNIAHVLHGWGEDGQPARVRLQFGDVLIRNVTTDIRRTIFGDGAGGMIKDGNSIFIF
FT                   EVAGLCIGHLGHLHTMLDDSHFAAIGRIDILMVPIDGSYTMSLDGISEITKRLRASVVL
FT                   PMHRFMTPLDEFMQRIGKSFAIDQRGERSLRISRDTLPSAPTVIILRGV"
FT   gene            118681..119580
FT                   /locus_tag="RPD_0102"
FT   CDS_pept        118681..119580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0102"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37342"
FT                   /db_xref="GOA:Q13EZ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ7"
FT                   /protein_id="ABE37342.1"
FT                   /translation="MLSLASLWIPFTLVAAIGQVARNAMQRSLTGPLGTWGATNIRFLF
FT                   GFPFSIVFFVVVIVATGDTVAWPGLAFWPWLLLGALSQIAATGLMLAAMNERSFVVTTA
FT                   YLKTEAIQTAIFGFVFLGDHLGVLKVVAILIATIGVVITALRPGAARNLASLRPTLLGL
FT                   TAAAAFALSAVGFRGAIIVVPGVSFVTAATLTLVFALGVQTLVLTIYLLARAPQVLRDI
FT                   LQLWKPSMLAGFTGALASQFWFLAFALTAAANVRTLALVEVLFAQAVAYYSFKQPLSGR
FT                   ELGGIALIVLGVALLVAA"
FT   gene            complement(119581..120015)
FT                   /locus_tag="RPD_0103"
FT   CDS_pept        complement(119581..120015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0103"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37343"
FT                   /db_xref="GOA:Q13EZ6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ6"
FT                   /protein_id="ABE37343.1"
FT                   /translation="MSATIWPWQVWALLSAVFAALTAIFAKVGVADINSDLATFIRTVV
FT                   VLVALAMVLSATGQFSVSGTITAKTWLFLVLSGLCTGASWLCYFRALTLGPASLVAPID
FT                   KLSVVLVALFAFAFLGERPSGVHWLGIALIAAGAVIIAVK"
FT   gene            complement(120224..120727)
FT                   /locus_tag="RPD_0104"
FT   CDS_pept        complement(120224..120727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0104"
FT                   /product="protein of unknown function DUF1178"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37344"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ5"
FT                   /protein_id="ABE37344.1"
FT                   /translation="MIRYNLRCECGHSFESWFQSSSAYDSQVRRKLVNCPACDSVKVEK
FT                   AIMAPQIVGKKGRGRAPEPAHEVAAGTAVAPQAAESPVAESATPLLLAQERELRTKLKE
FT                   LRDYIVKTADNVGDSFPNEARKMHYGDIEHRPIFGEASPAEAKALIDEGIEVAPLPVLP
FT                   EDRN"
FT   gene            complement(120724..121599)
FT                   /locus_tag="RPD_0105"
FT   CDS_pept        complement(120724..121599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0105"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37345"
FT                   /db_xref="GOA:Q13EZ4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ4"
FT                   /protein_id="ABE37345.1"
FT                   /translation="MTEVPFNAAMVQMRTGLLPGPSLEQATKLIREAAAAGADYVLTPE
FT                   VSNMMQLNREALFEHLADEADDASLKAYRDLARELNIHLHIGSLALRATPDRAVNRSFL
FT                   IDPSGAVLASYDKIHMFDIDLGNGESYRESTNYQPGESAVISDLPWGRIGLTICYDVRF
FT                   PALYRALAEAGASFLTVPSAFTRPTGEAHWHVLLRARAIENGCFVFAAAQCGLHENRRE
FT                   TYGHSLIVDPWGVVLAEGGVDPGFVMARIDPAAVAKARGKVPSLQHGRRFTVVDAKHSP
FT                   EHLHLVRGQT"
FT   gene            complement(121596..121886)
FT                   /locus_tag="RPD_0106"
FT   CDS_pept        complement(121596..121886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0106"
FT                   /product="Glutaredoxin, GrxC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37346"
FT                   /db_xref="GOA:Q13EZ3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ3"
FT                   /protein_id="ABE37346.1"
FT                   /translation="MSAAIEIFTRPGCGYCGAAKSLLNRKKAAFTEYDVSVDPGFRVKM
FT                   DERAGPGATYPQIFIGSFHVGGCDDLYALDREGKLDALLAGELAAGEKAIS"
FT   gene            complement(121938..122756)
FT                   /locus_tag="RPD_0107"
FT   CDS_pept        complement(121938..122756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0107"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37347"
FT                   /db_xref="GOA:Q13EZ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ2"
FT                   /protein_id="ABE37347.1"
FT                   /translation="MQAEAITASGAKADGGVLFKAFGAVRRVWTRAAHLALDVALPTLC
FT                   VACREPVAGDGLCAPCWSQLSFIAPPYCEKLGIPFVYDPGPGLLSMQAIADPPAYARAR
FT                   AAVRYDEVAKTLVHALKFHDRVDLAPTMGRWMAHAGQPLLADADLLIPVPLHWRRGFSR
FT                   RYNQSGALARAIGRQAGLPLAIEALKRIRPTAHQIGLSRAERAANVQGAFKVPPECKAE
FT                   VQGRRIVLVDDVLTSGATVDACARALLRAKARSVDVLVFARVVDTLKSPI"
FT   gene            122868..123170
FT                   /locus_tag="RPD_0108"
FT   CDS_pept        122868..123170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37348"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ1"
FT                   /protein_id="ABE37348.1"
FT                   /translation="MSEPDDKSADSITYVDIPTAPHVYFDIAPAHGVMANGVEIELAAR
FT                   TLNPLADGTVEVKFVTTARLRCSQAGAQHLRNALDAVLKMIEAAQQSPAAASKLN"
FT   gene            123232..124065
FT                   /locus_tag="RPD_0109"
FT   CDS_pept        123232..124065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0109"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37349"
FT                   /db_xref="GOA:Q13EZ0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ0"
FT                   /protein_id="ABE37349.1"
FT                   /translation="MTDVAPLLFDRSLLAARLARARTLGPASFLLDRVADEMGERLHAV
FT                   LRDFKAIADIWTPGDALPAERFPGITRVAIDRSGDEALRLPPGSLDLAVSALALQFAND
FT                   LPGVLAQIRRALKPDGLLLAALTGGDTLTELRQAFAAAEAEIEGGVSPRVAPTADLRDL
FT                   GALLQRAGFALPVTDIDRVVVRYDHAFALMQDLRRMGATNVLVERRRTPLRRATLLRMA
FT                   DIYAERFADPDGRIRATFEIVWLSGWSPHESQQQPLKPGSAKASLEQAVRGNQPK"
FT   gene            complement(124127..124528)
FT                   /locus_tag="RPD_0110"
FT   CDS_pept        complement(124127..124528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0110"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37350"
FT                   /db_xref="GOA:Q13EY9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY9"
FT                   /protein_id="ABE37350.1"
FT                   /translation="MKLLLVVAVALIDADNRVLIAQRPKHKQLGGLWEFPGGKLDPGER
FT                   PEAALIRELDEELGITVKEACLAPLTFASHAYEDFHLLMPLYVCRRWEGLVMPREGQEL
FT                   AWVRPNKLRDYPMPPADIPLIPPLIELLM"
FT   gene            complement(124701..125942)
FT                   /locus_tag="RPD_0111"
FT   CDS_pept        complement(124701..125942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0111"
FT                   /product="glutamate N-acetyltransferase / N-acetylglutamate
FT                   synthase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37351"
FT                   /db_xref="GOA:Q13EY8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY8"
FT                   /protein_id="ABE37351.1"
FT                   /translation="MSSSVSPLAPTNVPTLPDLAGVRLATAAAGIRYKGRTDVLLVALD
FT                   PGTAVAGVFTKSKCPSAPVEWCRDKLKGGSARVLVVNSGNANAFTGKTGRQATTLTASI
FT                   ASKAIGCKPAEVFLASTGVIGEPLDATKFDGVLGKLAETAQPGGWMEAARAIMTTDTFP
FT                   KVATATVKIGKTKVTINGMAKGAGMIAPDMATMLSFVFTDAPLSASCLQALLKAGVADT
FT                   FNAVTIDGDTSTSDTLLAFATGAAAKAGAPKISRASDPRLKAFVKAFNAVLADLAEQVA
FT                   RDGEGARKLVEIIVDGAKTPASARKIAMSIANSPLVKTAIAGEDANWGRVVMAVGKAGE
FT                   PADRDKLSISFNGIRVAKSGARDPSYNEAEVSAAMKKPEIQIKVSLGLGKGRDRVLTCD
FT                   LTKAYVEINGDYRS"
FT   gene            complement(126213..126722)
FT                   /locus_tag="RPD_0112"
FT   CDS_pept        complement(126213..126722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0112"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37352"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY7"
FT                   /protein_id="ABE37352.1"
FT                   /translation="MDAATLRATQAPIKERYKSDPDAALITLTAKGSVDSDGLTCKVET
FT                   GRALATAGLHPATGGSGLELCSGDMLLEALVACAGVTLKSVATAIEVPLTRGDVVAEGD
FT                   LDFRGTLGIDKETPVGFREIRLRFDVGTDAPQDKLDLLLKLTERYCVVYQTIKNGPKVS
FT                   VSLERV"
FT   gene            complement(126781..127566)
FT                   /locus_tag="RPD_0113"
FT   CDS_pept        complement(126781..127566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0113"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37353"
FT                   /db_xref="GOA:Q13EY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY6"
FT                   /protein_id="ABE37353.1"
FT                   /translation="MLVLDGLDKTYPNGVHALERFSAQIQLGEIIAIIGGSGCGKSTLL
FT                   RAIAGLDRASAGAITLDGETIAAPHPKIGIIFQEPRLLPWLSVADNIGFGLDGVPRRQR
FT                   AGRVAAALSRVGLSDKAKAWPRELSGGQAQRVAIVRALVPQPEVLLLDEPFSALDAFTR
FT                   RDLQDHLLDLWADTRPTLILVTHDVEEAVVLADRVLVMRPRPGRLFEEIAVDLARPRDR
FT                   NSPLFETLRHRVYSSLDRSLDLAQPGAEAKVNVGDAMWW"
FT   gene            complement(127566..128426)
FT                   /locus_tag="RPD_0114"
FT   CDS_pept        complement(127566..128426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0114"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37354"
FT                   /db_xref="GOA:Q13EY5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY5"
FT                   /protein_id="ABE37354.1"
FT                   /translation="MAMTLETPVLQRSDAIEPADGARAPRRAPRWRGPLLGLLLPLTIA
FT                   LGWELLVHFGYSNGRLVPPPSKVFAIIAELAKSGELSRHIVATVGRVASGFGLGVLAGT
FT                   VLGAVSGYWGLARQLLDPTVQALRAIPSIAWVPLFILWLGIFETSKVALIAVGVFFPVY
FT                   LGVMGAIRSVDRKIVEVGRAFRLSGPAMIRRILLPAVLPAYVVALRVGLGLGWMFVVAA
FT                   EFMGASEGLGFLLIDGQQLGKPAQIVAAIVIFALLGKTTDWLIEIASAPLLRWQDAFGR
FT                   HEGEA"
FT   gene            complement(128620..129606)
FT                   /locus_tag="RPD_0115"
FT   CDS_pept        complement(128620..129606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0115"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   aliphatic sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37355"
FT                   /db_xref="GOA:Q13EY4"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY4"
FT                   /protein_id="ABE37355.1"
FT                   /translation="MSNISRRAITALIAAAAFLPGVLPVVASAADKPKEIRIDWATYNP
FT                   VSIVLKQQGLLEKEFAKDGISVVWVQSAGSNKALEFLNAGSIDFGSTAGSAALVARING
FT                   NPIKSVYVYSRPEWTALVTAKDSKIASVADLKGKRVAVTRGTDPHIFLVRALLDAGLSQ
FT                   NDITPVLLQHADGKAALIRGDVDAWAGLDPMMAQAEVEEGAKLFFRKPEANTWGILNVR
FT                   EQFLKDNPDLVRRVLAVYEDARKYAVANTDEVKKAFIGVTKLPETVVDKQLKERTELTH
FT                   SRIGAPQRDSILAAGLALQQAGVIQSSVDVKATLDQLIDDQVPLPTN"
FT   gene            129849..132650
FT                   /locus_tag="RPD_0116"
FT   CDS_pept        129849..132650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0116"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37356"
FT                   /db_xref="GOA:Q13EY3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY3"
FT                   /protein_id="ABE37356.1"
FT                   /translation="MDKVATPPHRPAGDERFDTQRITAEIAVLAAQHGGNDQAFRNALA
FT                   QLMKAELAKARAEAEAQLLRDRHGRRCAERLCFVKDEIIRLLFMAATKYLYNSPTPSSS
FT                   ERMSVVATGGYGRGLMAPESDIDLLFILPYKQTAWGEQVAEVVLYSLWDIGLKVGHATR
FT                   SVDECIRQARADMTIRTAILETRFLTGDKALYAELVERFDKEVVEGTAAEFVTAKLAER
FT                   EERHRRSGQSRYLVEPNVKDGKGGLRDLHTLFWIAKYVYRVRETSELLERGVFDAIEFR
FT                   TFRRCEDFLWSVRCNLHFLTRRAEERLSFDLQREIGVRLGYTSHPGMQDVERFMKHYFL
FT                   IAKEVGNLTAILCAKLEDQQAKPAPALSRMMARLRPGATRRRVPESDDFVIDNNRINLA
FT                   APDVFKHDPVNLIRIFRLAQKNSLAFHPDAMRTVTRSLALINAQLRDDPEANRLFIEIL
FT                   TSDNSEPVLRRMNETGVLGRFIRAFGRIVSMMQFNMYHSYTVDEHLLRCVGNLQEIERG
FT                   GNDEFMLSSDLTRRIRPDHRAVLYVAVLLHDIAKGQPEDHSTAGAKVARRLCPRFGFNA
FT                   ADTELIAWLIEKHLVMSTVAQSRDLSDRKTIENFAAVVESVEQMKLLTILTTADIRGVG
FT                   PGVWNGWKAQLLRTLYYETEPVLTGGFSEVNRAERIRAAQAEFRAAFTEWPEAELDAYV
FT                   ARHYPAYWLKVELARKLRHARFLRASEQAGNKLAVNVGFDEARGVTELTILAVDHPWLL
FT                   SIIAGACASAGANIVDAQIYTTTDGRALDTISIRREYDRDEDEGRRATRIGEIIEEVLE
FT                   GKLRLPEAVARRATSSKTKLRAFVVEPEISINNNWSDRYTVIEVSGLDRPGLLYQLTTA
FT                   ISKLNLNIASAHVATFGERARDVFYVTDLLGAQITAPTRQAAIKRALVHLLANGDAEQK
FT                   PAA"
FT   gene            132778..133347
FT                   /locus_tag="RPD_0117"
FT   CDS_pept        132778..133347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0117"
FT                   /product="Putative threonine efflux protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37357"
FT                   /db_xref="GOA:Q13EY2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY2"
FT                   /protein_id="ABE37357.1"
FT                   /translation="MTTQMSYEAFVLTSLLILLTPGPTNTLLAASGAAMGVRKALWLAL
FT                   AEALGYSIAISLFVAAAGALEDVPIALPLLKAVAAGWLLFSAVQLWTRPATPDRADQRG
FT                   AFSRVCVTTMLNPKAMLVGTVIIPDVTIGQAQAVLTFVVLSSVAGAGWIVSGAALPAGL
FT                   RRYSFKSAAVIIAAFSFAAAASAVQG"
FT   gene            complement(133645..135261)
FT                   /locus_tag="RPD_0118"
FT   CDS_pept        complement(133645..135261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0118"
FT                   /product="HWE histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37358"
FT                   /db_xref="GOA:Q13EY1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY1"
FT                   /protein_id="ABE37358.1"
FT                   /translation="MQPPDYTFDRERLAALSRFGILDTPPERGFDDVVELTTLICETPV
FT                   ALVSFVTDDRQWFKARVGFDACQTDLNSSVCAHALIEPDLLVVPDLTIDERTKYNPLVT
FT                   GQPFIRFYAGAPLRTAGGHVLGSLCAIDTKARPGGLTAAQTSALRNLGRQVVAQLELRH
FT                   AVAQRDALLTEQKEAEIRRNGLLEIGDRLRDATSVSEMTRAAAAVVGETLGVSRAAFGR
FT                   FDEAGEYVEVEPDWTADGVVSAAGRHRLADYGPNLLRGVLNGQALVVTDVTTDPATAGH
FT                   TEALLRLDIRALVNIPVVEHGRAVAMLIVHARQPRSWSPETLTYLRNIADRIEMGVSRL
FT                   RAEAQQRILNSELSHRMKNTMALVQAVASQTLKSVPDKAPVKAFSDRLLALSMAHDVLL
FT                   QQDWRSAQVRNIVDAAICTFNEVGRFDISGEQVTLGSRAALSLALLLHELTTNAVKYGA
FT                   LSNELGRVQIAWRVETTDGDAGFRLRWNETGGPRIDPPSRRGFGSRLLGMGLSGTGDAA
FT                   LNYHRSGLEVEFTASLAELQA"
FT   gene            complement(135398..138127)
FT                   /locus_tag="RPD_0119"
FT   CDS_pept        complement(135398..138127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0119"
FT                   /product="sensor histidine kinase with PAS/PAC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37359"
FT                   /db_xref="GOA:Q13EY0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY0"
FT                   /protein_id="ABE37359.1"
FT                   /translation="MRLSMRLTLVMTTLVLCAVAAVGILTYYNVGRAVVPAGLTRLADR
FT                   AEARLGAFDGILRLLQLEILAARTFPPHQGLVRARINGGLDPQDDLTEARWLRRLGDAY
FT                   LGQMSVKSDIVRFSLVSADGGRELLRVDRSGPGGDIRVVPDDKLERVGQELFDRTIALS
FT                   EGEVYTSPIHAGPGNSGDDDLAPMVSIATPLRMPEGEPFGMLVLDFDLRPTFERIRASP
FT                   DNNTKAYFVDAGGPYLLDLLDGRVIPSRPRGQWQDDYPDLAKALGDKPGAATVLTAPDG
FT                   ARVAAAIAIAPLVGRLRVGVIETEAFERIIAPATALRQTVVTVALFAAGVAVLLSALLS
FT                   RSLAKPLVQITAAVDDFASTGRVAMPRGLSGETKTLAAAFEHMAAEIDTTTTALRAKSE
FT                   ALDKIVASMADAVLMLDAEGRRVFANPTFFALFGDIAEIGSERWRQHYQGLRPDGVTPI
FT                   PDDETPSARARRGESFDNLDVVLRRVGHSQLVHLAASGRPIETASGAFDGAVVVYRNVT
FT                   ALKETERQLRQAQKMQAIGQLTGGVAHDLNNILTVLTGGIEILADGVSDRPALKDVAVM
FT                   VDQAVSRASDLTNGLLSFARKQPLQPRSIDVNALMQETARLLRATFGSHIEIAFEPTPG
FT                   LRSALADPSQLSGALINLAINARDAMPGGGKLLLEAGNIDLDQAYADHNDEVAAGRYVV
FT                   LMVTDTGTGIPAAIRDRVFEPFFTTKALGEGTGLGLSMVYGFVKQSGGHIAIYSEEGVG
FT                   TTIRLYLPSADPKNSPGDAAAPQQAQGGRESILLIEDDVLVRSYVVTDLAALGYTVHAA
FT                   ATAAQAMAMVYDELEFDLLFTDVMLAGSINGYQLADELRKYRPDLKVLLTSGYTGNMLR
FT                   LQGGHEDGTPFLEKPYRRAELARMLRLALDGKAPSSPT"
FT   gene            complement(138274..138702)
FT                   /locus_tag="RPD_0120"
FT   CDS_pept        complement(138274..138702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37360"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX9"
FT                   /protein_id="ABE37360.1"
FT                   /translation="MTGYIDPTKEVFAQFRENDRDGPIHMLNLVRLKPRASYPDGREAT
FT                   GAEAYAAYGRDSLSVFSRLGGRVVWQGAFELMLIGPQQERWDHVFIAEYPGVSAFVEMI
FT                   RDPVYREAVKHRQAAVEDSRLIRLKPIPAGEGFGQIPE"
FT   gene            138971..140191
FT                   /locus_tag="RPD_0121"
FT   CDS_pept        138971..140191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0121"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37361"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX8"
FT                   /protein_id="ABE37361.1"
FT                   /translation="MKSLYRAAAAAVAAIALTAAPAAAQKKYDTGATDTEIKIGQTVPF
FT                   SGPASAYAGIGKTQAAYMRMINDSGGINGRKINLIQYDDAYSPPKAVEQVRKLVEGDEV
FT                   LLTFQIIGTPSNAAVQKYLNGKKVPQLLASTGATRFTDPKSFPWTMGYNPNYQTEARIY
FT                   ARYILKNHPNAKIGIMYQNDDLGRDYLAGLKAGLGDKAAAMIVAETSYELSDPTVDSQI
FT                   VKLKAAGVDLFFNASTPKFAAQAIKKVADLDWRPIHILDINASPVSSTLKPAGLDISKG
FT                   IISVNYGKDPADPQWKDDPGVAKYLAFMDKYYPEGDKMSTINTYGYSTAQLLVTILKQC
FT                   GDDLTRDNVMKQAANLKNVTGDLSLPGMVINTSPTDYRINKQLQMMKFNGERWELFGQI
FT                   IEDDQAM"
FT   gene            140396..140815
FT                   /locus_tag="RPD_0122"
FT   CDS_pept        140396..140815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37362"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX7"
FT                   /protein_id="ABE37362.1"
FT                   /translation="MHLVVCTGCREDVAQLIGNQIGSVDRWFEQRARHFVQNATDRLQR
FT                   IGVEWRGGEYDRMRVTSGAPQRGESTMRTESNRYFTIEQLEELAVAKYIEAALMPEGGE
FT                   REELLQEAKRFASRARMKSWLMGEIGITPPRREYH"
FT   gene            complement(140960..141211)
FT                   /locus_tag="RPD_0123"
FT   CDS_pept        complement(140960..141211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37363"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX6"
FT                   /protein_id="ABE37363.1"
FT                   /translation="MNRMQKTAEEIEALLLQDVRQQRHCGKVEAIRIRPCEPDEDTNGA
FT                   NWKVASVDPGQASREFAGAAVMIAMDRLQREVSAFPWD"
FT   gene            141403..143565
FT                   /locus_tag="RPD_0124"
FT   CDS_pept        141403..143565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0124"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37364"
FT                   /db_xref="GOA:Q13EX5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX5"
FT                   /protein_id="ABE37364.1"
FT                   /translation="MALGKKKAGERREPKFGFAESLAHLRLGPQDRVSVADDDRPKKPK
FT                   AQAGKSGGGGRGKSRGKSRKKGGLRSLVTRTVYWTAVAGIWAVLAVVGIMVWVGAHLPP
FT                   IQSLEIPKRPPTITIVGADGSQLAVRGEMAGTNVSLKDLPPYLPKAFIAIEDRRFYSHF
FT                   GVDPMGIARAAVANVMHRGVSQGGSTLTQQLAKNLFLTQDRTLTRKLQEVELALWLERK
FT                   HAKAEILELYLNRVYFGSGAYGVEAAARKYFGKSAKEVSLVEAAMLAGLVKSPSRLAPN
FT                   RNPEGAEKRAQLVLAAMAEADFITDKQARAAIANPVYTVAPTGAGTLNYVADWIGEVLD
FT                   DLVGQIDQSIVVETSIDPKLQTEAEAAIIDELAAKSVKFKVSQGALVAMTPDGAVRAMI
FT                   GGRNYADSQFNRAVTAKRQPGSAFKPFVYLTAIEAGLTPDTIRQDAPLDLKGWRPENYT
FT                   HEYFGAVTLTQGLAMSLNTVAVRLGLEVGPKNVVRTAHRLGIASKLDANPSIALGTSEV
FT                   SLAELVGAYAPFANGGLMASPHVVTRIRTASGNKLLYARPSDPPSRVVDARAVAMMNTM
FT                   MQETLQSGTGRKADLPGWSAAGKTGTSQDFRDAWFIGYTSTLITGVWLGNDDNSPTKKA
FT                   TGGGLPVDVWTRFMRAALQGAAPQPLPGGWVEAPATIAQSGPRGETQVMNVAPPSGRAP
FT                   QPTRANVRPEADTGLDGWLMDRLFGR"
FT   gene            complement(143897..144667)
FT                   /locus_tag="RPD_0125"
FT   CDS_pept        complement(143897..144667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0125"
FT                   /product="protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37365"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX4"
FT                   /protein_id="ABE37365.1"
FT                   /translation="MSGSAEMAFRALLYRRPTEPSTIAVRHGSQFFAVRIRRHRRATRY
FT                   TLRIHPSDREAILTMPPRGTLVDAKDFAQRHGAWIAARLGRLPKAAPFQPGTLVPLRGH
FT                   DHKIVHRTGRGTVWTETRDSGERIICVAGDAEHIDRRVHDFLKREARHDLQKACDRYAP
FT                   ELGVKVTRLSIRDQSSRWGSCTSAGSLSFSWRLILAPPYVLDYLAAHEVAHLVEMNHSA
FT                   RFWRVVGKVCPHMERAKTWLDTHGNDLHRYGISD"
FT   gene            complement(144990..146315)
FT                   /locus_tag="RPD_0126"
FT   CDS_pept        complement(144990..146315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0126"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37366"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX3"
FT                   /protein_id="ABE37366.1"
FT                   /translation="MPVIGEFGRPPEMPAEVSPAMTTPMYWFYELAHASLNPARAMSDA
FT                   ARLMFKNPLNPWSHTDLGKSIAAACEVFERTTRRYGKPEWGLDDTEVNGMRVPIEIHNV
FT                   WEKPFCRLLYFERKLEHPLRHPQPRVLIVAPMSGHYATLLRGTVEAFLPTHEVYIADWT
FT                   DARMVPVAAGRFDLDDYVDYVIEMLQTLGGNVHVVAVCQPSVPVLAAVSVMEANDDPFV
FT                   PLSMTLMGGPIDTRRNPTSVNNLAAEKGIDWFRSHVITKVPFPHPGVMRDVYPGFLQLN
FT                   GFISMNLDRHMDAHKNLFNHLVQGDGDLADKHREFYDEYLAVMDLTAEFYLQTVDLVFV
FT                   KHALPKGEMTHRGKLVEPSKIKRVALMTVEGENDDISGLGQTEATHTLCTSIPDERRVH
FT                   YVQKGVGHYGVFNGSRFRSEIVPRISDFMLSSASGARATAAE"
FT   gene            146905..147660
FT                   /locus_tag="RPD_0127"
FT   CDS_pept        146905..147660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0127"
FT                   /product="Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37367"
FT                   /db_xref="GOA:Q13EX2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX2"
FT                   /protein_id="ABE37367.1"
FT                   /translation="MHNRYGKLASWVYNLDKPVGRSFGDVEFYRQRLKDVDGPILEPAA
FT                   GNGRILVPLLEAGLRIEGFDASDEMLGYCRDECGKRHLSAGLTRQRFDDFSYDTRFASI
FT                   IMPAGSFQLITDAASAAAVLKRFHDHLAPQGRLIIDLDPISGFLGASRSIRSWATDDGD
FT                   MLTLTDHRVETDFIAQTTLSHLRYEHWQDGSLTRTELDLFKLRWWGVNEFSLALQAAGF
FT                   SDVEVSGNYQHGRAPQPGDDIISFEARRA"
FT   gene            complement(147710..148540)
FT                   /locus_tag="RPD_0128"
FT   CDS_pept        complement(147710..148540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0128"
FT                   /product="ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37368"
FT                   /db_xref="GOA:Q13EX1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX1"
FT                   /protein_id="ABE37368.1"
FT                   /translation="MRSLINSLELGHGIAWHRIEAMVLRYWYLLLSSWPRLLELVYWPA
FT                   LQIITWGFLQSYIAQNAGFFARAGGTLIGAVILWDILFRGQLGFSISFLEEMWARNLGN
FT                   LMMSPLKPIEFLASLMIMSLIRLAIGIVPMTLLAMIFFDFNLLGFGLPLIAFFCNLIFT
FT                   SWALGIFVSGLVLRNGLGAESIVWTLMFGVMPLACVYYPVSVLPHWLQLVAWTLPPTYV
FT                   FEGMRALLMEHQFRVDLMLWSLGLNAVLFAAAFISFLVMLNSARRHGSLIQTGE"
FT   gene            complement(148537..149331)
FT                   /locus_tag="RPD_0129"
FT   CDS_pept        complement(148537..149331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0129"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37369"
FT                   /db_xref="GOA:Q13EX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX0"
FT                   /protein_id="ABE37369.1"
FT                   /translation="MTLEIASRPAPSATDAPAAAAIEVAHLVKVYKTTRAVDDISFRVP
FT                   RGSITGLLGGNGAGKTTTISMIMGLVLPTSGRVRVLGHEMPERRADVLGRINFESPYVD
FT                   MPSRLTVRQNLIVFGKLYAVKDLPGRIAELAADLDLGEFLDRASGKLSAGQKTRVALAK
FT                   ALINRPELLLLDEPTASLDPDTADWIRSHLETYRKQHGASILLASHNMLEVERLCDRVV
FT                   IMKRGRIEDDDSPAAIMARYNRATLEEVFLDVARGRAAGSGR"
FT   gene            149441..150763
FT                   /locus_tag="RPD_0130"
FT   CDS_pept        149441..150763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0130"
FT                   /product="ATP-binding region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37370"
FT                   /db_xref="GOA:Q13EW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW9"
FT                   /protein_id="ABE37370.1"
FT                   /translation="MSDDQNSSDFRHPRRHVRLDTILRLRWLAALGQISAIFIVAQGLE
FT                   FDFAVLPCLAIVAASAVVNLGLQIAFNPMQRMEPIYAALLLALNIAELAGLLYFTGGLQ
FT                   NPFAFLFLGPVLIAATALPTRFTISLGILAASCAALLGYAHQPLPWAGEEAVQLPEIYL
FT                   IGVWLSILLAIGVTSVYTFQVTEEARKLADALSATELVLEREQHLTQIDGMAAAAAHEL
FT                   GTPLSTIFLISRELEKSAPPEMVGDLRTLREQAQRCREILAKISHLNAAGAPFDQMPLS
FT                   TLIEEAVAPHRDFGVAIKIRVAVSGVSEPVVMRNPAILYGIGNILENAVDFARETVEVN
FT                   AWWNADTVQIMISDDGPGIKPDLLKRIGEPYLSRRRHPDDAHTERSGLGLGVFIARTLL
FT                   ERTGAKVSFRNKLFPDHGAVVQLTWPRNRFENSEIPAVAEA"
FT   gene            150866..151420
FT                   /locus_tag="RPD_0131"
FT   CDS_pept        150866..151420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0131"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37371"
FT                   /db_xref="GOA:Q13EW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW8"
FT                   /protein_id="ABE37371.1"
FT                   /translation="MNAIPELNDLTDRSLLIVEDDKPFLERLSRAMETRGFAVTSCDSV
FT                   SSGLAQIGKAAPAFAVVDLRLGDGNGLDVVSALKRERPDARAIVLTGYGNIATAVTAVK
FT                   MGAVDYLSKPADADDVVAALLASGTEKSELPNNPMSADRVRWEHIQRIYEMCNRNVSET
FT                   ARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(151611..152090)
FT                   /locus_tag="RPD_0132"
FT   CDS_pept        complement(151611..152090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0132"
FT                   /product="protein of unknown function DUF1052"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37372"
FT                   /db_xref="GOA:Q13EW7"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW7"
FT                   /protein_id="ABE37372.1"
FT                   /translation="MESNAVHMVLPPDLRQSETALKVARGASRLLRSLGFACVSELPLP
FT                   SGRRADLVALNERGEIWIVEIKSSVEDLRADQKWPDYRAHCDRLFFAFTQDLPCEIFPA
FT                   DTGLIVADGYGAHMHCEAPEHKLPAPTRKLMMLRFALAAAQRLNRLSDPQGFGDG"
FT   gene            152241..153359
FT                   /locus_tag="RPD_0133"
FT   CDS_pept        152241..153359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0133"
FT                   /product="von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37373"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW6"
FT                   /protein_id="ABE37373.1"
FT                   /translation="MKRITMLRALAFAALIAPLAIPSAARARPAVEVAFVLDTTGSMSG
FT                   LIEGAKRKIWSIATAIVDSNPGADIRMGLVAYRDIGDDYVTRNVELTPDIQDLYARLLE
FT                   LQARGGGDWPESVNEALDVAVNKLRWSKDGDTRRIVFLVGDAPPHMDYAQDTKYPTTLS
FT                   VARQKDIIVNAVQAGAARDTERVWHEIADGGRGRYIPIPQDGGQIVVIETPYDQDIIIL
FT                   QNRINGTVIPYGPAPLQKRTEEQTRQLSKVAAAAPAAASDMASYINKRARTSSEAVTGG
FT                   GDLVSDVMAGRQKLDQVKDEELPDSLRALPAEQRTAKIEAEMNQRKALNEKLATLVKQR
FT                   DAYLFAQRDKQPEQASSFDREVEATLKAQLKR"
FT   gene            153579..154247
FT                   /locus_tag="RPD_0134"
FT   CDS_pept        153579..154247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0134"
FT                   /product="beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37374"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW5"
FT                   /protein_id="ABE37374.1"
FT                   /translation="MSTQSDTKTKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGDV
FT                   PEILAAIEKTGVSVEKIWLTHGHIDHVGGAAELRDALGVQIEGPHRDDLFLLENVVNSG
FT                   RSFGIGGVRDVTPDRWLDHGDSVSVGELTFQILHCPGHSPGSVVFFNDAMRFALVGDVL
FT                   FAGSVGRTDLPGGNHATLISSITDRLLPLGDDVGFICGHGAGSSFGQERLTNPFLNGAM
FT                   "
FT   gene            154717..155706
FT                   /locus_tag="RPD_0135"
FT   CDS_pept        154717..155706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0135"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37375"
FT                   /db_xref="GOA:Q13EW4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW4"
FT                   /protein_id="ABE37375.1"
FT                   /translation="MTVELLSEPLSEFRALDTSDPVELAQALWTVYGVRHFEAPPAGHF
FT                   RIRGNFIQLQDIALGFTSGHAPLTVDFPEADFARLQIGLAGQASTRSAGVTTAVDSRQG
FT                   CITSPGRTARTEFGETYEQLLLRVKNGALERKLSALLGTKPKRTIEFEPAATNDLPQAA
FT                   NLRRMIAFVSSQINSPSAPLPALVLAELQDAITLLLLSTYRHNFSRFLEADSPTAAPKH
FT                   VRKIEEYIEANWMKPITIETLVDLTGISARGVFKTFQRNRGYSPMAFAKQVRLQHARAM
FT                   LTQGRTQTTVTAAAFACGFANLGHFAKDYRELFGERPSETLGRSSTSL"
FT   gene            complement(155814..156233)
FT                   /locus_tag="RPD_0136"
FT   CDS_pept        complement(155814..156233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0136"
FT                   /product="protein of unknown function DUF1236"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37376"
FT                   /db_xref="GOA:Q13EW3"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW3"
FT                   /protein_id="ABE37376.1"
FT                   /translation="MMNRFAGAAVVVLSLATPSIVNAQGVPGGVERGAREGERAAGPVG
FT                   AVVGGTIGGVVGGVAGILGVDDRPRFRSYVVDQRRPSYSYREDVRVGAVLPADGVTYYE
FT                   VPDQFSAARDYRYTVVNGRTVLVEPRTRRIVEIIE"
FT   gene            complement(156463..157641)
FT                   /locus_tag="RPD_0137"
FT   CDS_pept        complement(156463..157641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0137"
FT                   /product="Esterase, PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37377"
FT                   /db_xref="GOA:Q13EW2"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW2"
FT                   /protein_id="ABE37377.1"
FT                   /translation="MSLKNTIDFLAHLRKFNGLSSLGAVSGGAGDASPLTETTDFGDNP
FT                   GQLRMLSFIPEGLSQRIPLVVVLHGCTQTATGYDVGAGWSTLAERYGFALLMPEQTRAN
FT                   NPNLCFNWFVPDDIRRGHGEAGSIRQMVEHLARTHQIDRARIFVTGLSAGGAMTAAMLA
FT                   TYPDVFAGGAVIAGLPYAVAGTVRQALKEMRHASPHSAHQLGDLVRRASSHRGPWPKLS
FT                   VWHGSADRTVDSGNADALVKQWLDLHGLPEAPMAQRKIDGFPHRIWWNSSGETAVESYT
FT                   ITDMAHGTPLGRANDEHFGVAGAYLLETGISSSFHIAEFFGLTAQVHQPKSVRQTSARP
FT                   DRAAVATESKASQSKPRAAAGARRTQEPPRDRRGFDVNAVITRALTAAGLMK"
FT   gene            complement(157856..158101)
FT                   /locus_tag="RPD_0138"
FT   CDS_pept        complement(157856..158101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37378"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW1"
FT                   /protein_id="ABE37378.1"
FT                   /translation="MKKIVLAAICSAAIGGLSIGQAAAQTTGPAPQDSMKMNDGMSKGG
FT                   MSDPGMKKTTTGMSKSSKAKATKKSMKSDKMNNMEK"
FT   gene            complement(158217..159605)
FT                   /locus_tag="RPD_0139"
FT   CDS_pept        complement(158217..159605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0139"
FT                   /product="Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37379"
FT                   /db_xref="GOA:Q13EW0"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW0"
FT                   /protein_id="ABE37379.1"
FT                   /translation="MSSSASQPRTTDSAAPGVSLAEATSAWAKIALLSFGGPAGQIAVM
FT                   HRIVVDEKRWVSEERFLHALNYCMLLPGPEAQQLATYLGWLMHGTRGGLIAGGLFILPG
FT                   ALAIMVLSVIYVSFGQLGIVAALFFGLKAAVLAIVLQAVSRVGARALKTSATRALAALA
FT                   LLAIFVFDVPFPLIVLGAGLIGWLGSRAGLAGFSPPTSSTAVVATNEDGARVDAVTAAG
FT                   GTPGEALRVALVWLVLWLTPVAALLIGLGPDNVFSQLAVFFSKMALVTFGGAYAVLAYV
FT                   AQLAVDHYGWLKPGEMLDGLGMAETTPGPLIMVLQFVGFVAAFRTPGALPPLVAGALGG
FT                   LLTTWVTFAPCFLWIFLGAPYVERLRGNAALSAALAAITAAVVGVMLNLALWFAIHTIF
FT                   REVRKLSVAGLTLELPVLSSINPSAALLSALAIVAVFGFRMGTATVLLICASAGFALHF
FT                   LGAL"
FT   gene            complement(159602..160213)
FT                   /locus_tag="RPD_0140"
FT   CDS_pept        complement(159602..160213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV9"
FT                   /protein_id="ABE37380.1"
FT                   /translation="MSRPQLLPESPSEQDTAKFLRRFSELVAVGQSASYLRHAAGLIDE
FT                   LIDRVRQTEALLHQQTADNADNLALRRRAEAEAMAARQELAPHAEALADLQDKFVCAQH
FT                   SFAAERADLTGRIARAESRLAEADAELRRLRARLAAIGPTHAIVPMQTLRLLQTQLAAL
FT                   AGEFQRGGDLVSVAMCEVSICVIDQTLAAEPGRRSTATSA"
FT   gene            complement(160419..160742)
FT                   /locus_tag="RPD_0141"
FT   CDS_pept        complement(160419..160742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37381"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV8"
FT                   /protein_id="ABE37381.1"
FT                   /translation="MASRSAPDRAGLPGLISRSRLIAVACLVIAGAGVTTSPVSAQSCQ
FT                   ALWVERNSYYKEAGYCFKTSRAIGYFGNRGCSYDYEGDVPLSVNIRDRIAEIKAMERRF
FT                   GCN"
FT   gene            160993..161466
FT                   /locus_tag="RPD_0142"
FT   CDS_pept        160993..161466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37382"
FT                   /db_xref="GOA:Q13EV7"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV7"
FT                   /protein_id="ABE37382.1"
FT                   /translation="MSDTMYDVFKFLHVVGVVVLVGNVTITAFWKAFSDLTRDPKIVAH
FT                   AQRGVTVSDLIFTLLGIVLVMVGGYGAAIVKDVPLFSSFWLVAGQILFAISGMMWLGIL
FT                   VPLQIRQARLARSFADGSDIPERYWRDTRTWLIWGIIATVPLVAAIFVMVVKF"
FT   gene            161499..161972
FT                   /locus_tag="RPD_0143"
FT   CDS_pept        161499..161972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37383"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV6"
FT                   /protein_id="ABE37383.1"
FT                   /translation="MTVEQIAPVVDREALLPGAQFIDAYSVTIGDNALDAREAATRMVE
FT                   HGPRWIGTLMRLRNIVVTPFGLKTPAPGGSARGDRIGSFPVLSETPTRIVAGFDDSHLD
FT                   FRIVVDVVDGAAGRRVIASTLVLTHNRLGRTYLAAIMPFHRLVVRAMLGRVAQ"
FT   gene            161969..162517
FT                   /locus_tag="RPD_0144"
FT   CDS_pept        161969..162517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37384"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV5"
FT                   /protein_id="ABE37384.1"
FT                   /translation="MKRRRNFGGRRRLPKVDGETNHNGGLSAPDEKTAALARAFDSAWE
FT                   RFIATEGAEADTDANRKRLASKIVALSRAGEADEDRLAQSGLIHLSVLAEAARLGSQPP
FT                   APTNGIGTSQQATHAQAFSPQTVAAMSAALEQCVETLPLQTPSSALQFLSARILEQASR
FT                   GEHDPERLSRHALEALRNR"
FT   gene            complement(162595..163710)
FT                   /locus_tag="RPD_0145"
FT   CDS_pept        complement(162595..163710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37385"
FT                   /db_xref="GOA:Q13EV4"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV4"
FT                   /protein_id="ABE37385.1"
FT                   /translation="MKRFWSRYPAHWRPRRPQWGLALRITLGALLALAAAQALHLRLPL
FT                   WAVLTAIIVTQLSVGRSVKIAFDYLVGTIGGAIYGGAITILVPHSSELALLGVLALAVA
FT                   PLALLSAIKPNLNVATVTAIIVLLVPTMTQVSPLDSAIDRVLEVTVGALVGLLVSFLVL
FT                   PSRAQAQALGAAAQALDLMAVALGELLAGLIRGLDNDALHRLQDGIGAALVTLNEIGDE
FT                   AEHERATGLSRGPQMAPLIRTLLRLRHDLVMVGRAVAAPLPPPLQQRLGPCLDSFRAAA
FT                   TLHLAASASALRDRRAPPPLRAVSSALDAYAAEVQTVRQDGLTRDLSGEQAERFFALGF
FT                   AMEQLTQNFRDLEMRVAEWAARPVVETPAAV"
FT   gene            163879..165252
FT                   /locus_tag="RPD_0146"
FT   CDS_pept        163879..165252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0146"
FT                   /product="MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37386"
FT                   /db_xref="GOA:Q13EV3"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV3"
FT                   /protein_id="ABE37386.1"
FT                   /translation="MANETATLAGYVAALRFEDIPQDVLARAKVLTLDFLGSAIRARRE
FT                   AESTPSLLAMLQALSLDGDGAATVFGDAKRWTPAMAALLNGALGHSLDFDDTHADSSLH
FT                   PSAPVVPAAFAVGELVGASGREVLTAIVAGYEVCCRLGNALDPTSHYARGFHPTATAGA
FT                   YGAAAAAAKLFGLTQDQIVAAFGVSGSQAAGSLQFLVNGAWNKRYQVGAAAMNGVIAAT
FT                   LAKNDFIGATESVEGIHGLLVGYTDTPHHDKAVADLGRVYETMKIGVKPYPSCRYTHAA
FT                   IDALIAMRREHNLTPDQVKRVEIGLHRNGITLTGDAATKRHPSSIVGGQFSMFFTGALA
FT                   LEQGSFGWDDYTRLGDPAIDALADRFDVVQDARLEGKTHPFGARVSITTDDGVHERIYA
FT                   DPSGEPNAFPTDQAMAQKFLQLARPVLDGRAQQFADAILTLERFDRVATATALGQPAS"
FT   gene            165321..165929
FT                   /locus_tag="RPD_0147"
FT   CDS_pept        165321..165929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37387"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV2"
FT                   /protein_id="ABE37387.1"
FT                   /translation="MQRFVCEQNILHFQKLLDGPTDATLRRTLLTLLSSAKRELALLNS
FT                   HTSGADLSPALSRRKHTGDLESVLRQLRPGFETSAHPYMLIHPGPGLKIIDINAAFSRA
FT                   TFSDRRDIVGRQLFEVFPDNPAIGTADGVSNLYASLRTVVETGQPHAMIVQRYDVRDRT
FT                   GGFIERYWQPINTPVHDSGERLICLLHHVEDVTAEVLAN"
FT   gene            166201..167619
FT                   /locus_tag="RPD_0148"
FT   CDS_pept        166201..167619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0148"
FT                   /product="Malonyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37388"
FT                   /db_xref="GOA:Q13EV1"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV1"
FT                   /protein_id="ABE37388.1"
FT                   /translation="MPSASVDRASEILGGLLTSLTERGRNLFRSSGDQPKTKEELIALG
FT                   EALLSRRGEATGVAMASSLLSGYDGATDEDQLGFLDALAEHFGPDLAQLTAAVEAFHVS
FT                   GASADAAGQLLKAAEPRRQELIRRLNLAPGGTASLVQMRETVLSHLRDHPQLKHVDDDF
FT                   VHLFTSWFNRGFLVLQRIDWNTPANILEKIIRYEQVHAIHNWDDLRARLAPADRRCYGF
FT                   FHPQLVDEPLIFVEVALTLDRPAAIAPLLDLGREPIAARSATTAVFYSISNTQKGLAGI
FT                   SFGNFLIKQVVEEIKRELPNVQSFVTLSPVPGFAKWLKRERAADESALLDDTARAALDV
FT                   LDTPDWFDQPELAEQIRPIMLPLAAAYFLQAKNPRGQPQDPVARFHLGNGARLESLNFL
FT                   GDRSPNGMRQSHGLMVNYLYALGEIEDNHEAFVERGQVAAASAVRRQLPSKPLSSEPRK
FT                   SNGAARRDGAQSPA"
FT   gene            167670..168587
FT                   /locus_tag="RPD_0149"
FT   CDS_pept        167670..168587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0149"
FT                   /product="Pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37389"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV0"
FT                   /protein_id="ABE37389.1"
FT                   /translation="MSWMPTDDPLLGDPKTCDALELIIVPRTRDLGDGFAVRRALPHGK
FT                   RQMVGPFIFFDHFGPVQFIPGKGMDVRPHPHIGLSTVTYLFDGTIMHRDSEGNIQEIAP
FT                   GAMNLMTAGRGIAHSERTPEMQRRDGQSMLGLQSWIALPAGSEEIAPSFQHFAAATLPT
FT                   VTDTGFTARVIAGSAFGEASPVTMVSPWFYVEVNARAGATVPLDPDHEERAIYLVDGEI
FT                   EIAGDRHSGPSLLIFRPGDRITVRVMTDTRMMFLGGDALEGPRHIWWNFVSSSKERIEQ
FT                   AKQDWKTGRFAAVPDESEFIPLPE"
FT   gene            168656..169573
FT                   /locus_tag="RPD_0150"
FT   CDS_pept        168656..169573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0150"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37390"
FT                   /db_xref="GOA:Q13EU9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU9"
FT                   /protein_id="ABE37390.1"
FT                   /translation="MTTMLTSDLPLNKIGRGKVRDIYAVDDERLLLVTTDRISAFDVVM
FT                   AETIPMKGAVLTQISAWWFDQLGGVVPHHMISADAAEIIDAVPALKDHRAALAGRAMLC
FT                   RRTTVFPIECVIRGYITGSAWKEYAASGTLAGETLPAGLQESERLAPPIFSPATKAETG
FT                   HDENITIARMREIVGDETAYTLESMTRAVYTQGEAIAREQGIIIADTKFEFGRDANGRI
FT                   ILIDEVMTPDSSRFWAADSYAPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPPKLPAE
FT                   VVAATSARYLDAYRRLTGTDLVVK"
FT   gene            169820..170602
FT                   /locus_tag="RPD_0151"
FT   CDS_pept        169820..170602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0151"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37391"
FT                   /db_xref="GOA:Q13EU8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU8"
FT                   /protein_id="ABE37391.1"
FT                   /translation="MPQNTVLIERDGPVTIISINRPERRNAVDGATAQKLFDAFLAFDA
FT                   DETASVAVFTGTGGSFCAGADLKAVAAGDIEKKREIAGHNTIAPMGPSRLRLSKPVIAA
FT                   IEGYAVAGGLELALWADMRVAAEDATFGVFCRRFGVPLIDLGTIRLPRLIGHSQAMDMI
FT                   LTGRPVSGIEAHRMGLANRLVHRGEAALHAITLAKEIAKFPQACMRADRLSALQQWDMP
FT                   EEDAIMNEMRGGLQVIASGETLSGAERFTAGEGRHGKF"
FT   gene            complement(170705..171424)
FT                   /locus_tag="RPD_0152"
FT   CDS_pept        complement(170705..171424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0152"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37392"
FT                   /db_xref="GOA:Q13EU7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU7"
FT                   /protein_id="ABE37392.1"
FT                   /translation="MPANSDEQLSQSGFAEAPHYHGHRERLRERFREAGADALSDYELL
FT                   EMVLFRALPRRDVKPLAKALIARFGSFAETMHAPEPRLREVSGLGEAAITEIKLVAAAA
FT                   ARVTKGQVKSRTVLSSWSAVIDYCRTTMAFADKEQFRILFLDKRNQLIADELQQVGTVD
FT                   HTPVYPREIVKRALELSATAVIMVHNHPSGDPTPSQADIQMTRTIVAIAEPLGVSVHDH
FT                   IIVGKNGHASLKGLKLI"
FT   gene            complement(171562..173370)
FT                   /locus_tag="RPD_0153"
FT   CDS_pept        complement(171562..173370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0153"
FT                   /product="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37393"
FT                   /db_xref="GOA:Q13EU6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU6"
FT                   /protein_id="ABE37393.1"
FT                   /translation="MARVSIRALSVAVFLGLALIVFLNLSSFFLYQGAQGEISEAQTSR
FT                   YQSYLLADELRQSSDDLTRLVRTYVVTGDAKFEQQYWDVLAIRNGEKPRPDQYQRIYWD
FT                   FMAADGRKPRPDGVNASLQQLMERGGFSAEEFGKLKQAQNNSNELIKLETIAMNAVKGR
FT                   FEDRDGKFTKTGAPDTALARELVHSADYHKYKAQIMAPIDEFFVLLDRRTGANVAIAEA
FT                   KAALYRTVSIVFLGLLLVSALVIGWVMLRGIARPLRSLSVSMNKLAEGDFNVALPGLDA
FT                   RNELGEVARAVERFKVKAEEKGQAEAEALLKQDQIAASQRRKDTHKLADDFEGAVGRII
FT                   DTVSSASSELESSAGKLTSTATRAQQLATLVAGASEEASTNVQSVASATEELSASVNEI
FT                   SRQVQDSARMASEAVDQARRTNDRVGELSKAAARIGDVVELINTIAGQTNLLALNATIE
FT                   AARAGEAGRGFAVVASEVKALAEQTAKATGDIGQQISGIQAATQESVGAIKEISGTIER
FT                   LSEISATIASAVEEQGAATLEISRNVQQAAQGTQRVSSNIADVQNGASETGSASSHVLS
FT                   AAQSLSNDSNRLKQEVGRFLDSVRAA"
FT   gene            173763..174749
FT                   /locus_tag="RPD_0154"
FT   CDS_pept        173763..174749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37394"
FT                   /db_xref="GOA:Q13EU5"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU5"
FT                   /protein_id="ABE37394.1"
FT                   /translation="MAPRANWKGFLRLSLVTCPVALFPATSDAEKISFNQINRKTGNRI
FT                   KYTKVDADTGEEVSSDDIMKGYKVDTDSYIEITKDELDAIALESTRTIEIDQFVPKSEI
FT                   DDLYLVRPYYIVPDGKVGHDAYAVIRETIRTMDRVALARVVLTNREHVIALEARDNGLM
FT                   GMLLRYPYEVRDASEYFDDIQDVKITKDMLDLARHIVEQRSGHFEPDKFEDHYEAALTE
FT                   LINQKRNGQPIAPKARPRGDNVVDLMDALRKSLGGAKPAPAAGKAASAEKPAAKPARTK
FT                   KRKTAPGQKEMLLPISGAKSAAAKQDAGKAKKPARSSTASSKARKTG"
FT   gene            complement(175023..175847)
FT                   /locus_tag="RPD_0155"
FT   CDS_pept        complement(175023..175847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0155"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37395"
FT                   /db_xref="GOA:Q13EU4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU4"
FT                   /protein_id="ABE37395.1"
FT                   /translation="MSYVDASETSLRKTGQIKLHGAAGFAGMRKAGQIVAQCLDELVDI
FT                   VKPGVPTSLIDDFVRDFAFSHGAFPATLMYRGYRYSTCTSINHVVCHGLPGDRPLKEGD
FT                   IVNVDVTMIVDGWYGDSSRMYPIGPIARKAERLIEVTYESLMRGIAAVKPGATTGDIGH
FT                   AIQSFVEPQQMSVVRDFCGHGLGRLFHDEPNIIHVGSPGQGAVLKPGMFFTIEPMINLG
FT                   KPYVKILSDGWTAVTRDRSLSAQFEHSIGVTADGCEIFTLSPKGLDKPPLQG"
FT   gene            complement(175945..177258)
FT                   /locus_tag="RPD_0156"
FT   CDS_pept        complement(175945..177258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0156"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37396"
FT                   /db_xref="GOA:Q13EU3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU3"
FT                   /protein_id="ABE37396.1"
FT                   /translation="MIDLTQAYEALLAAASSVGAEITSPWFYAQLGMILAALGIGLGGG
FT                   ALIKARVDMTTLTMGWPAPLRMFLRVVIDSAWTAIFALVVIAVRLAMLQMTWPSRSYLI
FT                   GVSAKLALAWLMIRLVTSILRNPFLIRVVSLSAWCVAALSIIGQLFPVLDALDSVAIEI
FT                   GELRLSPFLILKLGVLLAIALWLASIASNFFEGRINQSRDLTPSIQVLLIKLMRIGLMA
FT                   AAIALTMSAVGINLQALAVFSGAVGVGIGFGLQKIFANFISGVILLVDKSVKPGDLVTI
FT                   GDNSGRISAMNTRYISVAAGDGREFLIPNEDLITQKVVNWTYTDKNTLVKVAFATNYDA
FT                   DPRTVCRLAIDVAAAVPRASKAKSPGCILTEFTETGMKFALTFWIGEPDGMDGVKSEAM
FT                   LGLWDAFRREGIGVPYPVREIRVRNGALPAETIVEVPQ"
FT   gene            177483..179273
FT                   /locus_tag="RPD_0157"
FT   CDS_pept        177483..179273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0157"
FT                   /product="sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37397"
FT                   /db_xref="GOA:Q13EU2"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU2"
FT                   /protein_id="ABE37397.1"
FT                   /translation="MDSLDTVSITILLGAILVMAGILSSLLALRFGAPLLLVFLVLGML
FT                   AGEAGPGGLRFDDLSTTYLVGSVALALILFDGGLRTRFQTIKAVLAPSMGLATAGVLLT
FT                   ALITAPVAHYALDLSWTEALLAGAVVASTDAAAVFLLVHSQGLRLRPRVGATLEVESGT
FT                   NDPFAVFLTLMLVELITRGGSTIWYVIFEFVREAALGTVIGVVGGRAVVMALNRVALPQ
FT                   GLHAPFVTTAALVVFGAAQMLHASGFLAVYLAGMIIGNQPTRAHNSVVAFLDAATWLAQ
FT                   IVMFVLLGLLVSPQRLMMSIGPAVLVALALMLVARPVAVFLCLAPFRFNWRERLFIAWV
FT                   GLRGAVAIFLASIPMMVGLPKAHLYFDVAFVVVIISLLLQGWTLGPAARKLHIALQRTD
FT                   RGPRRIELDLPGQLEQQLVGYAVRPKSLFLRRGLVPSWSKPTLVIRDERILTPEEADPV
FT                   AAGDYVYLLAPPEKAEALDRFFVDMPPSTAPDPHLLGDFVVPGETSLGDLAAAYGVSVQ
FT                   AGEEALTLADYFDIHLDRAPTVNATVALDSIVLVARSLGGGRVNVVGLRLPEDDDAPPP
FT                   TRVQKARRKLSKVWSTLSGV"
FT   gene            complement(179274..180227)
FT                   /locus_tag="RPD_0158"
FT   CDS_pept        complement(179274..180227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0158"
FT                   /product="murein endopeptidase. Metallo peptidase. MEROPS
FT                   family M74"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37398"
FT                   /db_xref="GOA:Q13EU1"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU1"
FT                   /protein_id="ABE37398.1"
FT                   /translation="MRRRSIPARWLLAAALLSASAAAAWAQDKGTVNPKPLPPLANPND
FT                   PELAARELFARRYLPAALPARPIGFYARGCLAGGEALPLTGATWQVMRLSRNRYWAYPP
FT                   LVALVERLSKRANSEAGWPGILVGDMSQPRGGPMLTGHASHQVGLDADIWLTPMPNRQL
FT                   SRNEREEMSAVMMVRRDRLDIDPAAWTPTHHRVIRAAAQEPAVERIFVNAAIKKALCRE
FT                   AKGDRGWLNKVRPMYGHDYHFHIRIKCPPGAIGCEAQPEPPQGEGCGADLDYWFSDAVL
FT                   HPKPPKEPPKPKKPMTLADLPAECRAVLNAPDQKPD"
FT   gene            180631..182859
FT                   /locus_tag="RPD_0159"
FT   CDS_pept        180631..182859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0159"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37399"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU0"
FT                   /protein_id="ABE37399.1"
FT                   /translation="MPQIRLKANKTSKRCAGAALRKRRRAVRKGPGPSTVPKRPVRAGL
FT                   AAERERAVAQALAEARKSHERLREAIDLVPQGIVFLDSEGRYILWNKRYAEIYKASADM
FT                   FKPGARFQDTLRVGIARGDYPEAIGREDDWIAERMQRMFHPSHSHEQILADGRCIQIEE
FT                   CTTSDGGVIGLRVDITELKQREASFRLMFDSNPVPMIVCALRDERILAVNDAAVAHYGY
FT                   SSVEFAQLTLRRLQAFESDLPWAGDHTDDERAARTWKHVKADGSLIDLAIYSRQLTYNG
FT                   EPAVLLALMDITERKRAEMRLAFMTHHDGLTGLPNRNLLRKRLDELLVHTRRASDKIAV
FT                   LFIGIDHFKAVNDTLGHAIGDKLLRGVARRLRSTLREEDLLARLNSDEFAVVQTGIRRP
FT                   QEITLLAKRLLNAIAEPYLLDGHSVVAGASIGIAVAPVDGDDSEKLLMNADMALSRAKN
FT                   DSRGSFSFFEPGMDARAQARRKIETELRTALRNEVLRPYYQPLVELSSGRISGCEALVR
FT                   WPHPDRGMISPAEFIPVAEDTGLINAIGAQVLRQACLDASRWPGDIRVAVNLSPLQFRV
FT                   GNLMATVMDALKYAGLPPHRLEIEITETLLLEKSSQVIATLHALRALGVRISMDDFGTG
FT                   YSSLSYLRSFPFDKIKIDQSFVRDLCNNREAQAIVRAIISLGMGLGVTITAEGVETEAE
FT                   LSWLRAEGCHEAQGFLFSAARPNEEIKGLLDLQQSAAPDQQFPAARVA"
FT   gene            complement(183064..184008)
FT                   /locus_tag="RPD_0160"
FT   CDS_pept        complement(183064..184008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37400"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET9"
FT                   /protein_id="ABE37400.1"
FT                   /translation="MGVVLDAIGKVIANYLQKEEPGYEPFTPSDPDHLRSIMQPGDVLL
FT                   VEGNARISGIIKYLTQSTWSHAALYVGPIDGATEPDGEPHVLIEANIGEGVSSSPLSRH
FT                   LSYHTRICRPVGLSHEDRHTVCRYAINRIGFGYDTKNIIDLMRYLVPLPVPQRWRRRMI
FT                   ALGSGDPTKIICSALIAQAFDSVRYPILPKITRAGSRKARREILHIRDSSLYMPRDFDI
FT                   SPYFEVVKPTIINGFDYTALHWADKQKPLAEVAGPFNTFQDDLENASSFAPETIDAEAP
FT                   AMGGANQAPAVILSRTHWQHPEPRTLAPLEASS"
FT   gene            184346..185770
FT                   /locus_tag="RPD_0161"
FT   CDS_pept        184346..185770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0161"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37401"
FT                   /db_xref="GOA:Q13ET8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET8"
FT                   /protein_id="ABE37401.1"
FT                   /translation="MTISRRSLLGAAAGLVVLPAFASRAFAALPREVDVVVVGAGAAGI
FT                   AAARRIVAAGRKVIVVEASAQAGGRCLTDADGFDAPFDRGARWLHNPDSNPIIRLARSV
FT                   GVDIVPAPPGQKIRIGRRNARARETEDYLATLVRASRAIDDAARGKVDVASAAALPNDL
FT                   GDWGATIAFVLGPHVSGKDLKELSALDESRAPDRNALSGARQGLGTLLSRLAAPLPLAL
FT                   STPVTRIVWNGRDTGVETASGRITARAVIVTASTNVLASGAIKFTPELPKRQLDAAAKL
FT                   GLGSYDRIALQFKGNPLGLSRDEVIVEQSNSARTAALYANINGSSLCTVDIGGAFGRDL
FT                   SAQGEAAMQAFALEWLGKLFGSDITAAVERKAATRWNASPFVLGAMSAAAPGGQPSRKV
FT                   LAEPLGNLFIAGEATSETLWGTVQGAWESGDRAAEAALKRIGALKSDEPAKPERKPKKR
FT                   RTYEATGAAEQWPGLR"
FT   gene            complement(185997..188471)
FT                   /locus_tag="RPD_0162"
FT   CDS_pept        complement(185997..188471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0162"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37402"
FT                   /db_xref="GOA:Q13ET7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET7"
FT                   /protein_id="ABE37402.1"
FT                   /translation="MSQLQHSARRQHSARRKSQPMKLTLSWLKDHLDTDETLTALADKL
FT                   TMIGLEVEDITDKAKALAPFTIARVLSAEKHPNADKLQVCSVDTGDGGAPVQVVCGAPN
FT                   ARAGLITVFSPPGTFIPGKNITLGVGNIRGVESRGMLCSAAELQISEDHDGIMELPADA
FT                   PIGKAYAEWAGLGDPVLDINLTPNRQDCAGVHGIARDLAAADMGKLKESGIKPIKGEFP
FT                   CPVQVSVEDDKLCPGFALRLVRGVKNGPSPEWLQKRLTAIGLRPINALVDITNFLTFDR
FT                   SRPLHVFDAAKVKGNLVVRRARDGETLLALDGRNYNLDPGVCVIADDHGVESLAGIMGG
FT                   EASGCSAETTDVLIESALWNEINIAQSGRKLGINTDARYRFERGVDPAFMVPGLDLATR
FT                   LVIEFCGGTPSEMVVVGRTFGDDRIIDFPLSEVKRLAGIDVPLAEARRILTHLGFMVAG
FT                   QGAVVKVAAPSWRSDVHGKADIVEEIVRIVGVDKVPMTPFERGDAPRKPVLTPIQTRTR
FT                   RAKRALAARGLTEAVTWSFIAKPSAEAFGGGQPELALANPIASDLSDMRPSLLPGLVAA
FT                   AQANADRGTPDLALFEVGQIFKGDRPQDQFVAASGVRRGVASSNGLGRHWSGSAPASAL
FT                   DAKADAFAVLAAAGAPMAGLQIATGKALPAWLHPGRSGAIQIGPQNVLGYFGELHPRVL
FT                   EQLHADGPLVGFEVILDNIPAAKQRPTRAKPSLELSAFQPVSRDFAFIVDRKVQAADIV
FT                   RAAQSIDKKLISSVVVFDVYEGKGVDPDKKSVAIAVSLQPRDKTMTDQEIDAVGAKIVA
FT                   EVTKKTGGVLRG"
FT   gene            complement(188553..189137)
FT                   /locus_tag="RPD_0163"
FT   CDS_pept        complement(188553..189137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0163"
FT                   /product="protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37403"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET6"
FT                   /protein_id="ABE37403.1"
FT                   /translation="MMKALSSPHDALPRPLAGEGWGEGDTGTELAMDDPKQPSWNVSPS
FT                   LRRHARELRKTSTDAERLMWSALRDKQLNGFSFRRQVPIGPFIADFACHSVKLVVEIDG
FT                   GQHFSDDAERADASRTALIEARGFRIVRFSNAEVMSNRDGVLQSIAAELAASAPTPTLP
FT                   RKRERERAKRAAKQRPEQIDSKQRPAAGDAD"
FT   gene            complement(189275..190357)
FT                   /locus_tag="RPD_0164"
FT   CDS_pept        complement(189275..190357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0164"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37404"
FT                   /db_xref="GOA:Q13ET5"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ET5"
FT                   /protein_id="ABE37404.1"
FT                   /translation="MSNLENLQTQILADIAASSDEAALEAVRVGALGKKGSISALLATL
FT                   GKMDPEQRKTEGAAINLAKEAVTQALTARRDLLKAAALDAKLAAETIDVTLPLREPLAE
FT                   QGRIHPLSQVWDELTAIFADMGFAIAEGPDIETDDNNFTRLNFPEGHPAREMHDTFYFN
FT                   PKEDGSRLLLRTHTSPVQVRTMLSQRPPIRVICPGRTYRSDSDQTHTPMFHQVEGLVID
FT                   KGSHLGHLKWILAEFCKAFFEVDNVNMRFRPSFFPFTEPSLEVDIQCRRGNGEIRFGEG
FT                   EDWLEILGCGMVHPNVLTACGIDPEVYQGFAWGMGIDRIAMLKYGMADLRQLFEADSRW
FT                   LNHYGFKPLDIPSLAGGLSS"
FT   gene            complement(190501..190860)
FT                   /locus_tag="RPD_0165"
FT   CDS_pept        complement(190501..190860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0165"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37405"
FT                   /db_xref="GOA:Q13ET4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ET4"
FT                   /protein_id="ABE37405.1"
FT                   /translation="MARVKRGVTAHAKHKKVYKLAKGFRGRRKNTIRAAKAAVDKAGQY
FT                   AFRDRKRKKRTFRALWIQRINAAVRPLGMTYSVFINGLAKSGVIVDRKVLSDLAITEPA
FT                   AFQAIAEKAKAALAA"
FT   gene            complement(190948..191148)
FT                   /locus_tag="RPD_0166"
FT   CDS_pept        complement(190948..191148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0166"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37406"
FT                   /db_xref="GOA:Q13ET3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ET3"
FT                   /protein_id="ABE37406.1"
FT                   /translation="MPKLKTKSGAKKRFKVTATGKVMSAQRGKRHGMIKRTKKQIRQLR
FT                   GTRVIFKTDGDNIKKYFLPNA"
FT   gene            191512..191937
FT                   /locus_tag="RPD_0167"
FT   CDS_pept        191512..191937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37407"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET2"
FT                   /protein_id="ABE37407.1"
FT                   /translation="MNAPARSHARRFFPGITRTGLLAAAALLAALVAASGDAEAAKRRA
FT                   GGNFDGVWNVVFATRAGNCGPTYNAPFAVQGRRVSSAGGGKVTGGITGGGNVAVRLSVG
FT                   ASVANGRGRLAGNSGTGTWSGLIEGDRCSGTWQATRG"
FT   gene            complement(192320..192718)
FT                   /locus_tag="RPD_0168"
FT   CDS_pept        complement(192320..192718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0168"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37408"
FT                   /db_xref="GOA:Q13ET1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET1"
FT                   /protein_id="ABE37408.1"
FT                   /translation="MAMEAGMDLVEISPNVSPPVCKIMDYGKFKYSAQKKAAEARKKQK
FT                   IVEIKEIKLRPMIDDHDYDVKMKAMQRFFEEGDKVKITLRYRGREMAHQEIGTKLLEKV
FT                   KADVAEIAKVEQDARFEGRQVVMVLAPR"
FT   gene            193195..193992
FT                   /locus_tag="RPD_0169"
FT   CDS_pept        193195..193992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37409"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET0"
FT                   /protein_id="ABE37409.1"
FT                   /translation="MTNSAAAPKGSDPAFISVGEGAAERRIAVRARAGHAPGLFWLGGF
FT                   NSDMTGTKAVALDGWAAERGRACVRFDYSGHGSSSGAFADGTISRWLEDSLAVFDRFAT
FT                   GPQVVIGSSMGGWMALLLARELIRRGGEGQTKLAGLVLIAPAPDFTEALMWKGFSPEIR
FT                   RQIETEGVWMRPSDYGDAYPITRALIEDGRNHLLLGGAISVGCPVRILQGKQDPDVPWT
FT                   HAFALTERLPCEDVVLTLIQDGDHRLSRPQDIARMLAAVEEIG"
FT   gene            complement(194098..195240)
FT                   /locus_tag="RPD_0170"
FT   CDS_pept        complement(194098..195240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0170"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37410"
FT                   /db_xref="GOA:Q13ES9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES9"
FT                   /protein_id="ABE37410.1"
FT                   /translation="MAKQGQALGFDAIGICAPDSIPFALDRLRDYLASGFHGEMAWLAD
FT                   RPERRTDPRVMWSEVRSVVMLGVNYGPQSDPRHILGAKDRGAISVYAQGDDYHDVIKAR
FT                   LKQLARWLVATAGGEVKVFVDTAAVMEKPLAQAAGLGWQGKHSNLVSRELGSWLFLGAI
FT                   FTTLELPRDAAERDHCGSCRACLDSCPTAAFPEPYRLDARRCISYLTIEHKGPIPHEFR
FT                   QPIGNHIYGCDDCLAACPWNKFAQVGREAKLAARDALRAPALGELVRLDDAAFRALFTK
FT                   SPVKRIGRDRFIRNVLIAIGNSGDAELAGEAERLLVDAHPVVRGAAVWALAQLLPGDQF
FT                   AALKAARLGDEPDESVRAEWVGALPSPLVGEGGTDAVRAG"
FT   gene            complement(195300..195992)
FT                   /locus_tag="RPD_0171"
FT   CDS_pept        complement(195300..195992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0171"
FT                   /product="glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37411"
FT                   /db_xref="GOA:Q13ES8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES8"
FT                   /protein_id="ABE37411.1"
FT                   /translation="MYTLFHHPFCPQSRFVRLALGEHGLDLRLVEERSWERRTAFLALN
FT                   PAGTTPVLVAEGQPPIPGAGVIAEFLDESHGAALGDRRLLPHGTAERIEVRRLLAWFNE
FT                   KFFEEASGPLVTERIYKRFMSEEDGGGPPAMDVIRAATANVRYHLAYIGWLARTRNFLA
FT                   GDRMTYADLAAAAHLSAIDYLGDVPWIEDEAAKAWYARIKSRPSFRPLLSEWLAGVPAS
FT                   RTYVDLDF"
FT   gene            196204..197010
FT                   /locus_tag="RPD_0172"
FT   CDS_pept        196204..197010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0172"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37412"
FT                   /db_xref="GOA:Q13ES7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ES7"
FT                   /protein_id="ABE37412.1"
FT                   /translation="MLFDIFRAVILGVVEGVTEFLPVSSTGHLLLVGRFFNLGEDSFWK
FT                   SFAVLIQLGAILAILSIYFAKLWRIALGMFSDPAARRFVIGVLVAFLPAAMIGAVAGSY
FT                   IKLYLFNPWVVCFSLIVGGAILLWVDQLDLNPQQHDATAFPLPMYFYIGCAQCLAMIPG
FT                   VSRSGASIVAAMLFGADKRSAAEFSFFLAIPTMVGAFVYDFYKNRGEMTTDHLTIVAIG
FT                   FVVSFITAVIVVKTFLGYVTRHGFELFAWWRVIVGTLGLIALAMGR"
FT   gene            complement(197071..198036)
FT                   /locus_tag="RPD_0173"
FT   CDS_pept        complement(197071..198036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0173"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37413"
FT                   /db_xref="GOA:Q13ES6"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES6"
FT                   /protein_id="ABE37413.1"
FT                   /translation="MNTNIDTLVTVFGGSGFIGRHVVSALARRDYRIRVAVRRPELAGH
FT                   LQPLGRVGQIHAVQANLRHPASVAAAMRGAHVAINLVGILAEGGAQKFDAVQAEGAAAI
FT                   AKAAAAVGARMVHVSAIGADANSPAGYARSKAAGEQAVLSAVPQATILRPSVVFGPEDQ
FT                   FTNRFAALARISPVVPLVGADTKLQPVYVGDVATAVAEAVDGNTRPGATYELGGPEQLT
FT                   MREIIEIILETIDRKRMLLPLPFGLARMQAMLLQFAPGDLKLTPDQVELLKVDNVVSDA
FT                   AKSAGLTLQGLGVTPDSMQAIVPSYLWRFRKTGQFARKGA"
FT   gene            198196..198282
FT                   /locus_tag="RPD_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            198196..198282
FT                   /locus_tag="RPD_R0003"
FT                   /product="tRNA-Leu"
FT   gene            198454..199068
FT                   /locus_tag="RPD_0174"
FT   CDS_pept        198454..199068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0174"
FT                   /product="3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37414"
FT                   /db_xref="GOA:Q13ES5"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES5"
FT                   /protein_id="ABE37414.1"
FT                   /translation="MTIRLHRGDLPDLSRYTNSVAIDTETMGLHPHRDRLCVVQLSNGD
FT                   GSADVVQIPQGHSDAPNLKKLLGDPTVVKIFHFARFDLAALYNAFGVMPQPVYCTKIAS
FT                   RLTRTYTDRHGLKDLVRELLNVDLSKQQQSSDWGAETLSDAQLAYAASDVLHLHGLREK
FT                   LDAMLARENRTDLAQACFGFLPHRSRLDLDGWSEEDIFAHS"
FT   gene            199311..200081
FT                   /locus_tag="RPD_0175"
FT   CDS_pept        199311..200081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37415"
FT                   /db_xref="GOA:Q13ES4"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES4"
FT                   /protein_id="ABE37415.1"
FT                   /translation="MASVQTAAYHTSMEARFAAAARHSRLVRTLRVAVPLVVALSLAAI
FT                   LAISIFNPFRLLSKLPIDIGDLVVSGTKITMESPHLAGFTNDGRPYEMWARSATQDLTS
FT                   QDHVDLHTLRAKVVSDDQSTVLIQARDGKFNTKAQLLNLQKDVYLRTSTGSEAWMTQAD
FT                   IDMGKGNVSSDEPVDVKWLGGTLRGQRLRITEKGDVIRFEGGVVMNLDNANLPEPAEET
FT                   DTRAQPAPAAVPNADAAAKSKSSQPGQRREVNRP"
FT   gene            200078..200743
FT                   /locus_tag="RPD_0176"
FT   CDS_pept        200078..200743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0176"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37416"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES3"
FT                   /protein_id="ABE37416.1"
FT                   /translation="MTNARCLLARRKLLAIAGAAFLAGSANLSGALAQSAVQGVPNAMQ
FT                   GFSQNRDQPIQIESDTLEVRDKKKEATFTGSVKVVQGDTTMTSKTLVVFYDQDQSETSA
FT                   KQAKRKAMPAAAPGPGGTSSIRRLEAKGNVVVTQKDQVVTGDSAVFDTKTNLVTMLGSV
FT                   VLTQGKNVVRGDRLLVDMTTGVSRVESNSGRVQGLFQSSGSGSGAPLGIGPPPAGQKK"
FT   gene            200801..201754
FT                   /locus_tag="RPD_0177"
FT   CDS_pept        200801..201754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0177"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37417"
FT                   /db_xref="GOA:Q13ES2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES2"
FT                   /protein_id="ABE37417.1"
FT                   /translation="MVDLLGMFRRRAAKPSGFGRTRMDITALQGEVGDMLTAPVRDAPP
FT                   VAHAGATEPTQTPTPAPARPRRPAATQPRESHTGYLAVHRVEKSFGTRKIVRGVSIYVR
FT                   RGEAVGLLGPNGAGKTTVFYMITGLIKADRGAIELDGHDVTKLPMYQRARLGIGYLPQE
FT                   ASIFRGLNVEQNIRAVLEAVEPDKRKREAELDNLLHEFNIERLRKSPSIALSGGERRRV
FT                   EIARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRHLTNRGIGVLITDHNVRETLGLTD
FT                   RAYIVYAGEILTEGSPEEIVNNPDVRRLYLGEEFRL"
FT   gene            201922..203562
FT                   /locus_tag="RPD_0178"
FT   CDS_pept        201922..203562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0178"
FT                   /product="sigma-54 factor, core-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37418"
FT                   /db_xref="GOA:Q13ES1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES1"
FT                   /protein_id="ABE37418.1"
FT                   /translation="MALTQRLEFRQSQSLVMTPQLMQAIKLLQLSNLDLAVFVEDELEK
FT                   NPLLDRASDNAEPLVAGEASMDRAENAGDEFGGSEAGGEASDFADNAGGDSFEPGSEEW
FT                   MHRDLGSRSEIEQTLDTGMENVFPEEPAEAAARAAQDAAPASYTEWGGGASSDEGYNLE
FT                   AFVAAETSLADHLSEQLAVALSSPSERMIGQYLIDLVDDAGYLPADLGEAAERLGTTQT
FT                   EVEAVVGVLQTFDPPGICARSLAECLAIQLRELDRFDPAMQALIEHLDLLAKRDVVSLR
FT                   KICGVDDEDLADMIGEIRHLDPKPGLKFNSSRVQTVVPDVFVRPGPDGGWLVELNSDTL
FT                   PKVLVNQSYYSELSKTIRKDGDKSYFSDCLQTATWLVRALDQRARTILKVATEIVRQQD
FT                   GFFTHGVAHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIASAD
FT                   GGEAHSAEAVRHHIRQLIDGEDPSAILSDDTIVERLRGAGIDIARRTVAKYREAMRIPS
FT                   SVQRRRDKHSMLGTALTAPADRSRDTAPA"
FT   gene            203618..204226
FT                   /locus_tag="RPD_0179"
FT   CDS_pept        203618..204226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0179"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37419"
FT                   /db_xref="GOA:Q13ES0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES0"
FT                   /protein_id="ABE37419.1"
FT                   /translation="MTIRVSGKSISVGEALRGRVSERTEEVLRKYFDGNYSGHITLSKD
FT                   GFGFRTDCSLHLDSGITLEAESNAADAYVSADQALLQIEKRLRRYKSRLKDRSSRKAHA
FT                   EATALAELTAPVDMPSYVIEAPGDEEHHEDAYNPVIIAEATTAMKRLSVSEAVVELDLT
FT                   GAPVLIFLHGGSGRVNIIYRRADGNIGWIDPPSLNGAAA"
FT   gene            204510..204971
FT                   /locus_tag="RPD_0180"
FT   CDS_pept        204510..204971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0180"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37420"
FT                   /db_xref="GOA:Q13ER9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER9"
FT                   /protein_id="ABE37420.1"
FT                   /translation="MTITDLVAPEAVIPALKVISKKQALQELSARAAELSGQNERAVFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLERLFGLFARLERPIDFEAMDGQPVDLIFLLLA
FT                   PEGAGADHLKALARIARLLRDQDVAKKLRASRDAQAIYSVLALPPATVA"
FT   gene            complement(205475..205741)
FT                   /locus_tag="RPD_0181"
FT   CDS_pept        complement(205475..205741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0181"
FT                   /product="protein of unknown function DUF1150"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37421"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER8"
FT                   /protein_id="ABE37421.1"
FT                   /translation="MAELGTNHENVRVTPEALAHLGEGHIAYVKQIRSEDVPGLFPQAP
FT                   QIAPGLKLFALHSADGTPIMLTDSREAAVANAWSQELQAVSVH"
FT   gene            complement(205792..206217)
FT                   /locus_tag="RPD_0182"
FT   CDS_pept        complement(205792..206217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0182"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37422"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER7"
FT                   /protein_id="ABE37422.1"
FT                   /translation="MSRVPTLSSPFLLGFDEIERALDRVVKGADGYPPYNIERCERGNG
FT                   DPEKLRITLAVAGFTRDQLDVTIEENQLVIRGRQQDDKTRQYIHRGIAARHFQRTFVLA
FT                   EGMQVLGADLKNGLLSIDLVRPEPERVIKTIAITEHE"
FT   gene            complement(206368..207462)
FT                   /locus_tag="RPD_0183"
FT   CDS_pept        complement(206368..207462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0183"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37423"
FT                   /db_xref="GOA:Q13ER6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ER6"
FT                   /protein_id="ABE37423.1"
FT                   /translation="MANVVLRNVRKTYPGGFEAIKGVDLEVGDGQFCVLVGPSGCGKST
FT                   LLRMVAGLETITAGEIDIGGRVVNDVEPADRDIAMVFQNYALYPHMSVYNNMAYGLRNR
FT                   GMAKPEIEARVQEAARILEIGAMLDRKPRQLSGGQRQRVAMGRAIVRQPKVFLFDEPLS
FT                   NLDAKLRVAMRVEIRKLQRRLSTTAIYVTHDQLEAMTLADILVVMNAGQVEQIGSPLDV
FT                   YAKPATTFVASFIGAPPMNLIPLDAEGVRARFGGAVTEAGVLGVRPEDLAISSEPPAPG
FT                   GLTLDLAVEAIERVGPETFVYGTRSPGGDLAAISSKPGELPPDEIIIRIPGQEAPAIGQ
FT                   RISVVALRHNLHLFSADGRRRIAV"
FT   gene            complement(207468..208316)
FT                   /locus_tag="RPD_0184"
FT   CDS_pept        complement(207468..208316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0184"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37424"
FT                   /db_xref="GOA:Q13ER5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER5"
FT                   /protein_id="ABE37424.1"
FT                   /translation="MVEHRKFGNLLPHLVLWTGVLIVAFPVYIAFVASTQDNATIANGQ
FT                   MSLLPGGHFLETYYKTLFVGTSGTTREPVGTMLFNSFVMAMMIAVGKIAISLISAYAIV
FT                   YFRFPFRMTIFWLIFITLMLPVEVRIYPTYKIVADLHLLDSYAGLTLPLIASATATLLF
FT                   RQFFMTVPDELLEASRIDGAGPFRFFWDTLLPLSRTNMAALFVILFILGWNQYLWPLLI
FT                   TTRDDMQTIQIGIRKMIVTSDALTEWPVVMATAILAMLPPVAVVVLMQKLFVRGLVETE
FT                   K"
FT   gene            complement(208316..209230)
FT                   /locus_tag="RPD_0185"
FT   CDS_pept        complement(208316..209230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37425"
FT                   /db_xref="GOA:Q13ER4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER4"
FT                   /protein_id="ABE37425.1"
FT                   /translation="MTAVRAGRSRIMQKQSVFHSKFLPYMLVLPQLAVVLVFFYWPAVQ
FT                   AVIQSFLLQDAFGLSTTFVWFDNYRELLSDPDYFSAILRTFLFSVAIALSSLSLALLLA
FT                   VMADRPLRGSTFYRTLLIWPYAVAPPVVGVLWVFMLNPSLGVIAHGLRAIGIDWNPLLD
FT                   GNQAATLIILAAAWKQISYNFLFFLAGLQAIPSSVIEAAAIDGARPMRRFWTIIFPLLS
FT                   PTIFFLIVVNIVYAFFETFGIIDTMTRGGPAKATETLVYKVYSDGLLGGNLGSSAAQSV
FT                   ILMGIVIALTAFQFRFVERKVNY"
FT   gene            complement(209323..210648)
FT                   /locus_tag="RPD_0186"
FT   CDS_pept        complement(209323..210648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0186"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37426"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER3"
FT                   /protein_id="ABE37426.1"
FT                   /translation="MAFRFFGPTAAATAIAATLAIATPAHAATEIQWWHAMTGGNNDVV
FT                   VKLANDFNAAQSDYKVVPSYKGGYADTMNAGIAAFRAGNAPHIMQVFEVGTATMMAATG
FT                   AVKPVYKLMQETGEPFDAKAYLPAITGYYSTSKGEMLSFPFNSSSMVMWVNLDALKKAD
FT                   IAEIPKTWPEVFEGAKKLKAAGYATCGFSTAWVTWAHVEQLSAWHNVPLASKANGLDGF
FT                   DTKLEFNGPVQVKHLDKLIELQKDKTFDYSGRTNTGEGRFTSGECPLFLTSSGFFGNVK
FT                   SQAKFNWTSAPMPYYPDVKGAPQNSIIGGASLWVMGGKTPEEYKGVAKFLAFLSDTDRQ
FT                   VAVHKASGYLPITMAAYEKAKAEGFYKEAPYLETPIKELTNKPPTENSRGLRLGNMVQL
FT                   RDLWAEEIEQALAGKKTAKEALDAAVTRGNTMLRQFEKTAVK"
FT   gene            complement(210854..212059)
FT                   /locus_tag="RPD_0187"
FT   CDS_pept        complement(210854..212059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0187"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37427"
FT                   /db_xref="GOA:Q13ER2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER2"
FT                   /protein_id="ABE37427.1"
FT                   /translation="MTAALMPGAMAGLRVIDLTRVLGGPYCTQILADHGADVIKVEPPA
FT                   GDEVRDWGPPFHDDDAAYFIGINRNKRSIGLDLASPGGRDVLLEMLKDADVLIENFKPG
FT                   TLDKWGLGNDIVREKFPRLVHCRISGFGADGPRGGNPGYDAIIQAMTGMIAATGSPESG
FT                   PMRIGVPLVDITTGLYAAIGILMALSERQRSGKGQFLETTLYETGLAIMHPHTANYFLH
FT                   GKPPALTGNEHPNLVPYAIFEARDGKIFTGVGNDGTFRKLCKEIGKPELGTDPRFARNK
FT                   DRIANRAALRTELEAVFRQHDAAPLCDRLLDAGLPAGPVQSIDKALTSPHTTHRGDVIE
FT                   QDWYKGVASPIRFERTKASLRGLPPKFSQHAGEVLGEFGYSPDEISKLVADGVVSGPER
FT                   KR"
FT   gene            complement(212220..212295)
FT                   /locus_tag="RPD_R0004"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(212220..212295)
FT                   /locus_tag="RPD_R0004"
FT                   /product="tRNA-Ala"
FT   gene            complement(212363..212821)
FT                   /locus_tag="RPD_0188"
FT   CDS_pept        complement(212363..212821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37428"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER1"
FT                   /protein_id="ABE37428.1"
FT                   /translation="MATSQVKHRFSRNPKVAQVAKSDLGTKRICPTTGKKFYDLNKNPV
FT                   ISPYTGEVVPIAPVVAPRTRADSRSAAAPAAAEAPEAMEAEELVSLEEADAEEKTGKVK
FT                   AIVPESEDDIEIDESIEDDDDSTFIADEEEGDEDVTDIIGDVSGDEET"
FT   gene            212916..214253
FT                   /locus_tag="RPD_0189"
FT   CDS_pept        212916..214253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0189"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37429"
FT                   /db_xref="GOA:Q13ER0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ER0"
FT                   /protein_id="ABE37429.1"
FT                   /translation="MSHSDQTSPLEARKSAALSGTARVPGDKSISHRALILGALAVGET
FT                   RISGLLEGQDVIDTGKAMRALGARVERTGEFAWTVRGVGVAGFAQPEAPLDFGNSGTGC
FT                   RLAMGAVAGSPITATFDGDASLRSRPMRRIVDPLEQMGARVIQSHEGGRLPLTLQGARD
FT                   PLPITYRTPVPSAQIKSAVLLAGLSAPGVTTVIEAEASRDHTELMLQHFGATLVTEPEG
FT                   AHGRKISLTGQPELRGARVVVPADPSSAAFPMVAALLVPGSDIVLTEVMTNPLRTGLIT
FT                   TLREMGGAIEESETRDDTGEPMAQFRIRGSRLRGVEVPPERAPSMIDEYLVLAVAAAFA
FT                   EGTTVMRGLHELRVKESDRLEATADMLRVNGVKVEIVGDDLIVEGKGHVPGGGLVATHM
FT                   DHRIAMSALVMGLAADRPVKVDDTAFIATSFPDFVPMMRRLGGELA"
FT   gene            complement(214271..214945)
FT                   /locus_tag="RPD_0190"
FT   CDS_pept        complement(214271..214945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0190"
FT                   /product="protein of unknown function DUF374"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37430"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ9"
FT                   /protein_id="ABE37430.1"
FT                   /translation="MATPAFVKRILRSDAFQWTAVIPAAIYFQFVMWTGRFDRAPFPIA
FT                   EPYILAMWHGRLNMLPMLRNGSKPLVALISGHRDGQIISKAGTVFGIQTAVGSSSKGGM
FT                   RAAREMLRLARDGHSLFVTPDGPRGPRMHINNDGILDLARLTGLPILPVAVSLQRGKLL
FT                   RSWDRLMLPGLFSRVAIRFGEPVIVDADADRAEIRARLSASLTAAQQETDRLVGRIPVE
FT                   PA"
FT   gene            215116..215754
FT                   /locus_tag="RPD_0191"
FT   CDS_pept        215116..215754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0191"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37431"
FT                   /db_xref="GOA:Q13EQ8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ8"
FT                   /protein_id="ABE37431.1"
FT                   /translation="MIIAIDGPAASGKGTLGKRLAAHYGFRHLDTGVIYRAVAKALLDG
FT                   GADLTDEARAVAAARKLDPGIFGDPALKSQTVGDAASVISAYAPLREALVSFQRQFAAD
FT                   PPGAVLDGRDIGTVICPDADVKIFVIADPVVRARRRTLEALARGEAADEARVLADILKR
FT                   DERDRNRSAAPLTQAPDAVLLDNSNLDIEGGVRAAIDIVEAVRAGRRRV"
FT   gene            216049..217746
FT                   /locus_tag="RPD_0192"
FT   CDS_pept        216049..217746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0192"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37432"
FT                   /db_xref="GOA:Q13EQ7"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ7"
FT                   /protein_id="ABE37432.1"
FT                   /translation="MASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGIVVAIEKDMA
FT                   VIDVGLKTEGRVALREFAGPGRESELKVGDTVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFQGNEKVFGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNSQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVDVQ
FT                   VLEVDSVKRRISLGLKQTMRNPWEVFVEKYPVGSTVEGEVKNKTEFGLFLGLDGDVDGM
FT                   VHLSDLDWKQPGEQVIDNFKKGDMVKAVVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAIVTCEVLDVKESGIDVQIVGTDFATFIKRSELARDRNDQRSDRFAVGEKVDARVIQF
FT                   DKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
FT   gene            217997..218977
FT                   /locus_tag="RPD_0193"
FT   CDS_pept        217997..218977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0193"
FT                   /product="signal peptide peptidase A. Serine peptidase.
FT                   MEROPS family S49"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37433"
FT                   /db_xref="GOA:Q13EQ6"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ6"
FT                   /protein_id="ABE37433.1"
FT                   /translation="MSLDSDVIVDRRRIRRKLTFWRVAAVLVAIVAVVAVGAMVSPAGQ
FT                   GGLATSSSIARIKIDGLIRSNSERVEALERLEKSQSAAVIVHINSPGGTTAGSEELYNA
FT                   LMRLKAKKPMVVVVEGLAASGGYIAALASDHIIAQQSSLVGSIGVLFQYPNVSELMKTV
FT                   GVKVEEVKSSPLKAAPNGFEPTSPEARAALESLVRDSYAWFRDMVKQRRSMDDNQLGVV
FT                   ADGRVFTGRQALGLKLIDELGDEKTAVAWLETEKKIKSGLPVRDFKLSPQFGDLAFLRV
FT                   AASVTLDALGLGAIARQIEQSGAVQSVERLGLDGMLALWAPGGSR"
FT   gene            219124..219429
FT                   /locus_tag="RPD_0194"
FT   CDS_pept        219124..219429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0194"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37434"
FT                   /db_xref="GOA:Q13EQ5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ5"
FT                   /protein_id="ABE37434.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNREPGNTDTGA"
FT   gene            219442..219855
FT                   /locus_tag="RPD_0195"
FT   CDS_pept        219442..219855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37435"
FT                   /db_xref="GOA:Q13EQ4"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ4"
FT                   /protein_id="ABE37435.1"
FT                   /translation="MRGKASENDMQKFLTALVLIPLGLIFIVFAVANRHLVTVSFDPLE
FT                   PLNPMGTVQMPLFVLIIGVAILGVIAGGVATWVRQRHWRRAARRHQAEAIQAQTQLANL
FT                   RASVVTPAQSEPKRLLLGQGSAAGRRDKTSAAL"
FT   gene            219911..220567
FT                   /locus_tag="RPD_0196"
FT   CDS_pept        219911..220567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0196"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37436"
FT                   /db_xref="GOA:Q13EQ3"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ3"
FT                   /protein_id="ABE37436.1"
FT                   /translation="MSVVVKICGLSTCDTLEAAVAAGADMVGFVFFPASPRHVGLDVAR
FT                   ELSDQVGSRAAKVALTVDASDALIRDIVEILKPDLLQLHGSESPERVRALKQAFGLPVM
FT                   KAIAVATAADLAMLPAYAETADRILFDARPPKDATRPGGLGMTFDWELLRDLDLSLPFM
FT                   VSGGVNPGNVAAALRVTGAGGVDVSSGVERAPGAKDPELIRSFIRAARASEELMT"
FT   gene            220569..221783
FT                   /locus_tag="RPD_0197"
FT   CDS_pept        220569..221783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0197"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37437"
FT                   /db_xref="GOA:Q13EQ2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ2"
FT                   /protein_id="ABE37437.1"
FT                   /translation="MNQILPNSFRSGPDERGHFGIFGGRFVAETLMPLILELEKAYAEA
FT                   KDDPAFRTEMDGYLKHYVGRPSPLYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLG
FT                   QIMLARRMGKQRIIAETGAGMHGVATATMCAKFGLQCVVYMGAVDVERQQPNVLRMKAL
FT                   GAEVRPVTSGANTLKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQEVIGQE
FT                   VREQILETEGRLPDSLIACIGGGSNAMGLFHPFLDDAGVVIYGVEAAGHGLSKLHAASI
FT                   AGGKPGVLHGNRTYLLMDDDGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVNFLSATDA
FT                   EALDAFKLCCRLEGIIPALEPAHALAKVADLAPILPKDHLMVLNMSGRGDKDLASVAEH
FT                   LGGKF"
FT   gene            221783..222619
FT                   /locus_tag="RPD_0198"
FT   CDS_pept        221783..222619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0198"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37438"
FT                   /db_xref="GOA:Q13EQ1"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ1"
FT                   /protein_id="ABE37438.1"
FT                   /translation="MTTRIDTRFAELKKQGRSAFVTFVMAGDPDLATSLQVLKALPAAG
FT                   ADIIEIGMPFTDPMADGPAIQAAGLRALHSGATLSHTLGLVRDFRKDDDTTPMVLMGYY
FT                   NPIYIYGVDAFLADAKAAGVDGLIIVDLPPEEDSELCLPAMKAGLNFIRLATPTTDEKR
FT                   LPAVLANTSGFVYYVSITGITGSASADSAAVGDAVARIKRHTDLPVCVGFGIRTPEAAR
FT                   AIAAEADGAVVGSALIDALQKSLDADNRATKATVGAVADLVASLAAGVRGAKQAAE"
FT   gene            222727..223695
FT                   /locus_tag="RPD_0199"
FT   CDS_pept        222727..223695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0199"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37439"
FT                   /db_xref="GOA:Q13EQ0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ0"
FT                   /protein_id="ABE37439.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDTGQLVFYKDVEQNQF
FT                   VIPGSNYHMRMGALARLRSVFDNETWYDVALPEVTADPLKFRDERKYADRIKDARTKTG
FT                   AHDAVKVGYGKLEGLGVVAAVQDFDFMGGSLGMAAGEAIIRGLELAVEKHAPFIMFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQMLREAGLPYIVVLTNPTTGGVTASYAMLGDIQLAEP
FT                   GALIGFAGARVIEQTIREKLPDGFQRAEYLRDHGMVDMVVHRHELRPTLARLCRILTKT
FT                   PLPAVEEIAASDDAAQDAEAAAATEIVVTPPEAPSPTAPQA"
FT   gene            223692..225038
FT                   /locus_tag="RPD_0200"
FT   CDS_pept        223692..225038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0200"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37440"
FT                   /db_xref="GOA:Q13EP9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP9"
FT                   /protein_id="ABE37440.1"
FT                   /translation="MSAATAPQPSALVGELRARLAQLHPAQIDLTLGRIERLLAALDHP
FT                   QRRLPPVIHIAGTNGKGSTLAFLRAILEAAGLSVHAYTSPHLVRVNETVRLGRPGGGAL
FT                   VSDDEFAAALAHCERVNQGAPITLFEIETAAALWLFAQHPADVTLLEVGLGGRLDATNV
FT                   IDQPLACVLTPIGIDHTEFLGPTLADIAAEKAGIIRRGVPVIVAGQQNDAMDVIEREAE
FT                   RLRAPLHARGQQWHVEVEHGRLAYQDDRGLMDLTAPKLFGRHQIDNAWLAIATLRAQQR
FT                   FTFDQAAYQAGLLSADWPARMQRLTTGRLIDEAPPGSELWLDGGHNADGGRVAAAALGD
FT                   LEERVSRPLVIIAGMMANKDASAFLTNFTGLTRHVIAVPIPDRDGAMPPEKLADAGRAL
FT                   GLRVELADSVEAALSRIAGLAYELPPRILITGSLYLAGHVLRLNGTMPS"
FT   gene            complement(225390..225710)
FT                   /locus_tag="RPD_0201"
FT   CDS_pept        complement(225390..225710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0201"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37441"
FT                   /db_xref="GOA:Q13EP8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP8"
FT                   /protein_id="ABE37441.1"
FT                   /translation="MSVGKVSDADFETEVLKAQGPVVVDFWAEWCGPCRMIAPALDEIS
FT                   GAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQWISS
FT                   AV"
FT   gene            complement(225807..229286)
FT                   /locus_tag="RPD_0202"
FT   CDS_pept        complement(225807..229286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0202"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37442"
FT                   /db_xref="GOA:Q13EP7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP7"
FT                   /protein_id="ABE37442.1"
FT                   /translation="MSAPRSIPDQARERQILASDPSASVFVSANAGSGKTHVLVQRVIR
FT                   LLLDGVPPERILCITFTKAAAANMAERVFTTLGRWVTLDDEALTAAIKATGIKSVGPSL
FT                   LAQARKLFACALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDDRDQAELMQRA
FT                   SLAVLLQAAAAPDSAAGRALTLAMTSAADVTFREVVQEACTRRDRFLAWITQAGGVDGA
FT                   MAQLSATLGVAPQDRCEDVERDILDGPNLPRAQWSTAAAMFESGSANDQAQAKRLRAAL
FT                   ALSDVAQLDKYCEVFFTKDGPRKSLATKKIADAAPGFVEDLKREGARLEDLLERRRALL
FT                   MRERTRALLVIAADVAERIRREKQERGLLDYDDLIDKTLAMLDSGASSWVHFKLDRGVD
FT                   HVLIDEAQDTSPKQWDIVAHLIAEFTAGEGARDGVRRTVFAVGDEKQSIFSFQGAVPKE
FT                   FAERRDLLQRRFHGAGLNFEKVSFNYSFRSGATILQSVDHVFRDPDIYRSIHADAAYPL
FT                   HQSLADAGPSVIDLWPLELPDDKQNIEGWRAPFDAVSETSPEVRLAQKVQAEIASLIAG
FT                   GTMTGSLGDRRRLRFGDVLVLVRRRGSAFDAVIQALKRGGIPVAGADRLKLTEHIAIID
FT                   LMNLADALLLPQDDLALAVALKSPLFGLDDDDLFRLAWRRKGSLRHALREKAAGDAKLA
FT                   TALQRLDACAERSQTDTPFGFYAWLLGGVGGRARILRRLGPEANDALDEFLELALSYEQ
FT                   KAAPSLQGFMAWLRAADTEIKRDMEISRDEVRVMTVHGAKGLEAPVVFLVDTTSSPSDT
FT                   QRLNLIRLPGGNAQPGSVGAMVWAGRKSNDPRVVEQARAEMVSETEDEYRRLLYVAMTR
FT                   AADRLIVGGCMPGNRNEVRALSWYDLISKGLENSGLTMRTAPPDGAVKRYCRPEDEVTE
FT                   IAPSEQAPAAPPLVMPDWLHKAAPALRRPDNLLRPSDPDDADHRRIRRGETEAQRQRAL
FT                   QRGTLVHRLLQSLPDLPADIRANAADRFLLRNADDWSPQERDALAARVLEVISDDRFAA
FT                   VFAPGSRAEVPIVGRLQRHGEPVLISGQIDRLVVTDAEVLIVDYKTNHAPPRSLAETPP
FT                   AYVRQLALYRAVLSLLYPQRIVRAALLWTEAPEIMEISAPALDAEQAALTVA"
FT   gene            complement(229283..232432)
FT                   /locus_tag="RPD_0203"
FT   CDS_pept        complement(229283..232432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0203"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit B"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37443"
FT                   /db_xref="GOA:Q13EP6"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP6"
FT                   /protein_id="ABE37443.1"
FT                   /translation="MRVFSVPPSAPFLRTTIKALVDGELIAGFDARAKPERLAEATLYL
FT                   PTRRAGRLARDIFLDVLGADAVLLPRIVPLGDVDEDELAFAQAATGAADLDIPPALEGL
FT                   PRRLQLAQLIAVWAKGLRSGDPQQSPLVVGGPASTLALADDLARLIDDMATRGVDWAAL
FT                   DSLVPDAFDRYWRLTLDFLKIAGQWWPQHLRESDQIEPAARRDLLIEAEAARLAAHRGG
FT                   PVIAAGSTGSMPATAKLLHAIARLPNGAVILPGLDTELDEQAWRLIGAVRDKQGQLISP
FT                   PSPNHPQFAMHGLLTRMGLERREIVRLGEAVRHGREVLASEAMRPSAATASWHERLADP
FT                   EVDRLIEQGVNGLTVIEAPNSEIEALAIAVALREARERGQSAALVTPDRALARRVVAAL
FT                   GRWNLPVDDSGGDSLMETQAGIFARLAAEAALHGCEPATLLALLKHPLLRLGRAAGGWR
FT                   HAIETLELALLRGTRPAAGSEGLVKEFAKYRAELTRLKRGELSALHPSEPRARLGDESL
FT                   DAAQELIEALRAALAPLETVGAEPLDLCAFGRRHRDVLIALSIDHDEIAVAFEGSQGSA
FT                   LLKAFDDLAAVEPLSGVLVPPHDYADVFETAFSDRIVRRPELAGAALRIYGPLEARLTQ
FT                   HDRVILGGLVEGVWPPAPRIDPWLSRPMRHDLGLDLPERRIGLSAHDFAQLLGADEVIL
FT                   TYANKVGGAPAVVSRFLHRLEAVTGKARWSAVKARGQSYLDYAQALDRPEQVTPIAQPA
FT                   PRPPREARPLKLSVTAIEDWLRDPYTIYAKFILGLSAIDPVDMPLSAADRGSAIHEALG
FT                   EFTELFPDELPDDPAQVLREIGEKHFAPLMAHPEARALWWPRFARIAAWFGNWEQARRA
FT                   DGLRVFAERDGSLSIPLDGGRNFILSARADRIEHRADGSFAILDYKTGNPPTGKQVRMG
FT                   LSPQLTLEAAILRDGGFEGIDAGSSVSELTYVKLSGNSPPGDECVLELRIERKDERQSP
FT                   DDAAAEARSKLETLIRRFDDEAQPYHALVLSMWSRRYGRYDDLARIKEWSAAGGGAEDR
FT                   L"
FT   gene            complement(232504..233277)
FT                   /locus_tag="RPD_0204"
FT   CDS_pept        complement(232504..233277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0204"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37444"
FT                   /db_xref="GOA:Q13EP5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP5"
FT                   /protein_id="ABE37444.1"
FT                   /translation="MIQCARTNPVRSEQRATMSVQPSRAMILAAGFGVRMRPLTDHKPK
FT                   PLVAVAGKPLLDHVLDRLAEAGVAEAVVNVHYLPDQIIDHVAARSRPRVIISDERDAVL
FT                   GTGGAVVKALPLLGDQPFYHLNADTLWIDGVQPNLARLAEAFDPARMDILLLMAPTANS
FT                   IGYAGKGDFAMAADGSLRKRKETEVTPFVYAGVAIMQPAIFKDAPQGEFSLTTMFDRAA
FT                   EQHRLFGLRLDGVWMHVGTPDAVAAAERAYLASVA"
FT   gene            complement(233402..233716)
FT                   /locus_tag="RPD_0205"
FT   CDS_pept        complement(233402..233716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37445"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP4"
FT                   /protein_id="ABE37445.1"
FT                   /translation="MVAERNKDGRVVFERGIRAQMMAIDGTWRRPCQLEDVSEAGAKLT
FT                   VVGAVEGLNLKEFFLLLSSTGLAYRRCELSWVNGDQIGVSFLRNDKKKKPGSRTSATAA
FT                   "
FT   gene            complement(233930..235447)
FT                   /locus_tag="RPD_0206"
FT   CDS_pept        complement(233930..235447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0206"
FT                   /product="protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37446"
FT                   /db_xref="GOA:Q13EP3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP3"
FT                   /protein_id="ABE37446.1"
FT                   /translation="MSGSATFSVALANETATARLMAEIALLIGPGDVVTLSGDLGAGKT
FT                   SAARAMIRYLAGDDDLEVPSPTFTLVQSYELPPFPLLHADLYRVNDPSELEEIGLSPLP
FT                   DGAVALIEWPERAPGAMPSDRIDIALSHRPALGSMARAAEITGHGAAAARVERLAALRS
FT                   FIEMSGYADADRRHMPGDASTRSYARLVKDGASLILMNAPRRPDGPALYGGKSYSAAVH
FT                   LAEDVRPFVAIAGGLRARGFSAPAIHYADLDSGFLITEDLGASGFISGTPPAPIADRYQ
FT                   AAADMLAALHGQTLPDTLPLPDEDYAIPVFDPAAMLIEVGLMPEWYLPDRGAPASDALR
FT                   GEFIAMWRGLLGGLTDEAPTWVLRDFHSPNLIWLEQRSEIARVGVIDFQDTVLGPAAYD
FT                   LVSLLQDARVDVPEALELALFGRYIKTRRAAEPGFDPVAFARLYAVMSAQRNTRLLGTF
FT                   ARLNRRDGKPQYLRHQPRIWTYLGRSLAHQSLAEVRAWYQANVPAPL"
FT   gene            complement(235444..237957)
FT                   /locus_tag="RPD_0207"
FT   CDS_pept        complement(235444..237957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0207"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37447"
FT                   /db_xref="GOA:Q13EP2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP2"
FT                   /protein_id="ABE37447.1"
FT                   /translation="MSDVLGSMRRTCLSCTSLVRGLAGAGLLAASSPAWAADDPLATLT
FT                   SRFMFDFNRHELVTLAMAASVLGFSVVSAILLMRTRQRAAAQEAQLRADVQTLQAESDR
FT                   FRALLFAEPQVLISWSAGDDRPQISGDTALLLPQEVANAQPQRVLAFGTWLPPEPALQM
FT                   DHAVDALLDKGEAFLLHLTTSTGRSIEAMGRAIGGQAILRIRELSGIRRELADMSRRFK
FT                   SLQDESEMLRGFANAAPWPIWTRRASGELSFANAAYARATDAGSAADAVNRNLELLDSN
FT                   DRGNLARALNDNAQFAARLPIVVSGERRYFDVRALRLSGGSAGIAVDASEAAALGAALV
FT                   RMAEAHRRTLDQLSSGVAVFDAQRRLAFYNDSYRRLWDLDRAFLDSNPDDSSVIDRLRA
FT                   ARKLPEERDFREWKKKLHEAYRAVEPEKAIWYLPDGRAISIVTTPNQEGGVTYLFDDVT
FT                   ESLELQRRYGGLIDVQRETLDNLTEAVAVFGSNGCAQLFNPAFTRMWNLSPEALNNRPH
FT                   IETVEEWCRPLFDDAVSWQALRSAITGIDDRKHVLLKLERKDGTVLSCKTMPLPDGATM
FT                   LTFLDISDTENVERALRERNEALETADRIKVDFVHHVSYELRSPLTTIIGFAHLLGDPS
FT                   TGPLNDKQSEYIAYITSSTNALMAIINNILDLASIDAGAMTLNLGPIDIGRAIDAAAEG
FT                   IQDRLARDQITLDVEIDPAVGEFVGDERRVVQVLYNLLANAVGFSPNQATVTLVVHKIG
FT                   AKVVFTVTDAGPGIAPELKDKVFDWFESHSQGSRHRGPGLGLALVRSFVELHGGKVQVD
FT                   SVVGRGTSVICEFPIEPSAQRNAAE"
FT   gene            complement(238137..238595)
FT                   /locus_tag="RPD_0208"
FT   CDS_pept        complement(238137..238595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0208"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37448"
FT                   /db_xref="GOA:Q13EP1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EP1"
FT                   /protein_id="ABE37448.1"
FT                   /translation="MSDTIAVEIKQLPHAEGLPLPAYQSAHAAGLDLCAANSADAPLLL
FT                   APGSYVLVPTGLTIALPENYEAQVRPRSGLAAKHGVTVLNAPGTIDADYRGEIGVLLIN
FT                   HGDAPFTIRRGERIAQMVIAPVVRAELIGVETLSETARGVGGFGSTGR"
FT   gene            complement(238592..240127)
FT                   /locus_tag="RPD_0209"
FT   CDS_pept        complement(238592..240127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0209"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="6.3.2.5"
FT                   /EC_number="4.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37449"
FT                   /db_xref="GOA:Q13EP0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP0"
FT                   /protein_id="ABE37449.1"
FT                   /translation="MQCDRAARWHCIHGLLALPASVNLRVMANLTIRKLDDALKAELRQ
FT                   RAAANGRSMEDEVRVILRDVCHKRHGFAASFPQPGEDPAAPGKIEPSPGKDEGFPSEPA
FT                   ASVRITLIVGGGIAAYKAMDLIRRLKERGAEVRVVLTRAAQQFVTPLTASALSHQRCYT
FT                   DLFDPQSEFDAGHIRLARDCDLIVVAPATADLMAKIAGGHADDLATAILLATNRQILLA
FT                   PAMNPLMWNNAATRRNVDQLKRDGVALVGPNAGEMAERGEAGTGRMAEPIEIAAAAQAF
FT                   WTPQPQRPLRGRRVLITAGPTHEAIDPVRYIANRSSGKQGYAIAAAAAAAGAEVVLISG
FT                   PVDLRAPDGVTLTRVESAREMLDAVQAALPTDIAIFAAAVADWRVESEGGQKIKKGAGG
FT                   PPPLQLTENPDILATISKRGENRPNLVIGFAAETENLLDNARAKLARKGCDWIVANDVS
FT                   PATGVMGGDRNTVHLLMNTTDAVDVESWPLMTKDEVASALVARIAQTMEVHAP"
FT   gene            complement(240150..241724)
FT                   /locus_tag="RPD_0210"
FT   CDS_pept        complement(240150..241724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0210"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37450"
FT                   /db_xref="GOA:Q13EN9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EN9"
FT                   /protein_id="ABE37450.1"
FT                   /translation="MIAGLSHAARLVRAAYVFAREGVFGVVDPSLIPPAGQLPVRLARL
FT                   IERPGAKSGARLSRALTRLGPAYLKLGQFLATRPDVVGAAMARDLEALQDRLPPFAQEE
FT                   AEAVIAASLERPVAQAFVSLSPPVAAASIAQVHRGEVEIGGVRKQVAVKVLRPNVASRF
FT                   RRDLSDFFFVADKAEQYSSEARRLRLVEVINTMSRSVAMEMDLRLEAAAASEMAENTKD
FT                   DPDFRVPTVDWDRTTHNVLTMEWIDGIPLNDHKRLAEANVDTVELGRKVIQSFLRHALR
FT                   DGFFHADMHPGNLFLDPEGRLVAVDFGIMGRLLPKERRFLAEILLGFITRNYRRVAEVH
FT                   FEAGYVPAHHSVENFAQAIRAIGEPIHNRLAEEISMAKLLTLLLEVTGLFDMRTRPELI
FT                   LLQKTMVVVEGVARSFDPRLDIWKVADPVVREWIQRNLGPIGKVEGALTGAGELGHTLS
FT                   SLPTIVSRAVTVLNQLEVMTKDGLVLAPETIAAIGRTERGRTRGRTAALWIIAVTFIGV
FT                   LIAMSRL"
FT   gene            complement(241721..242482)
FT                   /locus_tag="RPD_0211"
FT   CDS_pept        complement(241721..242482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0211"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37451"
FT                   /db_xref="GOA:Q13EN8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EN8"
FT                   /protein_id="ABE37451.1"
FT                   /translation="MNQPGETTHFGFRDVPLNDKQTMVNDVFHSVASRYDLMNDLMSGG
FT                   MHRLWKDVMITTLNPPRDDAPFRLLDVAGGTGDISFRAAKASGAGFQATVCDINTDMLE
FT                   VGRQRAVQRHLDGQVDFVEGNAEALQFPDRSYDAYTIAFGIRNVPRIDLALKEAYRVLK
FT                   PGSRFLCLEFSSVDVPGLNKIYDLFSFKVIPEIGRVVTGDAESYQYLVESIRKFPKPYD
FT                   FAEMMRDAGFARVNWQMMSGGIVALHSGWRL"
FT   gene            242693..243574
FT                   /locus_tag="RPD_0212"
FT   CDS_pept        242693..243574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0212"
FT                   /product="Formamidopyrimidine-DNA glycosylase /
FT                   DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37452"
FT                   /db_xref="GOA:Q13EN7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EN7"
FT                   /protein_id="ABE37452.1"
FT                   /translation="MPELPEVETVRLGLTPAMEGFRIARAVTNRDDLRFPLQKDFVARL
FT                   TGQIVTGLGRRAKYLLADLASGDVLLMHLGMSGSFRVVAADGAHTPGEFHHPRSEDRTH
FT                   DHVVFDMSSGARVIFNDPRRFGFMKIFPRAAIDDEPHLKGLGPEPLGNAFDAVMLARAC
FT                   AGKQTSLKAALLDQRVVAGLGNIYVCEALWRAHLSPKRKAATLANRKNEPTDHALRLTD
FT                   AIRAVLGDAIKAGGSSLRDHRQTSGELGYFQHSFAAYDREGERCRTDGCGGAVKRFVQN
FT                   GRSTFWCSGCQK"
FT   gene            complement(243743..244705)
FT                   /locus_tag="RPD_0213"
FT   CDS_pept        complement(243743..244705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0213"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37453"
FT                   /db_xref="GOA:Q12ZW2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q12ZW2"
FT                   /protein_id="ABE37453.1"
FT                   /translation="MAQDSFIEALLPAGFGRNERLERISGLIDWDRLAVLIRKVRPGET
FT                   GRPPYAPLAMFKALLLQQWYGLSDPGLEEALLDRVSFRRFCGFALDAQTPDETTLCRFR
FT                   NALQQAGLGDALFQEVLRQLEAAGYVLKTGTLIDATLVQSSGRTPPSGSTPREVESRSS
FT                   HDPQADWTRHGAGRRLFFGYKAHIAIDQGSGLIRARKLTGAKTYESEVADDLVLGDEKA
FT                   VYADKAYEKRARRQALKARGIKDRIQHRRNKHQKALPRWQAVRNKLIGRVRQAIERTFA
FT                   QLKGRYGFTRMRYAGITANAFHLDLISIAYNLRTAAAIR"
FT   gene            complement(245415..246779)
FT                   /locus_tag="RPD_0214"
FT   CDS_pept        complement(245415..246779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0214"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37454"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EN5"
FT                   /protein_id="ABE37454.1"
FT                   /translation="MRSMLAATLMIVSATGLAAAQTPSGTVQGVKPKPVATTPIRPALQ
FT                   TPAETAKSMAQGEREAIQSDLAWTGDYNGVINGEASDRMVAAIKAFQNNHGAKPTGVLN
FT                   PQERAQLAEAARKLQGNVGWKLISDPVTGARLGVPGKLVPQQTSDANGSKWASSTGTIQ
FT                   IVLARRKEAGASIAKLADQEKKEPGRKVTYSAVRPDFFVLSGTQGLKKFYTRGAFKDAE
FT                   IRILTVLYDQATEGTMEPVVIAMSSAFNPFPSGAPAGPPPRKKVEYATGVIVSDDGAIL
FT                   TDRDAVDGCQTIVVVGHGNADLAATDKEHDLALLRIYGARGLKPLALGSGAAKASVDLT
FT                   GIADPQSQGGGAAVSVSKASVTPTGSAGGLALSPAPGLGFSGAPARDADRKFAGIALLR
FT                   PPVMAGAVNGAAAPQATLVDADIVRKFLATNKIQPATDAAADARASVVRVICVRK"
FT   gene            246901..247701
FT                   /locus_tag="RPD_0215"
FT   CDS_pept        246901..247701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0215"
FT                   /product="UBA/THIF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37455"
FT                   /db_xref="GOA:Q13EN4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EN4"
FT                   /protein_id="ABE37455.1"
FT                   /translation="MLSADELERYARHIVLREVGGPGQAALRRARVLVVGAGGLGAPVL
FT                   MYLAAAGIGTLDIVDNDEVSLSNLQRQVIHATPDIGKRKVDSAAARIKALNPHVEVRPH
FT                   ALRLTPANALDLIDGCDLVLDGSDNFATRYLVSDACFIARTPLITAALGPFDGSLTTIR
FT                   AHEKNPAGEFNPTYRCLFPEAPPPGTVPACEEAGVMGALAGMLGSMMALEAIREIVGFG
FT                   EGLVGRLLMIDARAMRFETLRYSRDPANPLNGDAPRVTDLSGHP"
FT   gene            complement(247862..248824)
FT                   /locus_tag="RPD_0216"
FT   CDS_pept        complement(247862..248824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0216"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37456"
FT                   /db_xref="GOA:Q12ZW2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q12ZW2"
FT                   /protein_id="ABE37456.1"
FT                   /translation="MAQDSFIEALLPAGFGRNERLERISGLIDWDRLAVLIRKVRPGET
FT                   GRPPYAPLAMFKALLLQQWYGLSDPGLEEALLDRVSFRRFCGFALDAQTPDETTLCRFR
FT                   NALQQAGLGDALFQEVLRQLEAAGYVLKTGTLIDATLVQSSGRTPPSGSTPREVESRSS
FT                   HDPQADWTRHGAGRRLFFGYKAHIAIDQGSGLIRARKLTGAKTYESEVADDLVLGDEKA
FT                   VYADKAYEKRARRQALKARGIKDRIQHRRNKHQKALPRWQAVRNKLIGRVRQAIERTFA
FT                   QLKGRYGFTRMRYAGITANAFHLDLISIAYNLRTAAAIR"
FT   gene            complement(249040..250041)
FT                   /locus_tag="RPD_0217"
FT   CDS_pept        complement(249040..250041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0217"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37457"
FT                   /db_xref="GOA:Q13EN2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EN2"
FT                   /protein_id="ABE37457.1"
FT                   /translation="MSVKKKPLVVVTRKLPDSIETRMRELFDARLNLDDVPMSADQLAE
FT                   AARTADVLVPTVTDTITSAMLNQPDCTLRLIAHFGNGIDNLDVAAAHARGITVTNTPKV
FT                   LTEDTADMTMALILAVPRRLIEGAALLTDGGEWPGWSPTWMLGRRLGGKRLGIIGMGRI
FT                   GQAVARRARAFGLQIHYHNRKPVAPRIADELGATYWDSLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLIRKDAFIVNTARGEVIDEETLTRLIETGDIAGAGLDVYEHEPVVNPKL
FT                   VRLAKAGKVVLLPHMGSATIEGRVEMGEKVIINIRTFLDNHKPPDRVLPAML"
FT   gene            250275..250799
FT                   /locus_tag="RPD_0218"
FT   CDS_pept        250275..250799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0218"
FT                   /product="protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37458"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EN1"
FT                   /protein_id="ABE37458.1"
FT                   /translation="MKLKRPIAAVLFAGAITGAAAPALAAKDSPLSASGLPVPRYVSLK
FT                   SDHVNVRIGPTKDNDVAWVYTRAGLPVEITAEFENWRRVRDSEGAEGWVYHSLLSGRRT
FT                   AVITMKDKDELATLYEAASTGSAVAARLQAGVVAQIKRCDPNWCRIIGSGFDGWIEKQR
FT                   LWGVYADEQVK"
FT   gene            complement(251081..251569)
FT                   /locus_tag="RPD_0219"
FT   CDS_pept        complement(251081..251569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0219"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37459"
FT                   /db_xref="GOA:Q13EN0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EN0"
FT                   /protein_id="ABE37459.1"
FT                   /translation="MDIGDRATYSREESVTLAHAVEPHLNGCPWHDVNEMLQSVGLRPT
FT                   RQRMALGWLLFSKGDRHLTAEMLYEEASQAKVPVSLATVYNTLNQLTDVGLLRQVSVDG
FT                   TKTYFDTNVTAHQHFYLENNHELIDIPDQHVALRSTPQVPDGYEIARVDVVVRLRKKS"
FT   gene            251784..252347
FT                   /locus_tag="RPD_0220"
FT   CDS_pept        251784..252347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0220"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37460"
FT                   /db_xref="GOA:Q13EM9"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EM9"
FT                   /protein_id="ABE37460.1"
FT                   /translation="MAEFRELKRQSRMRDRRSSYEYEDLLACGRGELFGPGNAQLPLPP
FT                   MLMFDRITEISETGGAHGKGLIRAELDVNPDLWFFACHFKGDPVMPGCLGLDALWQMLG
FT                   FFLGWSGGEGPGRALGSGELKFTGQVLPHVRKVVYNVDIKRVMRSKLWLGIADGWLSAD
FT                   DEIIYRAQDLKVGLFKQTAAKPAA"
FT   gene            252427..253653
FT                   /locus_tag="RPD_0221"
FT   CDS_pept        252427..253653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0221"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37461"
FT                   /db_xref="GOA:Q13EM8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM8"
FT                   /protein_id="ABE37461.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGFR
FT                   SQVQGLPSLNPADVVDRRAMRFLGEGAAWNHVAMEQALADSGLEESDISNPRTGIVMGS
FT                   GGPSARTIVEAADITRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYELIQWGKQDVVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDV
FT                   SRDGFVIAGGAGVLVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKM
FT                   ALSTTGGIKIDYINPHATSTPAGDPPEINALRNVFGAGDKCPPISATKALTGHSLGATG
FT                   VQEAIYSLLMMQNGFICESANITELDPAFADMPIVRKRIDNAKIGAVLSNSFGFGGTNA
FT                   TLVFKRLDA"
FT   gene            253850..254695
FT                   /locus_tag="RPD_0222"
FT   CDS_pept        253850..254695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0222"
FT                   /product="enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37462"
FT                   /db_xref="GOA:Q13EM7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM7"
FT                   /protein_id="ABE37462.1"
FT                   /translation="MQALMQGKRGLIMGVANNHSLAWGIAKTLSAHGAELAFTYQGDAL
FT                   GKRVKPLAQSLNAELVLPCDVEDLDSVDAVFATLKEKWGGLDFVVHAIGFSDKNELKGR
FT                   YADTTRENFSRTMVISCFSFTEIAKRAAELMPPTGGSMITLTYGGSTRVMPNYNVMGVA
FT                   KAALEASTRYLASDYGPRNIRVNAISAGPVRTLAGAGIADARIMFNYQLRHAPLRRTVS
FT                   IEDVGGSALYLLSDLSNGVTGEVHFVDSGYNIISMPEPDALKTVDEAETAAEQRAAKEK
FT                   "
FT   gene            complement(255039..257237)
FT                   /locus_tag="RPD_0223"
FT   CDS_pept        complement(255039..257237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0223"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37463"
FT                   /db_xref="GOA:Q13EM6"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EM6"
FT                   /protein_id="ABE37463.1"
FT                   /translation="MDAKTDDQGGKCPFPHGGGSRGHRNRDWWPEQLDINMLHRNSTLS
FT                   DPLGKAFDYAKEFESLDLDAVIKDLHALMTDSQDWWPADFGHYGGLMIRMAWHSAGTYR
FT                   TTDGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGNKISWADLYVLTGNVAL
FT                   ESMGFKTFGFAGGRADTWEPEELFWGPEGSWLGDERYSGERQLHDALGAVQMGLIYVNP
FT                   EGPNGNPDPVAAAKDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPSLIGAEPEGG
FT                   ALEDQGLGWKSKFGTGFGADAITGGPEVIWTQTPTQWSNFFFENLFGFEWELDKSPAGA
FT                   KQWKAKGAEATVPDPFDPTKKRVPTMLTTDLSLRFDPAYEKISRRFFENPDQFADAFAR
FT                   AWFKLTHRDMGPKVRYRGKLVPKEDLIWQDPIPPVDHELVSAKDIADLKARILASGLSV
FT                   SQLVSTAFASASTYRHSDKRGGANGARIRFAPQKDWEVNQPADLAQVLGKLEAIQKAFN
FT                   DAQSGGKKVSLADLIVLGGSAAVEKAAKDAGTEVEVPFTPGRMDALEEQTDGDSFKVLE
FT                   PRADGFRNFIGKRHQFMQPEEALVDRAQLLNLTAPEMTVLLGGLRVLGGNVGHDSHGVF
FT                   TDRPEKLTNDFFVNLLDMKTAWSLSATAEGVYEGRDRKTGDLRWTGTRVDLIFGSHSQL
FT                   RALAEVYGQSDAQTKFAQDFVAAWTKVMNADRFDLAAK"
FT   gene            257482..258420
FT                   /locus_tag="RPD_0224"
FT   CDS_pept        257482..258420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0224"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37464"
FT                   /db_xref="GOA:Q13EM5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM5"
FT                   /protein_id="ABE37464.1"
FT                   /translation="MVTLRQLRYLSALARHGHFGRAAESCAVTQPALSMQIAELERTLG
FT                   VKVVERRPGEVFLTEIGREIARRGDDLLTASRDLVDFARHRAQPLTGRLTLGVIPSLAP
FT                   YLLPKVLPLLQRRFPELRLELRESQTRQLVTDIGSGALDAALLALPAGNRDLDAIALFD
FT                   DVFLLAVPADDPRPESATVTVDEIDQSRLILLEDGHCLRDQALAFCATGRNRAINLGGA
FT                   GTATFGASSLTTVIQMVAAGYGVTLIPQIAAEIERRDARVKFLQLRRPQPGRSIGLAFR
FT                   KTSPRRSDFEALGDVVTEGVSGKAAREEASA"
FT   gene            complement(258512..260194)
FT                   /locus_tag="RPD_0225"
FT   CDS_pept        complement(258512..260194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0225"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37465"
FT                   /db_xref="GOA:Q13EM4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM4"
FT                   /protein_id="ABE37465.1"
FT                   /translation="MLSFLRSAAHDHAMAMLDAINRSQAVIEFDLEGNIRCANDNFLAT
FT                   TGYSLDEIKGKHHRIFVDPAERDSAAYRDFWASLRSGKQQSGEFERVAKGGRPLWLQAS
FT                   YSPIVDKSGKPGGFVKFAADVTAAKNRSMEDAGKILAISRAQAVIEFDLDGHIITANDR
FT                   FLKAMGYELTDIQGKHHSIFVDPSERASSEYCNFWARLGRGEYVSGEFKRFGKGQTEIW
FT                   ILATYNPILDVKGKPLKVVKFASDITQQKLSAADTAGQIAAIGKSQAVIEFDTQGIILD
FT                   ANDNFLAAVGFTLPEIKGRHHRIFVDPAERDGVAYQDFWAALARGQYQSAEYKRIGKGG
FT                   KEIWIQASYNPIIGLDGKPYKIVKYATDITRQVLTRIGNERVRGMMESVAAGAEELNAS
FT                   VREISEAMTKSRQTTLDAVNEVDSVDGQANRLNEAAQAMSGIVELISNITGQINLLALN
FT                   ATIESARAGEAGRGFAVVAGEVKNLANQAKQATDRIGAEIENLNGISGDVVGALGKIKA
FT                   AIQNVSEYVTSTAAAVEEQSTVTGEMSSGMQRAATEAAAIAAA"
FT   gene            complement(260510..262195)
FT                   /locus_tag="RPD_0226"
FT   CDS_pept        complement(260510..262195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0226"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37466"
FT                   /db_xref="GOA:Q13EM3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM3"
FT                   /protein_id="ABE37466.1"
FT                   /translation="MFSFFRRAGSSPSSTAIMEAMNRSQAMIEFNLDGTVLGANEKFLE
FT                   ALGYSLAEIKGKHHRMFVDPEETRTDAYRRFWADLQAGTYQAGEFKRIAKGAREIWIQA
FT                   SYNPVLGNDGKPLCVVKYATDITAAKRRSMEDFGKMQAIGRSQAVIEFAMDGTILTANK
FT                   NFLQALGYELDEIKGKHHSMFVEPAFCDSPAYREFWASLNRGDYLAAEYKRIGKGGREI
FT                   WILASYNPILDDKGKPFKVVKFATDVTGQKLKTADLAGQIDAIGKSQAVIEFGIDGTIL
FT                   DANANFLKVLGYNLADIKGKHHSMFVEPAERDAAAYRTFWAELAAGKYQAAEYKRIGKG
FT                   GREVWIQASYNPILDLNGKPFKVVKYATDTTRQVLVRIGNERVRAMMESVAAGAEELNA
FT                   SVREISEAMTKSRETALTAVSEVDAADGQAHRLNEAAQAMSGIVELISNITGQINLLAL
FT                   NATIESARAGEAGRGFAVVAGEVKNLANQAKQATDRIGAEIENLNGISGDVVGALGKIK
FT                   AAIQNVSEYVTSTAAAVEEQSTVTGEMSSGMQRAATEAAAIAAA"
FT   gene            complement(262822..264990)
FT                   /locus_tag="RPD_0227"
FT   CDS_pept        complement(262822..264990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0227"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37467"
FT                   /db_xref="GOA:Q13EM2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EM2"
FT                   /protein_id="ABE37467.1"
FT                   /translation="MFNKHSVEIDWGGRPLRLETGKVARQADGAVVATYGETVVLATVV
FT                   AAKTPREGVDFLPLTVDYQEKTYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFA
FT                   DGWRNETQVIVTVLSHDMENDPDILALVASSAALTLSGAPFKGPIGAARVGFINDEYVL
FT                   NPVLDEMPETQLDLVVAGTSDAVLMVESEAKELSEEIMLGAVMFGHRHFQPVIDAIIAL
FT                   AEKAAKEPRELTVIDDSAIEKEMLGLVEQELRAAYAIAVKQERYAAVGKVKEKAIAHFF
FT                   PEGQEPKYDKLRIAGVFKELEAKIVRWNILDTGKRIDGRDSKTVRSIIAEAGVLPRAHG
FT                   SALFTRGETQALVVTTLGTGEDEQYVDSLAGTYKETFLLHYNFPPYSVGETGRLGGTKR
FT                   REIGHGKLAWRAIRPVLPPHHEFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPL
FT                   KRPTAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTEQGVTSLQMDIKIAGITE
FT                   EIMKVALGQAKDGRIHILGEMSKALDRARAELGEHAPRIETFKIPTDKIREVIGTGGKV
FT                   IREIVEKTGAKVNIEDDGTVKVASSDGESIKAAIKWIKSIASDPEVGEIYEGTVVKVME
FT                   FGAFVNFFGAKDGLVHISQLAAGRVQKTSDVVKEGDKVKVKLLGFDDRGKTRLSMKVVD
FT                   QDTGEDLEAKQKAEAKAEDEAPAQAAGE"
FT   gene            complement(265334..265603)
FT                   /locus_tag="RPD_0228"
FT   CDS_pept        complement(265334..265603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0228"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37468"
FT                   /db_xref="GOA:Q13EM1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EM1"
FT                   /protein_id="ABE37468.1"
FT                   /translation="MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKT
FT                   HTKDNHSRRGLLKLVSTRRSLLDYVKKKDEARYKALLEKHNIRR"
FT   gene            complement(265606..266712)
FT                   /locus_tag="RPD_0229"
FT   CDS_pept        complement(265606..266712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0229"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37469"
FT                   /db_xref="GOA:Q13EM0"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM0"
FT                   /protein_id="ABE37469.1"
FT                   /translation="MTMTTSADTLAPQDVQHAGDDAPSSAQLRKPRDNNDPRNTARGKD
FT                   GNNKQPRRDKRDVHGWVVLDKPIGMTSTHAVAVVKRLFSAKRAGHAGTLDPLASGGLPI
FT                   AMGEATKTVPFVMDGRKRYRFTVAWGEERDTDDTEGKVTQASDLRPTPEAIRALLPQFT
FT                   GLIEQTPPQYSAIKIAGERAYDMARDGEIVPLVPRPVEIHELSLVEHDDSGKSVFEAEC
FT                   GKGTYVRALARDMGRLLGCYGHICALRRTLVGPFDEADMIPLEQLQALCDRAASGEGSL
FT                   ADALLPVETALDDIPALAVTRADAARLHRGQAVLLRGRDAPISSGTVYVTVAGRLLALA
FT                   ELGNGELIPKRVFNLSGLTASSARKESL"
FT   gene            complement(266712..267122)
FT                   /locus_tag="RPD_0230"
FT   CDS_pept        complement(266712..267122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0230"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37470"
FT                   /db_xref="GOA:Q13EL9"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EL9"
FT                   /protein_id="ABE37470.1"
FT                   /translation="MSRHQKPTGQSESPRKLRVGELVRHAVAEILAQGGVHDPVLETHL
FT                   ITVPEVRMSPDLKLATVYVMPLGGRDEKLVIAALEQHKRFLRGEVARRVNLKYAPEIRF
FT                   RIDERFAEAERIEKLLRTPAVQKDLEPDSDQD"
FT   gene            complement(267294..269945)
FT                   /locus_tag="RPD_0231"
FT   CDS_pept        complement(267294..269945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0231"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37471"
FT                   /db_xref="GOA:Q13EL8"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EL8"
FT                   /protein_id="ABE37471.1"
FT                   /translation="MVDTKTPGDKTLSMPTKTLTLKPRVEQGVVRQSFSHGRSKQVVVE
FT                   KRGKRRVGGDGPAEPAAAAPEVVKKPTPAPPAVSPRQQPRPSPQQQARSGMVLRTLTED
FT                   ERSARATALADARVREVEERRLAEIEAQRRAAQELVDKAEREAAEVRRKAEEERHRHEE
FT                   ETKRKAETEAKKRFGEAEPAKKPADGRPASTSTTTTAPRAPVTTTTRPPAVAAEAGDDD
FT                   EAPRMVRRGPGGGPARPAPPPKQPAAKPGASKQRGRLTLVTALTADDVRERSIASFRRR
FT                   TQRLKGHASNEPKEKLVREVIVPEAISIQELANRMSERAVDVIRMLMKQGAMHKINDVI
FT                   DADTAQLIAEELGHTVKRVAASDVEEGLFDVVDNSTDTEPRSPVVTVMGHVDHGKTSLL
FT                   DALRHANVVSGEAGGITQHIGAYQVTSPETGTKITFIDTPGHAAFTAMRARGAKVTDIV
FT                   ILVVAADDGVMPQTVEAINHAKAAGVPIIVAINKIDKPDAKPERVRTELLQYNVQVESL
FT                   GGDVVDVEVSAKNKTNLDKLLEMIALQAELLDLKTNESRPAEGTVIEAKLDRGRGPVAT
FT                   VLVQRGTLKVGDIIVAGAEMGRVRALISDQGDNVDFAGPSVPVEVLGFNGPPEAGDRLA
FT                   VVENEARARQVTSYRAHQKREKAASIVGMRGSLEQMMSQLKTTGRKDFPLIVKADVQGS
FT                   LEAILGSLEKLGTDEVAARILHAGVGGISESDVTLAEGFSAVILGFSVRANKEAAAAAK
FT                   RNGIEIRYYNIIYDLVDDVKKAMSGLLAPTLRETMLGNAQILEIFNISKVGKVAGCRVT
FT                   DGTVERGANVRLIRDNVVVHEGKLSTLKRFKDEVKEVQSGQECGMAFENYTDMRAGDVI
FT                   ECYRVETIQRSL"
FT   gene            complement(269938..270732)
FT                   /locus_tag="RPD_0232"
FT   CDS_pept        complement(269938..270732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0232"
FT                   /product="protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37472"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EL7"
FT                   /protein_id="ABE37472.1"
FT                   /translation="MFAAADAADLDDGPRTKKSATERMCAVSRQVRPTGELIRFVVAPT
FT                   GEVVADLKRKLPGRGLWVTASRAMVEQAVRRKLFARGFKRDVKAGPTLAADIERLLVQS
FT                   ACDALAIAAKARQVVSGFGKVSSALKSREAVAMIHAADGAADGIRKLDAVSRQIDGNET
FT                   GSRDFPVITVLNSEELDLALGRSNVIHAAVLAGPAGQTFLSRCQILVRYRLVDDGDAAE
FT                   AIAGTPINTPKDAADVDAADEEAADEVCANAHNVERLGRLNG"
FT   gene            complement(270895..272517)
FT                   /locus_tag="RPD_0233"
FT   CDS_pept        complement(270895..272517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0233"
FT                   /product="NusA antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37473"
FT                   /db_xref="GOA:Q13EL6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EL6"
FT                   /protein_id="ABE37473.1"
FT                   /translation="MAVSANKLELLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYG
FT                   SETDVHAEIDAKKGELRLSRHMLVVDKVENAANQISLKDAQRANPGAQIGDTIADTLPP
FT                   LEYGRIAAQSAKQVIVQKVREAERDRQYMEFKDRIGDVVNGVVKRVEYGSVIVDLGRGE
FT                   AIVRRDEMLPRESFRNGDRVRAYIFDVRRETRGPQIFLSRTHPQFMAKLFQQEVPEIYD
FT                   GIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWS
FT                   PDIATFVVNALAPAEVSKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGW
FT                   DIDILTETEESERRQADFENSTRVFMEALNVDEVVGQLLASEGFTSVEELAMVDIRELA
FT                   SIEGFDEETATELQARAAEYLDRVETELEARRQELGVEDALKDVPGVTSKMLVKLGEGD
FT                   VKTVEDLAGCATDDLVGWTERKEGAEPVKYAGILDGVEMTRDDAEHLIMQARVKAGWIT
FT                   EEELAQTADKGEDAGAETEGAAE"
FT   gene            complement(272520..273308)
FT                   /locus_tag="RPD_0234"
FT   CDS_pept        complement(272520..273308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0234"
FT                   /product="protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37474"
FT                   /db_xref="GOA:Q13EL5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EL5"
FT                   /protein_id="ABE37474.1"
FT                   /translation="MTDPIADPVVPDTLAEPRLVVEPGVAARFAAVAEPVLQAMGYRLV
FT                   RIKVSGEAGCTVQIMAERPDGTMLIDDCEAVSRALSPVLDVTDPIDRAYRLEISSPGID
FT                   RPLVRSSDFARYSGHLVKIEMAVPHQGRKRYRGLLDGVEGDAIRIQREGVTKDEDPLVL
FT                   LPMHDIGDARLVLTDELVAESMRRGKQAERELKQSLGLAPPPPPHAKRSDPKKSSAPKP
FT                   KPLTKPVVKPDAKPKPKNTKQHRLAADRLRRGDTDLSEGD"
FT   gene            273587..274672
FT                   /locus_tag="RPD_0235"
FT   CDS_pept        273587..274672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37475"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EL4"
FT                   /protein_id="ABE37475.1"
FT                   /translation="MSAALLLAPELDDVVGHGDAARRADAVRRIADLFVQGAMNFNAEH
FT                   VAVFDGVLVRLIPDTDGDLRGELARRFCSLGNAPPTLIEQLAQDEDIGVAGPLLRRSTQ
FT                   ITDDTLVELAEVRGQTHLMAISERPAISPPVTDVIVRRGDRDVLRMVAVNAGAAFSAFG
FT                   FSGLIRRAAQDGVLAVAVGVRDDLSLPRLKDLLASSSEPVRRKLFETASPSARIAINRA
FT                   LRELTGEPMQPSVKRDFAPAQRAIVALHNAGGLTEQALLSFARAFQYEETVAALSAMSG
FT                   VRITTLDPLMAGERHDPMLMLGKALGLDWTTVRAMIGLRRGPDRMPSSPDVEEARQNFE
FT                   RLAPSTAHQVVGFWKMRQAMN"
FT   gene            complement(274805..275575)
FT                   /locus_tag="RPD_0236"
FT   CDS_pept        complement(274805..275575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0236"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37476"
FT                   /db_xref="GOA:Q13EL3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EL3"
FT                   /protein_id="ABE37476.1"
FT                   /translation="MITIDRRVQTKCSVLGRHKQVFIDMNETVHHQGSFFGRRKGHKLR
FT                   AHQADLVDNLLPHLALDIELPAPDALAELFDAPVEAVRLEIGFGGGEHLIAEALAHPEI
FT                   GFIGAEPYVNGMAKILARIEDQNIRNVRLFAGDAAELMAWLPARALKRIDLIHPDPWPK
FT                   RRHWKRRFVQDSMIGAMARALIDGGEFRFVSDIDSYNAWTLAHLLRAPEFDWTAERADD
FT                   WRKPWSGYTMTRYGRKAEREGRRASYLRFRRIAA"
FT   gene            complement(275694..276113)
FT                   /locus_tag="RPD_0237"
FT   CDS_pept        complement(275694..276113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0237"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37477"
FT                   /db_xref="GOA:Q13EL2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EL2"
FT                   /protein_id="ABE37477.1"
FT                   /translation="MSTKAPNPVDKYVGSRVRMRRIMLGMSQEKLGEALGLTFQQVQKY
FT                   EKGTNRVGASRIQQISEILQVPVSFLFEGGPSGGLANANGFSEAPSPSYVSDFLATSEG
FT                   LALTRAFTKISDAKLRRSIVDLVEQIAAREPADDR"
FT   gene            complement(276304..277914)
FT                   /locus_tag="RPD_0238"
FT   CDS_pept        complement(276304..277914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0238"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37478"
FT                   /db_xref="GOA:Q13EL1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EL1"
FT                   /protein_id="ABE37478.1"
FT                   /translation="MKLPNLPSLVASSIILAWGWKRAAIAFVAGALSSLAMAPFNAWPI
FT                   LFVTFPVAVWLIDGAGAGRWRGVPAAALSGWWFGFGYFVPGLYWIGYAFLVDAQTFAWL
FT                   LPVAICGLPAYLALFTALGFALARLLWARGAMRVLALAVSLTIGEWLRGHLLTGFPWNA
FT                   FGYALTEPLALAQSVSLIGIWGLTLLAVAIFASPATLFDDGADTRRRWLAPTAALGLLI
FT                   AMAVYGSVRLQITPTQLVEGVRLRIMQPDVQQDRRFNYAAKAEVMQKYLTLSDRSTGPG
FT                   STGVRDATLLIWPESAFPFFLTREADAMAQIAELLPKGTILLTGAVRPPEMPPGRRITR
FT                   AYNSIYAIDHDGSILAVYDKLHLVPFGEFLPFQNLMEKIGFVQLTKVQGGFLPGVKRQN
FT                   IDLPKAPPLLPLICYEAIFPDEIEIRGSRPGWILNLTNDGWFGVSTGPYQHLQQARMRA
FT                   VEQGLPLVRAANTGISAVIDPVGRIVGRLDLGVEGVLDASLPSQIAPTVYARVGDVPAA
FT                   VLVALSMTLVLLRRRAPPR"
FT   gene            complement(277926..279053)
FT                   /locus_tag="RPD_0239"
FT   CDS_pept        complement(277926..279053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0239"
FT                   /product="putative HlyC/CorC family of transporters"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37479"
FT                   /db_xref="GOA:Q13EL0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EL0"
FT                   /protein_id="ABE37479.1"
FT                   /translation="MPDGDSTQNAAQPAEQDLSRQQLPAVVHQGEVLRPVAGAWLIRAI
FT                   RSLFGWKPGSVRDDLQVVLDTSPPDDTGFTALERTMLRNILGLHERRIADVMVHRADIV
FT                   AIKQEIPLGELMSLFEGAAHSRLVVYNETLDDPVGLVHIRDLVAFMTSKAKVAPQTVAK
FT                   RKKTLPAGLDLRAIDLKMPLTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALVVDEY
FT                   GGTDGLVSIEDIVEQIVGEIDDEHDSAEPPSIVRQPDGSFIADARTSLEDASVMIGDDF
FT                   VTGEAGEDVETLGGYLVNHVGRLPVRGEVISGPGNFEIEVLDADPRRVKRLRIGIRKER
FT                   AVARPRETRRREPASDQPATAPTDTTNPNPSPPGE"
FT   gene            complement(279055..279642)
FT                   /locus_tag="RPD_0240"
FT   CDS_pept        complement(279055..279642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0240"
FT                   /product="protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37480"
FT                   /db_xref="GOA:Q13EK9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EK9"
FT                   /protein_id="ABE37480.1"
FT                   /translation="MPQSNAGGRSDCIGAARDSSFGPMSSSAIPATEVVIAADCWQAEA
FT                   SAESVVLRAIEAAATMIDADTGDAELAVMLTDDDGVRALNASYRGIDKPTNVLSFPAPQ
FT                   PDYQDACQDSGGAPQMLGDIAIAYQTVRREADDEGKPFAHHLSHLAVHGFLHLVGYDHE
FT                   TDAEAETMESTERSILAGLGIPDPYADQDRVS"
FT   gene            complement(279642..280697)
FT                   /locus_tag="RPD_0241"
FT   CDS_pept        complement(279642..280697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0241"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37481"
FT                   /db_xref="GOA:Q13EK8"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK8"
FT                   /protein_id="ABE37481.1"
FT                   /translation="MAKSASDSSSLISRRKLERDSQTPPETQVVVAFDDNRAASALVGP
FT                   YGQHLAQIERRLAVVVDSRGNHITIAGARESCDSARRVLETLYAQAVSGSDISQGDVDG
FT                   AIRAVIAQGSLFEFDSKPAAGVFEAINLRKRPVRARTAAQDSYIRALKRHELVFGVGPA
FT                   GTGKTWLAVAHAAQLFERKEVDKIILTRPAVEAGERLGFLPGDLREKVDPYLRPIYDAL
FT                   YDLMDSRIVERALQTNEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGEN
FT                   SRMIVTGDPSQVDLPNGQTSGLSEAVRLLSGVEGIAQVKFTAEDVIRHELVARIVAAYE
FT                   GAPPKPAGGAA"
FT   gene            complement(280703..282124)
FT                   /locus_tag="RPD_0242"
FT   CDS_pept        complement(280703..282124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0242"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37482"
FT                   /db_xref="GOA:Q13EK7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EK7"
FT                   /protein_id="ABE37482.1"
FT                   /translation="MAPPRKLHIKSYGCQMNVYDAQRMVDVLAPEGFVETATVDDADLV
FT                   ILNTCHIREKASEKVYSELGRLRLARDEAASSGRRMQIAVAGCVAQAEGEEIVRRAPVV
FT                   DVVVGPQSYHHLPQLLARADQAGRALETEFPVEDKFGFLPQPRPETIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEVSRPVSAIIDDVKRLADNGVREITLIGQNVNAYHGEGPDS
FT                   RAWTLGRLLRRLAAVPGIVRLRYSTSHPNDVDDELIEAHRDLDALMPFVHLPVQSGSDP
FT                   ILAAMNRKHTAADYRRVIDRFRAVRPQIAFSSDFIVGFPGETEADFAATLALVTQIGYA
FT                   GAYSFKYSPRPGTPAADMQEMVPAAVMDERLERLQQLIDSQQSAFNKAAIGQTVDVLFE
FT                   RAGRKPGQIVGRTAYLQPAHVFPGPMFLGPGMAPDSLVGQILPVRVDSLERYSLLGELA
FT                   AKPPQHARPLAATGA"
FT   gene            complement(282222..282875)
FT                   /locus_tag="RPD_0243"
FT   CDS_pept        complement(282222..282875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0243"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37483"
FT                   /db_xref="GOA:Q13EK6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK6"
FT                   /protein_id="ABE37483.1"
FT                   /translation="MRPDLVIFDCDGVLVDSEVISCRVHAETLTRHGYPITTEQVAERF
FT                   LGRSGREARREIEAELGRVFSDDLEAQLVADVLRSFAESLEPIPHIIAALDALTQPVCV
FT                   ASSGTLERIAFALNRTGLYRRFAPNLFSAEQVANGKPAPDLFLHAARQMGVPPSRCVVI
FT                   EDSVPGILGARAAGMTALGFVGGSHCLPGMDARLRAAGASAIFDDMRQLYDFII"
FT   gene            complement(282970..283401)
FT                   /locus_tag="RPD_0244"
FT   CDS_pept        complement(282970..283401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0244"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37484"
FT                   /db_xref="GOA:Q13EK5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK5"
FT                   /protein_id="ABE37484.1"
FT                   /translation="MSELKATEIEARCAATGMRMTEQRRVIARVLAEAVDHPDVEELYT
FT                   RCVAVDDKISISTVYRTVKLFEDAGIIERHDFREGRARYEQMRDSHHDHLINLRDGKVI
FT                   EFTNEEIEKLQAEIARKLGYRLVDHRLELYCVPLDDDKT"
FT   gene            complement(283463..283948)
FT                   /locus_tag="RPD_0245"
FT   CDS_pept        complement(283463..283948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0245"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37485"
FT                   /db_xref="GOA:Q13EK4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK4"
FT                   /protein_id="ABE37485.1"
FT                   /translation="MMTWLAEFWGYADALVEPATLSDSPKLAQLHAASFHSGWSEEEFA
FT                   DLLSQRNTLVHRLRMGRRIIGFIASRFGADEAEILSVAVASGYRGRGLSRELLLTHLGH
FT                   LAGRGVAKVFLEVEENNQPARRLYQRSGFEIVGRRERYYRQPDGEQLNALIMRRDLS"
FT   gene            complement(283959..284654)
FT                   /locus_tag="RPD_0246"
FT   CDS_pept        complement(283959..284654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0246"
FT                   /product="peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37486"
FT                   /db_xref="GOA:Q13EK3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK3"
FT                   /protein_id="ABE37486.1"
FT                   /translation="MLILAIDTALDACAAAVLDTDVNRLLARESQPMQRGHAEALMPLL
FT                   GRVMQSSGIGFADLDRIAVTTGPGSFTGLRVGLSAARGIALAAGKPVVGLTTLSAFAAP
FT                   LVSERDDTPILSAIDARHDQVYYQLVSGNGTRLVRPRVAPIAEALEAVRHGAPRLVGNA
FT                   AGLLAARWPALTPPAPLIDQQPAPDILWVAWLGAAANPETAPARPFYLRAPDARPQADA
FT                   LARSQQPAA"
FT   gene            complement(284798..285364)
FT                   /locus_tag="RPD_0247"
FT   CDS_pept        complement(284798..285364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0247"
FT                   /product="nitrogen-fixing NifU-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37487"
FT                   /db_xref="GOA:Q13EK2"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK2"
FT                   /protein_id="ABE37487.1"
FT                   /translation="MFIQTEPTPNPATLKFIPGRVVLDSGTMEFTDRKQAARSPLAERL
FT                   FEVEGVSGVFYGSDFVTVTKDGAGDWQHLKPAILGAIMEHYMSGAPIMADGRVDGDETD
FT                   EDEFFAERDAETVEIIKDLIETRVRPAVANDGGDITFRGFKDGVVYLAMKGACSGCPSS
FT                   TATLQHGIQNLLKHFVPEVVEVRPV"
FT   gene            complement(285516..286010)
FT                   /locus_tag="RPD_0248"
FT   CDS_pept        complement(285516..286010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37488"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK1"
FT                   /protein_id="ABE37488.1"
FT                   /translation="MSTQRQSYRPDHRPKCLVIVDDTAEWDRAVYYASRWAVRVGGGVV
FT                   MLRVIEILDQNQQWLGVADVMRAEAIEIAEQALDRASGRANGVAGITPERVIREGDTIA
FT                   QVRKVIESDVDITTLVLAAGDGPEGPGPIVTAMVRHLGSFPVPVVMVASGLTDDDIDAL
FT                   S"
FT   gene            complement(286169..287278)
FT                   /locus_tag="RPD_0249"
FT   CDS_pept        complement(286169..287278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0249"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37489"
FT                   /db_xref="GOA:Q13EK0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK0"
FT                   /protein_id="ABE37489.1"
FT                   /translation="MDGAPNSAIGAAPFDHAQELNMTTQRVFSGVQPTGNLHLGNYLGA
FT                   IVNFVKLQETHNCIYCVVDLHAITVPVTVWGGPDELRRNTREVTAAFIAAGIDPNKHII
FT                   FNQSQVAEHAELAWVFNCVARLGWLNRMTQFKEKAGKDRENASIGLYDYPVLMASDILV
FT                   YRATHVPVGEDQKQHLELTRDIAQKFNNDFAESIAAQGLGDSYFPMPEPVITGPATRVM
FT                   SLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRKAKTDPEPLPSEEKGLETRPEADNL
FT                   VGIYAALAGKPKTDVLAEFGGAQFSAFKSSLVDLAVEKLSPIAGEMKRLSADHGYVDSV
FT                   LASGSDRARVIAAETMVGVKDIMGMVRKR"
FT   gene            complement(287292..288848)
FT                   /locus_tag="RPD_0250"
FT   CDS_pept        complement(287292..288848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0250"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37490"
FT                   /db_xref="GOA:Q13EJ9"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ9"
FT                   /protein_id="ABE37490.1"
FT                   /translation="MIRPILTVSAGTLSSRLLGFVRDALVAALLGAGVVADAFLLAFQL
FT                   VNVARRLLTEGALNAALVPAWLRVREHNGAVAAAAYAGRLLGTVALATLLLALLLGVFM
FT                   PLLIALLAPGFVGHPTLLMATRDARLMLPYLAFAGPVAVMMGLFNAQGKVGLTAFSPLL
FT                   FNVALIVVTAALLLWHANDTQAALILSATIGVAGLMQLGIVVFNGRGERLATPLRASFD
FT                   PSMRAFFAKAIPGMIANSGPQLLIVIGAIVASSKPSAVSWLYFANRLIELPLGIVGVAM
FT                   GAVLVPELARAVRGDDRAALSDAASRGLELAIGVALPAMLGLIVLREPIVRVLFEHGAF
FT                   TASDTAATALALGLLALGLPAQVLAKTWSAAFFAREDTSTPLFATLVALGVALAAALLL
FT                   GRTYGASGVAAAIALGAWSNAALLLGRGLARFGVAIDPAARRRVALIVLAAGAMGGLLW
FT                   LKAGFVLPLVAEASTLAQAAVLGVLIAGGLIIYAALLILFGVVRPAAALGALRRPRGLR
FT                   G"
FT   gene            289114..290115
FT                   /locus_tag="RPD_0251"
FT   CDS_pept        289114..290115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0251"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37491"
FT                   /db_xref="GOA:Q13EJ8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ8"
FT                   /protein_id="ABE37491.1"
FT                   /translation="MSSAQYDVLGIGNAIFDVLVRTEDDFLVRHGMAKGGMALIDEARA
FT                   AAIYADMGMATEISGGSAANTIVGLASFGARAVYVGKVKDDQIGKLYSHDIRAAGVTFD
FT                   TRPASDGPATGCSYILVTPDGERTMNTYLGAAQDLGPADIDEAQIAAAAITYLEGYLWD
FT                   PPQAKEAFLKASKIAHGAGRKVALTLSDSFCVDRYRGEFIELMRSRTVDLIFANESELH
FT                   SLYQTSDFDTALKQLALDVPLGVVTRSEKGCAVVEENNITLVPAAKIDTLVDTTGAGDL
FT                   FAAGFLFGLVRNAGYENAGRLAALAAAEVIQHIGARPQVSLKELAQQHGLPV"
FT   gene            complement(290262..291956)
FT                   /locus_tag="RPD_0252"
FT   CDS_pept        complement(290262..291956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0252"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37492"
FT                   /db_xref="GOA:Q13EJ7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ7"
FT                   /protein_id="ABE37492.1"
FT                   /translation="MTDKAPSYVCGVSDAPLLGITIGQALDLAAQRWPDREALVSPSHD
FT                   TRWTWREFAACVDALAAGFLALGLERGARIGIWSMNRPEWTLTQFAAAKAGLILVTINP
FT                   AYRLSELEFALAKVGCAALVTATAFKTSAYMEMLNTLIPELSQSQPGALQSSKLPHLRA
FT                   VIQIGGPKCPGTVAFDDLAQMGGARHREALAALAGRLQFDDAVNIQFTSGTTGSPKGVT
FT                   LTHHNILNNGYFVGRAMKLTEQDRICIPVPLYHCFGMVMGNLAAVTSGATMVYPGEGFD
FT                   PLATLQTASREKCTALYGVPTMFIAELDHPEFASFDLSSLRTGIMAGAPCPVEVMRRVN
FT                   DQMNMREVTIAYGMTETSPVSFQSAVDDPEQRRVSTVGRIHPHVEVKVVDLEGRIVPRG
FT                   QRGELCTRGYSIMLGYWDEAEKTADVLDRTGWMHTGDLAVIDDEGFCNIVGRIKDMVIR
FT                   GGENLYPREIEEFLYRHPKIQDVQIFGVADNRYGEELCAWVRVRSGEKLTADDIRAFCQ
FT                   GQIAHNKIPRYIEFVDEFPMTVTGKIQKFVMREKVESKLGLVAAKTA"
FT   gene            complement(292089..293276)
FT                   /locus_tag="RPD_0253"
FT   CDS_pept        complement(292089..293276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0253"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37493"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ6"
FT                   /protein_id="ABE37493.1"
FT                   /translation="MQSRANIDQLLQQSCERGDIPGVVAVAGSSTEVLYEGAFGKRDLS
FT                   KPQPMTTDSVFWIASMTKAITSAAAMQLVEQGKLSLDEPIGKVLPDLAEPLVLDGFDAS
FT                   GNPITRPANAPITLRQLLTHTAGFCYDMWNGDMVKYMERYDIPGVLRCREAALKVPIMS
FT                   DPGARWEYGISIDFVGRVVEAASGERLDAYLRDDILAPLGMSDTGFRITDAQRERLVAV
FT                   HSRGADGTLAPIEFEVEQEPEFIMGGGGLYGTAADYLKFTRMILNKGRGNGNQVLKPET
FT                   VALMGQNHIGDLNVTRLNSVIPFATNDVDLYPGMDNKWGLSFLINTATTPEGRSAGSLA
FT                   WAGLANTYYWIDPTRDVCGVILMQVLPFADGKCLEAFAGFERGVYAGLDAGKKAA"
FT   gene            293543..293869
FT                   /locus_tag="RPD_0254"
FT   CDS_pept        293543..293869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37494"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ5"
FT                   /protein_id="ABE37494.1"
FT                   /translation="MIPSWSAWKRYPQAGRGNIEAPISPGVYEIRNANDGSLVGFEAVD
FT                   NLAMALARLQVGPKRLGGWFGRRAPAAAPELEYRVCATTTRAHARAAAEHMINRRETWF
FT                   SRAA"
FT   gene            294048..295541
FT                   /locus_tag="RPD_0255"
FT   CDS_pept        294048..295541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0255"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37495"
FT                   /db_xref="GOA:Q13EJ4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ4"
FT                   /protein_id="ABE37495.1"
FT                   /translation="MSPTTAARKSDAASSLRDRLKDPSLLREQCFIDGAWIGTGATVVT
FT                   NPANGQELGKVPKMGADETTQAVEAAARAFPAWAKLTAKQRSNILRKWFELIVAHREDL
FT                   ALILTSEQGKPLAEALGEVDIGAAYVEFFAEEARRVYGETIPTQRADARLIAIKQPIGV
FT                   CGAITPWNFPNSMITRKVSPALAAGCPVVLKPANETPFSALALAALAEKAGVPKGVFNV
FT                   VTGHASAIGKVLCEHPAVRFVGFTGSTEVGKILYQQAAVGVKKLGLELGGNAPFIVFDD
FT                   ADIDAAVEGAMVSKYRNMGQTCVCANRIYVQDSVYDAFVDKLAAKVSAMKIGDGAEPGV
FT                   TQGPLINEAAVEKTENHIADAVAHGAKVIVGGKRHALGGTFFEPTVLANVRPDALVAHE
FT                   ETFGPLAPVFRFKDEAEVIRLANNSPFGLASYFYARDIGRVWRVAEALESGMVGVNSGL
FT                   ITTEVAPFGGVKESGLGREGSHHGMEEYVEIKYVMMAGI"
FT   gene            complement(295704..296390)
FT                   /locus_tag="RPD_0256"
FT   CDS_pept        complement(295704..296390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37496"
FT                   /db_xref="GOA:Q13EJ3"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ3"
FT                   /protein_id="ABE37496.1"
FT                   /translation="MRRAVGLALGLLLTAAPAHAQDSATLKKDMVGQWELSTTERSKTC
FT                   VVTLKPDAAPRGMKLELEPGCAAALPFTRDIAAWTVKGLDIVRLETAAGDPVIDFTEVE
FT                   SGIFEGLRANEGVYILQNLAAARSLAKSMEQMIGDWSMVRGSGRPICSLTLTNNEASTP
FT                   DNFQAFLKPRCEPPVAGFGPTMWRLERGALLLTAPSGEIWRFEADDNAQWRKTPDTADP
FT                   LIMLRQ"
FT   gene            complement(296392..297378)
FT                   /locus_tag="RPD_0257"
FT   CDS_pept        complement(296392..297378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0257"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37497"
FT                   /db_xref="GOA:Q13EJ2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ2"
FT                   /protein_id="ABE37497.1"
FT                   /translation="MAGEAGATDKIDLLIYGPSKPVINDGFPEQYALHKCEQPGDLDRL
FT                   TDDIRARIRGVAVTGLVPTNSSVLARYPKLEIVSSFGVGYDHIDSGWAAEHDVVVTNTP
FT                   DVLTEEVADTALGLLIATLREFVRADKYVRSGSWLTQPYPLSVGSLRDRKVGLIGMGRI
FT                   GQAIARRLDASRVPVVYHARNPAAGVSYQHYPDLIAMAKDVDTLIVIIPGGASTARLIN
FT                   AEVLQALGPRGVLINVARGSVVDEPALIAALKSGAILAAGLDVFADEPKVPDELRMMQN
FT                   VILLPHIGSASVVTRNAMDQLVVDNIKAWFDGKPPLTPIPETPVRGR"
FT   gene            complement(297378..298202)
FT                   /locus_tag="RPD_0258"
FT   CDS_pept        complement(297378..298202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0258"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37498"
FT                   /db_xref="GOA:Q13EJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ1"
FT                   /protein_id="ABE37498.1"
FT                   /translation="MSGRAPTGPRPSRISAASWLRVLLPFVVLAAGVAVWDLVVRINQI
FT                   PPYVLPGPGLVWQTLVADWPILSVSLLATLWTTLKGFLAAAIGGVALALLFNQSRWVEY
FT                   SLFPYAVVLQVTPVIAIAPLLLIYLPQETAVVVCAWIVAFFPVLANTTLGLNSVDRNLA
FT                   GLFRLYGASPLQTLLRLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGSAGAGSGLAY
FT                   RIAESGYRLNIPRMFAALLLLSAAGIVIYLLLALVSHLLLRRWHESALGKDN"
FT   gene            complement(298199..299011)
FT                   /locus_tag="RPD_0259"
FT   CDS_pept        complement(298199..299011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0259"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37499"
FT                   /db_xref="GOA:Q13EJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ0"
FT                   /protein_id="ABE37499.1"
FT                   /translation="MALSSSPDLDGPAAACAIRLRAATKVYRGGVEALGPIDLDIGRGE
FT                   FVSLLGSSGCGKSTALRLIAGLAKPSSGSVRVAGEATRRRGGHAIGFVFQEPTLMPWSS
FT                   VRANVGLPLKIAHAPAAEIARHVDAALARVELSDFAEAYPRELSGGMKMRVSLARALVT
FT                   DPDILLMDEPFAALDEITRFRLNDDLLALWRDLGKTILFVTHSVFESVYLSQRVVVMSP
FT                   RPGRIAAEFRIEAPEPRGDEFRTSTGYAAQCRDVSRALADASAAQVRA"
FT   gene            complement(299022..300143)
FT                   /locus_tag="RPD_0260"
FT   CDS_pept        complement(299022..300143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0260"
FT                   /product="perplasmic binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37500"
FT                   /db_xref="GOA:Q13EI9"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI9"
FT                   /protein_id="ABE37500.1"
FT                   /translation="MTPAFLLRALTGAVAVALLAVPVHASPPPAPEKPVEKPAPPPPPK
FT                   KPPPPVVQPVRKVPEGGFDKVSFGTNWVAEGEHGGFFQAVADDTYKSYGLNVTIVPGGP
FT                   NVNNRALLLAGKLDFFMTANTLQSFDAVANNVPVVAIAAVFQKDPQVFLTHPESKVGQL
FT                   DDLKRLTLFVSKEGIASYFQWLKSEYGFNEAKVKPYTSNPQPFIVDRNAAMQGYVTSEP
FT                   FVIEQKAKFKPSVLLLADYGLDGYSTLIETRRDLIDKNPDMIQRFVDASMIGWYNYLYG
FT                   DNAAGNALIKSLNPEMTDEMLAYSVAKMKEYGIVDSGDTLRNGIGAMSDERYASFFDKM
FT                   SRAGVVKRDLDFRQAYTLQFTNKGVGVDLRPSR"
FT   gene            300297..301109
FT                   /locus_tag="RPD_0261"
FT   CDS_pept        300297..301109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0261"
FT                   /product="Creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37501"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI8"
FT                   /protein_id="ABE37501.1"
FT                   /translation="MTRLPPRDWTEIRWPEIGDADPARWIAVLPLAATEQHGPHLPLGT
FT                   DVMIARAYLARVHELLPAELPVSFLPLQPIGLSTEHLAFPGTLTLGTETALRLWTEIGD
FT                   SVARAGVRKLVMVTSHGGNSAAMSLVAQELRARHAMLAVTTGWARFGLPDGLFADDELR
FT                   HGIHGGAVETSIMLAHAPQQVRTDRIADFRPATAAMEHEFRWLSAQRPAPFAWAAQDLH
FT                   PSGAIGDATAASADKGRKALDHGARAFCELLADVDRFDLATLRPAPRP"
FT   gene            complement(301191..302822)
FT                   /locus_tag="RPD_0262"
FT   CDS_pept        complement(301191..302822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0262"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37502"
FT                   /db_xref="GOA:Q13EI7"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI7"
FT                   /protein_id="ABE37502.1"
FT                   /translation="METILLPFSPRYIALTICAVLTALFASIAITDYHTSLFGVMLTLA
FT                   LVFGALTLLGVRDLLQKNHAVLRNYPISAHLRFLLEEIRPEMRQYFFESEKDGKPFSRD
FT                   TRALIYQRAKMVLDKRPFGTQEDVYGDGYEWMHHSVAPRPHAEERFRITIGGPDCAKPY
FT                   SASVFNISAMSFGALSPNAVRALNAGAKKGGFAHDTGEGGVSPYHREHGGDLIWEIGSG
FT                   YFGCRTRDGQFDPDAFARLATDDQIKMVELKVSQGAKPGHGGVLPAAKVSEEISRIRGV
FT                   AMDEDCISPPFHKAFSTPVEMLRFIAEMRRLSGGKPTGFKLCIGHPWEFLAICKAMLAT
FT                   GITPDFIVVDGNEGGTGAAPLEFMDHLGMPMREGVNFVHNALIGIGMRDRIKIGAAGKV
FT                   ATAFDMARAMALGADWCNSARGFMFALGCIQSLSCHTDRCPTGVTTQEPSRYRALVVTQ
FT                   KIDRVFNYHHATLHALAELVAAAGLDHPQEIGPHHFSQRTSSSVVVSFAQLYPTLRPGE
FT                   LLDGTDDPRFKQAWAMARAETFAAAL"
FT   gene            303023..304009
FT                   /locus_tag="RPD_0263"
FT   CDS_pept        303023..304009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37503"
FT                   /db_xref="GOA:Q13EI6"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI6"
FT                   /protein_id="ABE37503.1"
FT                   /translation="MPQLQDFRTGKPAFYPDQAIYAEYACARLGLRFSERDGGTGLLFA
FT                   VASGTKEICFGGGRCSYYPQNNATAASLATDKYLANALLERAGVATLGGRYFFLHDRHR
FT                   ALRPPGHERKDALDYLAAQGGHAFAKPLTGSRGDFARPIESAAALASYLDDVARYYDSV
FT                   LIQPYASGHEYRVFVVDGEALYTARKLPPAVIGDGVRSLRELLHEHDRALRDRGLSGAS
FT                   GDDPSLDQVPAAGERRDIAGRMNLSVGGAMVMEEAGAPAIAGARAATRALGLRLGAVDL
FT                   FVDPDARDDVRVIEVNSNPAIRFLESCGRDDLIVAIWRHSLTAAGLL"
FT   gene            304010..305326
FT                   /locus_tag="RPD_0264"
FT   CDS_pept        304010..305326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0264"
FT                   /product="FolC bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37504"
FT                   /db_xref="GOA:Q13EI5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI5"
FT                   /protein_id="ABE37504.1"
FT                   /translation="MFDLPKYGEGICLARLAVLLDRLGVDRARLQRIAVAVCGSNGKGS
FT                   TAAFTAGIGRAHGLRTGLFTSPHLYRFNERFQIDGAPIPDDALRRLLERVTKAIAEVGE
FT                   ARGEQFGAFEAQFALACLYFQDNACDFAVFEAGIGGRYDPVRLLGARVSCVTSVDLEHV
FT                   ALLGHSIELIASDKSDACAAGGVIVYGENCRPLRDHLAEYNRNREVAALFIGDEIGIGS
FT                   ASIADARQRFDLRIEDHTYVALETSLLGPFQVNNAAIAASLFALWLRQSGTDHDPARLD
FT                   AAIRHGLRDARWPGRLETISTEPLTVIDVGHTPDGIRQALAGLRAAHGESGWILVLGAS
FT                   RDKNAAEIVAALAPSFDAIVCSSAHHKGAPAEVIAEAARAANPRAEIVTAATVADAVGE
FT                   ARMLAERLDARIYVAGGLFLAIEFAAVTRGGRAEDLRFF"
FT   gene            305411..306409
FT                   /locus_tag="RPD_0265"
FT   CDS_pept        305411..306409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0265"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37505"
FT                   /db_xref="GOA:Q13EI4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI4"
FT                   /protein_id="ABE37505.1"
FT                   /translation="MTAVNRQVLLIAKPKEKLGPEHFRMAEAAVPEPKDGEALVKVRYI
FT                   SLDAANRAWMQGATYRAAVETDSVMPGGGIAEVVSSKAEGLSPGDIVFADTGWQDYAAL
FT                   PAKHLTKLPKVEPLTHLLSVYGIAGLTAYFGLLDVGKPVAGETVVVSAAAGSVGSIVGQ
FT                   IAKIKGCRVVGIAGGRAKCDWLVNELGFDAAVDYKDGALFKALRAAAPNGIDVYFDNVG
FT                   GDILEACLPQMNLRGRIACCGAVSQYDRTPSATGPRGVPGLIVVKRLIMQGFIVMDYMD
FT                   RRDAAVAELQGWVASGRLKVQEDVIDGLENTPQALIGLLAGENRGKRMVKV"
FT   gene            complement(306439..306675)
FT                   /locus_tag="RPD_0266"
FT   CDS_pept        complement(306439..306675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37506"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI3"
FT                   /protein_id="ABE37506.1"
FT                   /translation="MVSIPRGERLQIMLTEDEYHALDLWRFSRHMPSRAAAVRELLRRG
FT                   LSAEGFAVSDGTRKSSDFGLIGKSSAETDGRQP"
FT   gene            complement(307559..307635)
FT                   /locus_tag="RPD_R0006"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(307559..307635)
FT                   /locus_tag="RPD_R0006"
FT                   /product="tRNA-Arg"
FT   gene            307917..308537
FT                   /locus_tag="RPD_0267"
FT   CDS_pept        307917..308537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0267"
FT                   /product="protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37507"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI2"
FT                   /protein_id="ABE37507.1"
FT                   /translation="MQTVHTEVTMGLLDILNGMQNGPRGPADPNDKSGGMSKFTMAILA
FT                   LLAYKAYKHVTAPDAPASVGHGRPTSVPQSPNTMPSRNTINAGMPGGGLSDMLKGGLGG
FT                   LLAGGAAGTILSGGLGDLMKQFQTNGLGDAADSWVGRGENKQIGPNDLANALGADRLEM
FT                   LTQQTGMSREELLDGLSQQLPGVIDQLTPDGRLPTEDEASRWI"
FT   gene            308588..308866
FT                   /locus_tag="RPD_0268"
FT   CDS_pept        308588..308866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0268"
FT                   /product="Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37508"
FT                   /db_xref="GOA:Q13EI1"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI1"
FT                   /protein_id="ABE37508.1"
FT                   /translation="MTGILWIILVGFIAGIIARFLSPGPNNPQGFLLTTVLGIVGAFLA
FT                   TAIGQAIGHYGPNQGAGFITATIGAVLVLFIWNRLVARRVLSDPGNR"
FT   gene            complement(309048..309830)
FT                   /locus_tag="RPD_0269"
FT   CDS_pept        complement(309048..309830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0269"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37509"
FT                   /db_xref="GOA:Q13EI0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI0"
FT                   /protein_id="ABE37509.1"
FT                   /translation="MAKAGLNVIVTGSASGLGAATAKILARDGARLVINYSSSQKDAET
FT                   TAEDCRKAGAAEVVVVQGDVAKDDDCKRIVEAAAHWGGLDALINNAGITKHVAHHLLDQ
FT                   LSAEDFQRIYAVNTIGPYQMVRAARALLVAGAKAAGRSSAVVNVSSVAGTSGIGSSIAY
FT                   AASKGALNTMTLSLSRALAPSIRVNAICPGYIDTPWFTKGRGADAAQQVRDMVVAKVPL
FT                   KIASSPEDIAELVCFLASPKSSSMTGELVRMDAGMHLG"
FT   gene            310089..311156
FT                   /locus_tag="RPD_0270"
FT   CDS_pept        310089..311156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0270"
FT                   /product="acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37510"
FT                   /db_xref="GOA:Q13EH9"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH9"
FT                   /protein_id="ABE37510.1"
FT                   /translation="MTETTDNIVVETAEKIFADLADAQTINASKDGSWRAPLWRALSES
FT                   GLPLSWVPEACDGSGASLAEGFAVLNAAGRAGLAAPLAETMLAGWLLAQANIASPEGAM
FT                   TIAPVHPKDRITLGPDGTLSGRARGVPFARDAKFIAVLAQRSDGASVALVDASTCRIDH
FT                   GLGLGGDPSDTVTFDKVSPLKLAAAPQGFDATALLLIGSVARSLQIAGALETMLEISVR
FT                   YSNERVAFEKKISKFQAVQHNLAKLAGETSAALAAATSAADTLANATAFDDAVMLEAAA
FT                   AKIRCAEAAEKGAAIAHQVFGAIGFTSEHILHRYSLRALAWRDDFGNESHWAVELGRMV
FT                   ARRGADDLWPLVASR"
FT   gene            311182..312342
FT                   /locus_tag="RPD_0271"
FT   CDS_pept        311182..312342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0271"
FT                   /product="acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37511"
FT                   /db_xref="GOA:Q13EH8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH8"
FT                   /protein_id="ABE37511.1"
FT                   /translation="MTAALRFDPIRLPPVCEELRREVRAFLAEEIAAGTFDPHKPQRED
FT                   SDAPEFSRRVGARGWLGMTWPKQYGGHERTFLERYVVTEEMRVANAPTRRFFVADRQSG
FT                   PVLLKYAPEHIKMDILPRICRGELCFAIGMSEPNSGSDLFAAKTKATKTDGGYLINGSK
FT                   IWTTSAHIADYMIAIFRTSPSTKENRRHGLTQFLVNMKTPGIKVNPIAQITGQHEFNEV
FT                   VFTDAFVPDDHVLGEIDGAWKQATSELAFERSGPERFLETYYVLTELVRALGPDPDTRG
FT                   AEGIGRLVAQLHTMRRMSVSVAGMLQAGKEPVVEASIVKDIGTMWEQQLPHRVRELAAF
FT                   VDSEASNHATLDELTAFATKVAPKLTIQGGTTEVLRGIIARGLGLR"
FT   gene            312486..313292
FT                   /locus_tag="RPD_0272"
FT   CDS_pept        312486..313292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0272"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37512"
FT                   /db_xref="GOA:Q13EH7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH7"
FT                   /protein_id="ABE37512.1"
FT                   /translation="MTNYTDIAVETNGHVALIEIRRPPLNFFDISLIQQIADALDAIDA
FT                   DPEMRATVLAAQGKAFCAGANFGDSAQQAGDPQAAKGDPADSLGQIGHLYYEAVRIFRA
FT                   KKPIVAAVHGAAIGGGLGLAVSADFRVTCPEARFAANFTKLGFHPGFGLTVTLPELIGR
FT                   NNAELMFYTSRRVTGEDAVKMGLANELVPLNEVRSAALKLAREIAECAPLGLLSTRATM
FT                   RATLADRVMEATKHELAEQTRLRATEDFREGIKATEERRIAHFKGR"
FT   gene            complement(313355..314119)
FT                   /locus_tag="RPD_0273"
FT   CDS_pept        complement(313355..314119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37513"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH6"
FT                   /protein_id="ABE37513.1"
FT                   /translation="MAPFLRLRQICLVADSLEPATSRLAAIMGLEVCYRDPHVGKYGLE
FT                   NVLLPVDATLLEIVAPTRAGTAAGRFLEKTGGHGGYMAIFCCDDPDARGRHAATLGVRT
FT                   ANVIDHAPYHGVQLHPRDCRAAFIELNHTAGSDNVRGPYPPAGPDWHKAIRTEVTQALT
FT                   AVELQSPDPDDLAAHWGRILELPVTKGAEGVAELQVPNATLRFVKGDSEALTALTFKVA
FT                   DPTKIREAAQSQGVATTGDGFTLAGVAFRLSN"
FT   gene            complement(314122..314910)
FT                   /locus_tag="RPD_0274"
FT   CDS_pept        complement(314122..314910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0274"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37514"
FT                   /db_xref="GOA:Q13EH5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH5"
FT                   /protein_id="ABE37514.1"
FT                   /translation="MTDIVLQQLDQGLLTITMNRPDRRNALNQELIRGLVDAARRAADD
FT                   PEVRAVLLKGAGGTFCVGGDVKSMAAAGAPPPLEAKVANLRRGMEVSRILHQMPKPVVA
FT                   QIDGAAAGAGLSIALACDLRVVGASAKITTAFAKVGLSGDFGGTYFLTHLIGAAKAREL
FT                   YLTSPVLTAQEAHALGIVSCVVPDADVESAARELALSLAQGPSVTLGYIKTNINNAEHL
FT                   SLEACFDAEALHHSRCAETADHKEAASAFVEKRAPSFQGR"
FT   gene            complement(315107..316312)
FT                   /locus_tag="RPD_0275"
FT   CDS_pept        complement(315107..316312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0275"
FT                   /product="putative ureA/short-chain amide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37515"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH4"
FT                   /protein_id="ABE37515.1"
FT                   /translation="MKAIRIALFACLSITAISAAQAQSQPPLKLGAILDMSGLYADITG
FT                   PGSEAAAKMAVEDFGGTVLGRKIEIVVADHLNKADLSANIARDMLDNQGVEAIIDVAAS
FT                   ATALAAAEIAKARGKIIMFSGPGSIRLSNEACGPYTVHYVFDTFAQANTTGLAAVKQGL
FT                   DSWFFLSADYAFGQDLERDTSNVIKASGGKVLGNVKHPINTSDFSSFLLQAQSSKAKVV
FT                   GLANAGGDTINAIKQAAEFGIAKGGQKLSPLLAFISDIDSVGLDTAQGLILAEAFYWDL
FT                   NDDTRAFSKRFMERTKRVPTSVQAGLYSETMHYLQAVKAAGTTDAAAVMKKMKETPIND
FT                   FFAKNGRIREDGRMVHDMYLFEIKKPSESKGRWDNYKLLATVPGDQAFQPLSESRCPLV
FT                   KK"
FT   gene            316528..317322
FT                   /locus_tag="RPD_0276"
FT   CDS_pept        316528..317322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0276"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37516"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH3"
FT                   /protein_id="ABE37516.1"
FT                   /translation="MTATTNNARARGRLAAMISGGVLLFVPGVLFAGCPDLPRQGEGVV
FT                   AAIDDGRSLRLQDGREIRLAGIELELSRQAEAKAALASLASGRVITLRGVDDAPDRYGR
FT                   QPAFVFTDDETRPLQSRLLDAGHALVGTGIAQADCRGELLAAESSARIARRGLWAAPSA
FT                   LKNAGNPGDIMSRVGRFTVIEGRVLSVREAGGTIYLNFGRRWTRDFAVTISRRILGSFE
FT                   AAGIAPKSLENKRIRVRGWVERRSGPQIRIREVGQIEVPGAP"
FT   gene            317343..318836
FT                   /locus_tag="RPD_0277"
FT   CDS_pept        317343..318836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0277"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37517"
FT                   /db_xref="GOA:Q13EH2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH2"
FT                   /protein_id="ABE37517.1"
FT                   /translation="MIGSEGRRSIWRSRHWLAVPLLGSALALAGCGDFRRFETASAPAS
FT                   APAVKPARPAAQSPTAEREHERILATYGGAYDDPRLEALIGSTVNRLVAASDRPDLTYK
FT                   VTILNSGAVNAFALPTGQLYVTRGLVALASDTSELSSVLSHEMAHVLAKHAAIREDQAR
FT                   QAALVTRVVTDMGNDPDMTALALAKTKLSLASFSRQQELEADGIGVGISARAQFDPYGA
FT                   SRFLTAMERNAALKASRGDPRSQDFLSSHPATPERVRNAQNNARQYASPEQNAKGERDR
FT                   ETYLNAIDNLVYGEDPSEGFVRGRRFLHPKLGFTFQVPETFTLDNTAQAVIGVREGGSQ
FT                   AMRFDVVRVPAEQSLGDYLNSGWMENVDKSSTEELSISGFPTASVMARGDQWQFKVYAL
FT                   RFGSDVYRFIFATRQKSAESERNARDTVNSFRRLTLDEIQAARPLRIKVITVQPGDTVE
FT                   SLSHRMAGVDRPLERFRVLNGLDASATVKPRDLVKIVVD"
FT   gene            complement(319035..320333)
FT                   /locus_tag="RPD_0278"
FT   CDS_pept        complement(319035..320333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0278"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37518"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH1"
FT                   /protein_id="ABE37518.1"
FT                   /translation="MCYIWHILETRHAVFAAGKGSRQKQRTGAWRFHAQAVSQKTRKMS
FT                   VSSKRAKHAAAANRSATKSQSRISAKDTRSVKSPASKASGSKASSSKSPVSKASATKAS
FT                   ATKAVGSKSSVSKASASKASTSKASAGKAAAAKVTAGKASAAKVTTAKGSAAKASASKA
FT                   SALKSSKNKRSEMPSKTAKTAAPADASKTASAKSTAKPVAKAPEAPKAAVAKPEGKPVA
FT                   AKPAAPPKVEEPKKAVTQRQGFKAGEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFI
FT                   KDKMTLRVPTAKVANVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSG
FT                   DIVAIAEVVRDLFRSESQPEQSYSERQLYEAALDRLSREIAVVQQVTETEAVKEVEGQL
FT                   AKSPRRGAKAEVDAEGDADGDVDTDDAVTDEAA"
FT   gene            complement(320466..320804)
FT                   /locus_tag="RPD_0279"
FT   CDS_pept        complement(320466..320804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0279"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37519"
FT                   /db_xref="GOA:Q13EH0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EH0"
FT                   /protein_id="ABE37519.1"
FT                   /translation="MTYVVTENCIKCKYTDCVEVCPVDCFYEGDNMLVIHPDECIDCGV
FT                   CEPECPADAIKPDTEPGLEKWLELNTEYAKSWPNLTQKKEAPGDAKQYEGMEGKFEKFF
FT                   SPEPGTGD"
FT   gene            complement(320879..321148)
FT                   /locus_tag="RPD_0280"
FT   CDS_pept        complement(320879..321148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0280"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37520"
FT                   /db_xref="GOA:Q13EG9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG9"
FT                   /protein_id="ABE37520.1"
FT                   /translation="MERQRLDKWLWHARVVRARSAAAALVESGHVRINGAREKSPGHAI
FT                   KAGDVVTIALDRGVRVLKVVGFTERRGDAASVTGLYADLSVPRD"
FT   gene            complement(321188..324547)
FT                   /locus_tag="RPD_0281"
FT   CDS_pept        complement(321188..324547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0281"
FT                   /product="helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37521"
FT                   /db_xref="GOA:Q13EG8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG8"
FT                   /protein_id="ABE37521.1"
FT                   /translation="MPRSFSAPFTNDRAPGAGVTAVLGPTNTGKTHLAIERMVAHPSGL
FT                   IGLPLRLLAREVYNKIVDRVGPDAVALVTGEEKIKPPKARFWVSTVEAMPRDLDVSFLA
FT                   VDEVQIAADLERGHVFTDRLLRRRGRDETLLLGAATMRPIIERLLPGASIVTRPRLSQL
FT                   EFAGDRKLTRQPRRTAIVAFSADEVYAIAELIKRQHGGAAVVLGSLSPRTRNAQVAMFQ
FT                   SGDVDYLVATDAIGMGLNLDVDHVAFASDRKFDGYQFRRLNPSEFAQIAGRAGRATRDG
FT                   TFGTTGRCAPFEPELVNALQNHTFDAVKTLQWRNSELDFASIAALQVSLAETPRHDALT
FT                   RAPAAEDLRVLDHAARDGDVRDMAHGAAAVERLWEVCQVPDYRKIAPAAHAELVTTLYR
FT                   FLMQKGRIPDDWFGAQVEQADRIDGGIDTLSARIAQIRTWTFVANRVDWLADPEHWQGI
FT                   SRDIENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIVEGHVIGRLD
FT                   GFTFAPDAAEAGSDAKALQATAQKALAGEIDSRAEKLSGAPDEQFLLTSDGTVRWTGDA
FT                   VGRLVGSDEVLRPRLRIIADDRLAGASREAVQTRLDLWLKTHIEKILGPLFELSKAEDI
FT                   TGIGRGIAFQLIESLGVIERAKIAAEMKDLDQPSRATLRKYGVRFGAYHIYVPSLLKPA
FT                   ARALASLLWAQKLDDVDMSALSSAQHLASSGRTSFPADKALDRDAYRTLGYRLCGERAV
FT                   RVDILERLADLIRPALAWREGAQGEKPAGAFDGRSFVVTQSMTSLTGSAGEDFASILRA
FT                   LGYRMEKRPALPPSTTAPAKLPDAAPEAPSADSAETGLSAEDHAILAGAIAFEPAVAAE
FT                   TDDVADLTNDAPQPVAASEQAAPEPAADASESSPVESQPDSAAVPEAELAATDTAQEAT
FT                   AEAAASDAPAVDATTDNTDGAAPAVESAAPAQPEMVEVWRPGGRSDEHRARPDRNRQRH
FT                   RPPQAGQAAAPEGEAGEAKRGDRPDRGGRRGDRKGADVRRDRREGEGQGAPRSEAAGEG
FT                   RPSRERFKGRDKSQDKFKGGPKGGRDNQGGGSHRQVHSSAPPRERDRPIDPNSPFAKLA
FT                   ALKEQLSAGRKD"
FT   gene            complement(324975..325856)
FT                   /locus_tag="RPD_0282"
FT   CDS_pept        complement(324975..325856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37522"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG7"
FT                   /protein_id="ABE37522.1"
FT                   /translation="MNIPVSRPSRRQAHASLMPGLIAGLLTIGLASIAPLDRAAAQGKL
FT                   DARYEATLAGIEVGKGGWVIEITDDGYAAAANGATSGVLQAFSRGNGSGEAQGRLVNGQ
FT                   FSPMNYMATTTSAKKTETIRITLANGNVKESSIEPEQPHDADRIPVTEAHRRGVVDPMT
FT                   GSILRVPGVGDLISPDSCRVSTPIFDGRMRYDLRMDYKRIETVKAEKGYQGPVLVCGIY
FT                   FTPVSGYIPDRAAIKYLVEQRGMEVWLAPIAGTRMLVPFRLKIPTPLGNAVLQATQFVT
FT                   KATPPKSVSRTQ"
FT   gene            326169..326474
FT                   /locus_tag="RPD_0283"
FT   CDS_pept        326169..326474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0283"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37523"
FT                   /db_xref="GOA:Q13EG6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EG6"
FT                   /protein_id="ABE37523.1"
FT                   /translation="MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALGR
FT                   PVRLRVSTNALKSVDHRGGLDAFLAKASIAELSPKAAELKRAIAKKKAGEPAAAAS"
FT   gene            326692..330009
FT                   /locus_tag="RPD_0284"
FT   CDS_pept        326692..330009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0284"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37524"
FT                   /db_xref="GOA:Q13EG5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG5"
FT                   /protein_id="ABE37524.1"
FT                   /translation="MNRPIGQNNYAPDTAPDLDSLGPRCPRIEAGAMKLSTRLTLAMVA
FT                   LVLVTTAVLGFLNYRSIVELVMPRALKQLQTHAQLNALLMDAHLRGARADAVGAQASST
FT                   LRDLLLSRLKTTETPGEPAPEWRRRIEARFAAELVAKPTYAILRIIGPEDGGRELVRVD
FT                   RLGPNGGIRAVPVSQLTRRGDRSYVREGLALPRNEVAVSKIELNRNETGLEIPYVATMR
FT                   TMAPIDAPDGTRLGVLVINTNLSENLERVRDSVTRGNLIYIVNAAGDYLLHPDRSREFG
FT                   FDRGTPSRIQDDFPAFAALLDGKDEAPRVMESSTGQRFGVGWDWVRLADGPRVGVIEMR
FT                   SYASLTSVPRAVRDATLTGGAAAILVAMLMAVPLARSLTRPLVRITRSVQAFARGEKFE
FT                   LTPGGSQEINLLADAFSQMTHEANRKAIALAAEVEERTRIAGVLQNTIDIMVDPVLVVD
FT                   ARGTVILTNPAACEMFGSLAGISILNTTRSFDRFSPDGKPLTPDKSALLRAFLGETIEN
FT                   FEFIVQPIGSARRSYLTANGRPLRGETGQIQGAVMVYHDITKTKKAEEALRRSEQMARA
FT                   IVDTALDAFVQVDALGTITEWSPHAELVLGWRRSEAIGRNVFQLLIPADQLERRTEEFK
FT                   RFASSLGRDSSGFRVEIEVLHQDGTPTPIEVAMTALYRDGSFVINAFLRNLTEQIAFEE
FT                   QLRQSQKMESIGQLTGGIAHDFNNMLTVITGTIDIISDGVADQPHLATIAKLISEAADR
FT                   GAELTRLLLAFARKQPLRPDETDVNALVAGLQSLLRPTLGEQIEIETSFDDGAWPIYVD
FT                   RGQLESALVNLAVNARDAMPNGGKLTIETCNIVVDQELAKRFGNVESGSYVMIAISDSG
FT                   CGIPDAIRGKVFDPFFTTKEVGKGTGLGLSMVYGFIKQSGGHITLYSEVGLGTTFRLYL
FT                   PRASTENEREAATSSEQGAVGGTETILVVEDDAMVRSYVNAQLKSLGYTALSVGNATAA
FT                   LSISDSGAEFDLLFTDVVMPGPYNGVQLAAEMSKRRPGLKVLFTSGYSENALIYNDRLD
FT                   PDILLLSKPYRRADLARMIRLALNSTVESEVIQNAADEHLKNERVDDNVERSSVRPL"
FT   gene            complement(330097..331176)
FT                   /locus_tag="RPD_0285"
FT   CDS_pept        complement(330097..331176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37525"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG4"
FT                   /protein_id="ABE37525.1"
FT                   /translation="MTTGDGGAAAGRLLSRRRVVALAAGLAFAAHPALAQSQAQRFDPE
FT                   EFSTPAPERIEVRARPIESFDLRDRASRRFGALQFRSGLVLTSPFRGFGGLSGLKLDPK
FT                   GERFVAINDRGAWITGRIVYSGAEMTGLADVEAAPLLGPDGQPLTRRKWYDSESLAFDG
FT                   GTAYVGFERVNQIVKFDFGRDGVRALGQPIAVPPALRKLPNNKGIESLVAVPKGQPLAG
FT                   TLIAISERGLDADRNVIGFLIGGKTPGQFAVRRTEDFDISDAMLLPSGQLLILERKFSW
FT                   IHGVHIRIRRIALSTLTPGAIVDGPALFNADLGHEIDNMEGIDAHLDASGATVLTLVSD
FT                   DNFSMLQRTLLLQFTLVED"
FT   gene            complement(331173..333068)
FT                   /locus_tag="RPD_0286"
FT   CDS_pept        complement(331173..333068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0286"
FT                   /product="cobalt chelatase, pCobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37526"
FT                   /db_xref="GOA:Q13EG3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG3"
FT                   /protein_id="ABE37526.1"
FT                   /translation="MTTNSKFRTGSKEAPTEPFKRAVTSCLRAIAKSPELEVTFAAERP
FT                   GLAPGKARLPEPARKMSKRDAAIVRGHADSIALKLACHDPKVHRKLMPGNPQARGVFEA
FT                   VEQARVEALGARRMAGVAKNLTAMLDDHFHRGKFDEITERADAPLADALAMLVRERLTG
FT                   LAPPPAARKLVDLWRPVLDDKIGPRLDQLERFAENQSKFGDAIHDLLEALELGDDRDTE
FT                   SEEDENQDDKQEGENDQSGAEGTPESEAAQEMSAEQAEATSDEMSDSAMESAQASASDT
FT                   FDDSEVGEDDTPGEATRPNNRGANEPRGPEYHAFAPKFDEVIAAEDLCDHDELERLRSY
FT                   LDKQLAHLQGIVARLANRLQRRLMAQQNRAWDFDLEEGILDPARLSRVVTDPFHPLSFM
FT                   SEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTRAWK
FT                   GGQSREAWLAAGKPATPGRLNDLRHIIYKSADAPWRRARKNLGLMMREGLLKENIDGEA
FT                   LDWAHKRLLGRSEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRHIIEEIETRSPVEL
FT                   IAIGIGHDVTRYYRRAVTIVDAEELGGAITEKLAELFSETADAPAGPGRRRRLHS"
FT   gene            complement(333223..334218)
FT                   /locus_tag="RPD_0287"
FT   CDS_pept        complement(333223..334218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0287"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37527"
FT                   /db_xref="GOA:Q13EG2"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG2"
FT                   /protein_id="ABE37527.1"
FT                   /translation="MTAATTRAQEITGLPDMKVSVRQVFGIDSDLEVPAFSEADPHVPD
FT                   VDSDYRFDRATTLAILAGFARNRRVMVTGFHGTGKSTHIEQVAARLNWPCVRVNLDSHI
FT                   SRIDLVGKDSIVVRDGKQVTEFRDGILPWALQHNVALVFDEYDAGRPDVMFVIQRVLEV
FT                   SGRLTLLDQNKVIKPHPAFRLFSTANTIGLGDTSGLYHGTQQINQGQMDRWSIVTTLNY
FT                   LPHDEEVEIVLAKARHYRNAEGREIVNKMVRLADLTRNAFANGDLSTVMSPRTVITWSE
FT                   NAEIFGDIGFAFRVTFLNKCDELERPLVAEFYQRCFNAELPESSVNVAMS"
FT   gene            334517..334657
FT                   /pseudo
FT                   /locus_tag="RPD_0288"
FT   gene            334720..334860
FT                   /pseudo
FT                   /locus_tag="RPD_0289"
FT   gene            complement(334887..335534)
FT                   /locus_tag="RPD_0290"
FT   CDS_pept        complement(334887..335534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0290"
FT                   /product="heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37528"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG1"
FT                   /protein_id="ABE37528.1"
FT                   /translation="MAIDSSKFFDKIRVKPTKAEAAREAAREQVIMCDAPGCANRGAHR
FT                   APKGRGLEKDYWHFCLNHVREYNQGYNFFEGMNADAVARYQKDALTGHRPTWKMGQNGA
FT                   KSRTKNPEDLAGAADPFEVINEFNGRSRWRRGPDPSAEQTKSEPRKVFNAERKALQVMG
FT                   LDGDATLDIVKAKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRA"
FT   gene            335604..335909
FT                   /locus_tag="RPD_0291"
FT   CDS_pept        335604..335909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0291"
FT                   /product="transcriptional regulator BolA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37529"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG0"
FT                   /protein_id="ABE37529.1"
FT                   /translation="MQRDRKRTNGRDMGVKDTLTQKLREAFTPESLDVIDESNLHEGHA
FT                   GHSGRGESHFRVNIVSDAFAGKSRIDRHRMINELLAAELKGGLHALAVKAKAPGEA"
FT   gene            complement(335951..337273)
FT                   /locus_tag="RPD_0292"
FT   CDS_pept        complement(335951..337273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0292"
FT                   /product="protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37530"
FT                   /db_xref="GOA:Q13EF9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF9"
FT                   /protein_id="ABE37530.1"
FT                   /translation="MDWLTFGIVIACLFGSAFFSASETALTAASRANMMRLAKQGSRNA
FT                   GIVGRLLAVRERMIGALLLGNNIFNIGASALATGLFTAWFGELGVLYATAVMTVLVVIF
FT                   AEVLPKTIAINAPDRFALLVAKPMRAMVLVLGPLLTVIEALVRVLMRLMGVKVGAHQSL
FT                   LTATERLRGAVELIHHEGGVAKHDRDMFGGLLDLSELQVSDVMVHRTEMVMVNADLPPE
FT                   ELVREVLATEYTRIPLWREKPENIIGVLHAKDLLRAMRAAEGDASNIDVTKIALPPWFV
FT                   PEMRLVSEQLKAFRSRKTHFALVVDEYGEVEGMVTLEDILEEIVGDISDEHDIVVAGVR
FT                   TQPDGSVVVDGSVPIRDLNRAMDWNLPDEEATTIAGLVIHEARSIPDRGQSFTFHGFRF
FT                   RVLRRERNRITALRIVPVPRETEAEAADKKKGKIARIGPVP"
FT   gene            complement(337288..338436)
FT                   /locus_tag="RPD_0293"
FT   CDS_pept        complement(337288..338436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0293"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37531"
FT                   /db_xref="GOA:Q13EF8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF8"
FT                   /protein_id="ABE37531.1"
FT                   /translation="MTAPLNHSAPITVDVALGDRAYDIVIGRDVLGTLGERIAKLRPGA
FT                   RTAIVTDRTVAQHWLAQAEAVLDKAGVAHQRIVVGEGESSKTYAGLEQVAEALIAAKIE
FT                   RNDLVIALGGGVVGDLAGFASAIVRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQGKNL
FT                   LGAFHQPVLVIADTAVLDTLSPRQFRAGYAEVAKYGALGDEAFFAWLEANHAEIVSGGP
FT                   AREHAIATSCRAKAAIVARDERENGERALLNLGHTFGHALEAATGFSDRLFHGEGVAIG
FT                   MVLAAQFSAERGMMPEADALRLQHHLAEVGLPTRLQDIAGFAQEGLADADALLALMTQD
FT                   KKVKRGQLTFILMEGIGRAVIANDVEPAPVRDFLARQLARAS"
FT   gene            complement(338433..339047)
FT                   /locus_tag="RPD_0294"
FT   CDS_pept        complement(338433..339047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0294"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37532"
FT                   /db_xref="GOA:Q13EF7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF7"
FT                   /protein_id="ABE37532.1"
FT                   /translation="MSEIAPPADAARSQEAEIVAALGERAVVLIGMMGAGKSTVGRRLA
FT                   LRLGLPFLDADTEIESAAAMTIPEIFDTHGEPHFRDGEARVIARLLDGGAKVLATGGGA
FT                   FMREETRDRIRDKAVSLWLEADADVILRRVKRRADRPLLKTPDPAGTIARLIDERYPVY
FT                   RSADLTIASRDVPHEKIVDECVAALHGYLCCAAAPTLSETP"
FT   gene            339225..339371
FT                   /locus_tag="RPD_0295"
FT   CDS_pept        339225..339371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37533"
FT                   /db_xref="GOA:Q13EF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF6"
FT                   /protein_id="ABE37533.1"
FT                   /translation="MPTLFRFLSVVAVIGGIIYGTIFALANFVSPKSREMTVVVPADKF
FT                   LKK"
FT   gene            339389..340444
FT                   /locus_tag="RPD_0296"
FT   CDS_pept        339389..340444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0296"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37534"
FT                   /db_xref="GOA:Q13EF5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF5"
FT                   /protein_id="ABE37534.1"
FT                   /translation="MRRPRSNPSSSVQSSVQALAAEPANRETAPLRPASYSDAGLSELF
FT                   LDMIAAEQGASANTIDAYRRDLADLSHYLTRSRKSIASADTEALRGYLADLDARGFKSS
FT                   SVARRLSALRHLFRFLLSERIRVDDPAAILSGPKRGRGLPKVLSIADVDRLLGYARQQA
FT                   EAADGAGGVRAARLYCLLEVLYATGLRVSELVSLPSSAARGDARMIVVRGKGDKERLVP
FT                   LNHSAKQAMTRYLATAAAAEKAAATATKAGSKGSKWLFPSFGESGHLTRQHFARDLKDL
FT                   AGRAGLSPRLVSPHVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVVEDRLKS
FT                   LVRDLHPLAEG"
FT   gene            340595..341569
FT                   /locus_tag="RPD_0297"
FT   CDS_pept        340595..341569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0297"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37535"
FT                   /db_xref="GOA:Q13EF4"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF4"
FT                   /protein_id="ABE37535.1"
FT                   /translation="MSLVMSEPMRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEVSR
FT                   IEEKAAQALNELYAALTPWQKTQVARHPQRPHCVDYIQGLITEFTPLAGDRKFGEDEAL
FT                   IGGFGRFRGESICVLGQEKGSSTETRLKHNFGMARPEGYRKAVRLMEMADRFGIPVLSL
FT                   VDTAGAYPGIGAEERGQAEAIARSTDACLQLGVPNVAVVIGEGGSGGAIAIATANKVLM
FT                   LEHAIYSVISPEAASSILWRDGTKAQEAANSMKITAQDLLRFGVIDQILAEPKGGAHRD
FT                   PEAMIATTGDAIAAAFAELNGLDSSTVRNKRRQKFLEIGRKLG"
FT   gene            341987..343450
FT                   /locus_tag="RPD_0298"
FT   CDS_pept        341987..343450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0298"
FT                   /product="protein of unknown function DUF949"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37536"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF3"
FT                   /protein_id="ABE37536.1"
FT                   /translation="MTRTPLLRALLASAAIAASSLLAGCNSDQMSLATNAKANQPVPPK
FT                   LVAEMQAKNMDLQSPILVRLFKQEAELEVWKQDRTGVFALLKSYPICRWSGDLGPKVRE
FT                   GDRQAPEGFYAISPGQMNPQSSYYLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRGCYA
FT                   MTDEQIAEIYSLGRESFFGGQRAFQLQAYPFKMTPVNFAKHRNNPNMPFWKMLKEGYDH
FT                   FEVTRQEPKVDFCEHKYVFDAAPPPGSSKPLAFNASAKCPAYSVPADIADAVREKDQKD
FT                   QTKLAELISKGTPVARLRTGIDGGMHQVFAAKIPDGSTGLSEVDDSSSVALASFDRAPG
FT                   TIPPTVNPPRRPSDDLLQKATETTSVAAAPATSTSNPPARVASASKDDIGGLLSGLSRR
FT                   GGSGEITSSTAPTQATARRNEPTPAPPRPHATVPKSADTKQAAAKPQLKPAVELNGATA
FT                   AKPTTTGTISGAAPVVSSNNFEGRFSAFR"
FT   gene            complement(343844..346684)
FT                   /locus_tag="RPD_0299"
FT   CDS_pept        complement(343844..346684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0299"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37537"
FT                   /db_xref="GOA:Q13EF2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EF2"
FT                   /protein_id="ABE37537.1"
FT                   /translation="MIGAFARKLFGSSNDRRIKAYQARVAAINALEPDVAALSDEALRA
FT                   RTDQFRAELAAGKTLDDLLIPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLACYLNALAGKGVHVVTVNDYLASRDAGWMGQIYAFLGMSTGVIVHGLDD
FT                   SQRQKAYACDITYGTNNEYGFDYLRDNMKYRLEDMAQRGHFFAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSEFYNTIDTFIPRLDKSDYDVDEKQRSVALTEAGMEKIETLLRDAGQLK
FT                   GESLYDIENVSVVHHINQALRAHTLFQRDKDYIVRNDEVVIIDEFTGRMMQGRRYSEGL
FT                   HQALEAKEHVTVQPENQTLASITFQNYFRMYGKLAGMTGTAATEADEFYDIYKLEVVEI
FT                   PTNVTIARLDEDDEVYRTQTEKYAAILAEVERANKRLQPVLVGTASIEKSEVLADVLLK
FT                   SGYKQIDFGDPKALEKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIATN
FT                   MAGRGTDIKLGGSLEMRIQQETADITDEAEKAARIEQIKADIERFRQIVLNAEDEVEIE
FT                   PAKGNKPAKTAKRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLMR
FT                   IFGSGKLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDDVQNDQ
FT                   RKVIFDQRIELMKEDSVVETVTDMRHTFIEDLVSKHVPEHAYAEQWDVAGLKEELNRVV
FT                   GLDIPVDEWAKEEGIADEELLVRLEKVFDEHMAAKVAQWGPDVMRYAEKSILLQTLDHL
FT                   WREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFNLFQEMSAHLREAVTAQLMRVEIIP
FT                   PEQPRELPPMEVHKMDPNTGEDEMQFANVSLAPADTVEKSERDPNRPESWGKVGRNEDC
FT                   PCGSGKKYKHCHGRYA"
FT   gene            347027..347944
FT                   /locus_tag="RPD_0300"
FT   CDS_pept        347027..347944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0300"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37538"
FT                   /db_xref="GOA:Q13EF1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF1"
FT                   /protein_id="ABE37538.1"
FT                   /translation="MTPASSAAISALRSGFISAAATGCLAFALLASPMAHAEDANPVLA
FT                   KVNGAEIRQSDVALAEEELGPSLAQMDPATKKENVLAFLIDMKIVAKAAEDKKIADRAE
FT                   FKKRLEFARNRLLMDDLLAVEGKNATTNDAMKKVYEDAAKQISGEQEVHARHILVESED
FT                   DAKAVAEELKKGADFAELAKKKSKDPGASDGGDLGFFTKEQMVPEFSAVAFAMEPGKIS
FT                   DPVKSQFGWHIIKVEEKRSRKPPTFDQVKPQIEQYVTRKAQADYVAQLRQAAKVERLDK
FT                   PAEPAAAPADAAKPADPAKAPAKK"
FT   gene            complement(348152..349207)
FT                   /locus_tag="RPD_0301"
FT   CDS_pept        complement(348152..349207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0301"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37539"
FT                   /db_xref="GOA:Q13EF0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF0"
FT                   /protein_id="ABE37539.1"
FT                   /translation="MTANGTHVPARMHGDRVDWVDYAKGICIIMVVMMHSVLGVEAAAG
FT                   ETGFMHLVVEFAKPFRMPDFFLLSGLFLAVVIDRDWRTYLDRKVVHFAYFYVLWVTIQF
FT                   AFKAPSFAAEIGWAGVVKLYALSFIDPFGTLWFIYLLPIFFVVTKATRRAPPLLIWAIA
FT                   ALLESLHVATGWMVIDEFCARFFYFYTGYLFASRVFAFSDAARARPALALIGLALWAAI
FT                   NAALVHTGVSEWPLLSLLLGLAGACAIIAAGTLLAEKRWLDGLRFCGEHSIVIYLAFFL
FT                   PMAVSRTLLLKFAGFLGTGMIALLVTIIGVVGALVIWRLAMLSGATFLFERPNAFWIAP
FT                   RKKSARLQAAE"
FT   gene            349371..351848
FT                   /locus_tag="RPD_0302"
FT   CDS_pept        349371..351848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0302"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37540"
FT                   /db_xref="GOA:Q13EE9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE9"
FT                   /protein_id="ABE37540.1"
FT                   /translation="MHLSRSFDTPLPIDDALADLTSALAGNSTAVLVAPPGAGKTTRVP
FT                   LALLDQPWLGTKKIIMLEPRRIAARASAERMAKTLGERAGETVGYRVRFGSKISRATRI
FT                   EVVTEGIFTRQILDDPELAGIGAVLFDEFHERSLDADLGLALARDAQQGLREDLRILVM
FT                   SATIDGARVARLLGDAPVVESLGRAFPVETRYLGRRSDAPMERQMAEAIAAALRSDAGS
FT                   VLAFLPGAAEIRRTETMLRERVHDAAIEIVPLFGALDAAVQDRAIQPAPKGSRKVVLAT
FT                   SIAETSLTIEGVRIVVDCGLSRVPRYEPDIGLTRLETVRASRAAVDQRRGRAGRIEPGV
FT                   CYRLWDEPQTASLPAYTQPEILSADLTSLLLDLAQWGVTDPATLAFLDPPPGPALKEAR
FT                   ELLAELGALDADGRITDEGRALRAMALPPRLARMIVDAARLDHGEEAAEIAAILTERGL
FT                   GGDSVDLDHRRDQFRRDRSQRAMSARQMAQRWAGQASSPSPQGGEELSTGVLLAFAFPD
FT                   RVAKNRGNGSFVLANGRGAAIEQTSALARAPYLAVAELTGTAAQGRILLAAPITLAEIE
FT                   QHFAGQITDADDVSFDRAAMALRARRRRALHAITLSEAPQALTPSAETAQVLADGLIAA
FT                   GLDRLPWSKQLQQWRGRVMFLRKAEGEPWPDLSDSALAEQREDWLVPALFDKAGLKDVS
FT                   AGDLSDALMNLLPWDLRARLDREAPTHFEAPTGSRLPIDYEAEQGPTIAVRLQELFGLT
FT                   SHPSVAGGAVPLVLELLSPAHRPVQVTRDLPGFWRGSYAAVRADLRGRYPRHPWPEDPA
FT                   GAPPTRRAKPKGT"
FT   gene            351980..352492
FT                   /locus_tag="RPD_0303"
FT   CDS_pept        351980..352492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37541"
FT                   /db_xref="GOA:Q13EE8"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE8"
FT                   /protein_id="ABE37541.1"
FT                   /translation="MRNIMIFAALMVVLGSVMAQLADRMMPAPAQASVAKATTVGMSSN
FT                   AGARSVAIPRDARGHFQTDGRIDGQRIAFMVDTGASVVALNERSAAQFGLRPRPAEYTA
FT                   RVSTANGTVKAARARLAMLDVGGLIVRDVDAMVLPDEALSENLLGLSFLSKLRRFEYAN
FT                   GQMVLEQ"
FT   gene            complement(352495..353367)
FT                   /locus_tag="RPD_0304"
FT   CDS_pept        complement(352495..353367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0304"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37542"
FT                   /db_xref="GOA:Q13EE7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE7"
FT                   /protein_id="ABE37542.1"
FT                   /translation="MMTPRAATLIGLSAILMWSLLAVLTVATGTIPPFQLAAMTFAIGA
FT                   LAAATGWILRPGAIRALRQPPLVWAVGVGGLFGYHALYFLALRLAPPAEAGLLNYLWPL
FT                   LIVLFSSLLPGERLRPHHIAGALLGLVGTALLFTGNGAALEPAYLPGLAAAFVAAFVWA
FT                   AYSVLSRRLKAVPTDAVAGFCFVTALLAALVHGVIESTVWPQGAAQWLAIVALGIGPVG
FT                   AAFYAWDIGMKRGDIRVLGAASYATPLLSTGFLIIAGYAQPTATLALAALLIAGGGLLA
FT                   ARDMLRGGK"
FT   gene            complement(353514..354239)
FT                   /locus_tag="RPD_0305"
FT   CDS_pept        complement(353514..354239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0305"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37543"
FT                   /db_xref="GOA:Q13EE6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE6"
FT                   /protein_id="ABE37543.1"
FT                   /translation="MARVALVTGGTRGIGAAISKALKAAGYAVAASYAGNDSAAEKFKS
FT                   ETGIPVYKWDVSSFEACAAGVKQVEADLGPVDILVNNAGITRDGAFHKMTLEQWNAVIN
FT                   TNLGSLFNMTRQVIEGMRARKFGRIVNISSVNGQKGQFGQVNYSAAKAGDIGFTKALAL
FT                   ENARGGITVNAICPGYINTEMVQAVPKEVLEKAILPLIPCNRLGEADEIARAVVFLAAE
FT                   DSGFITGSTLSINGGQVMT"
FT   gene            complement(354417..355595)
FT                   /locus_tag="RPD_0306"
FT   CDS_pept        complement(354417..355595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0306"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37544"
FT                   /db_xref="GOA:Q13EE5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE5"
FT                   /protein_id="ABE37544.1"
FT                   /translation="MSDDVVIVSAARTAVGSFNGAFATTPAHELGAVAIKAALERGGIE
FT                   PARVSEVIMGQILTAAQGQNPARQASIAAGLPVESPAWGVNQLCGSGLRTVALGYQALL
FT                   NGDSEIVVAGGQESMSMAPHAQYLRGGVKMGAVEFVDTMIKDGLWDAFNGYHMGNTAEN
FT                   VARQYQITRQQQDEFAVASQLKAEAAQKAGKFKDEIVPVTIKTRKGDIIVDTDEYPRHG
FT                   ATIEAMAKLKPAFEKDGTVTAGSASGINDGAAVVVLMTAKQAAKEGKTPLARIVSWAHA
FT                   GVDPKIMGTGPIPASRAALKKAGWTINDLDLIEANEAFAAQACAVNKDLGWDVSKVNVN
FT                   GGAIAIGHPVGASGARVLVTLLHEMQKRDAKKGLATLCIGGGMGIAMCLARD"
FT   gene            355878..356486
FT                   /locus_tag="RPD_0307"
FT   CDS_pept        355878..356486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0307"
FT                   /product="Polyhydroxyalkanoate synthesis repressor PhaR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37545"
FT                   /db_xref="GOA:Q13EE4"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE4"
FT                   /protein_id="ABE37545.1"
FT                   /translation="MRVGAMAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLASMVKDGE
FT                   DFLVYDAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKYLE
FT                   QSIDSLTRDQEKFRKQLTSTFSLTPFGPLEETVRRNMELFQQTFSMFVPIKPSHGPQTD
FT                   EVAVEVTSGTDNIDDLRRQMKDMQERLDRMSLDHPKKEE"
FT   gene            complement(356488..358239)
FT                   /locus_tag="RPD_0308"
FT   CDS_pept        complement(356488..358239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0308"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37546"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE3"
FT                   /protein_id="ABE37546.1"
FT                   /translation="MPSADPASDHASAPPRSVGPDPSAILAALGQAAFVWDLATDAIIW
FT                   TGRASDLFQDIPAETLSTGAGYASLLEPSRAIRADALLNGAAAAGENCVPYRIEYGVRA
FT                   ATSAPIIWIEESGFWYPGADGRPASVEGIVRINNERHAREQQLLQLSQHDPLTGELNRT
FT                   YLVAALAESIEEAARFRSSLCFMLIGLDHLARINDSFGFDVADELICTIAQRIRARLRS
FT                   GDQLGRFSGNKFGLILKNCTVDDAQVAAERFLIAVRDEIVPTRSGPVSVTASIGAVSSP
FT                   RHARTAEEAINRAQEALSAAKHRRCGAFSMWRPNVERDAQRRVNIRVTDEIVTALNERR
FT                   IVLAYEPVVDVATRAPAFHECLVRMMQDDGQVLLAPDIVPVAERLGLIRLVDHRVLELV
FT                   VAELAASPQMTLSLNISPDTTMDADWWAGIESLMLAHPGVAERLIVEITETVAIQDIDE
FT                   VRGFVTRLKKFGSKIAIDDFGAGYTSFRNLRNLGVDIVKIDGAFVQNIARSVDDRAFVQ
FT                   TLIDLARRLGIKTVAEWVQDEESALLLRDWGCDYIQGRLIGLASQQRPSDVPAAAIAAA
FT                   VRERVAN"
FT   gene            358341..358739
FT                   /locus_tag="RPD_0309"
FT   CDS_pept        358341..358739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37547"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE2"
FT                   /protein_id="ABE37547.1"
FT                   /translation="MRGGARNEALRGGIFLAMIPLRRCERLEMVQVQTMTKIWIDQGDD
FT                   DIRDFGADHDAEPELIETLPAPVTPVQPRMRYTDRPVRPSSNFIAQLMAIDRGNPHPRE
FT                   APRAEQNQATAAYRSAKTYAAGRTRRVS"
FT   gene            complement(358756..359406)
FT                   /locus_tag="RPD_0310"
FT   CDS_pept        complement(358756..359406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37548"
FT                   /db_xref="GOA:Q13EE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE1"
FT                   /protein_id="ABE37548.1"
FT                   /translation="MSIIGFPLLLIPLAICNIVVFLMPGVGFDAPLTRIPLPSGTIWTI
FT                   SAGEMLVALGVLMLLFEVIKAARPGAKYLTDHLLSLLVLGGTVAEFVMLPQFGNATVFL
FT                   LATLMLVDFLAGIALRHQPQPRTAGHARSRSVAKVDLPQQEPAVAAAPAAETPVAPFPT
FT                   ATAASISAASIAEAVLLDRPQPVASPKASASSPRIQSPGLQPADAAAGVQPPR"
FT   gene            complement(359642..359824)
FT                   /locus_tag="RPD_0311"
FT   CDS_pept        complement(359642..359824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0311"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37549"
FT                   /db_xref="GOA:Q13EE0"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EE0"
FT                   /protein_id="ABE37549.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADALKRPTYAEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVIKKKDA"
FT   gene            complement(360016..360705)
FT                   /locus_tag="RPD_0312"
FT   CDS_pept        complement(360016..360705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0312"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37550"
FT                   /db_xref="GOA:Q13ED9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ED9"
FT                   /protein_id="ABE37550.1"
FT                   /translation="MKRAIRAAILTVLVLLAAPYVLTLLYGAGQPVSTLMIWRWLTGAT
FT                   VTREWVDIERISPALPRTVVASEDAKFCSHRGIDWDSVRDVIDDMQDGEATRGGSTITQ
FT                   QVAKNLFLWPGRSMVRKALEFPLALWIDLVLSKQRVLELYLNIAEWGPDGQFGAEAGAQ
FT                   YAFGRSAGQLTAQEAALMASILPNPRTRSARKPGRGVRRLAATYVARARSAELQQCWRE
FT                   NSALSGN"
FT   gene            360822..361787
FT                   /locus_tag="RPD_0313"
FT   CDS_pept        360822..361787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0313"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37551"
FT                   /db_xref="GOA:Q13ED8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED8"
FT                   /protein_id="ABE37551.1"
FT                   /translation="MNGPAEFYLEHFRMATGTSTIDFAKRLDTTAEDTEALLGRLLSDD
FT                   LLPDEITRPRRLMEAIRYATLGGGKRLRPFLAVESAAVFGVERASALLVGAALECIHCY
FT                   SLIHDDLPAMDNSDLRRGRPTLHKAYDDATAILAGDALLTFAFDIITRDEVHRDPQVRL
FT                   DLNRVLARCAGLGGMVGGQILDLAGEGRFGDREPVDVARLQQMKTGALLRYGCVAGAIL
FT                   GEAPPEHYRALDDYGRALGEAFQIADDLLDVEGDAAALGKPAGADAALGKTTFVTQLGI
FT                   DGAKQRVRDLLVRADEALAPFGAKGDVLRAAARFVAERKS"
FT   gene            361795..362481
FT                   /locus_tag="RPD_0314"
FT   CDS_pept        361795..362481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0314"
FT                   /product="protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37552"
FT                   /db_xref="GOA:Q13ED7"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED7"
FT                   /protein_id="ABE37552.1"
FT                   /translation="MSREAPDDPRLLRFRKLPRAVRVVVSRPRLFISVAVGVIAALLLP
FT                   ASLRPVTRALIGWDVSIVVYLALAFSMMARCDIDYIRRNAVLQDDGRFLILMVTATGAF
FT                   ASIAAIVAELGSGHRGAAELALATVTIALSWAAVHTTFALHYAHEYYRGAQVGGLQFPS
FT                   GDTHEDADYWDFVYFSFVIGMTAQVSDVGITDKTIRRTATAHGVVSFVFNTALVALMVN
FT                   IAAGAI"
FT   gene            362564..364216
FT                   /locus_tag="RPD_0315"
FT   CDS_pept        362564..364216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0315"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37553"
FT                   /db_xref="GOA:Q13ED6"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED6"
FT                   /protein_id="ABE37553.1"
FT                   /translation="MQVVAGPFHQRHCGFVEAKFLIFLILLAVLAGTALLARRFHVAPA
FT                   ILLLLAGIVLAFIPGMPAIQLPPDLILLLVLPPLIYSASVAMSWREFRSNLRPIGLLAI
FT                   GCVIFTACAVAVATHYLLGLSWSVGFLLGAIVAPPDVVAPLAIARKLGLPRRIIVVLEG
FT                   EGLANDATALILYRFALAAIMTGVFSLPKASGTFAAIMVGELAFGVAVGWLSLRARHYA
FT                   RDPQIEITLSLLTPYIAYWIPEHLGGSGVIATVACGLYISWNGPLLIPAATRLQGIFFW
FT                   DLVIYLIEGLLFLLTGFQMRAILERSKAFPLDDIVAATLLVAAIVIVARFLWVFPASYL
FT                   PRILSKRLRISDPSPPWRAVFVVAFTGVRGAVSLATALALPFTLPDGSGFPDRDLILFV
FT                   AFGVILITVVGLGSTLPAVVMALGVARDGQSEHIAEHENEIAARREALSAALASLDAMT
FT                   NDRELSDEVVTLLRARHDIRANQLPASLDDEAYAVTADERALVRELIAAERRFIHAQLR
FT                   DGKITDEARRRIERDLDLEEASLANREFRKGAQ"
FT   gene            complement(364246..365580)
FT                   /locus_tag="RPD_0316"
FT   CDS_pept        complement(364246..365580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0316"
FT                   /product="Ferric reductase-like transmembrane
FT                   component-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37554"
FT                   /db_xref="GOA:Q13ED5"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED5"
FT                   /protein_id="ABE37554.1"
FT                   /translation="MQFMRLTATFALVVLGLAALWALSLAPGALSQGFWATRTTLVYGT
FT                   GVMALGLMSVGIILAARPVWFETPLGGLDKFYRLHKWLGLSALGFALAHWVLRKGPSWI
FT                   TELGLFAIPPKPPHAKDVPTGFDVFRDLRDFAAEIGEWALYLLVALVALALWKRFPYKY
FT                   FFKTHRLMPMVYLVLVFHAFILIDRSYWTQPLGPVLALLLAAGTLAALIALFRKIGSGR
FT                   QASGKIATLRLYEGNQVLDVGVRLETAWRGHEAGQFAFVNFDDIEDAHPFTISSTWQND
FT                   GMLLFTIKGLGDYTRSLAGSLRLGQGVVVEGPYGRFDFHGDAGRQIWIGGGVGVTPFIA
FT                   RLRDLARVGRSEPVDLFYATNVPDTAFIAPIRQLALQTGISFHLVDGSQDGRLTLESLA
FT                   ATVPDWKQADIWFCGPSGFGDAMRGAMIAQGLPKARFHQELFEMR"
FT   gene            complement(365780..367105)
FT                   /locus_tag="RPD_0317"
FT   CDS_pept        complement(365780..367105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0317"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37555"
FT                   /db_xref="GOA:Q13ED4"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED4"
FT                   /protein_id="ABE37555.1"
FT                   /translation="MSQKPDIPDAMNKLENPLQNDVAGPAPRRQTTQVMVGDVAVGGGA
FT                   PIVVQSMTNTDTADVEGTIKQVAALARAGSEMVRITVDREEAAAAVPHIRDGLRKLGLT
FT                   TPLIGDFHYIGHKLLADYPACAEALDKYRINPGNVGFKNKRDSQFTDIVEIAIKNNKAV
FT                   RIGANWGSLDQELLTKLMDENAASAQPRDVRAVTREAMVQSALLSAARAEEIGLPKTKM
FT                   ILSAKVSAVQDLIAVYQDLASRSDYAIHLGLTEAGMGSKGIVASSAALGILLQQGIGDT
FT                   IRISLTPEPGGDRTLEVQVAQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELARSIQD
FT                   FIRLEMPSWKTRYPGVENLNVAVMGCIVNGPGESKHANIGISLPGTGESPAAPVFVDGQ
FT                   KFRTLRGPSIATDFKALVIDYIEQRYGAGTKPGAPQMVPAAE"
FT   gene            complement(367135..368049)
FT                   /locus_tag="RPD_0318"
FT   CDS_pept        complement(367135..368049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0318"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37556"
FT                   /db_xref="GOA:Q13ED3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED3"
FT                   /protein_id="ABE37556.1"
FT                   /translation="MSSISSAVARPLSAGAIALMLLCCFSWGFNQIAVKLVLPEIPPFL
FT                   QAAMRSIAGLIVILIIAWARGVKLFQRDGTLKAGLLAGVLFGIEFVLIYRGLLLTTASR
FT                   GVVFLYTAPFIVALGSYHFLGERLRTLQWAGLALSFAGVALAIGVPQPDVDATVLIGDL
FT                   MLVGGGAMWGATTLIVKASRLQQAPAEKGLAYQVAISIPILLLAALISGETIDKMPGPL
FT                   SLTLMAYQSIWVVGLTFLLWFGLVKTYSASKLSAFTFITPLFGVAAGYLIMHDPLNPAF
FT                   GVAALLVIAGLYLVNRPAKAVPA"
FT   gene            complement(368182..368670)
FT                   /locus_tag="RPD_0319"
FT   CDS_pept        complement(368182..368670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0319"
FT                   /product="zinc uptake regulator ZUR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37557"
FT                   /db_xref="GOA:Q13ED2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED2"
FT                   /protein_id="ABE37557.1"
FT                   /translation="MTALKPAFPAPNHDHERCAADGIEHAERICADRSQNLTPIRKQVL
FT                   RALLSSHRPLGAYEVIDELARDMPRPAPITVYRALDFLMQNGLVHRIESRNAFLACGRD
FT                   HDDASAVAFLICECCGSVGEIPAAAVAQSLSDAARGSGFTPKLSVVEITGVCGHCQSD"
FT   gene            complement(368865..370073)
FT                   /locus_tag="RPD_0320"
FT   CDS_pept        complement(368865..370073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0320"
FT                   /product="Beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37558"
FT                   /db_xref="GOA:Q13ED1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED1"
FT                   /protein_id="ABE37558.1"
FT                   /translation="MADVFVCDAVRTPIGRFGGSLARVRADDLAAVPIKALIARHPNLD
FT                   WSAVDEVFFGCANQAGEDNRNVARMAALLAGLPDSVPGQTLNRLCASGLDAVGAAGRAI
FT                   RSGEIDLAIAGGVESMTRAPFVQGKATEAFSRQAEIFDTTIGWRFINPLMKAQYGVDAM
FT                   PETGENVAEEFQISRADQDAFAIRSQQRAGAAIAAGYFAEEIAPVSAPGGKAGPIIVDK
FT                   DEHPRPETTLEGLAKLKPIVRNPGTVTAGNASGVNDGAAAIIVASEAAVKKHGLTPRAR
FT                   ILGLASAAVPPRIMGIGPVPATRKLMDRLGLKISDFDLIELNEAFASQGIACLRQLGVA
FT                   DDADFVNPHGGAIALGHPLGMSGARLALTAVHGMEKRGGRLALATMCVGVGQGVAMAIE
FT                   KLN"
FT   gene            370238..373009
FT                   /locus_tag="RPD_0321"
FT   CDS_pept        370238..373009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0321"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37559"
FT                   /db_xref="GOA:Q13ED0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ED0"
FT                   /protein_id="ABE37559.1"
FT                   /translation="MHRVMTIRPDIPPQPDIAAPAEPPARVSPMMEQYHEIKAANPGLL
FT                   LFYRMGDFYELFFEDAEIASRALGITLTKRGKHLGADIPMCGVPVERSDDYLHRLIALG
FT                   HRVAVCEQTEDPAAARARKSVVRRDVVRLITPGTLTEDTLLDARANNYLMAIARTRGSA
FT                   GVDRIGLAWIDISTGEFCVTECATGELSATLARINPNEAIVSDALYSDAELGPSLRELA
FT                   AVTPLTRDVFDSATAERRLCDYFAVATMDGLAALSRLEAAAAAACVTYVDRTQLGKRPP
FT                   LSPPAREAAGATMAIDPATRANLELTRTLGGERRGSLLDAIDCTVTAAGSRLLAQRLAA
FT                   PLTDEAAIARRLDAVAAFVADSALREQIRSALRAAPDMARALARLSLGRGGPRDLASLR
FT                   DGVSAADKVLAQLSQLAQPPHDIAAAMAALRRPSRDLCQELARALADDLPLLKRDGGFV
FT                   RDGYEAALDETRKLRDASRLVVAAMQARYADETGVKGLKIRHNNVLGYFVEVTAQHGDR
FT                   LMAPPLNATFIHRQTLAGQVRFTTAELGEIEAKIANAGDRALGLELDIFDRLAAMIDTA
FT                   GDDLRAAAHAFALLDVATALAKLAVSDNYVRPEVDGSLAFAIEGGRHPVVEQALKRAGE
FT                   PFIANACDLSPVPPPFPPPLAGEGRVGAGQIWLLTGPNMAGKSTFLRQNALIALLAQTG
FT                   SFVPASRARIGIVDRLFSRVGAADDLARGRSTFMVEMVETATILNQATERALVILDEIG
FT                   RGTATFDGLSIAWAAIEHLHEQNRCRALFATHYHELTALSAKLPRLFNATVRVKEWRGE
FT                   VVFLHEVLPGSADRSYGIQVAKLAGLPPSVVARAKSVLAKLEANDRGQSARTLADDLPL
FT                   FAMTARAPVEPPPPSEAEQLIEAVRALHPDELSPREALDALYALKAKLPKAD"
FT   gene            complement(373035..374597)
FT                   /locus_tag="RPD_0322"
FT   CDS_pept        complement(373035..374597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0322"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37560"
FT                   /db_xref="GOA:Q13EC9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC9"
FT                   /protein_id="ABE37560.1"
FT                   /translation="MVASASRVLDPHLRSRIMTAADAAALIPSGANVGMSGFTGSGYPK
FT                   LLPLALAERINAHHARGQKFKVSVWTGASTAPELDGALAKVDGIEMRLPYQSDPTCRKR
FT                   INAGRMEYIDIHLSHVAQHVWFGFLGKLDVAIVEVAGIREDGSLIPSSSIGNNKTWLDL
FT                   ADKVILEVNAWQDIRLEGMHDVYYGTQLPPHRKPIPIVASGDRIGEQYLRCDPSKIVAI
FT                   VETNLPDRNSAFSAPDEASQAIAEHILEFLGHEVKKGRLPPNLLPLQSGVGNVANAVMA
FT                   GLEDGPFDNMTAYTEVLQDGMLSLLRKGKLAHASATALSLSPDGYDEFLRNLDFYRERI
FT                   LLRPQEISNHPEVIRRLGVIAMNGLIEADIYGNVNSTHITGTSIMNGIGGSGDFARNSY
FT                   LSFFMTPSAAKGGKISCIVPMASHVDHTEHDVQVIVTEQGLADLRGLSPKQRAKVIIQN
FT                   CAHPTFKPALKEYYKRALEYSPGLHTPHILDEALTFLPNWMANKAAREAWREDAVVQAD
FT                   VWR"
FT   gene            complement(375533..376999)
FT                   /locus_tag="RPD_0323"
FT   CDS_pept        complement(375533..376999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0323"
FT                   /product="putative Omp2b porin"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37561"
FT                   /db_xref="GOA:Q13EC8"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC8"
FT                   /protein_id="ABE37561.1"
FT                   /translation="MNSIKRLALGSAAALFAIGSAQAADLPLKAKAVEYVKICSIYGAG
FT                   FYYIPGTDTCIKLGGYVRADVTFNGSNAYDAPAWNGASGAKNRNANSYIFRSRQDINVD
FT                   TRTATEYGVVRTYFDAVFSWTTGGANSGIAGGELGVYYAFVQFAGFTFGKAVSQFDTPW
FT                   TGYPGNNTSYLIGGYDNVTGINQVAYTSEFGNGVSASVSLEDQSAYLQSNLYNTNVGGT
FT                   VLGYGANSYAGTSVPDIVGKIRVDQAWGLFQVSAAAHQVRASYYTPALETSGHPGDTWG
FT                   YAVQGALSLKNLPTGPGDSINITATYSNGATRYVIGGVTTPASFLIYDNGSIPGTYQSV
FT                   AFAHAADGVFAGANNVFGTGIEKTNAWGVRGAFNHNWSPYWSSSLFGSYTSIDYNGNAS
FT                   ALICAGLGAPVAGFNCNPDFRIAQVGTVTRWTPVKNLTFSGEVLYTYLDQSHTGVVNVS
FT                   AIPALGKPTANYELKDQGVWTGSLRVQRTF"
FT   gene            377484..377993
FT                   /locus_tag="RPD_0324"
FT   CDS_pept        377484..377993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0324"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37562"
FT                   /db_xref="GOA:Q13EC7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC7"
FT                   /protein_id="ABE37562.1"
FT                   /translation="MPRKAKLGLAVQSIAVDPSTVGEFVTAIGSIAVYLDEIRQFRAKS
FT                   LGISGPQFAMLTTIRGLDEGDGISVRHVAKAIHVDSSFITTQSKILEKKGLLRRQTDET
FT                   DARVVNLSLTDKAYKQIAGLAADEQSLNEFIFADLSRDAFEGVTAQLTGLKARLEKACL
FT                   KIAGGF"
FT   gene            complement(378222..379013)
FT                   /locus_tag="RPD_0325"
FT   CDS_pept        complement(378222..379013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC6"
FT                   /protein_id="ABE37563.1"
FT                   /translation="MLGGLPDWHRLDPSAEPEAIRRCLESFDPPVEAVAIPWREDLFLD
FT                   SYYLPFERSGTDRAPIAVCIGEMRSKEELLIVMARPARERRLALLCVDSGSDDVEAPRR
FT                   SVRPESCVTAVIDYLVELPGIDPNRIALIADGSPSSLIAKGVVMDGRVAAAVCDGGLWE
FT                   LWEHAQTASLPGYLGAIAPTPIVAAIRCPTLIPLLPGSGIDPVYAKDLLSSHQARDRRI
FT                   AIADLAPQQSEMAPADSRIWAETTLNWVSRQLDGIQKIAER"
FT   gene            complement(379446..379530)
FT                   /locus_tag="RPD_R0007"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(379446..379530)
FT                   /locus_tag="RPD_R0007"
FT                   /product="tRNA-Leu"
FT   gene            379721..380266
FT                   /locus_tag="RPD_0326"
FT   CDS_pept        379721..380266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37564"
FT                   /db_xref="GOA:Q13EC5"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC5"
FT                   /protein_id="ABE37564.1"
FT                   /translation="MTANLLHHTGLGFRPARAARIARNVALTYAVIAAAALGAAWFFQL
FT                   ALDLTPCPLCLEQRYAYYAAIPLAGLIALGAWREAPISLLIAGLAVLAVLALGNAGLGA
FT                   YHAGVEWKFWTGPTDCAGPVLDFGKAGSLLDQLDKVKVMRCDEVQWRFLGLSLAGYNVL
FT                   VSLALAALAAWGIARIRR"
FT   gene            380435..381637
FT                   /locus_tag="RPD_0327"
FT   CDS_pept        380435..381637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0327"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37565"
FT                   /db_xref="GOA:Q13EC4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC4"
FT                   /protein_id="ABE37565.1"
FT                   /translation="MPSEHRPAPATAPEASLNRLEELPYRRRQQALLREFGTAALQTRD
FT                   FRQILQQAVDLSARGLGCSFAKVLEYVAVEKRLIVRAGIGWPAGTVDHVSLGADIESPA
FT                   GFAFQTGQSVVSNHLQDETRFRTPKLLADHGIKRAINVLIRRGGEGDTAFGVLEADSPD
FT                   PGQFDDADADFLAGFAGLLGIAIERQHADAKLQEALDHEALLTREMSHRVKNSLTSVVG
FT                   LLRVQARGSESADVKNALEDAAMRVASIAGVHDHLWRGSKVGFVDLSDFVSHLCETLQG
FT                   SAPEHVIQCRSDDIILSADKAIPLGLLVNELVTNAIKYAYVDGHGVIRLDAREINGHLL
FT                   VEISDEGAGLPDGFDINQPRKSLGFRVILGLVRQLLGELTISKNLPRGALFTIKFPVDP
FT                   P"
FT   gene            381649..382092
FT                   /locus_tag="RPD_0328"
FT   CDS_pept        381649..382092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0328"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37566"
FT                   /db_xref="GOA:Q13EC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC3"
FT                   /protein_id="ABE37566.1"
FT                   /translation="MREKQASHGGRETNAILVSPFYMPSILSPIRILVVENETFIRLDV
FT                   VEVLRVAGFNVAEAVNADEGIKMLEADPDIRLMFTDIEMPGAMNGLELAATVRERWPPI
FT                   KIIAASGRFKLQASDLPAGALFFLKPYETSQIIDAVRGLTAVA"
FT   gene            382089..382913
FT                   /locus_tag="RPD_0329"
FT   CDS_pept        382089..382913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0329"
FT                   /product="PRC-barrel"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37567"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC2"
FT                   /protein_id="ABE37567.1"
FT                   /translation="MSAGPNSSNAVSSQRLHIPIASVGPHTGKSQMTPVKILLMAAVIS
FT                   TVGMTHALAECEIADAKLEEAIQENPRFRGPANSQSVRDLRSLRDAAFTLRSYGRHEDC
FT                   ERLLANIRELIAGPPMGSLGDNDEEQADIQNSAREPKVRRGAAAGNRGKKDAKPLIRID
FT                   QLTPGLRTDEMIGAEVRSSDDKIVGEVRNIVFGTKDGRDYAIIASGGFFTTGKDSIVVP
FT                   IRSLQVTQDRSSFFLPIAKDVMRTVPVMPDQDYNWLSDQAWRTQNDALFEQP"
FT   gene            complement(383067..384146)
FT                   /locus_tag="RPD_0330"
FT   CDS_pept        complement(383067..384146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0330"
FT                   /product="putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37568"
FT                   /db_xref="GOA:Q13EC1"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC1"
FT                   /protein_id="ABE37568.1"
FT                   /translation="MSQNSALTAPSLRSRTLNVLETIAIGAAGGGLSYWVQLPGGLITG
FT                   AMVAVAAAGLAGRNMGLPPPLSHIVLMALGVSLGSMVSPAMIHNLSSYPVTIGLLAIAT
FT                   FFATFGSAIYLQRIHGWDRTSALLAGSPGALSQIIMLATERKANVPGIAVVQIMRVIIL
FT                   TSAVPMLLAMTGMMAHGPLPVRGPEATPLVLAAVVAVAVAAALLLRLINFPASWMFGAM
FT                   LGSSVLHGSGLVEGTLPEWAYLSALVGIGTLIGSRFGAIKLRTILSYLGAALGSFAVAI
FT                   AISGVFVVTIILTTPVRLSDVVVAFSPGAMDAMMALALTLNIDPVFVGAHHLSRFIYVS
FT                   IVTPGIVHWFGRSPDDLDD"
FT   gene            384313..384822
FT                   /locus_tag="RPD_0331"
FT   CDS_pept        384313..384822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC0"
FT                   /protein_id="ABE37569.1"
FT                   /translation="MRAPQIVTIASALMGTALLTLASAAPGHALTAQECSAKYQAAKTA
FT                   GTLNGQGWNDFRKAQCASDSAAEADSKAVEAKDKPEAKSAAKSEAKSEAKPKAKPAEPA
FT                   AASAGPPTFPTAVDAKFAKEPAARARLHTCAEQWKANKAANTTGGLKWIQKGGGYWSEC
FT                   NKRLKA"
FT   gene            384922..385305
FT                   /locus_tag="RPD_0332"
FT   CDS_pept        384922..385305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0332"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37570"
FT                   /db_xref="GOA:Q13EB9"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB9"
FT                   /protein_id="ABE37570.1"
FT                   /translation="MIASLGLILLCQLTAEAAVRALAVPLPGPVIGLLLLLGLLLARDR
FT                   LGWLARGPLRNDGVENASKGMLAHLSLLFVPAGVGAIQQLDLIATHGVVIVLVLAGSVL
FT                   ITLLVTVATFLVTARLLSMWSSR"
FT   gene            385302..386024
FT                   /locus_tag="RPD_0333"
FT   CDS_pept        385302..386024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0333"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37571"
FT                   /db_xref="GOA:Q13EB8"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB8"
FT                   /protein_id="ABE37571.1"
FT                   /translation="MSATPFSLWVYLSQTPLLWLTVTLLVYAATDAVSQATERSPLANP
FT                   VLHAIWIIGAFLWLTGTSYTTYFSGAQFVHFLLGPATVALAVPLYENRRQVIAAIVPMA
FT                   LALVVGCIVAIVSVMVLAQLAGLPETVVLSLASKSVTAGVAMGISESLNADPSLTAVAV
FT                   VLTGVMGAIMVTPLMNALGIRDFRARGFSVGLASHGIGTARAFQVDAIAGVFAGIAMSL
FT                   NALITAMLVPVAVTLLVK"
FT   gene            386266..386733
FT                   /locus_tag="RPD_0334"
FT   CDS_pept        386266..386733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37572"
FT                   /db_xref="GOA:Q13EB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB7"
FT                   /protein_id="ABE37572.1"
FT                   /translation="MTDASALPTSAAATHRVHGSAPRRAIALLAAVSAIAIALLVSSPE
FT                   ASTLAVASSDAELVMLLRFMAAVKALLALVALGVSVWRLGFPASPVLKVAYTLAPALMC
FT                   AAPVVIWQMADVAFGAGLFHAGFVLLLLALYADRGQAVELAKSAALKLRRA"
FT   gene            complement(386777..387850)
FT                   /locus_tag="RPD_0335"
FT   CDS_pept        complement(386777..387850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0335"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37573"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB6"
FT                   /protein_id="ABE37573.1"
FT                   /translation="MSDAVVDDIVALLPPLLQSIEALGFIARYLHPPEFGEVMRLAGAP
FT                   DAQLRSELPRVAKWPDQFAHLREPLRMAGDHALAAFDGLRTVDSGAGDLGAVFRALRHL
FT                   PQALEALYPLAATLPPVSGLYLDPALQQDEALHARLAQPKHPDSGVFHYANEPGSRGGF
FT                   SFYVPEYYTPDRAWPLVVALHGGSGNGRLFLWNWLRDARSRGAIVVAPTATGRTWALMG
FT                   DDADTPNLARIVDFIRSRWSIDPERLLVTGLSDGGTFCYVTGLDDASPFTHLAPIAASF
FT                   HPLLAGMASVDRLRGLPIQIVHGRHDWMFPVELARQAQQALFKAGADVSYREIADLSHT
FT                   YPRELNAALLDWLNGAG"
FT   gene            complement(388007..389698)
FT                   /locus_tag="RPD_0336"
FT   CDS_pept        complement(388007..389698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0336"
FT                   /product="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37574"
FT                   /db_xref="GOA:Q13EB5"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB5"
FT                   /protein_id="ABE37574.1"
FT                   /translation="MFATLSIRAKITTLVAALLIAMTCLGGLGILKVRSMNFAALDLAT
FT                   NWLPTIKMLGNLRYNVLNYRTAIRDHLITTTAEGMATVEKRLEAIEGTIQKDLQTYEKM
FT                   ITTPEERQLYDAWLSEWAKYKPLAAKMIDASRKSVGQSSEEATDLLYKVAGPVASRMDE
FT                   ILQKDIDLNDRGADGSTALAASTYSSAIYLIVTILGVAIVVGIVASVMVIRDVAQGIAS
FT                   IVKPMQSLGQGDLSADVPHRGEKTEIGSMADALQIFKDALISKKAADEDAAREAEAKIA
FT                   RGQRVDSATRQFETSIGEIVETVSSASTELEASAATLTATAGHAQELTTAVAAASEEAS
FT                   TNVQSVASATEEMSSSITEISRQVQESARIASEAVDQARKTNDSVGMLSAAAARIGDVV
FT                   ELINTIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQTAKATGEIGQQITGI
FT                   QSATVQSVSAIKEIGQTIDRMSEIASTIASAVEEQGAATQEISRNVQQAAQGTQQVSAN
FT                   ITDVQRGATETGSASTQVLSAAKSLSQDSNRLKQEVARFLETVRAA"
FT   gene            complement(390010..391701)
FT                   /locus_tag="RPD_0337"
FT   CDS_pept        complement(390010..391701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0337"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37575"
FT                   /db_xref="GOA:Q13EB4"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB4"
FT                   /protein_id="ABE37575.1"
FT                   /translation="MFAKLSIRAKVTALVAALLIAMTGLGGLGILKVRSMNFAALDLAT
FT                   NWLPSIKVLGELRFNVLNYRTMIRNHMLDVTPEGKARFEQRLASIDATIKKDQETYAAM
FT                   IASPEERQLYDSWVVQWNDYKSVTTKMLEMSRKDIGKVSAESTDFLFKNLNPIGVRMDE
FT                   ILQKDIDMNDKGADGATALAASTYSSAIYLVLTILGVAMVVGIVASVMVIRDVAQGIAS
FT                   IVKPMQSLGQGDLSADVPHRGEKTEVGSMADALQIFKDALIAKKAADEDAAREAEAKIA
FT                   RGQRIDAATRQFETSIGEIVETVSSASTELEASAGTLTATAGHAQELTTAVAAASEEAS
FT                   TNVQSVASATEEMSSSITEISRQVQESARIATEAVDQARKTNDSVGMLSAAAARIGDVV
FT                   ELINTIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQTAKATGEIGQQITGI
FT                   QAATDQSVSAIKEIGQTIGRMSEIASTIASAVEEQGAATQEISRNVQQAAQGTQQVSAN
FT                   ITDVQRGATETGSASTQVLSAAKSLSQDSNRLKEEVARFLETVRAA"
FT   gene            392283..393380
FT                   /locus_tag="RPD_0338"
FT   CDS_pept        392283..393380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0338"
FT                   /product="protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37576"
FT                   /db_xref="GOA:Q13EB3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB3"
FT                   /protein_id="ABE37576.1"
FT                   /translation="MRASENRFFILLLLVASIGFGWILLPLYSAVLWGVVIAILFAPLY
FT                   RQLNRAFGFRRNLAALTTVAIIVTMVILPISLIGAALAQEARAMFLRIESGNLDMLQYL
FT                   KQVLAEPPAWISGVLERFSIGNLSDLQERLSAVLMRGSQYLAGQAIGIGQGTVEIVINL
FT                   GVMVYLLFFLLRDGDLLAARIRRAVPLSVEQESQLLRKFTVVIRATVKGNMLIALIQGA
FT                   LGGVMFYILGVNGALLWGVVMAFLSLLPAVGAGLVWLPVALYLLGTGSIWQGVALIAFG
FT                   TMVIGTVDNVLRPVLVGKDTRMPDYVVLISTLGGIQVFGLNGFVIGPVIAAIFIAAWDI
FT                   YSASREAAAGIGETTTGGVPTSDAP"
FT   gene            complement(393530..394186)
FT                   /locus_tag="RPD_0339"
FT   CDS_pept        complement(393530..394186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0339"
FT                   /product="Anti-sigma factor ChrR , putative"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37577"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB2"
FT                   /protein_id="ABE37577.1"
FT                   /translation="MTVRHHIGDDLLLSYAAGTLDEASSLLVATHLALCPHCRARAAAA
FT                   DDLGGALFEDLPVAELSPGLRDAVLARLRSESVAAPATRPHRPRSDIVIPEPLRSYLGG
FT                   DLDTLRWTSVAPRVQQIAIDIANCGPRARMLRFQPGTHVPAHGHAGRELTLVLSGSLCD
FT                   RDAVLARGDVAETDEHTEHQPYAGPDKDCICLAVTDAPLRFKGMFARMLQPWFGI"
FT   gene            complement(394183..394770)
FT                   /locus_tag="RPD_0340"
FT   CDS_pept        complement(394183..394770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0340"
FT                   /product="sigma-70 region 2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37578"
FT                   /db_xref="GOA:Q13EB1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB1"
FT                   /protein_id="ABE37578.1"
FT                   /translation="MDHPRRDPRESAHDLSDCIVRIATDQDEAAFDTLFRHFAPRLKSY
FT                   FTRRGGDPAMAEEITQETMVLLWKNAAQFDPSKASPATWIFTIARNLGIDRLRRAKRPS
FT                   FDPNDPAFIPDAEEPPDRQFERAEAERRVRDVMDTLSANEKSVLMLSFYENQSHGEIAE
FT                   RLGLPVGTVKSRIRLAFGKLRAALDAQTGAAQ"
FT   gene            395002..395274
FT                   /locus_tag="RPD_0341"
FT   CDS_pept        395002..395274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37579"
FT                   /db_xref="GOA:Q13EB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB0"
FT                   /protein_id="ABE37579.1"
FT                   /translation="MPERDLDHPAPKKSRRRRSTAPRRRSRTDSRGCDVVVVIQRATCF
FT                   VNRSLTTKQEDTMSVLRKLNGMEAAVIGGALLMTLAPLVPYALLG"
FT   gene            complement(395596..396153)
FT                   /locus_tag="RPD_0342"
FT   CDS_pept        complement(395596..396153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0342"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37580"
FT                   /db_xref="GOA:Q13EA9"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA9"
FT                   /protein_id="ABE37580.1"
FT                   /translation="MNAHVSQGGWPVLVLNADFRPLSYYPLSLWSWQDAVKAVFLDRVN
FT                   IVEHYDRAVHSPTMEFRLPSVVSLKSFVKPSTHPAFTRFNVFLRDRFACQYCGAPEDLT
FT                   FDHIIPRSKGGQTTWENVVAACSPCNLRKGNLTPIQAKMFPRQTPFAPTVHHLHRNGRM
FT                   FPPNYLHESWLDYLYWDTELDP"
FT   gene            396439..397437
FT                   /locus_tag="RPD_0343"
FT   CDS_pept        396439..397437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0343"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37581"
FT                   /db_xref="GOA:Q13EA8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA8"
FT                   /protein_id="ABE37581.1"
FT                   /translation="MSSAATASIKSSAAAPAQQPGRGRVYDSIADAYGDTPLVRLNRLP
FT                   EQNGVKATILAKLEYFNPASSVKDRIGAAMIAAMEREGIIKPDTILIEPTSGNTGIALA
FT                   FVAAAKGYRLKLVMPESMSIERRKMLAFLGAELVLTEAAKGMKGAIAKAEELIASTPNA
FT                   VMPQQFKNLANPEVHRRTTAEEIWNDTHGGIDIFVAGVGTGGTITGVGQVLKPRKPSLK
FT                   IVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDRAVIDEVIKIAGPTAIATSRALAR
FT                   HEGIAGGISSGAAIAAAIELGKRPENAGKTIVAIVPSFSERYLSTALFEGV"
FT   gene            complement(397736..399184)
FT                   /locus_tag="RPD_0344"
FT   CDS_pept        complement(397736..399184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0344"
FT                   /product="Glycogen/starch synthases, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37582"
FT                   /db_xref="GOA:Q13EA7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EA7"
FT                   /protein_id="ABE37582.1"
FT                   /translation="MTTLTALSVASEIFPLIKTGGLADVTGALPAAVKAHGVAMRTLVP
FT                   GYPAVLGGIEDPQQVHSFTEFFGGSARLLAARCDELELLVLDAPHLYVRPGNPYVGPDA
FT                   KDWPDNALRFAALAQAGAWIGQGLLPGYAPDILHAHDWQTGLLPAYLRYSGRPAPKCVF
FT                   TIHNLAYQGQFPSELLARIGLPERAFSLDGVEYYGGIGYLKAGLQLADRITTVSPSYAL
FT                   EIQGSEAGMGLEGLLRLRAGQLSGILNGVDTKVWDPSADQLIPATYDVETIGARARNKQ
FT                   ALQARFGLRAESGALLFGVISRLSWQKGLDMLLEVLPGMLADGAQLALLGAGDAPLEAG
FT                   FRDAALKYPGQVGAVIGYDEALAHQIQAGADALLVPSRFEPCGLTQLCALRYGAVPVVA
FT                   RVGGLADTVVDANEMAIATGVATGVQFSPVTADMLTAALTKTRALYADHATWRNLQING
FT                   MTTDVSWKNPAQHYAKLYRELVDA"
FT   gene            complement(399181..400455)
FT                   /locus_tag="RPD_0345"
FT   CDS_pept        complement(399181..400455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0345"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37583"
FT                   /db_xref="GOA:Q13EA6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EA6"
FT                   /protein_id="ABE37583.1"
FT                   /translation="MRGFMSQGVPAPLARHAMAYVLAGGRGSRLMELTDRRAKPAVYFG
FT                   GKSRIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRGWNFFRPERNESFDILPASQR
FT                   VSDDMWYRGTADAVYQNIDIIESYDPKFIVLLAGDHVYKMDYEKMLQQHVEQGADVTVG
FT                   CLEVARSEASAFGVMDVDAKDVIRSFLEKPADPPAMPGKPDKSLVSMGIYVFDTKFLIE
FT                   ELHRDAANPDSSHDFGKDIIPYIVKHGKAVAHHFDKSCRRSHAEDTSYWRDVGTVDAYW
FT                   AANIDLTDIVPQLDLYDREWPIWTYGEITPPAKFVHDKDGRRGEAVSSLVSGGCIISGA
FT                   SLRHTLLFTGVRAHSYTHIEGAVILPYADIGRSCRLTNVVVDAEVRIPDGLVVGEDPEL
FT                   DAKRFRRSENGTCLITQPMIDRLGT"
FT   gene            complement(400757..403072)
FT                   /locus_tag="RPD_0346"
FT   CDS_pept        complement(400757..403072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0346"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37584"
FT                   /db_xref="GOA:Q13EA5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA5"
FT                   /protein_id="ABE37584.1"
FT                   /translation="MAQDDTRLHEADLPDATQQTVEYDGPAGGWGSLQGIAQIFGREWN
FT                   TPTVIETLMRQNKPKGFMCVSCSWAKPADHHAFEFCENGAKATLWELTSKRCTPEFFAA
FT                   HSVAELRGWADYDLEMQGRLTSPMRYDAATDHYVPCSWDEAFQGIGEHLRALDPKSVIF
FT                   YASGRASLETSYLYALFARLYGHNNLPDSSNMCHETTSVALKKLIGVGVGTVVFDDLAK
FT                   CDAMFVFGQNTGSNSPRFLHPLQEAAQRGVKIITFNPVRERGLESFVNPQSPTQMLTGK
FT                   ETAISSQYHQVKVGGDIAVLLGICKHVFAADDAAKASGGTRVLDVNFIAAHTHGLDAFE
FT                   AKVRATSWEQIETESGLTRTAIEGAAQVYVEAERVIGVFGMGLTQHVHGFDNIAMLLNL
FT                   LLLRGNIGRPGAGISPVRGHSNVQGQRTVGISEKPELVPLDKMAQQFGFAPPRDKGMNT
FT                   VEACHGLLEGKVKAFIGLGGNFIRAIPDQGVLEEAWTRMQLTVQIATKLNRSHLVNGES
FT                   AYLLPCLGRTEQDVQASGPQAVTIEDTFSCIQGSIGLRQPASEQLLSELAIVAGIAKAT
FT                   LPSNPKVKWDEWVGDYGLVRDLIEDSYPDMFHDFNARMFTPGGFYKGNEARERIWKTET
FT                   GKAEFTTPEILSSIGFDDAPGRYRLLTMRSNDQFNTTIYGMSDRLRGIEGRRDVLLINP
FT                   DDIARAGLTDGQMVWLESDAADGLQREVGPLKVTPFKLPDGCLGGYYPEMNPLIALTHH
FT                   DKQSKTPANKSVPVRIRA"
FT   gene            complement(403348..403467)
FT                   /locus_tag="RPD_R0008"
FT   rRNA            complement(403348..403467)
FT                   /locus_tag="RPD_R0008"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(403572..406403)
FT                   /locus_tag="RPD_R0009"
FT   rRNA            complement(403572..406403)
FT                   /locus_tag="RPD_R0009"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(406806..406881)
FT                   /locus_tag="RPD_R0010"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(406806..406881)
FT                   /locus_tag="RPD_R0010"
FT                   /product="tRNA-Ala"
FT   gene            complement(406915..406991)
FT                   /locus_tag="RPD_R0011"
FT                   /note="tRNA-Ile2"
FT   tRNA            complement(406915..406991)
FT                   /locus_tag="RPD_R0011"
FT                   /product="tRNA-Ile"
FT   gene            complement(407217..408691)
FT                   /locus_tag="RPD_R0012"
FT   rRNA            complement(407217..408691)
FT                   /locus_tag="RPD_R0012"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(409676..410614)
FT                   /locus_tag="RPD_0347"
FT   CDS_pept        complement(409676..410614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0347"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37585"
FT                   /db_xref="GOA:Q13EA4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA4"
FT                   /protein_id="ABE37585.1"
FT                   /translation="MVELVTLTPNPAIDLSTSVERMVPSRKLRCAAQQRDPGGGGINVA
FT                   RVVKRFGGDVEAIFPAGGFTGQLLRSLLDREHIPSRVVDAVAETREDFSVTEAATGQQF
FT                   RFVLPGLPLAEGEWRGLLELLAGTTPAPKIVVGSGSLPPGVPHDFYAQAAAVAKRIGAQ
FT                   FFLDTSGASLVAALDQGVTLIKPNLREMQELAGRPLDGEKDWIEAARQPIAAGKVEIVA
FT                   LSLGHLGALLVTKDLALRSPALPVNQVSTVGAGDSFLGAIAFSLAKGRPIEDAFRLALA
FT                   SGSASLTMQGTELCRPADVERLCAQVVIEAL"
FT   gene            complement(410826..411650)
FT                   /locus_tag="RPD_0348"
FT   CDS_pept        complement(410826..411650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0348"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37586"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA3"
FT                   /protein_id="ABE37586.1"
FT                   /translation="MIKDLIVNLERNPARDQIADVAVAIAQTFDAHVSGVCFAYESLPS
FT                   FAMPDFPSDLLTKMLAESETSARAAVERFEAACKREGVSAEHHLLETPYGTAGRFPRMA
FT                   RRFDLSVIMQSDPDNVDNDILIEQVLFDSGRPVLIVPYIQKAPLKLDRVICGWDGSRAA
FT                   TRAINDAMPFLRRAGAVELLIVRDHKVRDEKELRGIEMANHLARHGIKLDIKMITAPDV
FT                   GVAATILSHVADCSADLLVMGGYGHSRLREFVLGGVTREMLSSMTVPVLMSH"
FT   gene            411884..412120
FT                   /locus_tag="RPD_0349"
FT   CDS_pept        411884..412120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0349"
FT                   /product="ChaB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37587"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA2"
FT                   /protein_id="ABE37587.1"
FT                   /translation="MPYSSIDDLPPSLQVRLPLHAQSIYLAAFNNAFADNADRSPEEQE
FT                   SDAHRVAWAAVKKQYRKQDERWVARDPLRSAGS"
FT   gene            complement(412315..414354)
FT                   /locus_tag="RPD_0350"
FT   CDS_pept        complement(412315..414354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0350"
FT                   /product="3-methylcrotonoyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37588"
FT                   /db_xref="GOA:Q13EA1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA1"
FT                   /protein_id="ABE37588.1"
FT                   /translation="MMATTALYRRFRTLLIANRGEIACRVIRTARAMGLRTVAVYSEAD
FT                   ADALHVSEADEAVLLGPARARDSYLSIERIIAAAKQTGAEAVHPGYGFLSESAEFAQAC
FT                   ADAGLIFVGPTPQMITAMGSKSGSKALMEKAGVPLVPGYHGEAQDDATLAAAADKIGFP
FT                   VLVKASAGGGGRGMRVVRAANELGEAIVSAKREAKAAFGDDRLLIEKYVDNPRHIEVQI
FT                   VGDSHGNLVSLFERECTLQRRHQKVIEEAPSPTLDAAQRETVCEAARRAAGAVNYVGAG
FT                   TIEFVSDGKDVFFIEMNTRLQVEHPVTELISGVDLVEWQLRVAFGEALPLRQDQLTLNG
FT                   HAIEARVYAENPAKNFMPSVGRISTWRTPAETDGLRIDAGYRAGDSVSPYYDAMLAKVI
FT                   AFAPTRAAAIDRLNRGLEETDVRGVVTNIPFLSALVTHPEVRANAIDTGFIERHLAALT
FT                   AAPAPVSDLELATAVAAILRAETDAARAEAPTPWRSSGWMPVGRRKRGFVFRHGRGHDH
FT                   TDYKVQLAYGTGLATLTIDGRDLAFASLANGDGLDVLLDGARSRVNAVVEGHELYLRTR
FT                   NGRFELHWVDPFGGESEESVGEDKIVAPLPGTVVALLAEQGAKLEKGAAILTLEVMKME
FT                   QTLRAPFAGTLKAIKCKVGDIVQEGVELAEIESAQDATEAQCPS"
FT   gene            complement(414354..415961)
FT                   /locus_tag="RPD_0351"
FT   CDS_pept        complement(414354..415961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0351"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37589"
FT                   /db_xref="GOA:Q13EA0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA0"
FT                   /protein_id="ABE37589.1"
FT                   /translation="MMKSASEIRPIVPDVARNAETMRALVGELKDKLDNVAGAGGEASR
FT                   AKHTARGKLLARDRVDLLLDPGTAFLELSPLAAYGLYGGDVHSASVVTGVGRVAGRECM
FT                   IVANDATVKGGTYYPMTVKKHLRAQDIARQNNLPCIYMVDSGGAFLPQQDEVFPDERHF
FT                   GRIFYNQAQMSAQGIPQIAIVMGSCTAGGAYVPAMSDESIIVRNQGTIFLGGPPLVKAA
FT                   TGEVVSAEELGGADVHSRQSGVTDHYAQNDAHAIGIARKIVGTLKPPQRAVLNMRAPRE
FT                   PLYPAEQLYGIVPAEQRKPFDVRDIITRIVDGSEFDEFKKLYGQTLVCGFAHIWGYPVG
FT                   IIANNGILFSESSLKGAHFIELCCQRGIPLVFLQNITGFMVGKKYEAGGIARDGAKLVT
FT                   AVATANVPKFTVVIGGSYGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAAMVLSSLR
FT                   RDNIEAKGGSWSAEEEEEFRSPIRAQYETQGSPYYATARLWDDGVIDPADTRLVLGLGL
FT                   AASANAPIEPTKFGLFRM"
FT   gene            complement(416057..416791)
FT                   /locus_tag="RPD_0352"
FT   CDS_pept        complement(416057..416791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0352"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37590"
FT                   /db_xref="GOA:Q13E99"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E99"
FT                   /protein_id="ABE37590.1"
FT                   /translation="MSAPVVVITGAARGIGSAAASTFLDHGWRVHGLDRRAPLIKGAIG
FT                   HECDVTSEEQLLSVAERIGPIDALVPGAGINLRPHDNAAEKLTLEAWNRTIAVNLTGVM
FT                   LTVRAFRPRIRADGAIVLISSVAALRAMPHSDAYTASKGAIVALTRSWAVDYSRDGIRV
FT                   NCVAPGPTDTEMMSGLRDGYAVERQVQLPQQRMATAGEVAQVIRFLASDQASYVSGAIV
FT                   PVDGGAVAHSAGVPFPRRRPKP"
FT   gene            complement(417000..418610)
FT                   /locus_tag="RPD_0353"
FT   CDS_pept        complement(417000..418610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0353"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37591"
FT                   /db_xref="GOA:Q13E98"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E98"
FT                   /protein_id="ABE37591.1"
FT                   /translation="MSDAEDIKLATISDQATNLARRVNVGDITRRGARRHRDKIAVIMG
FT                   ETRLTYGELDARANRIAHGLLAMGLGNGARIGGLARNSIDFLTLYFAAAKAGAIFCPSN
FT                   PAIPDADLVHILGHAEVSAIFIDPDRHQQFTAVASQVPSIRKIFSVGGNGQADSQLDSL
FT                   AVIAEGQPAIDPETATGDRDVAMIMYTSGTTSAPKGAMLSHINVTTGAVHNAFAGEVDE
FT                   NTIATAILPLFHCGQLSISSGTLMRGGTVVVFDGFEPAALLDAIARERITWLFALPAMY
FT                   RALLAHKDLDNTDVSSLAFCLYAMAPMDPSTLREASRRLKARFALTSGQTEAYPPTVVF
FT                   APEFQLTKHGAFWGRAMPLVDLAIMDDDGRLVEDGSVGEIVYRGPMVMEGYLKDPEATA
FT                   RAFEGGWFHSGDLGRFDEDSLLLFVDRKKDIIKSGGENVSSVKVESCLLAHPAVRAAAI
FT                   VGVPHSRWSEAVVAAVCLLPGSVEDEGQLIAHCKQTLAPFEVPKKIVFYRELPQTATGK
FT                   LQKYQIRGELENLFRDQTN"
FT   gene            complement(418647..419438)
FT                   /locus_tag="RPD_0354"
FT   CDS_pept        complement(418647..419438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0354"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37592"
FT                   /db_xref="GOA:Q13E97"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E97"
FT                   /protein_id="ABE37592.1"
FT                   /translation="MTDWKTKYKLITFDNDKGVLTVSFSREAKLNAVDARMHTEMSWLW
FT                   GDVARDEATRAVLLTGAGAAFSAGGDLDWFKTMTPDALDRLFIEARRIIVDMLEVPQPI
FT                   IAAVNGAATGLGATLALMSDIIYASEKATIADTHVLAGIGAGDGGVVIWPWLCGMARAK
FT                   EYLMTGQKLNAREAHSIGLVNHVVAHDELLDTATRMARRLADGPQLAIRGTKFSLNKIL
FT                   REAVNLTLDTSLSLEKECFHSADHRECIDAFLEKRKPQFNR"
FT   gene            complement(419471..420262)
FT                   /locus_tag="RPD_0355"
FT   CDS_pept        complement(419471..420262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0355"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37593"
FT                   /db_xref="GOA:Q13E96"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E96"
FT                   /protein_id="ABE37593.1"
FT                   /translation="MTLVSAATEQTRDCVTGGDARVVLVTGGASGIGRAAALAWARQGC
FT                   SVLVADIDDRGGAETVEAIERLGSRARYQRNDVTDERECASLVEQAVLHFGRLDVAFNN
FT                   AGITGPSAYIANYPGADWRHVINVNLLGIFNSMQPQLRLFESQGAGVIVNTASVIGLRG
FT                   VAGGSAYAAAKHGVIGLTKCAALEYGRSGIRINAVCPGYIETPLVAAVPDRILTEKINR
FT                   TGARRLGRPDEVAALVLWLASPAASYVNGAAVAVDGGFLAS"
FT   gene            complement(420259..421437)
FT                   /locus_tag="RPD_0356"
FT   CDS_pept        complement(420259..421437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0356"
FT                   /product="Isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37594"
FT                   /db_xref="GOA:Q13E95"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E95"
FT                   /protein_id="ABE37594.1"
FT                   /translation="MIELASFDFDLDEPTRMLRDTVRSFVQAELAPRAYAIEQANDFPA
FT                   DIWRKFGSMGLLGITVDEAYGGSGLGYFAHIIAMEEISRASAAVGMSYGAHSNLCVNQI
FT                   HRNGTEAQKQRYLPKLVSGENVGALAMSEAGAGSDVVSMKLRADKVGSNFVLNGTKMWI
FT                   TNGPNADTLVVYAKTDPAAKSKGITAFIVERDFKGFSTSPKLDKLGMRGSNTCELVFDN
FT                   CEVPEANVLGEVGQGVRVLMSGLDYERAVMAAGPVGIMAACLDLVVPYARDRKQFGQPI
FT                   GEFQFIQGKLADMYTAQMTARAYLYGVARAIDGKVLQGQAARKDCAAVILYAAEQATKV
FT                   AAEAIQIMGGNGYVNECPAGRYWRDAKIFEIGAGTSEIRRMLIGREIVRSSA"
FT   gene            complement(421620..422846)
FT                   /locus_tag="RPD_0357"
FT   CDS_pept        complement(421620..422846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0357"
FT                   /product="extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37595"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E94"
FT                   /protein_id="ABE37595.1"
FT                   /translation="MKFYGVTSLSGAVRLAFFASAVCGPGAFNGAAAQEPVRIGVITDM
FT                   TGPYSSLSGPGVVVGMKMAVDEFGGKVLGQPIEVLSADSGLKADIALSRAREWYDRQNV
FT                   HMIVESSDSGSAVALQKLGADKKKITMFHSGTTALTNLECSPYGVHYAWDTYSMASGAA
FT                   RAAVQAGGNSWYFITADYVFGKSLEADASKIIRQLGGDIIGGVRHPLNVPDFASFLLSA
FT                   QQSKAKVVGLANAGSDTQNAVKQAAEFGLGGGQKVVPLLMFDTDVKGLGLKVAQGMEFA
FT                   TAFYWDYDDKSREFANKFFAIHKSMPTMNHAGSYSATLQYLKAVQATGSLDADKVMKYL
FT                   KSAKIEDAFARNGRIRVDGRMVHDIYQVRVKTPEESTGPSDILKVILTIKGDDAFMPLA
FT                   DSTCPLVKK"
FT   gene            423299..424021
FT                   /locus_tag="RPD_0358"
FT   CDS_pept        423299..424021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0358"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37596"
FT                   /db_xref="GOA:Q13E93"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E93"
FT                   /protein_id="ABE37596.1"
FT                   /translation="MPEPPARNRSNVSARIDVSLIAMTKNSADSARPRGLVQVRSSRAD
FT                   KQERTRRALLQAAIDIVGDEGYAAATVGKITSRAKVANGTFYNYFDSQQSIFDQLLPFL
FT                   GDRLTAHIKAQVDESLTGVARDRARFVAYFDFCRKNPAFLRVLNEAEVFAATAYRQHVV
FT                   AMYEGYLHALERSAAKHEITGYDREELPPVVFMLMGIRSYMTMLYQHNYVERSALSIEA
FT                   MADIYEKLLTLGLFNDRR"
FT   gene            complement(424369..424443)
FT                   /locus_tag="RPD_R0013"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(424369..424443)
FT                   /locus_tag="RPD_R0013"
FT                   /product="tRNA-Glu"
FT   gene            424666..425946
FT                   /locus_tag="RPD_0359"
FT   CDS_pept        424666..425946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0359"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37597"
FT                   /db_xref="GOA:Q13E92"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E92"
FT                   /protein_id="ABE37597.1"
FT                   /translation="MVAGGGGGDDARPLRQPQRGLGGDRNASLGAEKLIADGDENRRER
FT                   QRRGQARDHHHPPHPRKQRGLFGGRFGQGGFGHAMLGFGSVFLEGSIVNDSSGHLLEVV
FT                   VAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVAIRGAPVRDPAYHAASGETITIDV
FT                   PPPVAPEPAGEAIALEIVHEDDDIIVIDKPRGLVVHPAAGHETGTLVNALIAHCGESLS
FT                   GIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGAP
FT                   NRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETG
FT                   RTHQIRVHLAHIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHP
FT                   STGEVVAWESGLPADLKRLKAALTATE"
FT   gene            426165..427064
FT                   /locus_tag="RPD_0360"
FT   CDS_pept        426165..427064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0360"
FT                   /product="RNA polymerase sigma factor RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37598"
FT                   /db_xref="GOA:Q13E91"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E91"
FT                   /protein_id="ABE37598.1"
FT                   /translation="MARAATLPVLNGESGLARYLAEIRKFPMLEPQQEYMFAKRWREHD
FT                   DRDAAHHLVTSHLRLVAKIAMGYRGYGLPISEVVSEGNVGLMQAVKRFEPDKGFRLATY
FT                   AMWWIKASIQEYILRSWSLVKMGTTANQKKLFFNLRKAKSKISALDEGDMHPDQVKLIA
FT                   TRLGVTEQDVIDMNRRLGGDASLNAPIRDDGEPGEWQDWLVDQSPSQEAVMAEHEELDH
FT                   RRAALNGAIGVLNPRERRIFEARRLADEPMTLEDLAAEFGVSRERVRQIEVRAFEKVQS
FT                   AVKGTIARQEQAALEAAH"
FT   gene            complement(427197..427559)
FT                   /locus_tag="RPD_0361"
FT   CDS_pept        complement(427197..427559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37599"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E90"
FT                   /protein_id="ABE37599.1"
FT                   /translation="MGDIMGVLASGYTSAALQNPSRTPYKNVDEKLYEGTWSGTYSNTK
FT                   KFSITVSDVQGFRAQVRYQSEGSIKFQSVLIKDGSFRVGDTKFTLGANGSASIRTAVSD
FT                   PVTGQVNLVKGTAKLG"
FT   gene            complement(427695..428594)
FT                   /locus_tag="RPD_0362"
FT   CDS_pept        complement(427695..428594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0362"
FT                   /product="beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37600"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E89"
FT                   /protein_id="ABE37600.1"
FT                   /translation="MTSSARPEIRAFFDEPTNTISYLVSDPATRRAAVIDPVLDYDHSD
FT                   GSVDIRSADAILKAANDGGLTIEWVLETHAHADHLSGAPYIKRNTGARIGIGEHIKDVQ
FT                   RIFRPMFNADDLRTDGSDFDHLFKDGERFAIGDLAVEVMHTPGHTPADIAYRIGDDAVF
FT                   VGDTLFMPDYGTARADFPGGDAHQLYRSIQKLLALPPRTRLFMCHDYKAPGRDEYAWET
FT                   TVQAQREGNVHLRGGVSEDEFVDMRNARDATLKAPTLLLPSIQVNIRAGRFPKAQHNGV
FT                   HYLLLPVRARPGAEAGVN"
FT   gene            428704..429039
FT                   /locus_tag="RPD_0363"
FT   CDS_pept        428704..429039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0363"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37601"
FT                   /db_xref="GOA:Q13E88"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E88"
FT                   /protein_id="ABE37601.1"
FT                   /translation="MSLSPTFEADDFAANAARVATVLRALGNTRRLMILCRLIETGEMT
FT                   VGALADSIGISQSALSQHLARLRDDGIVTYRRDSQSVWYRIAEPRIEQLIAELHRLFCR
FT                   NAAALQR"
FT   gene            429057..429875
FT                   /locus_tag="RPD_0364"
FT   CDS_pept        429057..429875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0364"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37602"
FT                   /db_xref="GOA:Q13E87"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E87"
FT                   /protein_id="ABE37602.1"
FT                   /translation="MAITSADLITVASGGLVGFILALIGGGGSVLAVPLLVYVVGIRSP
FT                   HVAIGTSSIAVAISALANLLGHWAAGNVRWNCALVFSAAGIGGAFAGSFIAKQIDGQKL
FT                   LLLFGMLMVVIGVLMSRRQSGGGDPTIRLTIATAKTMLPKLIGTGFGVGALAGFFGIGG
FT                   GFLIVPGLILATGMPLTSAIGSSLVAVFAFGASTAASYALSGLIDWRLAGLFISGGLIG
FT                   GLIGIGAGKLIGAHDKVLRGVFSAVVVVVGLYVCYRGVAYFLVAQHPMSL"
FT   gene            complement(429936..431549)
FT                   /locus_tag="RPD_0365"
FT   CDS_pept        complement(429936..431549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0365"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37603"
FT                   /db_xref="GOA:Q13E86"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E86"
FT                   /protein_id="ABE37603.1"
FT                   /translation="MQETGVHNGAHGADKFGLKNLKGIYWNFGAPQLYEHALRNGEAVL
FT                   SADGALVADTGVFTGRSPKDKFTVRDATTETTMWWGGNQSITAEQFETLYQDFIKHAEG
FT                   MTLFAQDLYGGADPSFQIKTRVFTELAWHSLFIRTLLRRPDRADLAAFVPELTLIDLPS
FT                   FRADPKRHGCRSENVVAIDFARKIVLIGGTQYAGEMKKSVFTTLNYYLPERGVLPMHCS
FT                   ANVGPAGDTAIFFGLSGTGKTTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAKCIKLS
FT                   PEAEPEIFAASSRFGAVLENVVLDEITRKPDFDNGSKTENTRSAYPLESIPNASPTGRA
FT                   GQPKNVVMLAADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTERGVTEPTPEFSTCFG
FT                   SPFLPRDPSVYGNMLRDLIHNHNVDCWLVNTGWTGGKYGTGHRMPIKVTRALLTAALDG
FT                   SLRNAEFRTDPYFGFAVPTALPGVPSDILEPAKTWADKAEFDKTARALVGMFQKNFAKF
FT                   EAQVDADVRAAAPDVKIAAE"
FT   gene            complement(431739..432473)
FT                   /locus_tag="RPD_0366"
FT   CDS_pept        complement(431739..432473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0366"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37604"
FT                   /db_xref="GOA:Q13E85"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E85"
FT                   /protein_id="ABE37604.1"
FT                   /translation="MQPTADFNPTRVAKSLLRRRREGALATLLRGSGGPFCSLVNLATA
FT                   PDGAPILLISRLAVHTKNLLADPRMSLMLDERAEGDPLEGARIMLLGTALEARPADVQL
FT                   LRRRYLAAHPGAEAYIDFTDFSLFTIETSAAHLVAGFGRIVDLAPADFLTDLGGAAGLL
FT                   DAEPSAVDHMNVDHLDTLNLYATKLIGAGAADWRCTGVDPEGLDLQAGRTTLRLDFLER
FT                   VTTAAGLRDMLKRMADIARSAA"
FT   gene            432687..433388
FT                   /locus_tag="RPD_0367"
FT   CDS_pept        432687..433388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0367"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37605"
FT                   /db_xref="GOA:Q13E84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E84"
FT                   /protein_id="ABE37605.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALEAEGYRIMTYTDGASALDGFRTSP
FT                   PDLAILDIKMPRMDGMETLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFS
FT                   QRLLVERVKAVLRRSAPKDPAAAPKETDAKALDRGLLRMDPERHTCTWKNEPVTLTVTE
FT                   FLILQALATRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKVVDDDFEMIET
FT                   LYGVGYRFKET"
FT   gene            433595..435286
FT                   /locus_tag="RPD_0368"
FT   CDS_pept        433595..435286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0368"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37606"
FT                   /db_xref="GOA:Q13E83"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E83"
FT                   /protein_id="ABE37606.1"
FT                   /translation="MRRAGQFFFTLSFSSLTRRILSLNLAGLMALSASILYLSQFRAGL
FT                   IDARAQSLLVQAEIIAGAIAASATVETNTITVDPDRLLDLKPGETYGPPDEFAVLDFPI
FT                   NPERVAPVLRRLISPTKTRARIYDRDGVLILDSRSLYGRGDVMRFDLPPPTAEKPGLIE
FT                   RATIAVRTWLNRGDLPLYRELGPENGNGYQEVADSLKGQKNSVVRINDRGEVIVSVAVP
FT                   VQRFRAIHGALMLSTQGDDIDQMVTAERLAILKIFGLAAVVMFVLSVLLASTIAGPVRR
FT                   LADAAERVRRRIRARVEIPDFTTRRDEIGHLSGALREMTDSLYNRIEAIERFAADVSHE
FT                   LKNPLTSLRSAVETLPLAKNDKSRARLLAVIEHDVKRLDRLISDISDASRLDAELQRQD
FT                   AAPVDLRRLLTTLTLVANETRLGNNAVVEVRFEGPASDPFSVPGHDSRLGQVISNLLSN
FT                   AQSFSHPGGKVQIVCRRRKTEIEIVVDDDGPGIRDDAFEKIFERFYTDRPHQGFGQNSG
FT                   LGLSISKQIVEAHGGKIRAENRPGPRDADGEPTSAGARFVVRLPST"
FT   gene            435283..435744
FT                   /locus_tag="RPD_0369"
FT   CDS_pept        435283..435744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0369"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37607"
FT                   /db_xref="GOA:Q13E82"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E82"
FT                   /protein_id="ABE37607.1"
FT                   /translation="MSAAGSSSVHASAVRVGDHAVLIRGPSGSGKSRLAFGLIVAGRTG
FT                   QIPDAELIGDDRVFLERRDGRLWVRPAPELAGMIEVRGLGIRRCPNAPEAVIGLIVDLA
FT                   ADDAARLPEAAAMQIRIEGVELPRVPVAAEFDPLPLVVAALTTIDAVGA"
FT   gene            435884..436342
FT                   /locus_tag="RPD_0370"
FT   CDS_pept        435884..436342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0370"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37608"
FT                   /db_xref="GOA:Q13E81"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E81"
FT                   /protein_id="ABE37608.1"
FT                   /translation="MVKVTRSRGAPRSAREEFPMIGLVLVTHGRLADEFKAALEHVMGP
FT                   QKQIEAVTIGAEDDADLCRSDIIEAVNRVDSGDGVAILTDMFGGTPSNLAISCMSRPKV
FT                   EVLAGINLPMLVKLAKVREERALPDAIALAQEAGRKYVTIASRVLAGK"
FT   gene            436339..436674
FT                   /locus_tag="RPD_0371"
FT   CDS_pept        436339..436674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0371"
FT                   /product="Phosphotransferase system, HPr"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37609"
FT                   /db_xref="GOA:Q13E80"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E80"
FT                   /protein_id="ABE37609.1"
FT                   /translation="MTADASQTAPGGQPDTASGASGKISREIPVINKRGLHARASAKFV
FT                   QMAEKFHAEVTVTRNGETVGGTSIMGLMMLAAGIGTTVTVSATGPEAREALDALTELMG
FT                   SKFGEEE"
FT   gene            complement(436731..438272)
FT                   /locus_tag="RPD_0372"
FT   CDS_pept        complement(436731..438272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37610"
FT                   /db_xref="GOA:Q13E79"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E79"
FT                   /protein_id="ABE37610.1"
FT                   /translation="MTSIATSRTRLSLIERWIDALLDPKRQERTVVLSLAAYAAIWTAY
FT                   RTIATWPRDLHADVTELYGWSRNLAFGYDKHPPFSAFVTRAWFSVVPVSDLTFHLLATA
FT                   NIALTLYIAWRTMRRYMAAEKALFGLALLTLIPFFNFIALKYNANAVLLPLWALTIHCF
FT                   LRAFEQRSLLWPALAGVFAGCSMLGKYWSVVLIGALGLGALLDPRRARFFGSPAPWLMI
FT                   VAGALVLAPHLAWLVDHRFPSFTYAAARAGSGFFENALDTLRYLAGCLGYAALALVATW
FT                   ALLRPSRAALIDSAWPADPQRRLIVTIQFLMIVAPAPVALASGIRIVPLWTMPAWTLLP
FT                   IVLLSSPLIEVGRAALRRMLIGAAALALAILAAAPGVAVAIHTTSAPEPFEYASLLADD
FT                   IARTWQRHSDKPIALVAGETVLAENTAYYLRTDTRAFETADLAALKAEATARGAVLVCS
FT                   ATDQTCLATAEQIVAGQPQILRSKVWLSRPLFGIAGGTVRDVFLLVPPPATGAAK"
FT   gene            438293..440227
FT                   /locus_tag="RPD_0373"
FT   CDS_pept        438293..440227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0373"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37611"
FT                   /db_xref="GOA:Q13E78"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E78"
FT                   /protein_id="ABE37611.1"
FT                   /translation="MPGGHLPVRPAPSSMPKAAVFRAVVAADRLAGRNRRCYPATMTTV
FT                   PIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKA
FT                   QTVRLNYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLAN
FT                   VYHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLE
FT                   AIVTRLPPPKGDRGATLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTGAAYD
FT                   VERVGFFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAI
FT                   PVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEII
FT                   QERLSREFDLNLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVKIAEIEEPWIEATILT
FT                   PDEYLGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFD
FT                   YHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPI
FT                   QAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEA
FT                   FIAALKVDS"
FT   gene            440240..440926
FT                   /locus_tag="RPD_0374"
FT   CDS_pept        440240..440926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37612"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E77"
FT                   /protein_id="ABE37612.1"
FT                   /translation="MDPVLTEIPGRILDLAFGALSQANMHAVFSDAGNEHWDFISVTNT
FT                   AHAGELFLKAIIAKEHPLLIFKDLFSLDDNRTDSIELVNLIKRGKTHEFERLPQIIWAV
FT                   TGKRIPNPECYERLRRARNSIQHFCAPEDEDFRDLSLEFIYTIIDPLIFEHFESFAIEY
FT                   HEDHSAGDDYVVATLLRKQLRFSVPDDFDITEIRIRDEISASSQTYREWITGELNRIGR
FT                   LDLLNK"
FT   gene            441249..441485
FT                   /locus_tag="RPD_0375"
FT   CDS_pept        441249..441485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37613"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E76"
FT                   /protein_id="ABE37613.1"
FT                   /translation="MPAQPKKPTPKSPRERMAARRERLRAEGLRPVQHWVPDLRDPKVL
FT                   ADIRREGAMMAKHPDNDAIDAWIEEVADLDAWS"
FT   gene            441476..441811
FT                   /locus_tag="RPD_0376"
FT   CDS_pept        441476..441811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0376"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37614"
FT                   /db_xref="GOA:Q13E75"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E75"
FT                   /protein_id="ABE37614.1"
FT                   /translation="MELKRGDVVLLVAQGEIGKPRPGVVVQADELGNATTSVLICPMSS
FT                   DLSEFKRTRPWIEPSADNGLRVRSQIMTDKLSPIRRDRVRQVLGVLNAQTQERLDAALL
FT                   VVLGLAR"
FT   gene            441925..443745
FT                   /locus_tag="RPD_0377"
FT   CDS_pept        441925..443745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0377"
FT                   /product="isocitrate dehydrogenase (NADP+) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37615"
FT                   /db_xref="GOA:Q13E74"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E74"
FT                   /protein_id="ABE37615.1"
FT                   /translation="MTADAHLFSASDLEAATRIAEPDFELLDALIRTDDPDDQAHTLAR
FT                   VALSAFDNYYAVSRRIPALAKAAFYARDWPATVRLSKIRIGLYTACIDQLVPLLKAGLP
FT                   ELANDEQVWVRAEAELLAAIAGRYEADFAFAFWQSLRRKLVSDEWRPVSYDTGPAARPP
FT                   AAIAAVVRTIAATLPIQPEVIRNVLDAAGFTGPWRDLDGDAALAAAAIEAALEPLSPRA
FT                   GETAKIEIAESGFFRNRGACLVGRIRLRDRGDMPPRNIPLLVALLNEDDGLVVDAVLCD
FT                   SDELQFAFSSTLANYHATNPRYHELARLLHELMPKRPLGTQYSCIGFHHLGKVAVMNEI
FT                   LTEHRRSKEKLATAPGFKGTVAIAFTMPCSAYVLKIIRDHPTDDYKFDYFDGLDAVLRK
FT                   YNLVHEIDRAGSMLDNIIYSNVKLARTMFAPDLLDELLEAGIGTVTLERDALVFRHLIV
FT                   QIKLTPLPLYLTTAAAADARAAVINLGDCIKNNAAADIFNKDLDGRNYGVSRIRKVYLF
FT                   DYDAVEQLTEVKVRSTPPMPRAEDEDGVVFRPAQMLEGLRIDDPGLRRAFRDAHPELMQ
FT                   PDYWEGMQHALRAGKVPKVMNYPTSRRLRR"
FT   gene            443977..444726
FT                   /locus_tag="RPD_0378"
FT   CDS_pept        443977..444726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0378"
FT                   /product="protein of unknown function DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37616"
FT                   /db_xref="GOA:Q13E73"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E73"
FT                   /protein_id="ABE37616.1"
FT                   /translation="MLDAAIKALTQILSPPMRSILWRSIGFALALIAVAAIGLQRLLSW
FT                   LANSSELWAEAALGGFQTPLNILSWVFSIAAGLGIVVGAVFLMPAVTSLVAGIFVDEAA
FT                   EHVEREYYPSDQSGVALPVGIAMIETVKTALLTILVYLVALPFLFFAGAGVIVFFVATG
FT                   WLLGREYFELAAMRFRPAADAKAMRRDNATTVFIGGLVIAAFVSIPIVNLATPLFGMAF
FT                   MVHLHKRLSGSRPERIAPDRRDRIDAR"
FT   gene            445371..446354
FT                   /locus_tag="RPD_0379"
FT   CDS_pept        445371..446354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0379"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37617"
FT                   /db_xref="GOA:Q13E72"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E72"
FT                   /protein_id="ABE37617.1"
FT                   /translation="MSAKRDGCMMRALNDNNLPPRTPRTAFHTKPRWDHEGRDWPNQDA
FT                   SQFVHAAGLRWHVQQMGRGPVLLLIHGTGAATHSWRMLAPLLAEHFTVVAPDLPGHGFT
FT                   ETPPPARMTLDAMAQDIATLLRGLGHQPVLVAGHSAGAAVLARMCLDGSIAPAGLVALN
FT                   GALLPIGGAATRLMLPLARVLASSAMVPRLIARFARNKGMVERMIADTGSSVDPAGIDY
FT                   YRRLVGSPGHVAAAIRMMASWRLDRLAQQLPGLATRLLLIAGSNDKTIASQDSARVHSM
FT                   VPGARVEIMQGLGHLAHEERPHDVAGMMIELARNAGLLPRMFAAAE"
FT   gene            446518..448239
FT                   /locus_tag="RPD_0380"
FT   CDS_pept        446518..448239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0380"
FT                   /product="peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37618"
FT                   /db_xref="GOA:Q13E71"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E71"
FT                   /protein_id="ABE37618.1"
FT                   /translation="MGFSLSRDDREGVAQALDCRQTDAVLRSALFPEQSTRRPCRPHAP
FT                   PFVLKETLMALSPWSVCRAAMALMLVTTATLASARAQDAAPASQQPAAAQGGKSETGGS
FT                   RGKAAAASSDAEQHRLPADSVTRHTLALPGRSLSFAATAGSIRLFNDKAEPQADIAYTA
FT                   YQLDNAEARTRPVTFLFNGGPGASSAWLQLGAAGPWRLPIFGEAAVASATPALQPNAET
FT                   WLDFTDLVFIDPVGTGYSRLVASGDDVRKQFYSVDGDVDAIALTIRRWLEKHDRLLSPK
FT                   YVGGESYGGIRGPRVVRNLQTRQGVGVKGLILVSPLLDFREYSGSSLLQYVARLPSMAA
FT                   AARQQKGPVTRTDLTDVEAYARGEFLADLIKGEADQAATNRLADRVATLTGIDPAVSRR
FT                   LAGRLDTSEFQREFDRANGKVTGRFDASVLGFDPFPDSSDAQFSDPSADSLIAPLTSAA
FT                   AELTRNPLQWRPDGSYHLLNSSVAQQWDFGRGRNPVESLTQLREILAVDPKLQVLVTHG
FT                   LFDLATPYFASQIAIDQLPPFASKRIKLVTWPGGHMTYARDDARKALRGEVGAMMK"
FT   gene            complement(448307..449083)
FT                   /locus_tag="RPD_0381"
FT   CDS_pept        complement(448307..449083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0381"
FT                   /product="endonuclease III / DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37619"
FT                   /db_xref="GOA:Q13E70"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E70"
FT                   /protein_id="ABE37619.1"
FT                   /translation="MQKITRRAPAPAVAKSAKIPASSVAAKPRPQRQKSGKAATKPKRL
FT                   RRWSPDEVREAFTRFARANPEPKGELEHLNPFTLLVAVVLSAQATDSGVNKATRALFAV
FT                   ADTPQKMLALGEERVRDYIKTIGLFRTKAKNVIALSQKLITDFGGEVPSTRAELETLPG
FT                   AGRKTANVVLNMAFGQPTMAVDTHVFRVGNRTGLAPGDTPLAVELALERMIPPEFMQHA
FT                   HHWLILHGRYTCLARKPRCEVCPINDLCRWPEKTVA"
FT   gene            449106..449621
FT                   /locus_tag="RPD_0382"
FT   CDS_pept        449106..449621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37620"
FT                   /db_xref="GOA:Q13E69"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E69"
FT                   /protein_id="ABE37620.1"
FT                   /translation="MALDTDLDPELAQPKLFSALLKPHRALSHKAFLVLMGVLGTISFA
FT                   VGVGFWTMGAWPVFGFFGLDLLAIYIAFRISFARGRASEEISITISELRVRRISHRGHV
FT                   AEWVLNPLWVRLEKIVHAEFGIEQLYLVSRGRRVSVASFLGAEEKASFANALTAALDAA
FT                   RRGPLVRH"
FT   gene            449638..450570
FT                   /locus_tag="RPD_0383"
FT   CDS_pept        449638..450570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0383"
FT                   /product="DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase / Transcriptional regulator Ada"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37621"
FT                   /db_xref="GOA:Q13E68"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E68"
FT                   /protein_id="ABE37621.1"
FT                   /translation="MVAARRATYIGSMMNLAAADHRLAKPGPRDAALADYDSVRRAIAF
FT                   ISQKWKAQPTVEAIADASGLTPDELHHLFRRWAGLTPKAFMQALTLDHAKNLLRDSASV
FT                   LDAALDSGLSGPGRLHDLFVTHEAMSPGEWKSGGAGLTLRYGFHPSPFGAAVVIASERG
FT                   LAGLAFADPGEEQAAFVDLQQRWPRATCIADQEFTAPFAQRVFDPVQWRSEQPLRVVLI
FT                   GTDFEVRVWETLLKIPLGRAVCYSDIANKIAAPKASRAVGAAVGKNPISFVVPCHRALG
FT                   KGGALTGYHWGLTRKQAMIGWEAGRLGAG"
FT   gene            450661..452175
FT                   /locus_tag="RPD_0384"
FT   CDS_pept        450661..452175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0384"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37622"
FT                   /db_xref="GOA:Q13E67"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E67"
FT                   /protein_id="ABE37622.1"
FT                   /translation="MQSRRPVMLVILDGWGWREDPADNAVLQADTPTFDALWANGPHAF
FT                   LRTSGKSVGLPNGQMGNSEVGHLNIGAGRVVMQDLPRISDAIASGEIGQAPELLAFIEK
FT                   LRASGGTCHLMGLVSPGGVHSLQDHACALAKILAKAGVPTVLHAFTDGRDTPPKSAVDD
FT                   IARVRAELPPNVPIATVSGRYYAMDRDNRWERVSKAYGVIADADGPRFADADAVVAAGY
FT                   ASGVNDEFIVPAVVGDYQGMRDGDGVLCFNFRADRVREILATLLDPTFTGFPRKRVLKI
FT                   AAAAGMTQYSTALDALMRTIFPPQSLVNGLGQVVAATGRHQLRMAETEKYPHVTYFLNG
FT                   GEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVQAIESGKYDMIILNFANPDMV
FT                   GHTGSLPAAIKAVETVDTQLGRIVAAIRQAGGALLVTADHGNCEMLRDPVTGGPHTAHT
FT                   TNPVPVLLVGHEGPLADGQLSDLAPTLLKLMDLPQPAEMTGQSLIG"
FT   gene            complement(452216..453031)
FT                   /locus_tag="RPD_0385"
FT   CDS_pept        complement(452216..453031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0385"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37623"
FT                   /db_xref="GOA:Q13E66"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E66"
FT                   /protein_id="ABE37623.1"
FT                   /translation="MSDMRLIVAGAGGRMGRALTRAISETKGVVLTGALEAPGSELLGQ
FT                   DAGVLAGLPANGVKLSADLWTLSAGADGILDFTVPAATIANVAIAAQRGIVHVIGTTGL
FT                   SSSDNAVIKSVTDQAIVVKSGNMSLGVNLLAALTRRVAQSLDAGFDIEIVEMHHRAKID
FT                   APSGTALLLGEAAAAGRKVDLDDHSARGRDGVTGARKTGDIGFASLRGGTVTGDHSVIF
FT                   AGPYERIELAHKAEDRMIFAHGALKAAQWAHGKSPGLYSMMDVLGLAEF"
FT   gene            complement(453124..453435)
FT                   /locus_tag="RPD_0386"
FT   CDS_pept        complement(453124..453435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0386"
FT                   /product="protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37624"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E65"
FT                   /protein_id="ABE37624.1"
FT                   /translation="MAKGYWVARMDVHDLDGYKRDYVAHNGTVFAKYGARFLTRGGTYE
FT                   AHEGPARSRNVVIEFKDYATALACYHSPEYQALIKARSPFAQGEIVIVEGYDGPQPQG"
FT   gene            complement(453455..454162)
FT                   /locus_tag="RPD_0387"
FT   CDS_pept        complement(453455..454162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0387"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37625"
FT                   /db_xref="GOA:Q13E64"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E64"
FT                   /protein_id="ABE37625.1"
FT                   /translation="MAQADPADRDRLIVALDVPSVDAANAMIEKLGDSVGFYKIGYQLA
FT                   YAGGLPLVEKLARAGKKVFVDLKLHDIGNTVARGVESLNSLGATFLTVHAYPQTMKAAV
FT                   AARGDSGLKILAVTVLTSYDDSDLADAGYRFGVRDLVEARARQALAIGVDGLVCSPEEA
FT                   ANLRGIVGPDMALVTPGIRPAGAAAGDQKRIMTPARAIAAGASHLVVGRPVMEAADPKQ
FT                   AAEAIVAEIAQAT"
FT   gene            complement(454169..454750)
FT                   /locus_tag="RPD_0388"
FT   CDS_pept        complement(454169..454750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0388"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37626"
FT                   /db_xref="GOA:Q13E63"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E63"
FT                   /protein_id="ABE37626.1"
FT                   /translation="MSVVKILVIPGSLRTGSHNVRLAAAAAHELARADVDVTRLSLADY
FT                   PLPIYDGDFEAKSGVPINAINLKRMIGAHHGVLIVSPEYNSAPPALLKNAIDWVSRVED
FT                   SHETQGQVFRERAFALAAASEGKLGGARCLAALRLILSGCRAPVIPNQLALSFAHQAYD
FT                   ETDRLKLPADIAALQAMVRQLIDFAQHMMR"
FT   gene            complement(454899..455501)
FT                   /locus_tag="RPD_0389"
FT   CDS_pept        complement(454899..455501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0389"
FT                   /product="putative phospholipid N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37627"
FT                   /db_xref="GOA:Q13E62"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E62"
FT                   /protein_id="ABE37627.1"
FT                   /translation="MALQSTVRALKKQPRLDDEVRFLRSWIEKPLHMGAVMPSGKLLAR
FT                   TMAQYVDIDSTGPVIELGPGTGAITSALVEHGVEQKRLVLVEYNPSFCALLRERYPQAT
FT                   VVQGDAYRLRDSLWDVLPEPATAVVSGLPLVTKPMLTRMKLIRDSFNLLEPGAPFVQFT
FT                   YSVAPPIPKSLPGVSTEASERIWMNIPPARVWVYRKG"
FT   gene            complement(455595..456755)
FT                   /locus_tag="RPD_0390"
FT   CDS_pept        complement(455595..456755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0390"
FT                   /product="Chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37628"
FT                   /db_xref="GOA:Q13E61"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E61"
FT                   /protein_id="ABE37628.1"
FT                   /translation="MTIESVAMSTTKRCYYETLEVERSADESTLKSAFRKLAMKWHPDR
FT                   NPGDASSEVKFKEINEAYEVLKDGDKRAAYDRYGHAAFEQGMGGGAGFGAGFASSFSDI
FT                   FEDLFGMAGQRGGRGTGRERGADLRYNMEISLEDAFKGKTAQIEIPVSVTCESCSGIGA
FT                   KAGTKPKTCSTCGGAGRVRQAQGFFTLERTCPSCQGRGQIIEDPCPSCTGSGRVTRERT
FT                   LSVNIPQGVEDGTRIRLAGEGEAGVRGGPPGDLYIFLSLASHAIFQRDGADLHCRVPIS
FT                   MVTAALGGEFEVPTIERGKTKVKVPSGTQTGRRFRITGKGMPVLRSRQVGDMYVQVAVE
FT                   TPQNLTKKQQELLAEFEKLSSGATQPEAAGFFTKVKDFFGSRANTP"
FT   gene            complement(456864..458765)
FT                   /locus_tag="RPD_0391"
FT   CDS_pept        complement(456864..458765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0391"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37629"
FT                   /db_xref="GOA:Q13E60"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E60"
FT                   /protein_id="ABE37629.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKNSKVIENAEGMRTTPSIVAISDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLVGRRYDDPMVEKDKKLVPYKIVKASNGDAWVE
FT                   ADGQTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKTKTGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVNYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEIGEVVLVGGMTR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIP
FT                   PSPRGMPQIEVTFDIDANGIVNVSAKDKATSKEQQIRIQASGGLSDADIDKMVKDAEAN
FT                   ASEDKRRREAVDAKNHADALVHSTEKALAEHGSKVEDSERRAIEDALSDLRESLKSDDA
FT                   EAIKTKTNTLAQASMKLGEAMYKQQAESDAAKHAAKDDIVDADFTEVDDDKNNKKSA"
FT   gene            459160..460104
FT                   /locus_tag="RPD_0392"
FT   CDS_pept        459160..460104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37630"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E59"
FT                   /protein_id="ABE37630.1"
FT                   /translation="MRQIARLFAIALVFAAATPAVAADTVYPRGIRVGVTPMPGLTESQ
FT                   AFLGFESAGHGVKVLLAELPGPAFGEVEAAFKAVPEGAMGKVKPESIETAAGKAYYTAE
FT                   DAVVGTDKVRRYSLIVPGSKMFSGYIAVQVADSEAQTYSDEAVKKMLTSVSVRQQVPIE
FT                   EQIAQMPFSIRETAGFKTVRTLAPGAALLFADGNEETGVEGAPFMVLGLIGSVPDQTDA
FT                   RARFAQQAAATIPGLREARITTSEPMRIDGSAGFETRIEAVSGKDNTPVTVVQWLRFGS
FT                   ASVAMRVIGSSPRDQWSEAFPRFRKVRDGLKGR"
FT   gene            complement(460221..460841)
FT                   /locus_tag="RPD_0393"
FT   CDS_pept        complement(460221..460841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0393"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37631"
FT                   /db_xref="GOA:Q13E58"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E58"
FT                   /protein_id="ABE37631.1"
FT                   /translation="MTDSNGQKDNNQDQAQPADPVVSKPYIMPDDPEEGTNEALVREAA
FT                   EARDKMLRTLAEMENLRRRTAKEVADARTYGVSAFARDVLEIADNLQRALDAVPAEARA
FT                   NADAGLKGLIEGVELTERSLINALEKNGVKKFDPQGEKFDPNFQQAMYEVPDPSVPAGT
FT                   VVQVVQAGFMIGERVLRPALVGVSKGGAKPAPAAANGNEGGVA"
FT   gene            complement(460941..462029)
FT                   /locus_tag="RPD_0394"
FT   CDS_pept        complement(460941..462029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0394"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37632"
FT                   /db_xref="GOA:Q13E57"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E57"
FT                   /protein_id="ABE37632.1"
FT                   /translation="MAHHDPIGLIAPNTGLAQLNERSRDIFRQIVESYLATGEPVGSRN
FT                   ISRLISMPLSPASVRNVMADLEHLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP
FT                   ERQSIQAQLSSVGQAQTVEAALGEALTRLSGLTRAAAVVLTAKSNVRLKHLEFVRLEPE
FT                   RALVILVAEDGQVENRVLALPPGVPSSALVEASNFLNARIRNRTLAEARLELETLLSQD
FT                   RTELDQLTQKVISAGIASWSGGDGEDRQLIVRGHANLLEDLHALEDLERVRLLFDELET
FT                   KRGVVDLLGRAERAEGVRIFIGSENKLFSLSGSSTIIAPYSDGAGHIVGVLGVIGPTRL
FT                   NYARVIPMVDYTARIVSQMLGG"
FT   gene            462181..462894
FT                   /locus_tag="RPD_0395"
FT   CDS_pept        462181..462894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0395"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37633"
FT                   /db_xref="GOA:Q13E56"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E56"
FT                   /protein_id="ABE37633.1"
FT                   /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLEE
FT                   RLPPWLKGQGRGWVTAEYGMLPRATLERTRREAAAGKQNGRTVEIQRLIGRSLRAIVDL
FT                   QALGERQITVDCDVLQADGGTRTASITGAWVALADCLGWMKTRNMIKGTVLRDNVAAIS
FT                   CGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRIIEVQGTAEKTPFSQDEFLALMALAQ
FT                   KGVTRLVDLQKMAVA"
FT   gene            462947..463579
FT                   /locus_tag="RPD_0396"
FT   CDS_pept        462947..463579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0396"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37634"
FT                   /db_xref="GOA:Q13E55"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E55"
FT                   /protein_id="ABE37634.1"
FT                   /translation="MHRRISGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEPD
FT                   ETGDSFRANARIKAEAAAQAAKLPAFADDSGLSVDALDGAPGIFSARWAGEGKDFNAAM
FT                   AQIERLLRERGATAPAQRGAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGDAGFGYD
FT                   PMFLPDGHDRTFGEMSSIEKHGLPPLGLGLSHRARAFVKLAEICLGR"
FT   gene            463569..464726
FT                   /locus_tag="RPD_0397"
FT   CDS_pept        463569..464726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0397"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37635"
FT                   /db_xref="GOA:Q13E54"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E54"
FT                   /protein_id="ABE37635.1"
FT                   /translation="MGADPDKAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEARFARAF
FT                   AREIAATAARIGPRDVSSIFLGGGTPSLMQPSTVGAILDAIGKHWRVTPDAEVSLEANP
FT                   TSVEATRFRGYRAAGVNRVSLGVQALDDASLKTLGRLHTAQEAMDAVAIARSAFDRYSF
FT                   DLIYARPGQTPAMWEAELRRAIGEAAEHLSLYQLTIEAETPFFALHRAGKLQTPDESAS
FT                   RALYDVTQSVCAELGLPAYEISNHARPGAECKHNLVYWRGQEYAGIGPGAHGRLDIGGT
FT                   RYAIATEKRPESWMMRVEATGTGVITDDRLNSEERADEFLLMGLRLAEGIDPRRYQALA
FT                   GRSLDPSRIALLCAEGAIVVDADGRLRVTQAGFPVLDAVVADLAA"
FT   gene            complement(464836..466035)
FT                   /locus_tag="RPD_0398"
FT   CDS_pept        complement(464836..466035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37636"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E53"
FT                   /protein_id="ABE37636.1"
FT                   /translation="MAGLREPNTKSLRTTRRTAIGLILGTPLLGACSGVQQTLNNQFGQ
FT                   QPPPDAAQQQSQSVGTGRVKVGLVLPLSAAGNAGVAAQSMKNAAEMALAEFNNPDVQLL
FT                   VKDDAGNPQGAQSATQQALDEGAEIILGPLFAQSVPAAAQLTRARGISMIAFSTDSSVA
FT                   GRGVYLLSFLPESDVNRIIGYAASVGKRSYAALLPDNAYGGVVEAAFKQVVGTKGGRIA
FT                   AFEKYGADRAAAARTIAQALAGADSLLLADDGDALAGVSDALTAAGVDLRRLQLLGTGL
FT                   WDNPRVFATPALQGGLYAAPDPSGFRSFSGRYRARFGQDPVRTATLAYDAVALVAALAR
FT                   TQATRRFSSDVLTNPSGFAGIDGLFRFRADGSNERGLAVMRVATGGAQAVAGSPKSFGA
FT                   "
FT   gene            466232..467185
FT                   /locus_tag="RPD_0399"
FT   CDS_pept        466232..467185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0399"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37637"
FT                   /db_xref="GOA:Q13E52"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E52"
FT                   /protein_id="ABE37637.1"
FT                   /translation="MRAKAAPTIPSTTESEPESRAFLVAGQKLIAPRAAPGLHLVATPI
FT                   GNLGDITLRALETLAGVDVIACEDTRITHRLTERYGISAQLKPYHEHNAAQARPKILKK
FT                   LAQGGSVALVSDAGTPLISDPGYKLVREAYDAGHDVVALPGASAVLAALALAALPTDRF
FT                   FFDGFLPAKQGARRSRLSELAAIDATLVLFEAGSRIHNSLRDLAEVLGGREAAICRELT
FT                   KLHQEVRRAPLTTLAETAETLETRGEFVVVIGPPDPGARMMTQDALDTWLRDALQRDSV
FT                   KDAVAQAVDISGRPRREIYARALELARQREADDGQD"
FT   gene            467172..467567
FT                   /locus_tag="RPD_0400"
FT   CDS_pept        467172..467567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0400"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37638"
FT                   /db_xref="GOA:Q13E51"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E51"
FT                   /protein_id="ABE37638.1"
FT                   /translation="MAKTRSPSTPPAPERVAAFQTGISAETRAAAFLMAKGYRILARRF
FT                   KTPYGEIDIVAQRRKLIAFVEVKARARLDDAAYALTPRQQQRIIAAAEAWLVANPDHAT
FT                   YELRFDAMLVAPKRLPQHLPAAFDASP"
FT   gene            467651..468592
FT                   /locus_tag="RPD_0401"
FT   CDS_pept        467651..468592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0401"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37639"
FT                   /db_xref="GOA:Q13E50"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E50"
FT                   /protein_id="ABE37639.1"
FT                   /translation="MTLKVAVQMDPIARINIRGDSTFAMLLEAQKRGHAISYYTPDKLS
FT                   LRGTDVVASVQRLSVRDQEGDHFTLGEPTRVDMRSFDVVLLRQDPPFDLAYITSTHLLE
FT                   RIHPHTLVVNDPISVRNAPEKLFVMDFAELMPPTLISRDLNEINSFRAEHGAVVMKPLH
FT                   GHGGAAVFRVLPQDINFGSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAADDLRSNMVRGGAAAATDLSERERTICATLAPKLRERGLLLVGIDVIDGYLTEI
FT                   NVTSPTGIRAVARLGGPDIAARVWDVIEQKRS"
FT   gene            468696..469424
FT                   /locus_tag="RPD_0402"
FT   CDS_pept        468696..469424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0402"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37640"
FT                   /db_xref="GOA:Q13E49"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E49"
FT                   /protein_id="ABE37640.1"
FT                   /translation="MSADEGNQWGRRALEFVDAADRLDGPSLIRQFETHIASGGFSAYI
FT                   MAGLPSPGAGLADLTLANGWPRGWFELYVRENYIAVDPVPRHGATTVQPFEWSEAPYDR
FT                   KQNRAAHKVMTHATEFGLVRGYCIPLHYDEGGAVISMAGDQPDLDPVAKGAMQLIGVYA
FT                   HNRIRSLHRPKPQRRLLTSRECEILLWAAHGKTAWEISIILHIAERTVKFHLIEASKKL
FT                   NAVNRTAAVAKALAFGLIKL"
FT   gene            469502..470158
FT                   /locus_tag="RPD_0403"
FT   CDS_pept        469502..470158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0403"
FT                   /product="autoinducer (acylhomoserine lactone) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37641"
FT                   /db_xref="GOA:Q13E48"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E48"
FT                   /protein_id="ABE37641.1"
FT                   /translation="MEVHVVRRENREAYADLIERQFRIRHQIYVVERKWTELDRADGRE
FT                   IDQFDTDETVYLIGMQNGEIVAGMRMVPTSSPTLLSDIFPQLSLDRPVRRPDVYELSRI
FT                   YVVPNKRGEHAGPRAEAVIQAAAMEYGLSIGLSAFTIVLETWWLPRLLDQGWRARPLGL
FT                   PQDIDGMSTTAVLVDVDDDAWLEICARRSVPGPALHWLGLESVNRNPLPNPMELA"
FT   gene            470155..470379
FT                   /locus_tag="RPD_0404"
FT   CDS_pept        470155..470379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37642"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E47"
FT                   /protein_id="ABE37642.1"
FT                   /translation="MTTQENTSLGQTVPPGTSGRAKSVSIETLATTINRAIEQAEELGI
FT                   PSAAQLLMMARLEVDLTEIALETKLKKSA"
FT   gene            470489..472027
FT                   /locus_tag="RPD_0405"
FT   CDS_pept        470489..472027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0405"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37643"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E46"
FT                   /protein_id="ABE37643.1"
FT                   /translation="MVQHVSTVAFEGIEARAVDVQVQVSPGLPAFAVVGLADKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPADALAGFT
FT                   VLGELGLDGSIAPVAGVLPAAIAANARDEGLICPAACGSEAAWASPDIQIIAARSLIQI
FT                   ANHFKGTQLLSRPQPRVHETESSTLDLRDIKGQESAKRALEIAAAGGHHLLMVGSPGAG
FT                   KSMLAARLPSILPPLSPGELLEVSMIASVAGEIRDGALTARRPFRAPHHSASMAALTGG
FT                   GVKARPGEISLAHQGVLFLDELPEFDPRVLDSLRQPLEIGEVAVSRANHRVTYPARVML
FT                   VAAMNPCRCGRAYEPGYACKRGQVDRCSADYQSRISGPLMDRIDLRIEVPAVTAADLIL
FT                   PPAAEGSAEVAARVAAARDLQRERYAAIGLPQIRTNAEAPASTLEATAQPDSAGLKLLR
FT                   DAAETMRLSARGYHRVLRVARTLADLDGAEIIGRLHLAEALSYRALGEDIKRAA"
FT   gene            472132..472617
FT                   /locus_tag="RPD_0406"
FT   CDS_pept        472132..472617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37644"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E45"
FT                   /protein_id="ABE37644.1"
FT                   /translation="MLRFRVLASTLPLLAMGLFARSELIAGPQPCIAVGDHAVQIAPAS
FT                   WLAHLRVGFTEDPARATIRVQIVDSPDAADFAVTDDAGNTDSGACALTPETRLVGIAAH
FT                   PASDEPLIYLTYDAGGGADYRIFVSSNSFTLRQAAALLVGASDRNAPIATASIGSRS"
FT   gene            472732..474684
FT                   /locus_tag="RPD_0407"
FT   CDS_pept        472732..474684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0407"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37645"
FT                   /db_xref="GOA:Q13E44"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E44"
FT                   /protein_id="ABE37645.1"
FT                   /translation="MMRSLRIKSRRRVFARRFPRLVFMLRSLVVFTAAFCGAYGFIVGS
FT                   RAESSGYNPHTFAIGASFLFALACLGLAVQSMRLRWMRRSLHAVALHNEALADRNWELK
FT                   DAEERARTLLESRGELLTLRDDADATTRAKSRLLAMASHEIRTPLNGIIGMSGLLLDTT
FT                   LTPEQATYVRAVKTSGDALLSLIDELLDYSKIDAGKIELDHRPFALAALIEDIAELLAP
FT                   RAQARAIEIAAYVDERLPAQVIGDAARLRQVLLNLAGNAIKFTSSGGVALIAEPGERDG
FT                   EIDLLIRDTGIGIAPEAQARVFREFEQADDGIARNYGGTGLGLSISERIVSGMGGRIVL
FT                   HSRPGIGTTFTVSIPLAAADDPAAAMAFKAPDLAGQTILIAAPQTIEAQLVAHRLQRWN
FT                   AETRVVSDLAAARVLLPDHAWSAILIDAGFGVTEAAALALDAKLHATQRIVMLNPSIRA
FT                   ELLPKLPAAFTGYLVKPLRAASLAARLGGALIDTAAPGIADSDTPGLAAPDQTAQVGRR
FT                   LSILVAEDNDINALLIRSLLTKLGHDAVIADDGEQALQSWRAASADGAPFDLVLMDVQM
FT                   PLLDGIAASRQIRTYEAERQSRRTPILALTANSLAEDRAACLAAGMDGFLVKPLDRDRL
FT                   VGVLADITSSRPVIA"
FT   gene            474891..475904
FT                   /locus_tag="RPD_0408"
FT   CDS_pept        474891..475904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0408"
FT                   /product="ornithine-acyl[acyl carrier protein]
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37646"
FT                   /db_xref="GOA:Q13E43"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E43"
FT                   /protein_id="ABE37646.1"
FT                   /translation="MRTGRASADSVACGREDPMQTDHLARPKKFIKLLRPEMAGAAAQT
FT                   AITWFKPALRNGDHGKPIAKPALTPATLGRLGALEVRLAQKKQDIKRAQKLRYRVFYQN
FT                   GTAIADAATLLARRDKDAFDRICDHLLVVDHAAKPSLSGKQPVVGTYRLLRQEIADRHG
FT                   GFYTDSEFNIGGMIARHPELRFLELGRSCVLPPYRNKRTVELLWHGIWSYVRQHRVDVM
FT                   IGCASFDGTDPDRLALPLSFLHHYASAPEAWHARAHRSRYVEMNRMPKEAVNQKAALRE
FT                   LPPLIKGYLRLGATIGEGAVIDHQFGTTDVLIIMPVSAISARYIEHFGADATRHAA"
FT   gene            complement(476038..476994)
FT                   /locus_tag="RPD_0409"
FT   CDS_pept        complement(476038..476994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0409"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37647"
FT                   /db_xref="GOA:Q13E42"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E42"
FT                   /protein_id="ABE37647.1"
FT                   /translation="MDARSELHHYNPYRVFSRSEWANLRQDTPMTLDLAEVSTLRSLHD
FT                   RLDITEVEEIYLPMSRLLSIHVGAMQQLYYAQRRFLGVVERKMPYIIGVAGSVAVGKST
FT                   TARVLQALLARWSPRPKVDLITTDGFLHPNALLERAGLMQKKGFPESYDLPALLAFLSD
FT                   IKSGRRKVRAPIYSHLTYDIVPNKFAVVDRPDILIVEGVNVLQTGRLPRDGKAVPVVSD
FT                   FFDFSVYIDADEPVLRDWYIRRFLALRDTAFHDPRSYFHRYAPLSDEEATATAIAIWER
FT                   TNLANLEDNILPTRPRATLILKKGADHVVDSVALRRL"
FT   gene            complement(477185..477508)
FT                   /locus_tag="RPD_0410"
FT   CDS_pept        complement(477185..477508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0410"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37648"
FT                   /db_xref="GOA:Q13E41"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E41"
FT                   /protein_id="ABE37648.1"
FT                   /translation="MARFTLHDLAATIDARAASGGEASYTKKLLDKGAEHCAKKFGEEA
FT                   VELVIATVENDRGHLIAEAADVLFHMLVLLKARGVKLDEVEAALAQRTSMSGLEEKASR
FT                   KRD"
FT   gene            complement(477564..478331)
FT                   /locus_tag="RPD_0411"
FT   CDS_pept        complement(477564..478331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0411"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37649"
FT                   /db_xref="GOA:Q13E40"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E40"
FT                   /protein_id="ABE37649.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTVDDIKTLLRSGADKVSINS
FT                   AAVARREFVKEAAEKFGDQCIVVAIDAKRVPGRDRWEIFTHGGRKGTGIDAIEFAQEVV
FT                   SLGAGEILLTSMDRDGTRSGFDIPLTRAIADSVQVPVIASGGVGDLDHLVDGIREGHAT
FT                   AVLAASIFHFGEYTIREAKDHMVRAGLPMRLDP"
FT   gene            complement(478339..479076)
FT                   /locus_tag="RPD_0412"
FT   CDS_pept        complement(478339..479076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0412"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37650"
FT                   /db_xref="GOA:Q13E39"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E39"
FT                   /protein_id="ABE37650.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQARSFAAQGFQ
FT                   YLHVVDLDGAFAGKPVNAQAVESMLKVVSMPVQLGGGIRDLKTVEGWLAKGISRVIIGT
FT                   AAVRDPALVKQAAKKFPGRVAVGLDARDGKVAVEGWAESSQVTALEIAQRFEDAGVAAI
FT                   IFTDIARDGLLKGINWEATIALAEAVSIPVIASGGLASIDDVKALLSPRANKLEGAIAG
FT                   RALYDGRLDPAEALALIDAARAA"
FT   gene            complement(479255..479905)
FT                   /locus_tag="RPD_0413"
FT   CDS_pept        complement(479255..479905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0413"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37651"
FT                   /db_xref="GOA:Q13E38"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E38"
FT                   /protein_id="ABE37651.1"
FT                   /translation="MSVAIIDYGSGNLHSAAKAFERAARSMEVPEKIIVTRDPEQVFRS
FT                   DRVVLPGVGAFADCRKGLDAVDGMVEALTETVRVKARPFFGICVGMQLMATRGKEHVTT
FT                   DGLNWIPGDVVKITPNQEELKIPHMGWNTLDVLREHPVLERLPLGPNGLHAYFVHSFHL
FT                   AAQSEGDVLARADYGGPVTAVVGRDTAIGTQFHPEKSQRFGLALISNFLKWKP"
FT   gene            complement(479902..480420)
FT                   /locus_tag="RPD_0414"
FT   CDS_pept        complement(479902..480420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37652"
FT                   /db_xref="GOA:Q13E37"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E37"
FT                   /protein_id="ABE37652.1"
FT                   /translation="MPVFTVHAPPPVDDERRASPDRFVFVRDGFYGWAFVFGPLWLLTR
FT                   RLWLALFGYLVVAVAVTFALTALRVGAGPRFAVMLLMALLLGLEAASLWRWTLSRRGWR
FT                   QLDVVVGDDLPGAERRFFDRWSSRQSNPVSFSLPMDRGAPPPTRSVPMPSSSIYGDIVG
FT                   SFPRPGSSR"
FT   gene            complement(480449..481042)
FT                   /locus_tag="RPD_0415"
FT   CDS_pept        complement(480449..481042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0415"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37653"
FT                   /db_xref="GOA:Q13E36"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E36"
FT                   /protein_id="ABE37653.1"
FT                   /translation="MRTATIKRKTKETDIEVTVNLDGAGVSNAATGIGFFDHMLDLLAK
FT                   HSRIDITVKAVGDLHVDFHHTTEDVGIALGQAVKQALGNMAGINRYASMLMPMDETLTR
FT                   VVIDVSGRPFLVFKADFPRDKIGEFDTELVREWFQAFAMNAGVTLHVETLYGENSHHIA
FT                   ESCFKGLARALRAAVAIDPQAAGEVPSTKGQLGG"
FT   gene            481225..481806
FT                   /locus_tag="RPD_0416"
FT   CDS_pept        481225..481806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0416"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37654"
FT                   /db_xref="GOA:Q13E35"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E35"
FT                   /protein_id="ABE37654.1"
FT                   /translation="MNMYSASGEGSPQGSAQVWHGTTILTVRKGGKVVIGGDGQVSIGQ
FT                   TVIKANAKKVRKLGKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLTRAAVELAKDWR
FT                   TDRYLRRLEAMMIVADKDVSLVLTGTGDVLEPEYGVMAIGSGGNYALAAARALADTDQD
FT                   AETIVRKALDIAADICVYTNRNLTLETLSA"
FT   gene            481803..482288
FT                   /locus_tag="RPD_0417"
FT   CDS_pept        481803..482288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0417"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37655"
FT                   /db_xref="GOA:Q13E34"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E34"
FT                   /protein_id="ABE37655.1"
FT                   /translation="MTGIYQFRPFTADDLPLMASWLKRPHMAEWWGDPEEQLAGLREDL
FT                   DQPAMDQYLVITGGTPFAYMQCYRLTAWNDGFGPQPDGTRGIDQSIGDPEMINRGHGSA
FT                   FIRQFTDALLAAGTPRIVTDPSPGNGRAIRCYEKAGFRRDRVVDTPDGPALLMVQET"
FT   gene            482285..483586
FT                   /locus_tag="RPD_0418"
FT   CDS_pept        482285..483586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0418"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37656"
FT                   /db_xref="GOA:Q13E33"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E33"
FT                   /protein_id="ABE37656.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQADAKRAVAIALRNRWRRLQLEGILR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAIAQVRERKRKDVQARAQIAAEERVLDALVGPGSSPATRDSFRRKLRAGDLNDKEIE
FT                   VETQASSGSPMFEIPGMPGGQIGAISIGDIFGKMGGRTKTRRLTVADSHDILINEEADK
FT                   LLDNDQLVQEAINVVENNGIVFLDEIDKICVRDGRSGGEVSREGVQRDLLPLIEGTTVA
FT                   TKHGAVKTEHILFIASGAFHIAKPSDLLPELQGRLPIRVELNALTRDDMRRILTEPEAS
FT                   LIKQYIALLQTEGVTLEFSDDAIDALADVAVGVNSTVENIGARRLQTVMERVLDEISFV
FT                   APDRGGETIRIDADYVQKNVGDLAKNTDLSRFIL"
FT   gene            complement(483691..484287)
FT                   /locus_tag="RPD_0419"
FT   CDS_pept        complement(483691..484287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0419"
FT                   /product="Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37657"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E32"
FT                   /protein_id="ABE37657.1"
FT                   /translation="MKRFVPSLDPPATPRRKRSLSEEERALWDSVAKQVKPLRGRPRLT
FT                   RIDVATAPPATPAEKPQTPPSSQQPVKRPVKLATPMSPPPLASLGRRERSHLSRGRKDI
FT                   DARIDLHGMTQSRAHHALLRFLQRASHDGLSFVLVITGKGSRLGGDPERGVLRRQVPLW
FT                   LSLPEFRAYVVGFDEAHIGHGGEGALYVRVRRARG"
FT   gene            complement(484290..485768)
FT                   /locus_tag="RPD_0420"
FT   CDS_pept        complement(484290..485768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0420"
FT                   /product="MltA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37658"
FT                   /db_xref="GOA:Q13E31"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E31"
FT                   /protein_id="ABE37658.1"
FT                   /translation="MLAPAAVEAGHRHHHSKSHHAAAHKRHLQPVWPLEIPGSQYAPIS
FT                   WDQVAGWDTDDHLAAFKTFQASCRPIVARRNAVAETKPLGASLGEPCQAARVADVSDNA
FT                   KARAFFETHFLPLQISRVGEEAGFVTGYYEPVVEGSRVQTDVYNVPVYRRPSNLFVRGT
FT                   KQDAALPNGGPVYRKIGRRKLVPYYDRAGIEDGAVAGRGLEICWLKSQTDLLFSQIQGS
FT                   ARVKLEDGSVVRINYDAHNGYPYTPVGRILIDRAIIPKEQMSMQRIREWMDANPDGAKE
FT                   LRRANRSYVFFREVKLKDDEEAIGAQGVPLTPGRSIAVDKALHVYGTPFFITGELPIEA
FT                   PESKTPFRRLMVAQDTGSAIIGPARADLYFGAGAEAGAIAGRMRHPIRFVMLLPNSLDP
FT                   VARGRTMPLPDPRPSKKIAKQFPQTPAAKDQPASPDNAKPPEPTAAANGKPPSATSAPE
FT                   VVPTPQARPNAAPAAAPKRAHRRHHRHHDHRRAR"
FT   gene            complement(485824..486531)
FT                   /locus_tag="RPD_0421"
FT   CDS_pept        complement(485824..486531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0421"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37659"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E30"
FT                   /protein_id="ABE37659.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRNVLGQRTGSERPPFDRAAARDMIPG
FT                   KQDNNVVPMPGTVIDQSPTAPNADVVPPSDRWKGIAEPDSPLAHGLNAVLVQDSSFDAN
FT                   HFLTGAKSAYEMIVMAFANGDRRALRDLLSTEVYDSFDAAIKDREKNERKTETRFVAID
FT                   KAELLGAEVREHTAQLTVKFVSQMISVTRDKAGAIVDGNPDKVADITDVWTFARDISSR
FT                   DPNWKLVGTGSGH"
FT   gene            486979..487455
FT                   /locus_tag="RPD_0422"
FT   CDS_pept        486979..487455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0422"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37660"
FT                   /db_xref="GOA:Q13E29"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E29"
FT                   /protein_id="ABE37660.1"
FT                   /translation="MTNGNGAPPEAVAAPQLNVLAQYTKDLSFENPNAPASLAQQQQQP
FT                   AINIQINVGANNLAENEYEVTLSVEGKAESGSTVLFSFELAYAGVFRIVNVPQENLHPL
FT                   IMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFVGLYRQNMERQAQQGQPS"
FT   gene            complement(487508..488203)
FT                   /locus_tag="RPD_0423"
FT   CDS_pept        complement(487508..488203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0423"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37661"
FT                   /db_xref="GOA:Q13E28"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E28"
FT                   /protein_id="ABE37661.1"
FT                   /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEIYNRMPTGQAFHRYINP
FT                   ERDMPAEAFAVHGLSAEFLADKPLFAQVVDEFLDFIGDAPLVIHNASFDAGFLNAELAR
FT                   LSRAAIPRERLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   IDLIGARQSQLILAEVPSERAGQGGDKPRRQRSTPLAARVTELDLDAHRAFIATMGDKA
FT                   IWKEYPAGA"
FT   gene            complement(488243..488842)
FT                   /locus_tag="RPD_0424"
FT   CDS_pept        complement(488243..488842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0424"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37662"
FT                   /db_xref="GOA:Q13E27"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E27"
FT                   /protein_id="ABE37662.1"
FT                   /translation="MLVLGLTGSIGMGKSTTAKLFEEAGVPVYDADATVHKIYEDEAAP
FT                   AIEAAFPGTTANGKVDRTLLSAKVVHDTEAMKRLEQIVHPMLRSHHQNFLDDAEASGAP
FT                   IAVVDVPLLFETGGEKRVDAVVVVTTSPEIQRERILARDNMTPEKLDAILARQMPDAEK
FT                   RKRADFIVDTSHGLDPVRAQLDEILAAAARMPRRRP"
FT   gene            complement(488969..489577)
FT                   /locus_tag="RPD_0425"
FT   CDS_pept        complement(488969..489577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0425"
FT                   /product="Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37663"
FT                   /db_xref="GOA:Q13E26"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E26"
FT                   /protein_id="ABE37663.1"
FT                   /translation="MTLWLGPQPLVLASQSRARQALLTNAGIPFEAIPAKLDERGIARV
FT                   SGLSAPGDIAALLAQEKAAFVSNHHPGRLVLGADQTLALGAREFNKPADRNEAAKQLRE
FT                   LAGRRHELHSAIAVVRNGITLFAEVVIARMTMRPLSDEEIAVYLDEVGDTATCSVGGYQ
FT                   VEGLGVHLFDGIHGDHSTILGLPLLPLLGFLRSQKLLTL"
FT   gene            complement(489574..490413)
FT                   /locus_tag="RPD_0426"
FT   CDS_pept        complement(489574..490413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0426"
FT                   /product="protein of unknown function DUF299"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37664"
FT                   /db_xref="GOA:Q13E25"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E25"
FT                   /protein_id="ABE37664.1"
FT                   /translation="MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLV
FT                   RSQKQLDRVLQEIEESPGIVLFTLLESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYL
FT                   GASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKTPTS
FT                   IYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPDRLIQVRQNRLLSLGAGAG
FT                   NDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE"
FT   gene            490867..491307
FT                   /locus_tag="RPD_0427"
FT   CDS_pept        490867..491307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0427"
FT                   /product="conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37665"
FT                   /db_xref="GOA:Q13E24"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E24"
FT                   /protein_id="ABE37665.1"
FT                   /translation="MFDWSDFYLWVKAFHVIAVISWMAGMLYMPRLFVYHCAAEVGSVQ
FT                   SETFKIMERRLYKAIMNPAMIAAWAAGLVIAWQQSFFASGWFHAKLAAVVLMTVIHLLL
FT                   GRYVRDFAADRNKRSHKFYRVINEIPTLLMVGAVIVVIVKPF"
FT   gene            491591..492856
FT                   /locus_tag="RPD_0428"
FT   CDS_pept        491591..492856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0428"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37666"
FT                   /db_xref="GOA:Q13E23"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E23"
FT                   /protein_id="ABE37666.1"
FT                   /translation="MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQL
FT                   SAKETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNTLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSAR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVSDKRTFPAIDISRSGTRKEELITDPQVLKKMYVLRRILNPMGTMDAI
FT                   DFLLDKLRNTKNNSEFFESMNT"
FT   gene            492960..494348
FT                   /locus_tag="RPD_0429"
FT   CDS_pept        492960..494348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0429"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37667"
FT                   /db_xref="GOA:Q13E22"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E22"
FT                   /protein_id="ABE37667.1"
FT                   /translation="MRMHPSDQTIFALATGQLPSAIAMVRVSGPRAGDLLTALTGSLPP
FT                   PRTARRVLIRDQNQDLIDDGVALWFAGPASATGEDVAEFHIHGGRAVLAALVRALSAFD
FT                   GVRPAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTEAQRRQAVRQLGGLLGDRARRWR
FT                   AQIIEATALIEAGIDFADEGDVQGELMAPALQTIAALHDEIAEVLAAQGRSERLRDGMV
FT                   VAIAGPPNVGKSTLINRLARREVAIVSPHAGTTRDVIEVQLDLGGYPVTVIDTAGIRES
FT                   NDPVEQEGVRRARARAAEADLVLWLGEGEMTGDAVAASAPVWRVRNKIDLRGGEGDGGP
FT                   VGLPVEPLAAALRQTDGAWGGNAAFEISALRGQGLGELIAAIEDFAAQYFASGETALIS
FT                   RARHRTLLQDAAAMLQRSLQHDLPAELVAEELRLAGVALGRLLGRVDVEDVLGEIFSRF
FT                   CIGK"
FT   gene            494578..496458
FT                   /locus_tag="RPD_0430"
FT   CDS_pept        494578..496458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0430"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37668"
FT                   /db_xref="GOA:Q13E21"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E21"
FT                   /protein_id="ABE37668.1"
FT                   /translation="MRNSYDVIVIGGGHAGCEAAAAAARLGATTALVTHRFATIGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
FT                   AMQAAIRATVHLSVIEGEADALLSADGRVTGIRLADGREFAAGAVVITTGTFLRGLIHL
FT                   GEQSWPAGRIDEAPALGLSRSFEALGFALGRLKTGTPPRLDGRTIDWGAVEMQPGDDPP
FT                   EPFSVLTPAITTPQIECGITRTTPATHAVIRDNVHRSPMYSGQIQSTGPRYCPSIEDKI
FT                   VRFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQRAILKTIPGLERTELVRPGYAI
FT                   EYDHVDPRELEPTLQTKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAVLAAGGGDPAV
FT                   FDRADGYLGVMIDDLVTRGINEPYRMFTSRAEYRLTLRADNADQRLTDKGLALGCVGAE
FT                   RAAFHRTKMAALADAKALAQSLSITPNEASRHGLSLNRDGQRRSAFDLLSYPEIGWDEV
FT                   KAIWPELAAVSPAIAVHVEIDAKYHVYLARQTADVEAFRRDEGLLLTEIDYAQVPGLSN
FT                   EARNRLERHRPRTVGQAGRLDGITPAALGILAAYLRREARKRPATVSGER"
FT   gene            497049..497750
FT                   /locus_tag="RPD_0431"
FT   CDS_pept        497049..497750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0431"
FT                   /product="methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37669"
FT                   /db_xref="GOA:Q13E20"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E20"
FT                   /protein_id="ABE37669.1"
FT                   /translation="MASRQSPMAVSQPDHADRSAALQLTPVSRETERRLDAYLDLLRQW
FT                   QAKTNLVAPSTLPQLWTRHVADSLQLLTLAPDARRWLDFGSGGGFPGIVLACAMAEHDG
FT                   GHVTLVERNAKKAAFLREALRVTGSPGTVMLADIGDNVDRFPQGLDCITARAVAPLHQL
FT                   IGFARPLMTEGSKALFLKGQDVEAELTEATRYWKIDPQLHASLTGGHGWIVEIDRIERQ
FT                   ALPTASKEAAQ"
FT   gene            497747..498601
FT                   /locus_tag="RPD_0432"
FT   CDS_pept        497747..498601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0432"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37670"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E19"
FT                   /protein_id="ABE37670.1"
FT                   /translation="MTVIDQIYQGDKASTEPGRPRIIALANQKGGVGKTTTAINLGTAL
FT                   AAIGERVLIVDLDPQGNASTGLGIDRRDRNCSTYDVLAGEAPLRDAVVATAVPRLHIAA
FT                   STMDLSGLELELGHSRDRAFRLRDAIAVLNKDVDPPLDYTYVLIDCPPSLNLLTVNAMA
FT                   ASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPELTIHGIVLTMFDSRNNLSSQVVA
FT                   DVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLKLATEVIQRERELR
FT                   TMH"
FT   gene            498870..499760
FT                   /locus_tag="RPD_0433"
FT   CDS_pept        498870..499760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0433"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37671"
FT                   /db_xref="GOA:Q13E18"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E18"
FT                   /protein_id="ABE37671.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEAAHVERPRAQRKVPIEFIKANP
FT                   RNPRRTFSDAELGELSDSIRQHGVIQPIVVRPVKGAQDRFEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDADALEIAIVENVQREDLNPLEEAQGYHALANEFKRSQDDIAKIVGKSRS
FT                   HVANMMRLTRLPDDVLALIAAGQLSAGHARALIGVPDPSAAAKRIVAEGLNVRQTEALA
FT                   HEEGVPERKPQKPRASAAAKPAKDADTLALEKRVSDALGMKVTIEDRDGTGSLQIRYAD
FT                   LDQLDDIIRRLEAGG"
FT   gene            complement(500113..501141)
FT                   /locus_tag="RPD_0434"
FT   CDS_pept        complement(500113..501141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0434"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37672"
FT                   /db_xref="GOA:Q13E17"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E17"
FT                   /protein_id="ABE37672.1"
FT                   /translation="MVALRGKDVTSFLARPDAARPIILLYGPDSGLVRERADALIASAL
FT                   DDPNDPFALVRLDGDELASEPSRLVDEAMSIPMFGGRRAIRVRAGSRSFVAGVETLAAS
FT                   PPRECRVVIEAGDIKPDNALRKACEKAPSAVAIGCYPDAEADLARLIDDELRHSNLQIG
FT                   RDARAVLMTLLGGDRQASRNEVRKLALYAHGQSEITLDDVMACVSDASDLKLDVIVDAA
FT                   FSGKPAVVESEFAKAMVAGTYPGQIILAAQRHAAFLHKTSLAVEAGAAAATALDSGFPR
FT                   LHFSRKAASETALRNLGAPRLAQIIDQLATAALETRRQATLGAAIAQRTLLSIAVSARR
FT                   RN"
FT   gene            complement(501189..501749)
FT                   /locus_tag="RPD_0435"
FT   CDS_pept        complement(501189..501749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37673"
FT                   /db_xref="GOA:Q13E16"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E16"
FT                   /protein_id="ABE37673.1"
FT                   /translation="MSSVRPAVARVFARLALAAMLAAPVAGCFQPMYADRGDGSPTLRD
FT                   KLAAVTVPPLDVPNGSRNARIGVEIRNALMFKMYGSATGAPPLYSLALNINSSRSSLIV
FT                   DPNTTLPTIENYGIDANYRLTEIATGKVVMSGSTFSRVEYDIPGQTQRFARTRAGRDAE
FT                   DRAAQEIAENINTRLASFFYAGI"
FT   gene            complement(501736..504372)
FT                   /locus_tag="RPD_0436"
FT   CDS_pept        complement(501736..504372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0436"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37674"
FT                   /db_xref="GOA:Q13E15"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E15"
FT                   /protein_id="ABE37674.1"
FT                   /translation="MSNERYNARESEPKWQAKWDEAKIFATRNDDPRPKYYVLEMFPYP
FT                   SGRIHMGHVRNYTMGDVVARTMRARGHNVLHPMGWDAFGLPAENAAIERKVAPKAWTYA
FT                   NIAAMKKQLQTMGLSLDWAREFATCDPTYYKHQQKMFLDFLKAGLAERETRKLNWDPVD
FT                   MTVLANEQVIDGRGWRSGAVVEQREMNQWVFKITRYAQELLDALETLDRWPDKVRLMQR
FT                   NWIGRSEGLLVRFALDSATTPAGETELKIFTTRPDTLFGAKFMAIAADHPLAQAAAAKD
FT                   PKIAAFVEDCKKRGTAQAEIDTAEKLGIDTGIRALHPFDPNWQIPVYVANFVLMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYQLGNTPVVCPEGQDPSSFVITDEAYDGDGRLINSRFLDGM
FT                   SIAEAKEDVAKRLETATLGNAPVGERKVNFRLRDWGISRQRYWGCPIPVIHCEVCGVVP
FT                   VPDKDLPVVLPEDVSFDKPGNALDHHPTWKHTACPQCGAKATRETDTMDTFVDSSWYFA
FT                   RFTDPWNENAPTTPDVVNRMLPVDQYIGGVEHAILHLLYSRFFTRAMKATGHVGLDEPF
FT                   RGMFTQGMVVHETYRKADGMFASPAEVAIVAEGDGRRATLLDDGTPIEIGPIEKMSKSK
FT                   RNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFVQRLWRMINDAAEI
FT                   AKAAPAARPDAFGPEALAVRKAAHGALDKVLSGIERLAFNVSLAHIREFSNSLGEALAR
FT                   PGAASPDVAPDLAWAIREGAVILVQLFHPMMPHLAEECWAALGQPGLVSEALWPQIERD
FT                   LLLEDSITLPVQVNGKKRGEVTVARDANNPEIEAAVLALDAVRQALDGKPVRKVIVVPQ
FT                   RIVNVVG"
FT   gene            complement(504585..506261)
FT                   /locus_tag="RPD_0437"
FT   CDS_pept        complement(504585..506261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0437"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37675"
FT                   /db_xref="GOA:Q13E14"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E14"
FT                   /protein_id="ABE37675.1"
FT                   /translation="MSRIAIIRKKSQLRGMLGIRARLVVLALILVCPLMLDRVRLLENT
FT                   RTTQIAAVADSVATLAQRATDAQREVISSVEAVLKSAAYIHAAASQIGRSCSILRASLR
FT                   VDLPSIRMLSVADSSGIIRCSTSSMFVGSDVSNRAYFRKAFETHDFVVSDFVIGQQSRQ
FT                   GTILAAYPVSAVDTGEEAVLIAGMNLDWLSDIMANLAGRPGINVALIDGEGTVLATPPD
FT                   HRSLIGRKLDQSTLDFALGARPLEREQATTSIDSGQTLSVSRIPGTNARLVVTLDENIV
FT                   SAAISRDIRTAYLQLALVCLLVLLGALIAAERLIVRPISVLTSIANQFAQGDWSARVTR
FT                   ARLPAEFLPLARAFNAMAAQLGQRERELVASNNSLTVMASMDLLSGLANRRGFQSRLDF
FT                   EWMRGLQNGHTVALLLLDVDYFKSFNDSYGHPEGDACLSRIGETLATVANDTGGFAARY
FT                   GGEEFCLLLPDTDADTAYQVGEMVRATVERLDVPHHTSLFQRVTVSIGVASTSPTEDAS
FT                   PAELIEAADAALYAAKGRGRNTVVEHGFIRATDTISMAIAS"
FT   gene            506433..507098
FT                   /locus_tag="RPD_0438"
FT   CDS_pept        506433..507098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0438"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37676"
FT                   /db_xref="GOA:Q13E13"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E13"
FT                   /protein_id="ABE37676.1"
FT                   /translation="MSGAEVHGLAAVEQEIAQACKEARRERGSVTLIAVSKTFDADSIL
FT                   PVLAAGQRVFGENRVQEAKAKWPALVAGHPGTELHLIGPLQSNKAKEAVALFDAIHSVD
FT                   RESLAEALSKALPLAGRAVELFVQINTGEEPQKAGVAPQDADAFLTACRERWGLTIAGL
FT                   MCIPPVDEAPAPHFALTAKIARRNGLSKLSMGMSADFATAIEFGATHVRVGSAIFGHR"
FT   gene            complement(507145..507714)
FT                   /locus_tag="RPD_0439"
FT   CDS_pept        complement(507145..507714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37677"
FT                   /db_xref="GOA:Q13E12"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E12"
FT                   /protein_id="ABE37677.1"
FT                   /translation="MKITFRSERYKNPTVDRPLSMLQVRAAAGQRSRGWLTAGGMTIPV
FT                   ALGRGGILANKREGDGGTPRGTFRPRRLWWRADRWPKPRTFLPVRPITAEDAWCEDPSS
FT                   RHYNRPLRRGPGEAGDRLQRADHLYDFIIEIDHNTTPRIAGRGSAVFLHLARDNFGPTA
FT                   GCVAMTRGNLLRLLARIGPNTKIVIG"
FT   gene            507883..508569
FT                   /locus_tag="RPD_0440"
FT   CDS_pept        507883..508569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0440"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37678"
FT                   /db_xref="GOA:Q13E11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E11"
FT                   /protein_id="ABE37678.1"
FT                   /translation="MPNARKILIVDDDTDLREALVEQLSLHEEFEASAVDTGAKGVQSA
FT                   KANSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFTVGPYSFRPGSKMLTGANAKKVRLTEKETAI
FT                   LRFLYRASQSPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            508696..509142
FT                   /locus_tag="RPD_0441"
FT   CDS_pept        508696..509142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0441"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37679"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E10"
FT                   /protein_id="ABE37679.1"
FT                   /translation="MSIEDDVALLERVPTLRLLGDTSLRMLAIGSDQREFARGDVLFSA
FT                   GDASDAGYVVQTGSFQVTSADGGPHEMIARPGDLIGELALVLPMPRPSSAVAMEYSSVV
FT                   RIARSLFQRVLESDPVAARNLRDEFAARTTMIAKDITRAGAKLT"
FT   gene            complement(509393..510451)
FT                   /locus_tag="RPD_0442"
FT   CDS_pept        complement(509393..510451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0442"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37680"
FT                   /db_xref="GOA:Q13E09"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E09"
FT                   /protein_id="ABE37680.1"
FT                   /translation="MMDARVKPAHDAVLDRTDGRVGRLYQDRHAGLDPAIHPLRKTPQQ
FT                   APGWLYTSAACVRSRAAQQTARSSQRRRPARNSPRLPMRFTLTTWNINSVRLRIDLVAA
FT                   FLKEQQPDVLCLQETKCPDDAFPLKRFKQLGYEHIALNGQKGYHGVAVISKIPFVARDI
FT                   RIFCDNLDSRHISVSLGTGDNDPPLVLHNFYVPAGGDVADPELNPKFKHKLSFLDEMKA
FT                   CEPLHPSGDARHILVGDLNVAPHEHDVWSHKQLLKVVSHTPVECEKLLAVLRAGNWVDV
FT                   ARDRIPLSEKIYTWWSYRAADWTVGDRGRRLDHIWVSEALRTRVTDFKILRDARSWERP
FT                   SDHVPVTVTMEL"
FT   gene            complement(510508..511455)
FT                   /locus_tag="RPD_0443"
FT   CDS_pept        complement(510508..511455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0443"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37681"
FT                   /db_xref="GOA:Q13E08"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E08"
FT                   /protein_id="ABE37681.1"
FT                   /translation="MEISERESRNRHSATVAAEGLGAGSAAPVQDITLTNDFNGLTPRP
FT                   AISTGLRRSLAAGVGLLMVTAAPLALAETVPVPRPSPKAVERQISTAEPSRPQRPPQPP
FT                   APVAKLATPPDPVIPDPRRNVPASIFTTFDAKQKADAARVSAYLSSLSTLVGNFVQVGP
FT                   DGSKLKGDFYIMKPGKVRFEYDEPSPISMVANGQSLVVRDRKLATQDIYPLSQTPLRYL
FT                   LSDRIDLLRDTSVVAITSDELYISIIIEEKNAVIGTSRLMLMLGVKDGQLKQWTVTDPQ
FT                   GYDTTVAIYNLDTARRPDPAMFKIDFTDYSTPPG"
FT   gene            complement(511473..513944)
FT                   /locus_tag="RPD_0444"
FT   CDS_pept        complement(511473..513944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0444"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37682"
FT                   /db_xref="GOA:Q13E07"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E07"
FT                   /protein_id="ABE37682.1"
FT                   /translation="MPAIERVIPLVGHLPASIRDALVRRLREFAGFGLIVIATVGAAAL
FT                   ATWSVQDPSLSHATSRKIHNLIGYPGAIGADLSMQILGLGAVGLLLPVATWGWRMINHR
FT                   PFDRRALRFAAWILCTIFAAGFASSFPHDSAWPLPTGLGGVVGDALVRAPSLVFGPGLI
FT                   FRVILSIVLGALMAVSFLIASGFGSREPDADDVIADDVPLDEDEDRDPGSVSLGWLTHA
FT                   ALSAKARLWRLMKLGYRGLVSSAPAGPAAASFERQEPRLGGGRVAPPIVPRDHLDDDDD
FT                   TLDLEPADAIEDEEDEAPVARAPRKKAAPKPAAKKSGRFELPSVNVLTAPKASDRQPLN
FT                   KAELEANSRALEGVLQDFGVRGEIVKAHPGPVVTLYELEPAPGIKSSRVIGLSDDIARS
FT                   MSALSARVAVVPGRNAIGIELPNAHREKVYLRELLSVKDGNETVHKLPLCLGKNIGGDS
FT                   IIIDLARTPHMLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYDGI
FT                   PHLLTPVVTDPKKAVVALKWAVREMEERYKRMAKLGVRNIDGYNTRLSEAKARGEDLTR
FT                   TVHTGFDKESGKAIYEEEKLDLEPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMARA
FT                   AGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLY
FT                   MAGGGRISRVHGPFVSDEEVEKVVKHLKTQGQPEYLEAVTAEEPAEGEDGAVFDATGMG
FT                   GDGAGDLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMELEGIVGQPNHAGKR
FT                   EILVAEEDSNF"
FT   gene            complement(513953..515191)
FT                   /locus_tag="RPD_0445"
FT   CDS_pept        complement(513953..515191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0445"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37683"
FT                   /db_xref="GOA:Q13E06"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E06"
FT                   /protein_id="ABE37683.1"
FT                   /translation="MALPASSASARAAGSPSAAGHSERSPFARLTELLAPYQPGERLIN
FT                   LSLGEPQHPVPDFVGPVLAQHIADFGRYPMAKGIAPFRNAAASWLAQRFALPRAPDPET
FT                   EVLVLNGSREGLFLAALAAARHVGPRDGTPAILMPNPFYPAYAAGARAAGCEAVFLPTN
FT                   LANGFLPDLESLDEATLKRTVAIYIASPANPQGSVASRDYFARLKALADRYGFLILADE
FT                   CYSEIYTRTAPGSALEAAGPDFRNVAVFQSLSKRSNLPGMRVGFVAGDADFLNAFHELR
FT                   NVAAPQVPVALQHVAVAAYGDEAHVEENRRLYRLKFDLADQILGERFGYQRPAGGFCLW
FT                   LDVSAHGGDEAATVKLFREGGVRVIPGSYLARPQPDGSNPGAGYIRLAMVQDSESTAEA
FT                   LHRLVRILDESRG"
FT   gene            515319..515588
FT                   /locus_tag="RPD_0446"
FT   CDS_pept        515319..515588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0446"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37684"
FT                   /db_xref="GOA:Q13E05"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E05"
FT                   /protein_id="ABE37684.1"
FT                   /translation="MRAPQEQAEVDMASRITSDGRVRIPKDILETLDVGPGGEVDFKRG
FT                   ADGAVVLEKVSQPSRRQIDWEKVIGSAGPGLSTDEVMKLLRGDD"
FT   gene            515593..516000
FT                   /locus_tag="RPD_0447"
FT   CDS_pept        515593..516000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0447"
FT                   /product="PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37685"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E04"
FT                   /protein_id="ABE37685.1"
FT                   /translation="MTLVDTNVLIDLVTADPNWLGWSAARINEAIDRGPLLINDVIYAE
FT                   ISTRFDQEEQLEVVLRTIGIVVAPIPRSALFLAGKAFVQYRRSGGVKTRVLSDFLIGAH
FT                   AATEHLSLLTRDARHYRTYFPNVDLITPDRG"
FT   gene            complement(516232..517674)
FT                   /locus_tag="RPD_0448"
FT   CDS_pept        complement(516232..517674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0448"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37686"
FT                   /db_xref="GOA:Q13E03"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E03"
FT                   /protein_id="ABE37686.1"
FT                   /translation="MTFKRPYGAGLAVLAAGLFAATAAYAEPTVNKGDNAWMMTSTILV
FT                   LLMTIPGLALFYGGLVRSKNMLSVLAQVFYTVCVGSIIWAVYGYSLAFTGGSDFIGGFS
FT                   KAFLAGITPDSKAATFSVDANISELIYVCFQMTFCTLTPALIVGAFAERTRFAAVALFI
FT                   PLWITLIYLPMAHMVWYWAGPDAISDAVKALAAATDEATKAAAQAKLDEVNADAGFLFK
FT                   KGALDFAGGTVVHINAGIAGLVGALLVGRRTGYGKELMAPHSLTMTMIGASLLWVGWFG
FT                   FNAGSALEASGGAGLAMANTFVATAAAALSWMFAEWIFKGHPSLLGALSGAVAGLVAVT
FT                   PAAGYSGPMGAIVLGLVAGVVCLFFCTVIKNALKYDDSLDVFGVHAVGGIVGALGTGIV
FT                   VNPALGGTGVYDYTLGKVAEYDLVNQMISQSWGVGTTLLLSGIGSAILYKVVDVIVGLR
FT                   APVEVEREGLDLVEHTERAYNM"
FT   gene            complement(517715..518053)
FT                   /locus_tag="RPD_0449"
FT   CDS_pept        complement(517715..518053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0449"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37687"
FT                   /db_xref="GOA:Q13E02"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E02"
FT                   /protein_id="ABE37687.1"
FT                   /translation="MKIVMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTEI
FT                   YRGAEYAVSFLPKIKIEVAIATDQVEKTIEAITTAAKTGQIGDGKIFVLGLDHAVRIRT
FT                   GEADAAAL"
FT   gene            complement(518377..518691)
FT                   /locus_tag="RPD_0450"
FT   CDS_pept        complement(518377..518691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37688"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E01"
FT                   /protein_id="ABE37688.1"
FT                   /translation="MMAAFVLMMSIPGLSLFYSGRQSPRPIWPPAPVRRPGARSPASAQ
FT                   SCPPAAMCKGHGDAGGVDQRPSGTAYVPLKLVGVFVALRVFREHEIKGLDISQHGEALQ
FT                   "
FT   gene            complement(519000..519338)
FT                   /locus_tag="RPD_0451"
FT   CDS_pept        complement(519000..519338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0451"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37689"
FT                   /db_xref="GOA:Q13E00"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E00"
FT                   /protein_id="ABE37689.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVDSALAEKAVEVITRSARTGQIGDGKIFVTPLDHALRIRT
FT                   GETDADAL"
FT   gene            complement(519615..520496)
FT                   /locus_tag="RPD_0452"
FT   CDS_pept        complement(519615..520496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0452"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37690"
FT                   /db_xref="GOA:Q13DZ9"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ9"
FT                   /protein_id="ABE37690.1"
FT                   /translation="MPLSKSLIDLISILDLEPIEVNLFRGTSPKTSWQRVFGGQVIGQA
FT                   MVAGCRTVENRLPHSIHCYFILPGDPQVPIIYQVERLRDGKSYSTRRVTAIQHGQAIFS
FT                   VMMSFHDDEETAFDHQDKMPDVPPPEALTAEEISKQPFFKEMPDFIKRYYEADRPIELR
FT                   PVELSRYFGKKIEDGRIHVWIRTAAKLPDDPALHMCALAYASDFSLLDAVMARYGRTLF
FT                   DKRMMPASLDHAMWFHRPFRADEWLLYAQDSPSAQGGRGLTRGQIFKPDGTLVASVAQE
FT                   GSIRQRRDTPKD"
FT   gene            520635..521954
FT                   /locus_tag="RPD_0453"
FT   CDS_pept        520635..521954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0453"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37691"
FT                   /db_xref="GOA:Q13DZ8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ8"
FT                   /protein_id="ABE37691.1"
FT                   /translation="MSGRTAAVITTAVPACFAQLRHGRKNSGARARKMTAPRSIVIGGG
FT                   AFAGLALALALRQGLGPEVPVIVADPALALRPSRDPRATAIVAACRRLFEALGVWDEVA
FT                   PTAQPIIDMVVTDSALEDATRPVFLTFAGEVQPGEPFAHMVENKYLIEALAKRAEAEGV
FT                   ELRATPVTSYQSRAEATMVTLGDGSVIEASLLVAADGAKSKLRERAGISTYGWDYDQTG
FT                   IVVTVAHERDHNGCAEEHFLPAGPFAILPLTGKRSSLVWSESRADAAKIMALPDAQFQA
FT                   ELEKRFGLRLGEVKPLDKPKAFPLGYFVAQSFIAPRLALIGDAAHVIHPIAGQGLNMGL
FT                   KDVAALAEVVVDAARLGIDPGQVDVLERYQRWRRFDTMAMGVATNGLNLLFSNKSPLLR
FT                   SVRDIGLGIVDRLPPLKEVFIRQAAGLGGETPRLLKGEAL"
FT   gene            complement(522175..522372)
FT                   /locus_tag="RPD_0454"
FT   CDS_pept        complement(522175..522372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0454"
FT                   /product="protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37692"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DZ7"
FT                   /protein_id="ABE37692.1"
FT                   /translation="MTTSSERPETSVDRKLLEILVCPVTKGPLEFDAARQELISRGAKL
FT                   AYPIRDGIPIMLPEEARKLG"
FT   gene            complement(522466..523140)
FT                   /locus_tag="RPD_0455"
FT   CDS_pept        complement(522466..523140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0455"
FT                   /product="peptidase S16, lon-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37693"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ6"
FT                   /protein_id="ABE37693.1"
FT                   /translation="MPINADYRGPADLPEVIALFPLPGALLLPRGQMPLNIFEPRYLAM
FT                   IDDAFRDGHRLIGMIQPDATHSEKDGTPKLFQVGCVGRITQLAESGDGRYILELTGVSR
FT                   FKLVEELSVKTPYRQCKVDYFPYLDDFTARKGEDEVDREALLTVLTDFLKANNLKVDWD
FT                   GVETAPNEALVNALAMMSPYGAPEKQALLEAPDLKTRAEILIAVTEMDLAKKRTSGDPP
FT                   LQ"
FT   gene            complement(523270..524190)
FT                   /locus_tag="RPD_0456"
FT   CDS_pept        complement(523270..524190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0456"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37694"
FT                   /db_xref="GOA:Q13DZ5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ5"
FT                   /protein_id="ABE37694.1"
FT                   /translation="MTIIEQGSAAAPQAAPDLIKDTTTQSFVRDVIEESKRQPVLIDFW
FT                   APWCGPCRQLTPMLEKAVRAAGGKVKLVKMNIDEHPSIPGQMGIQSIPAVIAFVDGRPA
FT                   DGFMGAVPESQVATFIEKLTAGVPGGAPSAAELLQEAEAVLAEGDPATAGAIYAEVLQA
FT                   DAANVEAMAGLARCYMQSGAVDQAKQLLDQVPENRREDAAVKAVQAMIDLAEQAEQLGP
FT                   IAELEQKVAADPLDHQARFDLATALNAAGRRDEATAHLLEIVKRDRKWNEDGARKQLVQ
FT                   LFEAWGPTDDATVEGRKRLSTILFA"
FT   gene            524502..524576
FT                   /locus_tag="RPD_R0014"
FT                   /note="tRNA-Gly1"
FT   tRNA            524502..524576
FT                   /locus_tag="RPD_R0014"
FT                   /product="tRNA-Gly"
FT   gene            complement(524645..525583)
FT                   /locus_tag="RPD_0457"
FT   CDS_pept        complement(524645..525583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0457"
FT                   /product="LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37695"
FT                   /db_xref="GOA:Q13DZ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ4"
FT                   /protein_id="ABE37695.1"
FT                   /translation="MRFDLIDLRLFVNIVQSGSITRGAEASHMALASASERVSGMESLL
FT                   GTPLLRRERRGVAPTAAGRALLHHARSVTLQIERMRGDLRAFSAGMRGEVRMLSNTAGL
FT                   VDLVPAALRRFLTAHPNVDVDLEERTSMEIVQAVAEGQAEFGVIAGTADPGALDIRTLI
FT                   VDRLAVLAARTHPLAAREAVGFAELLDERFVGLGAGALHDHLQQHAAQLGRRIAYRVRL
FT                   SSFEAVARLVEAGVGLAILPMSAIDRHPADDVTAIALTDAWSQRQLLVCAIDFGELTTH
FT                   ARLLVEELQRQAGKLDDHLGPSPVTAGPQSP"
FT   gene            525665..526414
FT                   /locus_tag="RPD_0458"
FT   CDS_pept        525665..526414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0458"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37696"
FT                   /db_xref="GOA:Q13DZ3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ3"
FT                   /protein_id="ABE37696.1"
FT                   /translation="MSEVFLLIGAGALAGAMNATAGGGSFVTLPALIGVGVPSVLANAS
FT                   STIALYPGGLASAWVYRDGFSRVAGVPLGTMLLTTLFGGLIGALLLLWTPTSLFDRVLP
FT                   WLLLLATLALAFGRRLGPALRARFRTGIVTLLVIQFLLGVYGGYFGGAVGLMMMAAWNL
FT                   LDGADVKALNPPRTLLVSAANTVAVICFIVAGAVRWPEALLVGAGAILGGYFGAILGKA
FT                   LPSSVVKSATVLLAAAMTIHFFLRAYA"
FT   gene            complement(526524..527306)
FT                   /locus_tag="RPD_0459"
FT   CDS_pept        complement(526524..527306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0459"
FT                   /product="histidine kinase, HAMP region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37697"
FT                   /db_xref="GOA:Q13DZ2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ2"
FT                   /protein_id="ABE37697.1"
FT                   /translation="MQFDLSNRNLSQKISILVLGITFFVALAIGGVGEMILHKVGADQA
FT                   KQSASVASLDRLVGLGGATLSPVRAADGSIVGMLVMQQDAGPVVMPASYEGQGLVVQAA
FT                   ETVAAPAADYALSAAHTMLLLAGIVVFAVVGLVGTRISRGLLAPLGELEKDVARLASGD
FT                   TSIRIHALSRSDEIGRIARSIAKIQESLIELARLKTQKVVGGATSVMENLKEMWGDLKS
FT                   AARNAREMLFTDGRTVGETLTRSWNDWVHNGLGVPKRA"
FT   gene            528003..528995
FT                   /locus_tag="RPD_0460"
FT   CDS_pept        528003..528995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0460"
FT                   /product="putative photosynthesis gene regulator, AppA/PpaA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37698"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ1"
FT                   /protein_id="ABE37698.1"
FT                   /translation="MIQSKDGLSFPGLPRRCGNGAAGFATSRDRRTGAPGTPICFPLGS
FT                   FAGPGQSSFPFPAIRGQPDRVRAVHPESIVSTVIPHLLVKHSAAPKRVRIAKDPAEARA
FT                   DELARLLIAPNLADAFDLIDSSLTRASSPTALFTGLFEPTARKLGDLWSEDACSEFEVT
FT                   IGLCQLQTAMRRISFDLLSAPLTRSQPRTVLVISQPGEPHSFFPALHSELLRQAGWNTV
FT                   SEFPDTDKALSDLVANGWFDAVNLSLSPALRREHWLPRVAETIRKVRRASRNPALAVVA
FT                   SGRVFAERADACTMVGADAATVSSVQIERCLMRSLLNRTARPAANFAWI"
FT   gene            529350..530435
FT                   /locus_tag="RPD_0461"
FT   CDS_pept        529350..530435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37699"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ0"
FT                   /protein_id="ABE37699.1"
FT                   /translation="MPPEGKSYPFDHLPAIDYDAHPAYGRVMSMPMLGARLKALSIFGY
FT                   GFLLTSAQRAIDVEHLPRPAQGGKPLITVLRGLPTYLRLILLQRLSRFTAGRAYAPKTE
FT                   RGTAVFVPLQGDGFAVVRLGNDVIAQIRTQLAPQLKTLEQRATPAGDPDSSRIWVDPVS
FT                   APDLYRWFNQTAADLGLTEAASAYLKRPVGVGHIAAEVVDAPGAPPASPFADVGVDVSP
FT                   CDGFKVDLGYNAMKLVIYLDEVGPANGPLTYVAGSNRAATRFGDALIRRANDLSGLSSR
FT                   LQAWRETFYALPAGLQRKASFGADLVADSNFATAIQSHQVAVTSSEGNAVLYDPAGIHR
FT                   DAAPTQGRRTAVIVRFTELSR"
FT   gene            complement(530582..531880)
FT                   /locus_tag="RPD_0462"
FT   CDS_pept        complement(530582..531880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0462"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37700"
FT                   /db_xref="GOA:Q13DY9"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY9"
FT                   /protein_id="ABE37700.1"
FT                   /translation="MTPDDIAGFYAKRSDLNLDDYIELDFDFECAGDPREAAAHLCSEQ
FT                   STAQWRRVGVDEDFRPRFAAKVLELHAEPRPSGFSTPVECAVRGEVHACRVTIAHPHGN
FT                   FGPKIPNLLSAVCGEGVFFSPGIPLIRLQDIRFPDSYLAAFAGPQFGVAGLRERLKAFD
FT                   RPIFFGVIKPNIGLSAEPFAELGYQSWLGGLDIAKDDEMLADVDWCPLAERAALLGDAC
FT                   RRAEAETGVPKIYLANITDEVDRLIELHDLAVSNGAGALLVNAMPVGLSAVRMLRKHAT
FT                   VPLIAHFPFIAAFSRLANYGIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVMDCVR
FT                   ACLEPMGPIKPCLPVPGGSDSAATLESVYRKVGCADFGFVPGRGVFGHPMGPAAGAASI
FT                   RQAWDAIASGIAVSDHAARHPELAAALRAFGGR"
FT   gene            complement(532026..532454)
FT                   /locus_tag="RPD_0463"
FT   CDS_pept        complement(532026..532454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0463"
FT                   /product="protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37701"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY8"
FT                   /protein_id="ABE37701.1"
FT                   /translation="MNIVRHRIELATTAPIQIIDITEQVRGFVAGSGLGDGLVTVSCLH
FT                   TTARINVNEREPQLERDMLTFLKRFAPRDGDYLHNLAPIDGRDNAHSHLIGLFMNSSET
FT                   IPLAGGAMVLGEWQSIFFIELDGPRERRGVELQIIGQV"
FT   gene            532736..534718
FT                   /locus_tag="RPD_0464"
FT   CDS_pept        532736..534718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0464"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37702"
FT                   /db_xref="GOA:Q13DY7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY7"
FT                   /protein_id="ABE37702.1"
FT                   /translation="MRPTYRSDIDGLRAIAVLLVVAFHAFPNSVRGGFVGVDVFFVISG
FT                   FLITSIICQAQHSDGFSFRTFYARRINRIFPALALVLTVCAVAGWFMLFPVDYRDAGKA
FT                   IGFGAAFLSNLALLHDAGYFATTSELNPLLHLWSLGVEEQFYILWPPVIVLAWRWKRGA
FT                   LIAALVILLASFAANILLTPRNALAAFYLPVTRFWELMAGCLLAIIATAGPGRDISSIA
FT                   ALDRLRAMLERHEALLRAGCAWFGLLLLAAGAVLISSDRGFPGWWAALPVLGAALLIFA
FT                   GPSPWVNRLLLGNRAMVYVGLISYPLYLWHWPLLAAIRIVRFGEEPPPLMKAIAILLAF
FT                   ALADITWRFVERPFRFRPTRSKTAAAFASVAVIGAVGAGIYAADGFPSRFGPELQAITR
FT                   DLTAEASTAYRAGACFLTSESHFAEACDDNAPADAPRLLLWGDSHAAHLYPGLRALQIA
FT                   DGNIRLSQYTTAGCPPMFGFASEKSPACAANNAIVRARLSSLKPDTVIMVARQWRDYDG
FT                   PDRDPQASDAMIRATIAEVRAAGVRRIVVVGMFPSWRTPPRRILAQSYRQHAAGLITAD
FT                   AIPIRDRSGHLDSSRADDNERLRRIFEAEGAAFISPTPVFCNPDGCLLAAPDSGGTPVV
FT                   HDGSHLTAAGSVFFARETAPAILGR"
FT   gene            complement(534811..535989)
FT                   /locus_tag="RPD_0465"
FT   CDS_pept        complement(534811..535989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0465"
FT                   /product="putative AlgJ protein, required for O-acetylation
FT                   of alginate in Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37703"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY6"
FT                   /protein_id="ABE37703.1"
FT                   /translation="MAAATTRAGQWLRRLAAAAVLLMPVLTLWNIAVPSRAFNIGPSLI
FT                   GVTKQTPLDLSLRAFLDGTLQKTAAIRIAEAMPLRRTLIRLNNQIAYSLFGEVNAPGIL
FT                   AGVGGQLVERSYLEEYCTRSDGDADRLADTVVPLLRNLQAYYRDRGAIFLYVVTPSKVA
FT                   HLPQHFVHLISCRSTDAARVELVPRYVARLRAAGIDVVDAATSTHALKGQYPVELFPRG
FT                   GIHWNDQAMARASQQIVEAVNRQAGRELLPQFDFTSTVSLPPEGRDRDLAELINLLVSP
FT                   LDYATPKLTFSNPPCAGQPARTIDAAIVGGSFMDAVGEVLTESACMARLSQYFYLKLGR
FT                   YGGTRRQLIQENLSDSDLQRLRDVDIMLLEENESAIGRQGYLTLLHHIVTDK"
FT   gene            complement(535992..537404)
FT                   /locus_tag="RPD_0466"
FT   CDS_pept        complement(535992..537404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0466"
FT                   /product="membrane bound O-acyl transferase, MBOAT"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37704"
FT                   /db_xref="GOA:Q13DY5"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY5"
FT                   /protein_id="ABE37704.1"
FT                   /translation="MLFYEPLFLTCFPFLLVLYFAAGDARSKRWILLTGSGLFYLWGEP
FT                   LFVPVVVVSALVDHLLALRITRTPNAATRRALLTLGVVQNLAILVIYKYTSFAIESLNL
FT                   LLAAGRLGALPLWQIALPIGVSFVAFEKITYLVDSYRGVSKPARRFSDYCLFVFFFPKL
FT                   LAGPILKYHEIDGQIAAPRGFAWNDFGYGLLRFSRGIFKKLMIADPLGGYADQVFGADP
FT                   AGLSAATAWFGVACFTLQIYFDFSGYSDMAIGIARMLGFSLRENFNLPYIARSITDFWR
FT                   RWHISLTTWIRDYLYIPLGGNRVSDLVTTRNLWICFLLSGLWHGASWNFVLWGAYNGLF
FT                   LTLDRLFLERALKRSGAVVATLLTLLIVMIGWVIFRSPSAAHLGSFFAALAGLGQSTTT
FT                   LTPAASVIWTAALGAALSLIPALPGFAALRAAWQGGAVLRLAGNIGLGLLGIVAIARAV
FT                   AIPFQPFIYFRF"
FT   gene            complement(537564..537639)
FT                   /locus_tag="RPD_R0015"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(537564..537639)
FT                   /locus_tag="RPD_R0015"
FT                   /product="tRNA-Thr"
FT   gene            complement(537900..539666)
FT                   /locus_tag="RPD_0467"
FT   CDS_pept        complement(537900..539666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0467"
FT                   /product="HemY-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37705"
FT                   /db_xref="GOA:Q13DY4"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY4"
FT                   /protein_id="ABE37705.1"
FT                   /translation="MLRIILFLVIIALAAAGAAWVAEQPGDVVLSWNDWRAEMRLPVFV
FT                   LGLGAAIVSIVLAWAIITGLWRAPSRMKRGRFERRSGRARHAITQGLLAVGHGDAAAAR
FT                   NHASAARRHAPHDPLALLLQAQSAQLEGDRDGARRAFLAMAGRDDTKSLGMRGLYIEAQ
FT                   RADDPYGALAIAEEALRLQPNSTWASQAVLGFRCARADWSGALDILETNLSSGLVDKKV
FT                   FRRQRAVLLTARAIDLEDSDESLARDSALEANKLAPTLIPAAVLAAKCLAETHQVRRAM
FT                   KVIEAAWQAQPHPDLAAAYANIKPGDPANIRLARVQNLIAKNPADFESALAIARAGIDA
FT                   GEFSRARRALQPFIDNPTQRVAMLMAEIEHGERGDTAKARAWTLRAVRALPDAMWTADG
FT                   YTSDHWRPVSPVTGRLDAFQWQVPIAALPARKAVVIEDNPFHDALIASSATEALPAANA
FT                   HDPVTVTIESVVETTVVAPKQAEATVVTVEPEAAADKPKDQKGSSRGGATKDAGKSAPE
FT                   APVAASETVIAMPSTPLFHRRPSQATPPVIPIVRAPDDPGVDEEAAPGDFTEQSAAPAG
FT                   QTGNWRGYRPPR"
FT   gene            complement(539674..541113)
FT                   /locus_tag="RPD_0468"
FT   CDS_pept        complement(539674..541113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37706"
FT                   /db_xref="GOA:Q13DY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY3"
FT                   /protein_id="ABE37706.1"
FT                   /translation="MVKNRPGHENTQHEKDPRENAASVGASDAHPEQAAEVDVDAPIEA
FT                   LALNPVEPTAEELRDDPALELSAEHRQQDVIDAEPLPETATDDPPETRFASTSDKAEEA
FT                   AARSAAAAEPRRPGIVAAMLPPVLAVAIAAAVVVGAAKTGLLPQFLSSTSVSAPEGDVA
FT                   AIDALKARIADLEARPTPTGSNTAAATPAAAADPALAGKVDALEKTVAALRDDLATLRD
FT                   RSEQLASALKEVKAAPSEPTATASEPPAMASTDKTPPDKAAADKAATDSAAALAAINAR
FT                   LTELEHAAKTATEAAPQAPQPAVVSDDAPLRRLVTATMLDLTVKQGAPYAAILKAAEPL
FT                   ATETGALKPLEPFAATGVPAAAALGRELIALLPKLLSGAEGASNANFIDRFQSNAERLI
FT                   RIQRSDATAGIDRTAIVGRITAAAQRGDLAEARRELKALAPADRAPVQSWIDKSEARDQ
FT                   ALAASHSFATAALAALQKPSP"
FT   gene            complement(541174..541917)
FT                   /locus_tag="RPD_0469"
FT   CDS_pept        complement(541174..541917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0469"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37707"
FT                   /db_xref="GOA:Q13DY2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY2"
FT                   /protein_id="ABE37707.1"
FT                   /translation="MAMLVTRPQPDNDATAAALRAKGYDVLLAPMLRFEPLPFPDDQDT
FT                   ITTGVIVTSANALRAIEHQPGFARLLKLPLFAVGKHTARAARDAGFQDVVVADGDAARL
FT                   RLKVSDSVRGKKKTEGTLLYLAGADLSRDLAGELREDGFNVVMQTTYRMAPVPTLPASV
FT                   CDAFAAHRIEAVLHYSRRSARAFIDATRESGIEISALAIPQCCLSETVSEVVREAGATQ
FT                   VTVARTPDEPALFEALDRAIGAPAR"
FT   gene            542016..543185
FT                   /locus_tag="RPD_0470"
FT   CDS_pept        542016..543185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0470"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37708"
FT                   /db_xref="GOA:Q13DY1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DY1"
FT                   /protein_id="ABE37708.1"
FT                   /translation="MIAFRDPAMLREARRTLVRPQTQGLNLTSEQTLLVLGIETTCDET
FT                   AAAVVERRADGSGRILSNIVRSQIDEHAPFGGVVPEIAARAHVDLLDGIVANAMREAGT
FT                   GFAQLSGVAAAAGPGLIGGVIVGLTTAKAIALVHNTPLIAVNHLEAHALTPRLTDATEF
FT                   PYCLFLASGGHTQIVAVLGVGDYVRLGTTVDDAIGEAFDKIAKMLGLPYPGGPQVERAA
FT                   ASGDAARFAFPRPMLGRPDANFSLSGLKTAVRNEASRLTPLEPQDINDLCAGFQAAVLD
FT                   SMADRLGAGLRLFRERFGAPKALVAAGGVAANQAIRRSLREVAAKAQTTLMVPPPALCT
FT                   DNGAMIAWAGAERLALGLTDTMDAAPRARWLLDANATAPGKFANTRAGF"
FT   gene            543222..544211
FT                   /locus_tag="RPD_0471"
FT   CDS_pept        543222..544211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0471"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37709"
FT                   /db_xref="GOA:Q13DY0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DY0"
FT                   /protein_id="ABE37709.1"
FT                   /translation="MSAFNSISVLGGGAWGTALALTAARAGRSVTLWEHDPGHAQHLEQ
FT                   TRESRFLPGVMLEPSIKVTRDLAEAARAEALLLVVPAQVLRSVATSLQPLIAARTPLIA
FT                   CAKGIEHGTHRFMTEIIAECAPNAIPAILSGPSFAADVARGLPTAVTIAASDAAIAQAL
FT                   AQAMNSGSFRPYHSTDVRGVELGGATKNVMAIAAGIVAGRKLGASALAAMTTRGFVELV
FT                   RFGKAYGARIETMHGLSGLGDLTMCCSTPQSRNFSFGMALGRGESIDEAAHGKLAEGYY
FT                   TAPVLLEMAQAKGVEMPISTAVAAILQGQLGVDAAIEGLLTRPLKAEE"
FT   gene            544215..544628
FT                   /locus_tag="RPD_0472"
FT   CDS_pept        544215..544628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0472"
FT                   /product="protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37710"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX9"
FT                   /protein_id="ABE37710.1"
FT                   /translation="MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKK
FT                   GDRAFFYHSNEGKEIIGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAE
FT                   PRLAEMALLKYSRLSVQPVTADEWKLICKMGGL"
FT   gene            544799..545476
FT                   /locus_tag="RPD_0473"
FT   CDS_pept        544799..545476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37711"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX8"
FT                   /protein_id="ABE37711.1"
FT                   /translation="MSSTSAIADPIAFIRANTRLRPVPLVPEVMLHVADEALPLWSKTE
FT                   EELGEAGLPPPFWAFAWAGGQALARYLLDHPETVAGRDVIDFASGSGLVAIAAMKAGAR
FT                   RVTAFDIDGFAREAIAVNAAANGVAIAVSGDDLLAAPHVAPAQTVLAGDIFYQSDIAEL
FT                   AFGFLQNRADGGAFVLIGDPGRYYLPKDKLIQLASYGVPVTRELEDAEIKATGVWTLKQ
FT                   PVR"
FT   gene            545958..547910
FT                   /locus_tag="RPD_0474"
FT   CDS_pept        545958..547910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0474"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37712"
FT                   /db_xref="GOA:Q13DX7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX7"
FT                   /protein_id="ABE37712.1"
FT                   /translation="MSEKIYDVPSEWASRAFVDDAKYREMYARSVSDPNGFWAEQAKRL
FT                   DWIKPPHKIENCSFAPGNVSIKWFEDGVLNVAHNCIDRHLHTRGDQVAIIWEGDDPSQS
FT                   RKITYRELHDEVCKFANILRNRNVGKGDRVTIYLPMIPEAAFAMLACARIGAIHSVVFA
FT                   GFSPDSLAQRITDCQSKVVITADEGLRGGRKVPLKANVDAALAKCGGVDWVVVVKRTGA
FT                   AVEMDDVRDFWYHEAAEMVTTECPIEPMHAEDPLFILYTSGSTGQPKGVLHTTGGYLVF
FT                   AGMTHQYVFDYHDGDVYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSRFW
FT                   EVIDKHQVNIFYTAPTAIRALMQAGDEPVKKTSRKSLRLLGSVGEPINPEAWEWYHRVV
FT                   GDDRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVVPEILDPEGVVLEGECT
FT                   GNLCLARSWPGQMRTVYGDHARFEQTYFSAYKGKYFTGDGCRRDADGYYWITGRVDDVI
FT                   NVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMAGIEPSEELRKEL
FT                   VAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDEPSTLGDTSTLADPAVV
FT                   DDLVEHRQNKHHKAV"
FT   gene            548292..548819
FT                   /locus_tag="RPD_0475"
FT   CDS_pept        548292..548819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0475"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37713"
FT                   /db_xref="GOA:Q13DX6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX6"
FT                   /protein_id="ABE37713.1"
FT                   /translation="MSFGFRSAKTAGAVAALASAFVLTAPDAQARPDLVSFRGDYSPGT
FT                   IVVKTNERRLYLVVEPGQAVRYPVGVGKAGKRWEGVTKIDGKYRNPAWSPPADVKRDNP
FT                   AIPDVIPGGTPENPMGVAAMTLAGGEYAIHGTNRPNSVGGFVSYGCIRMLNDDISDLYQ
FT                   RVSVGTQVLVTR"
FT   gene            complement(548928..551021)
FT                   /locus_tag="RPD_0476"
FT   CDS_pept        complement(548928..551021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0476"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37714"
FT                   /db_xref="GOA:Q13DX5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX5"
FT                   /protein_id="ABE37714.1"
FT                   /translation="MRRLRLALLATTAITLWQAASLPARADTALMLMAQAAPAPDKGDE
FT                   KDRKGPPPGERKGPPPGAAPSQAPPPAAAPQPRPAPPPAAAPAPRAEPPAAPRAEPPPR
FT                   PAPPPAPRAEPPAAPRAAPPPPPPAAAPPRPPAPPAEKSAPRVEPPAPPRAAPPPPPPA
FT                   AAPPKPSAPPAADKGAAPPPAATPPRPSVPPAADKGAAPTPPPAAAPQRQPAPADRLAP
FT                   ADKGGAPSQRPTPPAAGQIGAPPAAGSPPPAAQTPPPAAGQTSAPTTPPPAGQPPAAQT
FT                   GAPAQPPAGQPPAAQKDVTPPAAGQIGTPTPAAPTPATPTQPPAGQTTAPVPGTIGPQG
FT                   AQPGAAGALPPGAPVARTPPPTVTAPIPAAPPPAQALTPIAPGAAPQGPRNITDFRSER
FT                   REVQQGGRTVITEPGRIIVRDPNGQEFIRHNEMDRFRYGARNIRTEKIRGGDTRTIVLR
FT                   PDGSEIINVTGGDGQLLRRIRRDRQGREIIIIDNSFGPRDRANFYVDLPPPVLRMPRDR
FT                   YIVDYEDASPELIYETLDAPPVERIQRRYSMDEIRYSPSVRQRMPSIDLNTITFELGSW
FT                   DISPDQASKLQAIADGLNRSISRNPREVFLIEGHTDATGNDTDNLSLSDRRAESAAALL
FT                   TQQFAVPAENLTSQGYGEQYLKVQSDGPERQNRRVTVRRITPLLNGGQASLPPPPPGTA
FT                   PRR"
FT   gene            complement(551564..552052)
FT                   /locus_tag="RPD_0477"
FT   CDS_pept        complement(551564..552052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0477"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37715"
FT                   /db_xref="GOA:Q13DX4"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX4"
FT                   /protein_id="ABE37715.1"
FT                   /translation="MAADTNQGDAQHAWDLMKKITFAMLATRDGEKLRSRPMAAYIRPE
FT                   EGAIYFLTDVRRHKDDEIAQDHHVNLGFADSSAQKYVSVSGYGTISNDRAKIKELFGTA
FT                   AKAWWDSPDDPNIRILKVTPEEAEYWDSPGTLVSYVKMAVAAATGSRPDLGENRKVAI"
FT   gene            complement(552188..552970)
FT                   /locus_tag="RPD_0478"
FT   CDS_pept        complement(552188..552970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0478"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37716"
FT                   /db_xref="GOA:Q13DX3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX3"
FT                   /protein_id="ABE37716.1"
FT                   /translation="MVEFALPKNSKIVGGKAWPKPEGATEVREFRVYRWNPDDGNNPSI
FT                   DTYYVDKHDCGPMVLDGLIWIKNNIDPTLTFRRSCREGVCGSCAMNIDGENTLACTKAM
FT                   DDVRGDAVKVTPLPHQPVVKDLVPDLTNFYAQYASIQPWLQTVTPTPQKEWRQSHDDRE
FT                   KLDGLYECILCACCSTSCPSYWWNSDRFLGPAALLQATRWVEDSRDEATGERLDNLEDP
FT                   FRIYRCHTIMNCAKACPKGLNPSEAIASLKLKLVERQI"
FT   gene            complement(553099..554922)
FT                   /locus_tag="RPD_0479"
FT   CDS_pept        complement(553099..554922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0479"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37717"
FT                   /db_xref="GOA:Q13DX2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX2"
FT                   /protein_id="ABE37717.1"
FT                   /translation="MAANGNGAPAVNGHAYPIEDHVYDVVVVGAGGAGLRAVVGCSEAG
FT                   LRTACITKVFPTRSHTVAAQGGISAALGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMV
FT                   RNAPEAVYELEHWGVPFSRTEEGKIYQRPFGGMTMEFGKGQAQRTCAAADRTGHAMLHT
FT                   MYGQALRHAAEFYIEFFAIDLIMDDQGCCRGVIALKLDDGTLHRFRAQTTILATGGYGR
FT                   AYASCTSAHTCTGDGGAMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVN
FT                   SEGERFMERYAPSAKDLASRDVVSRAMTIEMREGRGVGKKKDHIFLHLDHLAPEVLAER
FT                   LPGISESARIFAGVDVTREPIPILPTVHYNMGGIPTNFRGEVVTKKEGDDNAVVPGLMA
FT                   IGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCAEKLTINGKQPELPADSADGTLSRL
FT                   DKYRYASGGTPTAKLRESMQQVMQNNCAVFRTGEVLSEGKDLIRKVHGGVGDIGVSDRS
FT                   LVWNSDLVETLEFDNLIIQAVVTMNSAANRTESRGAHAREDFPDRDDKQWMKHTLAWIG
FT                   DDGDTTIDYRPVHDYTMTNDVQYIPPKPRVY"
FT   gene            complement(554926..555348)
FT                   /locus_tag="RPD_0480"
FT   CDS_pept        complement(554926..555348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0480"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37718"
FT                   /db_xref="GOA:Q13DX1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX1"
FT                   /protein_id="ABE37718.1"
FT                   /translation="MSGEESHGATRRQAASMRTPMGKVRKLGPAGSGTSDFWQQRITGV
FT                   AMTLLTLPVVVVVMMLLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDY
FT                   IQNEKLKLVTVMANNFFTIAVALAAIFAIFKLASGV"
FT   gene            complement(555345..555734)
FT                   /locus_tag="RPD_0481"
FT   CDS_pept        complement(555345..555734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0481"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37719"
FT                   /db_xref="GOA:Q13DX0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX0"
FT                   /protein_id="ABE37719.1"
FT                   /translation="MIDRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWWLIA
FT                   CAAGPASYANLQAFTGSWIGRLILFGYTWSLMHHLLSGVRHFVWDLGYGFKTADREWLT
FT                   WAALIGGVVLTVLFWVIAFSMGVAR"
FT   gene            555966..557084
FT                   /locus_tag="RPD_0482"
FT   CDS_pept        555966..557084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0482"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37720"
FT                   /db_xref="GOA:Q13DW9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW9"
FT                   /protein_id="ABE37720.1"
FT                   /translation="MSLSKGIELLQARTKRAPRHSPGPLLRAILSTTAFAPHRNEVVAP
FT                   HPSPMTQIHDHDHHASASEQGHNHGHAHGPGGHVHAPKDFGRAFALGIGLNIAFVITEA
FT                   AFGWLGNSMALLADAGHNLSDVLGLAVAWIAAELSKRPPSQRYTYGLRGSSILAALFNA
FT                   VFLLIAVGAIGWEAIARLFAPEPVGSVTMMVVAGIGILINGATAWLFFSGRDNDLNIRG
FT                   AYLHMVADAGVSAAVVVAGVVILFTGWNWIDPAVSLAVAFVIIWGTWGLLRDSTAMSLD
FT                   AVPPGIDPVAVRAFLESRPGVAQVHDLHIWSMSTTEVALTSHLVMPGGSPGDAFLIEIA
FT                   HELQHDFGIAHTTVQIETDPNTVCALAPDHVV"
FT   gene            complement(557384..558895)
FT                   /locus_tag="RPD_0483"
FT   CDS_pept        complement(557384..558895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0483"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37721"
FT                   /db_xref="GOA:Q13DW8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW8"
FT                   /protein_id="ABE37721.1"
FT                   /translation="MNANLFARLFDALDDPNRLAIETAAGETISYGDLIARAGRVANVL
FT                   VARGVKTGDRVAAQTEKSVEALVLYLATVRAGAVYLPLNTAYTLHELDYFITDAEPSLV
FT                   VCDPSKRDGIAAIAAKVKAAVETLGGDGQGSLTDAAAQASAEFTTVPRSADDLAAILYT
FT                   SGTTGRSKGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFAR
FT                   AAMIFLPKLDPDRIIDLMPRATVLMGVPTFYTRLLQSPRLTQQATRHMRLFISGSAPLL
FT                   ADTHREWAARTGHAVLERYGMTETNMNTSNPYEGERVPGAVGFPLPGVSARVTDPETGR
FT                   ELARGEIGMIEVKGPNVFKGYWRMPEKTRSEFRDDGFFITGDLGKIDERGYVHILGRGK
FT                   DLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGAAIDEAQV
FT                   LSGLDGQIAKFKMPKKVIFVDDLPRNTMGKVQKNVLRDTYADIYK"
FT   gene            558984..559733
FT                   /locus_tag="RPD_0484"
FT   CDS_pept        558984..559733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0484"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37722"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW7"
FT                   /protein_id="ABE37722.1"
FT                   /translation="MTKSGKRVAWITGGGSGIGEAGAEALAADGFTVVVSGRRADALDA
FT                   VVAKIRAQGGAAEAIALDVSSSDAVIDAADKILAAHGRIDCLVNSAGINVPKRSWADME
FT                   LDGWDKLVEINLNGVLYCMRAVLPAMRAQKDGCIINVSSWAGRHVSKMPGPAYTTTKHA
FT                   VLALTHSFNMDECVHGLRACCLMPAEVATPILKLRPVVPSAEDQARMLQPDDLGRTIAF
FT                   VASMPPHVCVNEILISPTWNRSFVGGL"
FT   gene            560248..560832
FT                   /locus_tag="RPD_0485"
FT   CDS_pept        560248..560832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0485"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37723"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW6"
FT                   /protein_id="ABE37723.1"
FT                   /translation="MSKRIAYLSAAALSALALTATAMAPANAEDKKMMKSEMSGEKTVM
FT                   VGGAPMYPSKNIVENAVNSKDHSTLVAAVKAAGLVKTLEGKGPFTVFAPTNAAFGKLPA
FT                   GTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDGKKLTTVEGATLTVKRSGDQVMLV
FT                   DAKGGSSTVTIPNVNQSNGVIHVVDTVLMPS"
FT   gene            561057..561701
FT                   /locus_tag="RPD_0486"
FT   CDS_pept        561057..561701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37724"
FT                   /db_xref="GOA:Q13DW5"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW5"
FT                   /protein_id="ABE37724.1"
FT                   /translation="MSSMTVSEQANAGQAGEETVRKVIQPAWVRIMHWINAVAMIVMIM
FT                   SGWQIYNASPLFDFQFSRSVTLGGWLGGGLLWHFAAMWVLMINGLLYLVVGLATGRFRR
FT                   KLLPITPSGVASDLAKAATFRLSHRDLTTYNYVQKLLYAGIMGVGIVVVLSGLSIWKPV
FT                   QFQLLTAVFGGYDTARYVHFFAMASIVAFLIVHIALAVLVPKSLRAMIIGR"
FT   gene            561704..562483
FT                   /locus_tag="RPD_0487"
FT   CDS_pept        561704..562483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0487"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37725"
FT                   /db_xref="GOA:Q13DW4"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW4"
FT                   /protein_id="ABE37725.1"
FT                   /translation="MLRIKSLLIPGVDKTLLVKDAAKLMPDPTRRRFLAGGASLGALTL
FT                   LTGCDVVDGMSAENLLVKVSKFNDAVQAAIFNPNTLAPTYTDKDITRPFPFNAFYTLDE
FT                   APDIDGKEWKLDVAGLVDNKKSWTLDELGALPEVKQITRHICVEGWSAIGSWSGVRLSD
FT                   FLKLVGADTGAKYVWFRCADDYTSPIDMPTALHPQTQMTLKYDGQVLPRAYGYPMKIRI
FT                   PTKLGFKNPKYVVAMEVTNDYKGGYWEDQGYNSFSGS"
FT   gene            562633..563151
FT                   /locus_tag="RPD_0488"
FT   CDS_pept        562633..563151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0488"
FT                   /product="superoxide dismutase, copper/zinc binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37726"
FT                   /db_xref="GOA:Q13DW3"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW3"
FT                   /protein_id="ABE37726.1"
FT                   /translation="MIVRSMLTAAALLALSTTAFAAETAKASMKNAEGADVGIATLTQG
FT                   SKGVTIKLSLKGLPPGEKAFHVHAVGKCEPPFTSAGGHFNPDNKKHGKMAPDGAHAGDM
FT                   PNLTIPDSGRLDIDVVNEAVTLDKGKPNSVFKPDGTALVIHAKADDYKSDPAGNAGDRI
FT                   VCGVIEEVK"
FT   gene            complement(563283..564467)
FT                   /locus_tag="RPD_0489"
FT   CDS_pept        complement(563283..564467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0489"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37727"
FT                   /db_xref="GOA:Q13DW2"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW2"
FT                   /protein_id="ABE37727.1"
FT                   /translation="MTLLDRTEAPVHPARLILILSLAPTVGLGIGRFAYSLLLPDMRDS
FT                   LQWSYSAAGFMNTINAAGYLAGALITSQLVRRYGLSAIVRVGTLGCVLSLALCALSGNF
FT                   VLLSAARLIAGIGAALAFVAGGALATTIAQSQPQRSAFLLSLFYAGPGLGILSSGLITP
FT                   FLLQAAGPGSWWIGWLVMAALSAVMTLPLLLAPLDSHASMSGGPATTFSIRPVLIYLVG
FT                   YFMFGAGYIAYMTFMIAYVRDAGGGPAAQSAFWCLIGASAFVTPWVWRRIMALDRGGVS
FT                   TTIILAVNALGAALPLFGLSPLILAISALVFGVSFFAVVASTTAFVRFNYAQAAWPGAI
FT                   AAMTIAFGIGQTLGPLAVGAITDAVGSLSSALAVSAATLALGAVFSAFQRPLKR"
FT   gene            564693..565805
FT                   /locus_tag="RPD_0490"
FT   CDS_pept        564693..565805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0490"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37728"
FT                   /db_xref="GOA:Q13DW1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW1"
FT                   /protein_id="ABE37728.1"
FT                   /translation="MATHKLLLLPGDGIGTEVMAEVSRLIDWLNKAGIASFETEHGLVG
FT                   GAAYDADKVAITDATMAKAQACDAVIFGAVGGPKWDAVPYDARPEAGLLRLRKDLALFA
FT                   NLRPAVCYPALASASSLKPEVVEGLDIMIVRELTGGVYFGEPKTITDLGGGQKRAIDTQ
FT                   VYDTYEIERIGRVAFDLARKRRNKVTSMEKRNVMKTGVLWNEVITQVHQREYKDVQLEH
FT                   QLADSGGMNLVKWPKQFDVIVTDNLFGDMLSDIAAMLTGSLGMLPSASLGEVDSKTGKR
FT                   KAMYEPVHGSAPDIAGKGMANPVAMLASFGMALRYSLDMGDLADKLDEAIAAVLAKGLR
FT                   TADIKSDGSTVVSTSQMGEAIVQELQALHG"
FT   gene            complement(565977..566357)
FT                   /locus_tag="RPD_0491"
FT   CDS_pept        complement(565977..566357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37729"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW0"
FT                   /protein_id="ABE37729.1"
FT                   /translation="MTLKFPAARTFAVLLASAAVVAIGLDTANAQQQPTKRVYQTNDQA
FT                   RYGARGPNASYQAGPRTRVYVTKRSWLDAGTEVLPGDRKFTDYAFPPGTSFSRQNGQRT
FT                   IDRAPLNPASDLGGYPERFPLY"
FT   gene            complement(566522..567340)
FT                   /locus_tag="RPD_0492"
FT   CDS_pept        complement(566522..567340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37730"
FT                   /db_xref="GOA:Q13DV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV9"
FT                   /protein_id="ABE37730.1"
FT                   /translation="MRPNPALPAAPHRGRIHPALRSFADECRETVVRLLAYVGALALIG
FT                   LIVFYAANPLTDAAITAAAEPAARAGWSGAMRSHPAFAVSQIDLPGATASTEILRHPDG
FT                   GRKDILRWALAGQPPVAEITLYRPGNEARAEVQGLPDIVADIAARLDPGGGGAAQPAGL
FT                   IDSKFGTVALFDLAGRANRCFGFFKPIDEASLRISGWTCRGDSLPQRRAAAGCMLDRLV
FT                   LLSAGGDTALAETFARAELRRQGCKDGQSQQDAGADWVLGAQNPRLRGTF"
FT   gene            567499..568533
FT                   /locus_tag="RPD_0493"
FT   CDS_pept        567499..568533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0493"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37731"
FT                   /db_xref="GOA:Q13DV8"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV8"
FT                   /protein_id="ABE37731.1"
FT                   /translation="MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEV
FT                   SYGDKTLKCKALEHYDFSDVDICLMSAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDV
FT                   PLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALKPLHDHAKITRVVVSTYQSVSGAG
FT                   KEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTKEEWKMMVETKKI
FT                   LDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGYV
FT                   TPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAK
FT                   KKAA"
FT   gene            568675..569241
FT                   /locus_tag="RPD_0494"
FT   CDS_pept        568675..569241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0494"
FT                   /product="Uncharacterized protein UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37732"
FT                   /db_xref="GOA:Q13DV7"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV7"
FT                   /protein_id="ABE37732.1"
FT                   /translation="MTDQPDLPKSPSPIKRVERGFETLLFNSRWLMAPFYFGLVLSLLV
FT                   LLYKFVVLLAELILHASLAKESDIILGVLSLIDVSLTGNLVLIVVFSGYENFVSRIDPR
FT                   DHPDWPEWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNLDAGYDPTRLGWLVGIHLVF
FT                   VVSTLLMALSDRWGSDHGSGDKAGH"
FT   gene            complement(569490..570134)
FT                   /locus_tag="RPD_0495"
FT   CDS_pept        complement(569490..570134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0495"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37733"
FT                   /db_xref="GOA:Q13DV6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV6"
FT                   /protein_id="ABE37733.1"
FT                   /translation="MTSFPKTLIEGYQAFRTQRLPTEQSRYRDLSERGQSPEVMLIGCC
FT                   DSRVSPEVIFDAGPGELFVVRNVANLVPVYEPDGGAHGVSAALEFAVQVLKVKHIVVLG
FT                   HAQCGGIKAFTDKTPPLTDSDFIGRWMSMFIKPGEVVEQRDHESVQDFRTRIEKAAVFR
FT                   SIENLMTFPCIKILVERGRLQLHGAYFGVAAGELFVLDPQTKEFRPAAPRG"
FT   gene            570335..571213
FT                   /locus_tag="RPD_0496"
FT   CDS_pept        570335..571213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0496"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37734"
FT                   /db_xref="GOA:Q13DV5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV5"
FT                   /protein_id="ABE37734.1"
FT                   /translation="MIRPRRSLLFMPGSNARALEKARLLPVDGLILDLEDSVAPEAKAQ
FT                   ARDQIGQAVAAKGYGRREVLVRINALDSPWWLDDIAMAAKVKPDGILVPKVSSVQDLSA
FT                   IADRLSDLNADMSIRVWIMIETSRGVLHAEELAAQVHDSETRLAGFVFGPNDISRETGI
FT                   RMLPGRTAMIPMITHCILAARVHGLTVLDGPYSDIASVDGFALECAQARDLGFDGKTLI
FT                   HPGQIEACNAAFTPPPEDVAQARKIIAAFERPENAGRGAIQLDGRMVERLHAEIAKKTI
FT                   AIADAVETMGR"
FT   gene            complement(571384..573117)
FT                   /locus_tag="RPD_0497"
FT   CDS_pept        complement(571384..573117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0497"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37735"
FT                   /db_xref="GOA:Q13DV4"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV4"
FT                   /protein_id="ABE37735.1"
FT                   /translation="MCASSHSALEPSSMKIRITISAMIVLFGVITAIGLAAMLATSTFA
FT                   LKQLRVGGPLYSQIQLGNDLVADILPPPAYVIEAYLEATLALRKPSELAAHQARLAQLH
FT                   KSYSERKDYWSSKSELDPSVKKRLTVDSDAEVQKFWKVAEQDMIPALSKGDKARAEAAY
FT                   AELETIYQAHRSIIDDIVKKANNENSELEKVAATQVDSYSMVTWVVSGLVVTLIVLGVL
FT                   GIAIGLVRPVVRLTSALEEMAGGNLDVAIPGAGRGDEIGGMARAVSAIKANAEQKARDE
FT                   AEAKNRLDRLAAEQRKADMARLADSFEGAVGEIIEVVSSAATELEASARSLSSTAERSI
FT                   DLATGVAAASAEASSGVQSVASASEELTASVAEISRQVQSSARVANEAVDQAQKTNSRV
FT                   GELSSAAARIGDVVELINTIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQT
FT                   AKATGEIGQQVAGIQAATEESVVAIKQIGNIIGQMSEISSTIASAVEEQGAATKEISAN
FT                   IQQAAHGTSLVSSDIANVKGGAQETGAASAQVLSSAQSLSKESNRLRVEVGNFLSSVRA
FT                   A"
FT   gene            complement(573397..574002)
FT                   /locus_tag="RPD_0498"
FT   CDS_pept        complement(573397..574002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0498"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37736"
FT                   /db_xref="GOA:Q13DV3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DV3"
FT                   /protein_id="ABE37736.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGLFSE
FT                   QRYNDDGSENPDFILNKPAYRNAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGVLPIRVSQADLDKLFDDAERGSNATVTIDLPAQEIRGPDGGTVKFEID
FT                   PFRKHCLINGLDDIGLTLEKKASIDSYEDKAKTERAWA"
FT   gene            complement(574093..574494)
FT                   /locus_tag="RPD_0499"
FT   CDS_pept        complement(574093..574494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0499"
FT                   /product="protein of unknown function DUF1025"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37737"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV2"
FT                   /protein_id="ABE37737.1"
FT                   /translation="MWTTAKAPSLAEFEEMAHEMFGKLPDDFRALCEGVIIRVDDFPTD
FT                   EVLDELQAETEFDLLGLFQGIGLPQRSNQDIAPLPNMIWLYRRPILDYWADHDETLGHI
FT                   VSHVLIHEIGHHFGLSDDDMEEIESQVAD"
FT   gene            574610..574948
FT                   /locus_tag="RPD_0500"
FT   CDS_pept        574610..574948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37738"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV1"
FT                   /protein_id="ABE37738.1"
FT                   /translation="MIRRMTLAAAGLGLAVSLLLQAAEPAQAQTPKPARPSVSSAPADL
FT                   SPTDLSSQQRRPPRRLRIYPRNAPDGVYPRFNPGPNAVRECTATYVQEYRPSGTVITPR
FT                   MSCFWRRG"
FT   gene            575449..575742
FT                   /locus_tag="RPD_0501"
FT   CDS_pept        575449..575742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37739"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV0"
FT                   /protein_id="ABE37739.1"
FT                   /translation="MNILKLTGLAAVAGLLLIAAPGDRAQAAPMAAAGLATSVQRDVIS
FT                   DVSEVQYRHHHHGYRHHRHVRPHHYRGHHYGHRSHRHYGAPRHHHRHHRHWR"
FT   gene            575878..576198
FT                   /locus_tag="RPD_0502"
FT   CDS_pept        575878..576198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37740"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU9"
FT                   /protein_id="ABE37740.1"
FT                   /translation="MRTWIGAAIIAAALGVMSPVAAQVPMPAAASATRAGESMPTEFSS
FT                   RHRSRHAHRELRRSAHRHHARGPRPGYYATHYYARPYDYRPYGMAPFFPFGFGGYGFQP
FT                   SW"
FT   gene            576327..577028
FT                   /locus_tag="RPD_0503"
FT   CDS_pept        576327..577028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37741"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU8"
FT                   /protein_id="ABE37741.1"
FT                   /translation="MAAYAMAITPRRSHPPALASRVGLFAVAAVAALAMSIATAPRAQA
FT                   LSPASAGAATANKATANNTATERLIQVRAGHIGGGGGGGHHGGGGFHGGGGFRGGGFHH
FT                   GGGFRGGGFRPAFHGGGYRGVGHIGRGPVFHHRQFYGGPRFVGHRHFGHRHFGHRYPGF
FT                   RPYYGGARYYGYSRPRYYAPVYYGPRRVCRVIYTYYGPRRVCQFRPWRHHLHRHHWRHH
FT                   HRHHRAWRVYW"
FT   gene            complement(577127..578539)
FT                   /locus_tag="RPD_0504"
FT   CDS_pept        complement(577127..578539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0504"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37742"
FT                   /db_xref="GOA:Q13DU7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DU7"
FT                   /protein_id="ABE37742.1"
FT                   /translation="MSAAKPTTLYDKIWNDHLVHEAEDGTCLLYIDRHLVHEVTSPQAF
FT                   EGLRTAGRKVHSPEKTLAVVDHNVPTTDRSKPNPDPESAEQIAALAENARDFGVTYYNE
FT                   HDKRQGVVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLI
FT                   QKKAKNMRVTVDGDLPDGVTAKDIILAIIGEIGTAGGTGYVLEYAGDAIRALSMEGRMT
FT                   VCNMSIEGGARAGLIAPDEKAYAYLKGRPMAPTGANWDAAMRYWDTLRSDEGAHFDHEL
FT                   RLDAAALPPIVTWGTSPEDVISITGRVPNPADIADEAKRLSKERALAYMGLTPGTRITD
FT                   IKIDRMFIGSCTNGRIEDLRAAAKVAEGKTVNGNVSAMIVPGSGLVKEQAEAEGLDKIF
FT                   VKAGFEWREPGCSMCLAMNPDKLAPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAA
FT                   IAGHFVDIREWR"
FT   gene            complement(578747..579016)
FT                   /locus_tag="RPD_0505"
FT   CDS_pept        complement(578747..579016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37743"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU6"
FT                   /protein_id="ABE37743.1"
FT                   /translation="MLCESAGFARAFSWCRFLLVSRARCSVVHAAPQTRDPGCFRHVQN
FT                   RGPGSAAHHVAARRVAMRPGHDCRRCCSTEPRPGHGSRYIVGRA"
FT   gene            complement(579034..579429)
FT                   /locus_tag="RPD_0506"
FT   CDS_pept        complement(579034..579429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0506"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37744"
FT                   /db_xref="GOA:Q13DU5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DU5"
FT                   /protein_id="ABE37744.1"
FT                   /translation="MNLIQTLEKEQFDKLSAGKTIPEFGPGDTVIVNVKVVEGERSRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPLLSPMIDSIKVVRRGKVRRAKLYYL
FT                   RNLRGKSARIVEKKQDRPAKVAAGAAE"
FT   gene            complement(579543..580361)
FT                   /locus_tag="RPD_0507"
FT   CDS_pept        complement(579543..580361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0507"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37745"
FT                   /db_xref="GOA:Q13DU4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU4"
FT                   /protein_id="ABE37745.1"
FT                   /translation="MMDARVKPAHDASFAASLRNSRTASMWRATVLTLFPEMFPGPLGV
FT                   SLAGRALAGGLWGLEARDIRDSATDRHRSVDDTPAGGGPGMVLRADVLAAAIDAATPTP
FT                   DQPRLVMSPRGRPLTQARVADLARGPGSLIVCGRFEGIDQRVIDARGLEEVSIGDYVLS
FT                   GGEIAAMALIDACVRLLPGVMGKLDSSTEESFSAGLLEYPQYTRPQLFEGRAIPEILTS
FT                   GDHGKVAAWRQAEAEALTRARRPDLWAATTAKKAPAKGESRKTPKNTTDG"
FT   gene            complement(580553..581083)
FT                   /locus_tag="RPD_0508"
FT   CDS_pept        complement(580553..581083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0508"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37746"
FT                   /db_xref="GOA:Q13DU3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DU3"
FT                   /protein_id="ABE37746.1"
FT                   /translation="MPAGLICIARIGAPHGVRGAMRLWSFTAEPLAVMDYGPLATKDGA
FT                   RSFEIATARPAKDHLVVTLKGVATREEAERLNGLELYVPRDRLPPTEDGEYYHADLIGL
FT                   PAITPAGEPLGRVLAIHNFGAGDIIEIAPPQGATLLLPFTNAVVPTVDLTAGHVVIELP
FT                   TEIEGDTPNHPEA"
FT   gene            complement(581096..581419)
FT                   /locus_tag="RPD_0509"
FT   CDS_pept        complement(581096..581419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0509"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37747"
FT                   /db_xref="GOA:Q13DU2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DU2"
FT                   /protein_id="ABE37747.1"
FT                   /translation="MSVVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMA
FT                   KDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGIKKREARNNPEKAVPRKERKAAE
FT                   AGK"
FT   gene            complement(581581..583134)
FT                   /locus_tag="RPD_0510"
FT   CDS_pept        complement(581581..583134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0510"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37748"
FT                   /db_xref="GOA:Q13DU1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU1"
FT                   /protein_id="ABE37748.1"
FT                   /translation="MFDNLSEKLGGILDRLTGRGSLSEADVDAAMREIRRALLEADVAL
FT                   EVVRSFTEKVREQAVGATVVKSVKPGQMVVKIVNDELIAMLGSDSQAIDLNAVAPVPIM
FT                   MVGLQGSGKTTTTAKLARRMTQRDKRKVLMASLDVYRPAAMEQLAVLGRDLEIDTLPIV
FT                   VGQKPQDIARRAMEAGRLGGYDVVLLDTAGRTTLDEDMMSEAAEIKAAANPHEVLLVAD
FT                   SLTGQDAVNLARAFDERVGLTGIVLTRIDGDGRGGAALSMRAVTGKPIKLMGTGEKTDA
FT                   LEDFHPSRIAGRILGMGDVVSLVEKAASTLDAEKAAAAVEKMRKGKFDLADMREQLEQM
FT                   TKMGGIGGLMGMMPGISKMKNQIAAAGVDDKVLKRQVAIIDSMTREERKNPDILKASRK
FT                   KRIAAGAGIKVEDVNKLLKMHRNMADMMKAVGRGKGGPMAGLAQAMGFGGGLPTAEQIK
FT                   AMQEKAQQGGELPGGLPELPKDLPASLRTGLPKLPGLTGLSGKPTLPGLGSFPGFGKKK
FT                   "
FT   gene            583492..584466
FT                   /locus_tag="RPD_0511"
FT   CDS_pept        583492..584466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0511"
FT                   /product="beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37749"
FT                   /db_xref="GOA:Q13DU0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU0"
FT                   /protein_id="ABE37749.1"
FT                   /translation="MTFYKGPITDHFDGERFFDRDGMPPKSWADLLRWRFGHKPAPWPD
FT                   WAPSPYADKPPPRVTGDKARLSYVGHASWLIQTGGLNILIDPVWSQRVSPVSFAGPKRH
FT                   NDPGIAFDALPQIDVVLVSHGHYDHLDLATLSRLAAKHAPRVITPLGNDLTMTAHDDAI
FT                   RAEAYDWRDRVELGSGVAVTLTPTRHWTGRGAFDRNRALWASFVLETPAGKIYVVCDSG
FT                   YGDGKHFRDVRHAHAPLRLAILPIGAYEPRWFMKDQHMNPAEAVQALADCGAAQALANH
FT                   HGTFQLTDEAIDAPQTDLYAALDAAGVPRERFAVLKPGQVFEV"
FT   gene            complement(584490..585215)
FT                   /locus_tag="RPD_0512"
FT   CDS_pept        complement(584490..585215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0512"
FT                   /product="protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37750"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT9"
FT                   /protein_id="ABE37750.1"
FT                   /translation="MTMQLHTLTAAALILATLGAAPGRAQPVPSPQQWQQQSAITVIGE
FT                   AQKSVPPDIAQVEAGVSNMAKTARAAAEANNNAMGKVLLELRNAGIDAKDIQTSRLSIQ
FT                   PQYASNRSGPSEITGYLASNLVTVHARDIARVAGLVDTLVVAGANEIRGISFRVANSSK
FT                   VLDDVRTEAIADARRKAEIYARAAGVTLGAPLVISEDASPGVAPMRKMATSFDAGAPVA
FT                   AGQETLSVTVMVSWAIKAP"
FT   gene            complement(585212..586018)
FT                   /locus_tag="RPD_0513"
FT   CDS_pept        complement(585212..586018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0513"
FT                   /product="transcription activator, effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37751"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT8"
FT                   /protein_id="ABE37751.1"
FT                   /translation="MNRHRFFHPALLGLLSAAALTLGAAGAPAQTETKPAETKSTETKP
FT                   AETTTPPPAATTPSPSTPAPSAAAPSTPAPSTAAPATPAPSTPPAAAETPATPPPAAQT
FT                   PAVPPAAKVQTADPFGEEITLAPKTAVVLKGKASWDNAFESLIEAIKSVTGLLEKQGIK
FT                   PNGNPMIVYTSTDDNGFTFQAEIPVPEAPKNLPKTMSMGPTPDGKVLKFVHRGSYDNMD
FT                   NTYEAITNHLDDKKIEAKDTFVEEYITDPLTTAEDKLVINVYVPMK"
FT   gene            586253..587134
FT                   /locus_tag="RPD_0514"
FT   CDS_pept        586253..587134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0514"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37752"
FT                   /db_xref="GOA:Q13DT7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DT7"
FT                   /protein_id="ABE37752.1"
FT                   /translation="MSALDNRLFAKMNGIGNEIVVVDLRDQPAPVTPDDARAVAAHLPY
FT                   DQLMLLQPARLPGTEAFVRIYNNDGSEAGACGNGMRCVARQMFASTDKQGLTFETRAGL
FT                   LNCWRGPADGLYTVDMGEPKFGWKDIPLAEEFRDTRSIELQIGPIDAPLLHTPSVVSMG
FT                   NPHAIFWVDDIEAHDLGRFGPLLENHPIFPERANITLAHIVDRDHITMRTWERGAGLTR
FT                   ACGSAACATAVAAARLKRADRVVEMTLPGGQLSIAWRESDNHVLMTGGATFEFEGRFDP
FT                   ALFARSRDKTSA"
FT   gene            587134..588465
FT                   /locus_tag="RPD_0515"
FT   CDS_pept        587134..588465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0515"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37753"
FT                   /db_xref="GOA:Q13DT6"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT6"
FT                   /protein_id="ABE37753.1"
FT                   /translation="MAVEIVTFGCRLNAFESEVIRREAEGAGLHDAIVINSCAVTNEAV
FT                   AQARQQIRKLKRERPGARIVVTGCAAQTEPATFAGMDEVDRVIGNDDKMRSEAWRAARI
FT                   AFDADTAFGLGAEQKIAVADIMAVREMAPHLVDGYQSGLPRVFVQVQNGCDHRCTFCII
FT                   PFGRGNSRSVPIGAVVDQVRALTERGHAEIVLTGVDLTSYGADLPGTPKLGALVKKVLR
FT                   HVPELQRLRISSIDSIEADRDLLDALAGEQRLMPHLHLSLQAGDDLILKRMKRRHLRDD
FT                   AIAFCEEVRRLRPDIALGADLIAGFPTETEAMFRRSLDLVDDCGLTFLHVFPYSKRPGT
FT                   PAARMPQLDGRIIRERAARLRAAGEAALQRRLQAEIGQTRAVLIESATQGRTEHFIPVA
FT                   MSGATPGTVQSLTIAGHDGARLTTTRRSSHTPQAAGADAAAAAR"
FT   gene            complement(588401..589297)
FT                   /locus_tag="RPD_0516"
FT   CDS_pept        complement(588401..589297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0516"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37754"
FT                   /db_xref="GOA:Q13DT5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT5"
FT                   /protein_id="ABE37754.1"
FT                   /translation="MNESHPDQFDVPELSPEDIQARVLHRDGLMLVIDKPAGLPVHRGP
FT                   KGGPNLETSFEFLRFGLPRPPVLAHRLDRDTSGCLVLGRHRKATATLGLLFKHSKISKT
FT                   YWAIVEGGPEQDHGTIDLPIGRLNAERGWWQKVDPEGLPSLTKWTVLGRSHPVAPAPAA
FT                   ISSEPVASDSSPPCGEGSGVGVDNGSFASGAPHPTPPPQAGEGAGGARGKRLTWLALEP
FT                   ITGRTHQLRVHCAAMGWPIVGDNIYGNGPRFGEPKLHLHAREIVIPLSRNKPPVIVTAP
FT                   PPPHLHPRLAACGWSGA"
FT   gene            589326..590273
FT                   /locus_tag="RPD_0517"
FT   CDS_pept        589326..590273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0517"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37755"
FT                   /db_xref="GOA:Q13DT4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT4"
FT                   /protein_id="ABE37755.1"
FT                   /translation="MSDTPETQKPSWWRRLSSGLKRTSSSIGTALSEFISKRKLDRAML
FT                   DEIEDVLLRADLGTEVASRISDAVGEGRYDKMISASDVKEIVASEVEKVLAPVAKPLVI
FT                   DDAKKPFVVLVVGVNGSGKTTTIGKLSARFAAEGRKVMMAAGDTFRAAAIEQLKVWGER
FT                   TGTPVIAGAQGSDSASLAFNALTAAKEQGRDVLLIDTAGRLQNRKELMSELEKVVRVIK
FT                   KVDDTAPHAVLLVLDATVGQNALSQVEAFTRTAGVTGLVMTKLDGTARGGILVAIAEKH
FT                   KLPVHFIGVGEGVEDLSPFTARDFAQAIAGTETQ"
FT   gene            590270..590902
FT                   /locus_tag="RPD_0518"
FT   CDS_pept        590270..590902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0518"
FT                   /product="intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37756"
FT                   /db_xref="GOA:Q13DT3"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT3"
FT                   /protein_id="ABE37756.1"
FT                   /translation="MTKDSATNDLVPKNQPHPLFKLATELGPLLVFFFVNAKWNLFAAT
FT                   GAFMVAVIAAIIASYVVTKHVPMMALVTAVVVLVFGTLTLVLHDETFIKMKPTIVYTLF
FT                   GAVLGGGLLFGRSFIAIMFDQVFNLTAEGWRKLTLRWALFFFAMAVLNEAVWRTQTTEF
FT                   WVSFKVFGMVPLTMLFAILQMPLTKRYQVAPATLEQSATDEGDVSGR"
FT   gene            complement(591159..591551)
FT                   /locus_tag="RPD_0519"
FT   CDS_pept        complement(591159..591551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37757"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT2"
FT                   /protein_id="ABE37757.1"
FT                   /translation="MRTFKLRTLKLRHLTLAPLAAALAFGLLVNAPAMAQAPQTTPQTD
FT                   KMAPPPAATKTSPTAGAKSEKVDLLDINSATVEQLEVLPGIGKAYSAAIIKGRPYKGKD
FT                   ELVQKKVVPEKTYEGIKDKIIAKQKG"
FT   gene            complement(591670..592269)
FT                   /locus_tag="RPD_0520"
FT   CDS_pept        complement(591670..592269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0520"
FT                   /product="periplasmic protein thiol"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37758"
FT                   /db_xref="GOA:Q13DT1"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT1"
FT                   /protein_id="ABE37758.1"
FT                   /translation="MSTPVPDAPSPKRRSLVVALPLLVFAGLAALFWFRLGDRDISRIP
FT                   SALIGREAPSTTLPSLEGLTRDGVQVAGLDPALFRGKVSVVNVWASWCVPCHDEAPLLT
FT                   ALADDKRIQIVGINYKDKPDNARRFLGRYGNPFVAVGVDPNGRAAIEWGVYGVPETFVV
FT                   GRDGRIAYKLVGPITPDNLDKLLKAEIGKALAAPQS"
FT   gene            complement(592266..592445)
FT                   /locus_tag="RPD_0521"
FT   CDS_pept        complement(592266..592445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0521"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37759"
FT                   /db_xref="GOA:Q13DT0"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT0"
FT                   /protein_id="ABE37759.1"
FT                   /translation="MMFGRYAEFIVSSYAATAIVVVLLILWVVIDYRRQKARLRDLEAR
FT                   GAVRRSGRSATDLS"
FT   gene            complement(592442..593176)
FT                   /locus_tag="RPD_0522"
FT   CDS_pept        complement(592442..593176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0522"
FT                   /product="heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37760"
FT                   /db_xref="GOA:Q13DS9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS9"
FT                   /protein_id="ABE37760.1"
FT                   /translation="MTLTELANPTRFLSLAGRLLPWLAGATALLLTVGLVLAMLAPDDY
FT                   QQGATVKIMFVHVPNAWLAMFVWGVMSLASLGTLVWRHPLADVAAKTAAPIGAAFTFLA
FT                   LLTGSLWGRPMWGTYWEWDARLTSMLILFLMYLGLIALWRAVEDPSRAARAAAVLTLVG
FT                   AINLPIIKFSVDWWNTLHQPASVMRMSGPALDKAFLSPLLVMAVGFSLLFLTLHVAAMR
FT                   NEILRRRVRTLQMMQASRAEAA"
FT   gene            complement(593368..594036)
FT                   /locus_tag="RPD_0523"
FT   CDS_pept        complement(593368..594036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0523"
FT                   /product="heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37761"
FT                   /db_xref="GOA:Q13DS8"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS8"
FT                   /protein_id="ABE37761.1"
FT                   /translation="MTALGAIIRRDIRIALRVGGGALVGVLFFLTVVVLMPFAVGPDLK
FT                   LLQRLGPAILWLGALLASLLTLDRLFTADAEDGSLDLIVMSHTPLELTCAAKAFAHWLA
FT                   AGLPLIVATPVLGLLLNLDGMASLAVMATLLAGTPALTFTGMIGAALAVTLRRGGLLLA
FT                   VLVLPLSIPVLIFGVAASQAAIVGPVPFGTPFSILCALSLASLVIGPFAAAASLRHGLD
FT                   "
FT   gene            complement(594086..594688)
FT                   /locus_tag="RPD_0524"
FT   CDS_pept        complement(594086..594688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0524"
FT                   /product="heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37762"
FT                   /db_xref="GOA:Q13DS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DS7"
FT                   /protein_id="ABE37762.1"
FT                   /translation="MWLSGRGLRCVRGGREVFDGLGFEAAGGEALALVGHNGAGKTSLL
FT                   RLIAGLLAPAAGTITFDGGEPDTPVAEQAHYLGHRDALKPSLSVTENLAFWREFLGGEP
FT                   TDLPAAIEAVGLAHAAELPAAYLSAGQRRRLSIARLLVVRRPIWLLDEPTSALDVRGQE
FT                   AFGRLMSDHLAGGGLIIAATHSPLGIAAREMRIGAAA"
FT   gene            594905..597622
FT                   /locus_tag="RPD_0525"
FT   CDS_pept        594905..597622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0525"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37763"
FT                   /db_xref="GOA:Q13DS6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS6"
FT                   /protein_id="ABE37763.1"
FT                   /translation="MTSLDSFKCRKILKVGSKSYVYYSLPTAEKNGLKGISRLPYSMKV
FT                   LLENLLRNEDDRTVKKADIQAVAKWMRKKALEHEIAFRPARVLMQDFTGVPAVVDLAAM
FT                   RNAMQALGGDAEKINPLVPVDLVIDHSVIVNFFGDNKAFGKNVAEEYKQNQERYEFLKW
FT                   GQKAFSNFAVVPPGTGICHQVNLEYLAQTVWTRKEKMTIGKKKGTFEVAYPDSLVGTDS
FT                   HTTMVNGLAVLGWGVGGIEAEAAMLGQPLSMLLPEVVGFKLKGALKEGVTATDLVLTVT
FT                   QMLRKQGVVGKFVEFFGPGLDHLSVADKSTIANMAPEYGATCGFFPVDTETLDYLKTSG
FT                   RASARVALVEKYAKAQGLFRTAKSADPVFTVTLTLDLASVVPSLAGPKRPEGRVALPAV
FT                   SEGFTAAMDAEYKKALDGARYAVDGRKFDLGHGDVVIAAITSCTNTSNPSVLIGAGLLA
FT                   RNAAAKGLKAAPWVKTSLAPGSQVVAEYLANSGLQKDLDKVGFNLVGFGCTTCIGNSGP
FT                   LPEDISKSINDNGIVAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAYALAGTVTKNLA
FT                   VEPIGTGKDGKPVYLKDIWPTTKEINAFVKKYVTAAIFKKKYADVFKGDTNWRKIKTVD
FT                   SETYKWNMSSTYVQNPPYFEGMKMQPEPIVDVVDARILAVFGDKITTDHISPAGSIKLT
FT                   SPAGKYLSEHQVRPADFNQYGTRRGNHEVMMRGTFANIRIKNHMLKGADGNIPEGGLTK
FT                   HWPDGDQMSIYDAAMKYQAEQVPLVVFAGAEYGNGSSRDWAAKGTRLLGVRAVICQSFE
FT                   RIHRSNLVGMGVLPLTFEDGTSWASLGIKGDEKVTIRGLQGDLKPRQTLTAEIKAGNGK
FT                   VKRVPLLCRIDTLDELEYYRNGGILHYVLRKLAA"
FT   gene            597793..598629
FT                   /locus_tag="RPD_0526"
FT   CDS_pept        597793..598629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0526"
FT                   /product="protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37764"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS5"
FT                   /protein_id="ABE37764.1"
FT                   /translation="MQRAAFSFQGVRTAADARFVPLPAKVTMIGVVGISRWLGALGLCA
FT                   LIAMVRPAAAEPRAVVELFTSQGCSSCPPADQIIGDLSKDPSVIALSLPIDYWDYLGWK
FT                   DTLADSRFSARQRAYSQMRGDRDVYTPQVVVNGSAHVVGSNRAGIDDAIKSTDKATGVM
FT                   TVPVTMAVNDKEIKVSVAAAPPGDGERRGEVWICSVSKAVPIAITRGENRGREVTYHNV
FT                   VRTLLKVGDWTGAAGSWSVPLENIARDGIDAAAVYVQDGSRDRPGPMLGAAFTSLH"
FT   gene            598989..599357
FT                   /locus_tag="RPD_0527"
FT   CDS_pept        598989..599357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37765"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS4"
FT                   /protein_id="ABE37765.1"
FT                   /translation="MSVISEEADPSDSRLAERQGAAPPQQRVTFNRLELNRILNLYGRM
FT                   VADGEWRDYAIDFLKDHAVFSVFRRASEVPIYRIVKDPRLARKQGAYSVVAASGQILRR
FT                   GHELDRVLLVIDRKLALV"
FT   gene            complement(599552..600097)
FT                   /locus_tag="RPD_0528"
FT   CDS_pept        complement(599552..600097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0528"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37766"
FT                   /db_xref="GOA:Q13DS3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS3"
FT                   /protein_id="ABE37766.1"
FT                   /translation="MSDLLIRPATTDDLPAVTAIYDEAVRTGTATFELTPPDLAEMTRR
FT                   FETLTGGGFPYLVGLLDGRVAGYAYAGPYRPRPAYRFTVENSVYLDPATHRRGLGTALM
FT                   RELIAQCEARGFRQMIAVIGDSANSGSVGVHRKTGFDMIGTHRNVGFKFGRWLDTVMMQ
FT                   RALGDGGETVPEQREIEL"
FT   gene            complement(600372..601163)
FT                   /locus_tag="RPD_0529"
FT   CDS_pept        complement(600372..601163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0529"
FT                   /product="protein of unknown function UPF0005"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37767"
FT                   /db_xref="GOA:Q13DS2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS2"
FT                   /protein_id="ABE37767.1"
FT                   /translation="MSDLDRNYASPFGRAAGRVDSAAVDAGLRAYMLRIYNYMTIGLAI
FT                   TGLAALGVYMGAVTPNDVGAAGRIGNTYLTTFGVAMFASPLKWVFILAPLAMVFAISFG
FT                   INRLKPATAQLLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKR
FT                   DMTGMGSFLIMGLFGVVIASVVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYI
FT                   YGYASEGGEVAERAAITGALSLYLNFINLFTLLLQLLGQKE"
FT   gene            complement(601496..604090)
FT                   /locus_tag="RPD_0530"
FT   CDS_pept        complement(601496..604090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0530"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37768"
FT                   /db_xref="GOA:Q13DS1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS1"
FT                   /protein_id="ABE37768.1"
FT                   /translation="MTLAADPLAKSPSTSAPTSRGLSLPLRYALREMRGGLNGFYVFIA
FT                   CIALGVMAIAGVGSVAASLGDGLAREGRTLLGGDVAFSLIQREATAEELGYLRERGPVS
FT                   VAATLRGMARTAAGQSALVEIKAVDNLYPMLGELKLAPQLPTAEVLAERDGAFGAAADA
FT                   ALLARLDLKIGDRVTVGSAAFQIRSVVASEPDKLAGNVGFGPRFLISDAALRATQLLQP
FT                   GSLVRWIYRVRLPDNRADDKAAQAFADATRAALPQAGWEIRSRGNASPQLERTITRFTQ
FT                   FLTLVGLAALLVGGVGVANAVKSHIDRRRDVIAAFKALGATGHDVFAIYLTQVLVLATI
FT                   GSLIGLALGAALPFVITGLFGKLLPLPVVAALHPEELALSLVYGLLTALAFGLWPLAQV
FT                   RDVPVATLFREAATADAHRPKFRHIVWIGVVIALLLAVVIGLAYDKRVAIAFVVAAVVV
FT                   FALLRGVAAGLMAIARWLPRSRITMLRLAIANIHRPGALTPSVVLSLGLGLAVLVTISQ
FT                   IDGNLRRQFLAALPERAPTFFFIDIPSSETEQFSGFLTRIAPKATLEDVPMLRGRIVAA
FT                   RGVRAEDLKPGQDAEWVLQSDRGLTYAAEMPAGSKVVEGHWWPKDYDGKPLVSFEKKLA
FT                   DGLGLKIGDSVTVNVLGREITATISNLRSVDWQSLGINFVLVFSPNTFRGAPHTHIATL
FT                   TETGSTPESDAALIKQVADKFPMVTSVRVREALETVGGVVSNLALAVRGASSVTLISAI
FT                   LVLGGALAAGHRHRVYDAVILKTLGATRGRLIGAFALEYMMIGLATAVFGVIAGSAAAW
FT                   LIVTRLMSLSFAWQAGSAAGVVVAALVVTVGLGLVGTLLALNQKPASVLRNL"
FT   gene            complement(604094..604834)
FT                   /locus_tag="RPD_0531"
FT   CDS_pept        complement(604094..604834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0531"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37769"
FT                   /db_xref="GOA:Q13DS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS0"
FT                   /protein_id="ABE37769.1"
FT                   /translation="MDSFIEPSSRPGDEPDTISISNVNLSLGSGAARVHILKDISLRVA
FT                   PGEAIGLIGPSGSGKSTLLMVMAGLERPDSGEVVVSGTAFNGLSEDALARFRGREVGIV
FT                   FQSFHLIPTMTALENVAVPLELAGTPDADARAARELASVGLGERLHHYPSQLSGGEQQR
FT                   VALARALAPDPAILVADEPTGNLDEATGRQIVDLLFTKHAERGMTLVLVTHDTALAQRC
FT                   DRVVRLRSGRIDTTQPGHAQARSA"
FT   gene            604899..605534
FT                   /locus_tag="RPD_0532"
FT   CDS_pept        604899..605534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0532"
FT                   /product="lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37770"
FT                   /db_xref="GOA:Q13DR9"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR9"
FT                   /protein_id="ABE37770.1"
FT                   /translation="MVIAALAMTAMPIQRAAAQAAAKPLKVVVLGDSLSAGYGLPAEAA
FT                   FPAKLQKALQAKGIATDMINAGVSGDTASGGLQRLDWSVPPDADAVIVELGANDALRGT
FT                   DPKVPQQALDEIVKRLKARNIAVLLCGMLAPPNYGPDYAKQFNAIYPDLAGKHGVPLYR
FT                   FFLDGVAAVANLNQPDGIHPTAAGIDVVVANILPTVEAFLRSVGAQKG"
FT   gene            605725..606261
FT                   /locus_tag="RPD_0533"
FT   CDS_pept        605725..606261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0533"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37771"
FT                   /db_xref="GOA:Q13DR8"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR8"
FT                   /protein_id="ABE37771.1"
FT                   /translation="MPRLFTGLEIPAEVTSTLSNLRGGLPGARWIEPENYHLTLRFIGD
FT                   IDGVTANEIASTLFRINRKPFEVALQGLSSFGGRKPRAVVASVVPSKPLIELQAELERL
FT                   LQRVGLDPEGRKFTPHVTLARLRDVSCQDVADYLSIRGYFPTKVFKAERFVLFSSRAST
FT                   GGGPYVVEAPYELTP"
FT   gene            606344..607525
FT                   /locus_tag="RPD_0534"
FT   CDS_pept        606344..607525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0534"
FT                   /product="AFG1-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37772"
FT                   /db_xref="GOA:Q13DR7"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR7"
FT                   /protein_id="ABE37772.1"
FT                   /translation="MSSPLSFRQQYQSLVASGAIEADPAQARAVEAFAALDDTLANYKP
FT                   PKKQSFLGRLFGGGDAEPPPRGLYVHGEVGRGKTMLMDLFFDASPVAHKRRSHFHEFMA
FT                   EAHERINAFRQNIKRGEIPDGDVIGLTAASIFEEAWLLCFDEFHVTDIADAMILSRLFG
FT                   KLFELGTVVVATSNVAPDDLYKGGLNRSLFVPFIGQVKQHMAVLRLDARTDYRLEKFAG
FT                   MKVWLAPDDAEATAALDRAWGRITGGAVGLPRDIAIKGRHLHVPRADHHVARFDFADLC
FT                   EKPLGASDYLRLAHEYHTLMIDHVPVMDHADRNAAKRFIALIDTLYDNAVKLMASAEAE
FT                   PAGLYRATEGYEAMEFNRTVSRLIEMGSESYLALPHGRSDSSASGSTTGLVET"
FT   gene            607655..608623
FT                   /locus_tag="RPD_0535"
FT   CDS_pept        607655..608623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0535"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37773"
FT                   /db_xref="GOA:Q13DR6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DR6"
FT                   /protein_id="ABE37773.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHMIGLKELGDVVLFDIAEGVPQGKAL
FT                   DIAESSPVDGFDAKFTGANSYEAIEGASVVIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGMPAKKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLVKYSTVAGIPLPDLVKIGWTSQARLDEIVDRTRNGGAEI
FT                   VNLLKTGSAFYAPAASAVAMAESYLRDKKRVLPVAAYLNGEYGIKDTYVGVPVVIGAKG
FT                   VERIVEIELAGKDREAFDKSVGAVQGLIDACKKIAPDLLGR"
FT   gene            608713..609912
FT                   /locus_tag="RPD_0536"
FT   CDS_pept        608713..609912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0536"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37774"
FT                   /db_xref="GOA:Q13DR5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DR5"
FT                   /protein_id="ABE37774.1"
FT                   /translation="MNIHEYQAKAVLREFGVPVSHGYPIFKASEAEAAAKQLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKDYAQQMLHATLVTVQTGPAGKQVN
FT                   RLYVEEGSEIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHDTPEKIVSFTVDPAT
FT                   GIMAHHGRAVANTLGLKGEQAKQAESLVTKLYTAFLAKDMEMLEINPLVLTKQGDLKCL
FT                   DAKMSFDGNALYRHADIQALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMTPANFLDVGGGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDIIAE
FT                   GVVAAVKEVGLDVPLVVRLEGTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVNAVKQVA
FT                   "
FT   gene            609963..610196
FT                   /locus_tag="RPD_0537"
FT   CDS_pept        609963..610196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0537"
FT                   /product="CopG-like DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37775"
FT                   /db_xref="GOA:Q13DR4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR4"
FT                   /protein_id="ABE37775.1"
FT                   /translation="MPKNITLAIDEAVLDRVRVIAAERKTTVNGLVRNYLENLSGADDK
FT                   RARLAKRIDELRAKSTLEVGPVTWTRDDLYER"
FT   gene            610186..610605
FT                   /locus_tag="RPD_0538"
FT   CDS_pept        610186..610605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0538"
FT                   /product="PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37776"
FT                   /db_xref="GOA:Q13DR3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR3"
FT                   /protein_id="ABE37776.1"
FT                   /translation="MSAEAMLDANVLVYAASTAAAEAAKARTATQLLKTGNVGISGQVM
FT                   QEFYVTVTRKSPTPLSVDDALDWLDVFNELPCIPVDAALVRSGAEIAQRYQISYWDGAV
FT                   LAAAHRLNATVLYSEDLSHDQTYGSVRVVNPFRAN"
FT   gene            610618..611502
FT                   /locus_tag="RPD_0539"
FT   CDS_pept        610618..611502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0539"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37777"
FT                   /db_xref="GOA:Q13DR2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR2"
FT                   /protein_id="ABE37777.1"
FT                   /translation="MSILIDANTKVICQGFTGKNGTFHSEAAVAYGTKMVGGTSPGKGG
FT                   TTHLGLPVFDTVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLD
FT                   MVRVKRSLVGSKSRLIGPNCPGVMTAGECKIGIMPANIFKQGSVGIVSRSGTLTYEAVF
FT                   QTTSEGLGQTTAVGIGGDPVKGTEFIDVLEMFLADDKTTSIIMIGEIGGSAEEEAAQFL
FT                   IDEAKRGRKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKTSAMEAAGITVSPSP
FT                   ARLGKTLVEVLKG"
FT   gene            611893..612579
FT                   /locus_tag="RPD_0540"
FT   CDS_pept        611893..612579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0540"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37778"
FT                   /db_xref="GOA:Q13DR1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR1"
FT                   /protein_id="ABE37778.1"
FT                   /translation="MRDFDGVSVATVVASPTSASPHSGGHMPDFPELSFLPLSTATWPL
FT                   LEDLFGPERGADSGCWCMWWRVSRSRFNAMGKDARKAALQELSASDESPGILAVRDGQA
FT                   IGWCAVARRSAYPVLTRSRVAAPIEDLSPEKIWFISCLYVRVGFRRHGLSGPLIRAAVD
FT                   HALARGALCIEACPTTSATTSAEGFVGSSATFADLGFVEIARRSPKRPLMRWTRTSGLV
FT                   EAARGA"
FT   gene            complement(612634..613737)
FT                   /locus_tag="RPD_0541"
FT   CDS_pept        complement(612634..613737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37779"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR0"
FT                   /protein_id="ABE37779.1"
FT                   /translation="MLLSAKGVLEVASLNDLLARAELNSPDTSYGQDIDAANTVLLDPL
FT                   KTHEERHAAFLAWAARYQPCLFGRFGSREMQGIGIDTCWIDENEIALGDGFVSRKIQKA
FT                   RQEWKERAAAGIAHGFLIMFNGPRLARLKPGIDLLEICERIADLYLIEHAPIKRDVIYT
FT                   ESVPLRGASLSVFKAGINIFYPSAHRTRNHDRRIPGGLMISVNSPGHWANSLVMRGLAP
FT                   SLDEAVGRVLDIALRSIGNGGIGHDGTPSASWHNRENNPDCLMRRRQLSKLPHYVPEDY
FT                   SQRFYSALYHTDVLVPTDVTIDGTIDPDIDASEHWNHLIIDYISEQERTPDHINYALFH
FT                   GHPIPDEALYHNPWSPRRAVNSPLSSS"
FT   gene            613913..614425
FT                   /locus_tag="RPD_0542"
FT   CDS_pept        613913..614425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0542"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37780"
FT                   /db_xref="GOA:Q13DQ9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ9"
FT                   /protein_id="ABE37780.1"
FT                   /translation="MRKVGNMLGAVSIVLADEIWAAVNDTLETSGETAAALIMLGAHPG
FT                   IPIKELGRALALSHSGAVRLVDRLEKEGVVRRKEGRDARTVLLHLTPAGTKLRRSVLKE
FT                   RARVLERALAVLSAEEVRVLGAYLDRMLRGLLTERRLGYRFCRMCEEECCVPHDCPVDA
FT                   KWKELSE"
FT   gene            614527..615342
FT                   /locus_tag="RPD_0543"
FT   CDS_pept        614527..615342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0543"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37781"
FT                   /db_xref="GOA:Q13DQ8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ8"
FT                   /protein_id="ABE37781.1"
FT                   /translation="MSRDLLNTVPPSQLLVIQLTASVAALAGLALPNMPWRYRSRGMLR
FT                   ASAIGILEPGLTYSIGLIGLSLTTAGSASIIGATEPIMIVLIAWLFLSQRPSPRLAVCI
FT                   VIAVIGLLMVSGETLFRPGQGNALGDGLIVLATVSAASYVVLSAKVAAHFPAATLAMAQ
FT                   QLAGLAFVFAVFVVVQAFGLERPILAELSLSIVAYAAVSGIIQYAIAFWLYLIGLRYLT
FT                   PGAAGLWLTLVPVFGIFGAFVWLDEIPTPVMLAGAALIIGAVLIGKAEK"
FT   gene            615785..618742
FT                   /locus_tag="RPD_0544"
FT   CDS_pept        615785..618742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0544"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37782"
FT                   /db_xref="GOA:Q13DQ7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ7"
FT                   /protein_id="ABE37782.1"
FT                   /translation="MSRQDANAAFALSSFLQGANATYIDDLYSRYENDPSSVDADWQAF
FT                   FKSLKDNPGDIQKNAEGPSWGQANWPLTPRDDLTSALDGNWAQVEKTVGQKIQTKAQTR
FT                   GVELSPADVNQATRDSVRALMLIRAYRMRGHFHAKLDPLGLSPPKDHEELDIRSYGFTE
FT                   ADLDRKIFLDHVLGLEYGSLREIVAICERTYCQTMGIEFLHISNGAQKAWLQERIEGPD
FT                   KEISFTREGRRAILMKLVEAEGFERFCDLKFTGTKRFGLDGGESLIPALEQIIKRGGNL
FT                   GVREIVLGMPHRGRLNVLTQVMGKPHRALFHEFKGGSANPDEVEGSGDVKYHLGASSDR
FT                   EFDHNKVHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDLPEERLSVLPLLMHGDAAFAG
FT                   QGVVAECFGLSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHV
FT                   NGDDPEAVVFAAKIAVEYRQKFHKPVVIDMFCYRRHGHNEGDEPAFTQPMMYRKIAGHP
FT                   SALELYSKRLIADGVITEGEVEKAKADWRARLDAELEAGSSYRPNKADWLDGKWAGFKS
FT                   ADQEEDPRRGITGVDLAQLKDIGRKITKVPEGFRVHRTVARYLENRAKAIDSGVGIDWA
FT                   TGEALAFCTLLQEGHRVRLSGQDSERGTFSQRHSVLFDQEDETRYTPFNHLTPEQGHYE
FT                   VINSLLSEEAVLGFEYGYSLAEPNALTIWEAQFGDFANGAQVLFDQFISSGERKWLRMS
FT                   GLVCMLPHGYEGQGPEHSSARLERFLQMCAEDNMQVVYATTPANFFHVLRRQLRREIRK
FT                   PLILMTPKSLLRHKRAVSRLDELGPDTSFHRVLADDAQLLPDEKIKLAPDNKIRRVVIC
FT                   SGKVYYDLYEEREKRGVDDVYLLRVEQLYPVPLKTLVQEMSRFKEAELVWCQEEPRNMG
FT                   AWHFIEPYLEWVQNQAGATHRRPRYVGRPASAATASGLMSKHLAQLKAFLDEALR"
FT   gene            618849..620150
FT                   /locus_tag="RPD_0545"
FT   CDS_pept        618849..620150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0545"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37783"
FT                   /db_xref="GOA:Q13DQ6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ6"
FT                   /protein_id="ABE37783.1"
FT                   /translation="MTDIRVPTLGESVTEATIGRWFKKQGDAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLGEIIAKDGETVAVGALLGQISEGGGAAKPAAKDTPKATAAVAPETTTGR
FT                   PDLKTDTTKPINAGPEEVRPKPELKTPPSDAPQAPSVRRLSSESGVDAATVPGSGKDGR
FT                   VTKGDMLAAIEKAASAPTPVNQPAAAMQVRAPSPADDAAREERVKMTRLRQTIARRLKE
FT                   VQNTAAMLTTFNEVDMTNVMALRAQYKDVFEKKHGAKLGFMGFFTKACVQALKDIPAAN
FT                   AEIDGTDLIYKNYYHVGVAVGTDKGLVVPVVRDCDEKSIADIEKSIADFGKRARDGQLK
FT                   IEEMQGGTFTITNGGIYGSLMSTPILNAPQSAILGMHKIQERPVAIGGKVEVRPMMYLA
FT                   LSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL"
FT   gene            620210..620611
FT                   /locus_tag="RPD_0546"
FT   CDS_pept        620210..620611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37784"
FT                   /db_xref="GOA:Q13DQ5"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ5"
FT                   /protein_id="ABE37784.1"
FT                   /translation="MQPMPIEITVLGWSVVLLIVQMFLASVPAMLELGGPYQAGPRDEG
FT                   KVAQGRFAGRANRAFRNLLETYPAFVALALALAVTGKTGGYAATAAVIWLVARVLYAPL
FT                   YIIEIPFARSLVWFVALLALIAMLIRLMS"
FT   gene            620619..621365
FT                   /locus_tag="RPD_0547"
FT   CDS_pept        620619..621365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0547"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37785"
FT                   /db_xref="GOA:Q13DQ4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ4"
FT                   /protein_id="ABE37785.1"
FT                   /translation="MNDRVVVITGGSRGIGRATALAAAARGFKVVVGYASNEEAARTVV
FT                   SEIEARNGKAIAVKCDVGSEPDILALFAAADQFGTLGALVNNAGIVGPTTRVDEMSAER
FT                   IQRMMAVNVTGSILCAREAVKRLSTRHGGPGGVIVNLSSVAAKLGSPNTYVDYAASKGA
FT                   IDSFTVGLGHEVAGEGIRVAAIRPGLIDTDIHASGGDPDRAHRLSANVPMQRVGRAEEI
FT                   ANAIVWLMSDEASYVTSAILDVSGGR"
FT   gene            621392..621646
FT                   /locus_tag="RPD_0548"
FT   CDS_pept        621392..621646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37786"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ3"
FT                   /protein_id="ABE37786.1"
FT                   /translation="MPVVAMVDGVKIEFYPDEHPPPHFHARYAEHVAQIEIRTAKVLRG
FT                   SLPPAKLGRVLSWASRHYMGLMDAWTAVEELRKPEKIDD"
FT   gene            621639..621929
FT                   /locus_tag="RPD_0549"
FT   CDS_pept        621639..621929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37787"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ2"
FT                   /protein_id="ABE37787.1"
FT                   /translation="MTEIVAIQSAEPVIFGVLKIVWSDGFEGVVDLRPLIAKGEMFEFL
FT                   RAAPARFATVQREPYGHKIFWLDDQGDEIDFGSSSLRQRAERQAGLLHLAS"
FT   gene            621944..623347
FT                   /locus_tag="RPD_0550"
FT   CDS_pept        621944..623347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0550"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37788"
FT                   /db_xref="GOA:Q13DQ1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ1"
FT                   /protein_id="ABE37788.1"
FT                   /translation="MATYDLVIIGTGPGGYVCAIRAAQLGLKVAVVEKNATLGGTCLNV
FT                   GCMPSKALLHASELFEEAGHSFAKMGIGVPAPTLDLPAMMNFKQQGIDGNVKGVEYLMK
FT                   KNKIDVLVGRGRVLGAGKVEVTGNDGKAQTVETKSIVIATGSDVAKLKGIAIDEKRVVS
FT                   STGALSLDKVPERLIVVGAGVIGLELGSVWRRLGAQVTVVEFLDRILPGMDSEIVKQFQ
FT                   RILEKQGFAFKLGAKVTGVDSSGAKLAVKVEAAAGGNPETLEADVVLVAIGRVPYTEGL
FT                   GLKEAGVALDERGRVVIDNHFATSVKGVYAIGDVVRGPMLAHKAEDEGVAVAELLAGKA
FT                   GHVNYDVIPGVVYTTPEVSSVGKTEEDLKQAGIAYTVGKFPFTANGRSKVNQTTDGLVK
FT                   ILADAKTDRVLGVHIVGREAGELIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAAL
FT                   AVGKRAIHM"
FT   gene            623344..623925
FT                   /locus_tag="RPD_0551"
FT   CDS_pept        623344..623925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37789"
FT                   /db_xref="GOA:Q13DQ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ0"
FT                   /protein_id="ABE37789.1"
FT                   /translation="MKSAGIVRKPDDIMKRRLLQPLWFILAVLFLIEAWLWEHLEPWVA
FT                   RIVAAIPLRELKAWTAERVEHLSPPMALIVFVVPLIPLYPFKLFALWLMATQHFIAGLI
FT                   AFALAQFVGLGLIAFIFDVTKPKLMQMAWFVRAYQFVLTVKAKAREIVAPVMARIRVGL
FT                   ADLLRGDGSGWSARALRRIGALRRRIRAER"
FT   gene            complement(624018..624608)
FT                   /locus_tag="RPD_0552"
FT   CDS_pept        complement(624018..624608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37790"
FT                   /db_xref="GOA:Q13DP9"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DP9"
FT                   /protein_id="ABE37790.1"
FT                   /translation="MGAHESMEHAEHAEHASGSNKNIALLISVIALFLAFSETLGKASQ
FT                   TESIAKNVEASNLWAFFQAKSIRRTVVQTVSEEARLSMGTIGDAAAKAALQKQIEEWQK
FT                   TAQRYRSEPETGEGSEQLAERAKHAEHARDLAQARYHHYELASAAFQIGIVLASATIIT
FT                   GMLALAWISGLLALTGLGFTAIGLFAPHAVHLF"
FT   gene            complement(624737..625726)
FT                   /locus_tag="RPD_0553"
FT   CDS_pept        complement(624737..625726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0553"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37791"
FT                   /db_xref="GOA:Q13DP8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DP8"
FT                   /protein_id="ABE37791.1"
FT                   /translation="MRPDSFMAKAQPAPAPIELACASADLNAEFTRWLSHLRAERRLSG
FT                   KTLEAYARDLRQFLIFLAGHWGGVVTLGRFARLEATDVRAFMAARRGDAIAGRSLMRAL
FT                   AGLRSFGRFLEREGKGSVGALSSVRAPKIKKSLPKPIQIAAAKRLADADERAGEDRETW
FT                   ILVRDAAVMALLYGSGLRISEALGLRRRDVPAPGKGDTLIVLGKGNKTRMVPVLQNVLA
FT                   QIADYASACPHPLPPDGPMFVGARGGPLSPRIIQLAMERLRGSLGLPDSATPHALRHSF
FT                   ATHLLTRGGDLRAIQELLGHASLSTTQVYTGIDTERLLEVYNSAHPRA"
FT   gene            625901..628108
FT                   /locus_tag="RPD_0554"
FT   CDS_pept        625901..628108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0554"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37792"
FT                   /db_xref="GOA:Q13DP7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DP7"
FT                   /protein_id="ABE37792.1"
FT                   /translation="MDDSRTSPTSNASTRVVDVQVPVAVDQAYSYRVPRGLDLKPGDVV
FT                   AVPLGPREVLGVVWAENPNPDPRLHNRLKDVAEKLDVPPLREELRRLVDWVANYTLSPR
FT                   GQVLRMTLRMGELGPERQRMGVRLVGPPPQRMTPARRRLIEILSDGLLHGKSDVAKEAG
FT                   VSPGVIDGLVDEGTLHVEAMPREPAAPTPDPDFAPADFSPEQARAAETMRELVKPGGGF
FT                   QAALLDGVTGSGKTEVYFEAVAEVVRQGRQCLILMPEIALTGQFLDRFALRFGVRPLEW
FT                   HSELTPRTRARNWAAIAAGEAQVVVGARSALFLPYADLGLIIVDEEHDQAYKQEDGAHY
FT                   HARDMAVVRASIARIPIVLASATPSVETEVNARKGRYRRIPLPSRFGGQHMPQIEAIDL
FT                   RREPPMRGRFISPRLAEQVGHAIERREQALLFLNRRGYAPLTLCRACGHRFACTICDAW
FT                   LVDHRFRQRLVCHHCGFSMPRPLQCPHCAAEQSLVAVGPGVERLQEEASSLFPDARTMV
FT                   LSSDLITSIEAMRSELNDIAEGRVDIIIGTQLVAKGHNFPRLNLVGVVDADLGLSNGDP
FT                   RAAERTFQLLNQVIGRAGRDQGRGVGFLQTHQPEHPVMKALVACDREAFYASEIEARER
FT                   TLYPPFGRLASLIISAGDRPTAEGFARQLASSAPVDERVQVLGPAEAPLAVIKGRYRFR
FT                   LLVKSVRSFDLSNYLRQWLAQGPKTKGNLKLEVDVDPQSFL"
FT   gene            complement(628269..628748)
FT                   /locus_tag="RPD_0555"
FT   CDS_pept        complement(628269..628748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0555"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37793"
FT                   /db_xref="GOA:Q13DP6"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DP6"
FT                   /protein_id="ABE37793.1"
FT                   /translation="MTDTKKSPPGLVTRPRTAFALIAATVLMSGAAATEASARSKRHHH
FT                   HAHHNNAQNDWRDANAALGSGGRSFSGVASYYGNESGNRTASGQRMNANAMTAAHRSLP
FT                   FGTKLRVTHGGRSVVVTVNDRGPFIRGRVLDLSTGAARAIGLTSRGVGRVVAEVM"
FT   gene            629384..629944
FT                   /locus_tag="RPD_0556"
FT   CDS_pept        629384..629944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0556"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37794"
FT                   /db_xref="GOA:Q13DP5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP5"
FT                   /protein_id="ABE37794.1"
FT                   /translation="MASEDPSVSGVSGRYATALFELARDEKVIDAVKADLDKFSAMLVE
FT                   SPELLRLVRSPVFGAEAQTKALGAVLDKAGIAGISANFLKLLAANRRLFVVADVIGAYR
FT                   ALVARFKGEATADVTVAETLSDKNLEALKLALKSVTGKDVTLNINVDPAIIGGLVVKLG
FT                   SRMVDSSIRTKLNSIKHAMKEAG"
FT   gene            629944..631476
FT                   /locus_tag="RPD_0557"
FT   CDS_pept        629944..631476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0557"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37795"
FT                   /db_xref="GOA:Q13DP4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP4"
FT                   /protein_id="ABE37795.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVLAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRSIVDTPVGKGLL
FT                   GRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAVGQKRSTVAQFVKVLE
FT                   EQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDHGSGSLTALPIIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDALP
FT                   VAKVRSFEDGLLSLLRGKESAILDAIRTSRDLSDDTAAKLKAVIESYAKTFA"
FT   gene            631618..632493
FT                   /locus_tag="RPD_0558"
FT   CDS_pept        631618..632493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0558"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37796"
FT                   /db_xref="GOA:Q13DP3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP3"
FT                   /protein_id="ABE37796.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPY
FT                   AEKMDAVISNIAGAAAGSPGAPVLLAGTGKDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RAYALMNQGKTVKFFCVGRKGYEQLRRTFDKQIIENIELRSVRQLGFVNAEDIAQKVIA
FT                   RFNNGEFDVCTLFYSRFKSVISQIPTAQQLIPLVVEAPAAGSVATSYEYEPEEDEILST
FT                   LLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGDMIRKQTLIYNRTRQAMITKEL
FT                   IEIISGAEAI"
FT   gene            632564..633994
FT                   /locus_tag="RPD_0559"
FT   CDS_pept        632564..633994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0559"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37797"
FT                   /db_xref="GOA:Q13DP2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP2"
FT                   /protein_id="ABE37797.1"
FT                   /translation="MATPANQTGRITQVIGAVVDVQFEGHLPAILNAIETKNGDNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVTDTGSPIMVPVGIGTLGRIMNVIGEPVDEQG
FT                   PVANEGLRPIHAEAPLYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVAKAHGGYSVFAGVGERTREGNDLYHEFIESGVNKKGGGEGSKCALVYGQMN
FT                   EPPGARARVALSGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
FT                   TLATDMGALQERITTTHKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEK
FT                   GIYPAVDPLDSTSRMLSPLIVGEEHYQTARMVQQVLQKYKSLQDIIAILGMDELSEEDK
FT                   LAVARARKIERFLSQPFFVAEIFTGSPGKFVDLADTIKGFRAICEGKYDHLPEAAFYMV
FT                   GAIEEAVEKGKKLAAEAA"
FT   gene            634081..634536
FT                   /locus_tag="RPD_0560"
FT   CDS_pept        634081..634536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0560"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37798"
FT                   /db_xref="GOA:Q13DP1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP1"
FT                   /protein_id="ABE37798.1"
FT                   /translation="MDPRVKPAGDSRESSSMATFHFDLVSPEQVAFSGEVDQVDIPGAE
FT                   GDFGVLAGHAPVVAVIRPGILTVTAGGAQQKIVVLGGIAEVSEKGLTVLADVATAVADL
FT                   DMQDFAATIATMEQQLPGKVGDVLDRSIERLDHYKSIQHQISTTAMH"
FT   gene            complement(634798..635307)
FT                   /locus_tag="RPD_0561"
FT   CDS_pept        complement(634798..635307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0561"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37799"
FT                   /db_xref="GOA:Q13DP0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DP0"
FT                   /protein_id="ABE37799.1"
FT                   /translation="MSETPPARSLPYRRNVGIALFNAEGRVLIGRRFRDDGPEIILPGL
FT                   EWQMPQGGIDADEEPRDAVMRELWEETGVRHAEILGETDWVTYDFPPYDGPPHRLGVFC
FT                   GQRQKWFALRFTGDEAEIDPLAVRNDMPPEFDAWRWEQLDRVADLVVPFRRDVYREVAR
FT                   SFARFV"
FT   gene            complement(635304..636251)
FT                   /locus_tag="RPD_0562"
FT   CDS_pept        complement(635304..636251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0562"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37800"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN9"
FT                   /protein_id="ABE37800.1"
FT                   /translation="MRLSRRILVSGGAGFIGSHLCDRLLAEGHEVLCVDNYFTGWRRNI
FT                   EHLVGTPRFEVMRHDVTFPLYVEVDDIYNLACPASPVHYQHDPVQTLKTSVHGAINMLG
FT                   LAKRTRAKIFQASTSEVYGDPTVHPQPESYWGHVNPLGIRACYDEGKRAAETLFFDYHR
FT                   QHKVKIKVARIFNTYGPRMHPRDGRVVSNFIVQALSGDDITIYGDGSQTRSFCYVTDLL
FT                   DGFARLMATGDGFIGPVNLGNPVEFSMRELAEMVIAMTDSKSKLVYLPLPSDDPKQRQP
FT                   DITLARRELGWEPKVALADGLKETIGYFRKLLAS"
FT   gene            636526..637596
FT                   /locus_tag="RPD_0563"
FT   CDS_pept        636526..637596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37801"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN8"
FT                   /protein_id="ABE37801.1"
FT                   /translation="MTAPVDISNARILEIGGGYFKLQYPERTTCLWTWTKLTNDFGPLD
FT                   GFSTPDRIWRELRAAAEGKYDVVVVNTLRYSPWHPRYWARGMFYTPKSPWASLTRQFGP
FT                   SVLRWLNVPVPLIAVEMDDSFGISKSSVFLLDKAKAYFKRELPADKWQVLAGTIHPHLP
FT                   TLRYRRSEKWRRRIDRLQPISLPQFRFDQRWRDAPFPEKTHDIFFSGAVEGNSTVRAAG
FT                   LPELERLRAMGVRIDQPTERLPYDAFMERMSHSWLAWSPEGMGWDCYRHYEAPLVQAVP
FT                   LMNNPTILRYAPLLSGVHGVYYDIEPGGLVRAVTAALADKDKLRAIAVAGREHVLAHHT
FT                   VKAHCDHILQAALAGR"
FT   gene            complement(637751..638254)
FT                   /locus_tag="RPD_0564"
FT   CDS_pept        complement(637751..638254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0564"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37802"
FT                   /db_xref="GOA:Q13DN7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DN7"
FT                   /protein_id="ABE37802.1"
FT                   /translation="MARYEDLPYRTCVGMMLINREGLVFIGRRAGGIEHVDDTHVWQMP
FT                   QGGVDPGEDTWEAAKRELYEETNVRSVEKIGEVPDWLIYDIPRTVAGRAWKGRYRGQRQ
FT                   KWFAVRFTGADSEIDVGAPGGHKPEFTGWRWEPMQNLPDLIVPFKRPVYERVVKEFSQL
FT                   AVAV"
FT   gene            complement(638389..639624)
FT                   /locus_tag="RPD_0565"
FT   CDS_pept        complement(638389..639624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0565"
FT                   /product="protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37803"
FT                   /db_xref="GOA:Q13DN6"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN6"
FT                   /protein_id="ABE37803.1"
FT                   /translation="MSVSADELSTPLGQKRGRLRRFRLPFTITQAIATLLGVFLLGFLG
FT                   FALFNNDPLGGEPTVQVMIKPPAPDEKKEAAAPADKSSAAKAAKSEFAEAKDGKDAVQP
FT                   GQKTITIIDGSKGTRQDVVVSSGSGDDKVDAPPAEPAMANGINPKLLEQSRYGMIPVAA
FT                   GALKPVSAYAMTTDADRAKAEKMPTIAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYG
FT                   SDPGKLVEQARAKQHEVLLQIPMEPFDYPDNDPGPQTLLTSGAPEQNLDRLTWHLSRIQ
FT                   GYVGLSNFMGARFVATDAAMQPIIREAAKRGLGYLDDGSAPRSVAPSLAKSLAMPFARA
FT                   DSAIDAVPTAAEIDKALARLEALAKERGSAVGTASALPVSIERIVSWSKSLESRGILLV
FT                   PLTMAMLKSKST"
FT   gene            complement(639784..641154)
FT                   /locus_tag="RPD_0566"
FT   CDS_pept        complement(639784..641154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0566"
FT                   /product="C-terminal processing peptidase-3. Serine
FT                   peptidase. MEROPS family S41A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37804"
FT                   /db_xref="GOA:Q13DN5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN5"
FT                   /protein_id="ABE37804.1"
FT                   /translation="MMRKTSVILLSAVTGAALTLFVTQPRSVLMGSTARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLVESAISGMLTGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASKAGIMANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIRLKIVRKGQDNPIEVTLVRDNIRVRSVRARVESDDIGYIRITTFNEQTTEGLKKE
FT                   ISNLTSQIGADKLKGFILDMRNNPGGLLEEAVTVSDAFLDRGEIVSTRGRNAEETQRRS
FT                   AHSGDLTKGKPVIVLINGGSASASEIVAGALQDHKRATLVGTRSFGKGSVQTIIPLGSG
FT                   NGALRLTTARYYTPSGKSIQARGITPDIEVLQDVPDDLKARTDTKGEASLRGHLKGADG
FT                   DEKTGSQSYVPPDAKDDKALKTAADLLHGIKATVTAPAPVTGDKAAIDKPAANKAAN"
FT   gene            complement(641151..642566)
FT                   /locus_tag="RPD_0567"
FT   CDS_pept        complement(641151..642566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0567"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37805"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN4"
FT                   /protein_id="ABE37805.1"
FT                   /translation="MHHPLSMAAKDDTPGAGWQSVALLSASLVSGGFAAQLPSGLLASG
FT                   LGMLLPCAIITATQAQPAAAPSPTTDLIRQREQELEAARQQQKRASELQDKLRADLAAI
FT                   GEDRTKLNQQLIDIAAKVRAVESKISETEARLGPLDARETQIRTSLERRRGEIGEVLAA
FT                   LQRAGRRAPPALLVRPEDALQSLRTAILLGAVVPDLRDRADRLATDLGELIAVRKTIAA
FT                   ERDQLADDRAAMTADQTRLAALIDERQRKQSAVEKDIETERSRALTLSRQVDSLQGLIA
FT                   KMEQDLKSAAKAAAAATQKGSPVALNGQPNLAALKDPGRLSPAIAFASAKGMLAFPVNG
FT                   SRIREFGRADGVGGVERGISLSTRAGAQVTTPCDGWVVYAGPFRSYGQLLILNAGGGYH
FT                   VLIAGMERISVNIGQFVLTGEPVATMGSTSQVASILAANASQPVLYIEFRKDGTPIDPG
FT                   PWWAANEGEKVRG"
FT   gene            complement(642586..643143)
FT                   /locus_tag="RPD_0568"
FT   CDS_pept        complement(642586..643143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0568"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37806"
FT                   /db_xref="GOA:Q13DN3"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DN3"
FT                   /protein_id="ABE37806.1"
FT                   /translation="MRFAGGAFRWRRVANEAAQRERPRPMRLTVIAIGKLKQGPERELA
FT                   ERYRGRFDDLGRKLGFRGLDIHEIAESRARDAAGRMAEEAAAIAALIAEGSSLVTLDER
FT                   GKSVDSAAFAAQLGRWRDESVPGTIFVIGGADGLLPELRRKAKLCLSFGAATWPHQMVR
FT                   VMLLEQIYRAATILAGHPYHRA"
FT   gene            complement(643190..643822)
FT                   /locus_tag="RPD_0569"
FT   CDS_pept        complement(643190..643822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0569"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37807"
FT                   /db_xref="GOA:Q13DN2"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN2"
FT                   /protein_id="ABE37807.1"
FT                   /translation="MSKADLPKSVAEEIVPAKTVKAKTAKAKTATSKTAASKTAASKTA
FT                   AASKTAAASKTSASKTPASKTPASKTAASKTAASRSAKAEATPPDAISTTHGTAEETLQ
FT                   LILSRLDDMKAEETVAIDLRGKSAMFDYVVVTSGRVNRHVGAISENVSKALKEAGISKI
FT                   HVEGLTNCDWVLMDCGDVVLHVFRPEVREFYNIERLWTQGPQPAKTL"
FT   gene            complement(644041..644670)
FT                   /locus_tag="RPD_0570"
FT   CDS_pept        complement(644041..644670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0570"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37808"
FT                   /db_xref="GOA:Q13DN1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN1"
FT                   /protein_id="ABE37808.1"
FT                   /translation="MTPDPVAARRAIPAYSPGMRIGLLGGSFNPPHEAHRAISRFALTR
FT                   LKLDRIWWLVSPGNPLKDVSGLRELDARAAAAQAVADDPRIQVSCLEAAIGTRYTADTI
FT                   DYLLQHCPGAHFVWIMGADNLAQFHRWQRWRRIADSLPIAVIDRPPATFRALAAPAAQT
FT                   LKRYRLPSTAAASLADRPAPSWIFLTGLKSPLSSTSLRNPDGSWKK"
FT   gene            complement(644701..645993)
FT                   /locus_tag="RPD_0571"
FT   CDS_pept        complement(644701..645993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0571"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37809"
FT                   /db_xref="GOA:Q13DN0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DN0"
FT                   /protein_id="ABE37809.1"
FT                   /translation="MTASLKANDGSAELAALMTDLGRRARAAARVLALAPPEQKNRALE
FT                   AMERAIRAGAAAILDANAEDVADAKGSGANSAFLDRLTLTPARVEAMAEGIAVVRGIAD
FT                   PVGAVTESWQRPNGMTIERVRVPLGVVAVIFESRPNVTADAGVLCLKSGNAVILRGGSE
FT                   SFRSGRAIHACLVQGLREAGLPEAAITLVPTRERAAVGLLLGGLNGTVDVIVPRGGKSL
FT                   VARVESEARVPVFAHLEGINHVYVDRTADLDMAKSIVLNAKMRRTGVCGAAETLLIDRA
FT                   AADTHLAPLVGMLIDAGCEVRGDDAVQRADARVKPATDQDWDTEYLDAVIAAKVVDDVD
FT                   DAITHIHEHGSHHTDAIVAEDAKTAAKFLGEVDSAIVLHNASTQFADGGEFGFGAEIGI
FT                   ATGKFHARGPVGAEQLTTFKYRIHGTGQTRP"
FT   gene            646116..646400
FT                   /locus_tag="RPD_0572"
FT   CDS_pept        646116..646400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0572"
FT                   /product="Protein of unknown function UPF0156"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37810"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM9"
FT                   /protein_id="ABE37810.1"
FT                   /translation="MAGSYKLDEHSEAFVEGLVASGRFETAGDVLRESLRLMEAREAKL
FT                   DALRAEIQQGLDSGPMEEFDPKTLMEDIKRRGRERLAADRAVAAQKRGA"
FT   gene            646390..646689
FT                   /locus_tag="RPD_0573"
FT   CDS_pept        646390..646689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0573"
FT                   /product="plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37811"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM8"
FT                   /protein_id="ABE37811.1"
FT                   /translation="MAHNRRISPKARVDLDAIWSFIAADSEKAADAMIEQITAAFAMLT
FT                   DNPNAGRLRPEISAAVRSFPVKRYLIFYVAEASGIKIIRVLHGRQDRSRQDLAP"
FT   gene            complement(646692..647822)
FT                   /locus_tag="RPD_0574"
FT   CDS_pept        complement(646692..647822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0574"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37812"
FT                   /db_xref="GOA:Q13DM7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DM7"
FT                   /protein_id="ABE37812.1"
FT                   /translation="MARPKLHDFRRLVVKVGSSLLIDSGAGEVRADWLAALAADIAELH
FT                   RGGRDVMIVSSGSIALGRSRLKLPRGALKLEESQAAAAVGQIALARTWSEVLGSHGIGA
FT                   GQILVTLQDTEERRRYLNARSTIAKLLEWRAVPVINENDTVATNEIRYGDNDRLAARVA
FT                   TMASADLLILLSDIDGLYTAPPGSNPDAKLIPEVESVTAEIESMAGAAGSELSRGGMRT
FT                   KIEAAKIATSAGTHMLIASGKIDHPLKAIAEGGPCTWFLTPANPVTARKRWIAGSLEPK
FT                   GTLTIDAGAVSALRAGKSLLPAGVIRVDGQFARGDAVIVRGPDTHEIGRGLVAYDADDA
FT                   DRIKGRSSPDVMMILGISGRAEMIHRDDLVVGTAPG"
FT   gene            648321..649289
FT                   /locus_tag="RPD_0575"
FT   CDS_pept        648321..649289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0575"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37813"
FT                   /db_xref="GOA:Q13DM6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM6"
FT                   /protein_id="ABE37813.1"
FT                   /translation="MAAFPEALRGSGLSEPEHQGELCTVLRLLGAADLSIARLIEGHIN
FT                   AIALVCRYGTQAQQASLASDVGDGALAAVWGADDAAGLKIVTDGSRAELVGRKILASGA
FT                   GFVTRPIVTAKAGEDQLMCLLRLAPDHPVDLSGWTAQGMRSTATGAVDLTGIPIGSDEI
FT                   VGSAGDFMRQPWFSGGAWRFCAAHLGATERLVELFRDHLISRGRAEDPYQLQRVAGCVA
FT                   AARTARFWVEEAARRFGGGDCNPDATVAFANMTRMVTERSALDVMETVQRGAGLLAFIR
FT                   PDPIERICRDLSTYLRQPVPDLAMSNAARAWLNSSAPTGEF"
FT   gene            649290..650075
FT                   /locus_tag="RPD_0576"
FT   CDS_pept        649290..650075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0576"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37814"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM5"
FT                   /protein_id="ABE37814.1"
FT                   /translation="MNASEYLDGVRHLPLGSLSDLTGGAPWVLLSPHPDDESLGAGGLI
FT                   AAACDAGERVDVVLITDGGASHPQSQQYPRQRMIELRRTELENATSILGLPRDQLHHLG
FT                   LPDTQAPTEGPPFEAAVDAIAAICAHAGAKSLFVTWDGDPHCDHEASARIAEAVCRRNP
FT                   GIALWAFPIWGWHLDPSLPLDRPPPRGFRLDISAQRARKRAAINAHVSQMTGLIDDDPN
FT                   GFRFTDDRLAPFLGQFEHYLKVSPHEPKNRDDPGGILRE"
FT   gene            650029..650607
FT                   /locus_tag="RPD_0577"
FT   CDS_pept        650029..650607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0577"
FT                   /product="Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37815"
FT                   /db_xref="GOA:Q13DM4"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM4"
FT                   /protein_id="ABE37815.1"
FT                   /translation="MSRRTETIPAEYFENKYRSDIDPWRFRSSDYEREKYQSTIGALGR
FT                   QRFDEALEVGCSIGVLSAQLARHCVALTAIDASSTAIAAARAAAPANVSFAVATLPQDF
FT                   PSGCFDLIVLSEVLYYFSQADLLSVAQRCVEALRPEGEIIQCHWLGETDYPLTGRDASD
FT                   QFATTVATRLPVRTVVRDEIYRLERLSAR"
FT   gene            complement(650456..651715)
FT                   /locus_tag="RPD_0578"
FT   CDS_pept        complement(650456..651715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0578"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37816"
FT                   /db_xref="GOA:Q13DM3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM3"
FT                   /protein_id="ABE37816.1"
FT                   /translation="MKADRLAARGSAVVAIPAHDEAQRIHRCLSALAMQRDEVGAPIRA
FT                   GAFEILVFANNCTDATPDVVRTFAASVPHPILVIEAQLPPGQRSAGAARKHAMDLAAAR
FT                   LNERGAFDGVILTTDADSCVAPTWFAATMRELQSGVDCVAGYIDAEPFEIVSLGDAFLA
FT                   RGRLEDTYLRLLAEIDARCDPRPHDPWPNHRVSSGASLALTLAAYEAVGGLPPRPVGED
FT                   VALTAALEHFGFKVRHSMAVSVSTSCRLDGRAQGGAADTMRLRHAETNAPCDDDLEPAL
FT                   QATRRAIYRGRLRRLLAERPKRPDLPRGWRISNATMELLTQPCVPFADAWQRISNDSPA
FT                   LRRGAPLRPSDLPRQIAIARMVLRQLRLEVSAPTIAPADISRHARRFEPAAEWRPWSRI
FT                   DHSRRVRSADNPSRPANGTE"
FT   gene            complement(651830..652654)
FT                   /locus_tag="RPD_0579"
FT   CDS_pept        complement(651830..652654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0579"
FT                   /product="exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37817"
FT                   /db_xref="GOA:Q13DM2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM2"
FT                   /protein_id="ABE37817.1"
FT                   /translation="MAPSGSRSSSVGRVKIATFNINNVNKRLPNLLQWLRAAKPDIVCL
FT                   QELKAEQRKFPEQALHDAGYNAAWVGQKTWNGVAILARKRSLIVTQTKLPGDADDQQAR
FT                   YIEAAIGGILVGCVYAPNGNPQPGPKFDDKISWMKRLNRHAGKLLASGAPVVIAGDFNV
FT                   APTALDIYPTKSWNEDALIQPESRRAYAKLLGQGWTDAVRALHPDQRVYTFWTYWRNRF
FT                   ERDDGLRLDHLLVSPELASRLFAAGVDRAVRAREGASDHAPAWIVLKAPSPR"
FT   gene            complement(652934..653887)
FT                   /locus_tag="RPD_0580"
FT   CDS_pept        complement(652934..653887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0580"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37818"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM1"
FT                   /protein_id="ABE37818.1"
FT                   /translation="MPKDIIARHSTLVLARATRTCRRHHKEIDLPIDRNALGATRSATN
FT                   VITPRWVLAYASALGLSSESYLDDSRPSTLIIPPTFCVCLEWTLSDMERGVSSLGLRAD
FT                   EQRGSVHALQDSRFERPLKLGMRVRTDSRVEYIGRTSAGAYVLTSFRHTDDETGDRLIT
FT                   SYSGAILRGVDFADAPLGELPSDLADESASGLAQISLPALQLERTLPHIYSECARIWNP
FT                   IHTETAVARAVGLDDIIVHGTLTWALAAREICRSVDASDLGRLGRLSAQFRAPLVAGRT
FT                   MTIRPNEIQANGQLRFSAVNEQGRTILANGLLEILH"
FT   gene            complement(653893..655473)
FT                   /locus_tag="RPD_0581"
FT   CDS_pept        complement(653893..655473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0581"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37819"
FT                   /db_xref="GOA:Q13DM0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM0"
FT                   /protein_id="ABE37819.1"
FT                   /translation="MIWDQYDTTLGRAIKTTAQRARDATAIIFDERSGARSLSWMDADE
FT                   QSDRIAVWLHRQGIERGDRVGVMCTVRSEYILIYMACVKLGAVLVGVNALYKGQEVSQL
FT                   VARTSPKILFVVERDGDRPVCDEIAEVLADGGGCRVVKLHTDQPQQGLLFDAIAETPTS
FT                   EQRHWLAQRIAEIDPDDAALFVFTSGSTGVPKAVVLTHRNLIVNLAVQIRCFQMKADDR
FT                   LLVHMPLNHVGAATELVVPSFLLGSSMVLIERFDPQHALDVVARHRVTFLHQVPAMYIK
FT                   EFNLPKFDEYDLSSLRTMTVAGATTPPAVMAKMMEKVPQVFTGYGMTELGGFVTYTEAN
FT                   DDPDTISFTVGKIAPEFELKIVDDDKKEVPIGARGEVALRGDCCFKGYFGDEASTNEAL
FT                   DKDGWYYSGDIGVLDERRYLTLVDRKKLMFITGGYNVYPREIEDYVGRHDAVEFAACLP
FT                   KPHDVMGEVGVLFVKLKDGTVRDTTAIERFCVDGLATYKVPRDIRVLKEFPLTPIGKID
FT                   RQKLSESIR"
FT   gene            complement(655470..656693)
FT                   /locus_tag="RPD_0582"
FT   CDS_pept        complement(655470..656693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0582"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37820"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL9"
FT                   /protein_id="ABE37820.1"
FT                   /translation="MRRGLVAAAVVSLFGAMAPQFAFGDSGSVKVGVLTDMSGTFADMS
FT                   GSGTVFSVERAIADSGGNVGGKPIKLVVADHQNKADIASSIARKWFSEDGVDVIVNAAG
FT                   SAVALAVVEMAKTYNKTALVTGALSTRLTNESCSPNSIHYGLDTYALSNGAVQALSQQG
FT                   VKSWYFIVADYAFGISMQRDSENFIKAAGGTVKGGIRHPLNSSDFSSYLLQAQASNADV
FT                   IALGSGGSDIVSMIKQAKEFGVGGGSQKLAALALFISDVNSMGVENAQGMNLVEGFYWN
FT                   YDDGSRGFSKPFYDKFKRMPTVYQAADYSGLRHYLKSALDADWTDGKGIVAQMKKGRID
FT                   DFFARGGYIREDGLLIHDLLLARVRKPADIKQPWDYYDILQTIPGDTAFQPLSLSRCEM
FT                   ITGKTAKQ"
FT   gene            656829..657422
FT                   /locus_tag="RPD_0583"
FT   CDS_pept        656829..657422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0583"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37821"
FT                   /db_xref="GOA:Q13DL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL8"
FT                   /protein_id="ABE37821.1"
FT                   /translation="MGKRAENSAAIKERLYVAAAEIVAQVGFAGASVARITDKAGIAQG
FT                   TFYNYFETREAIFEELVPIFGKKLRGHIRSRVGDTFDFYERERIAFDAFFEFLHGNRFF
FT                   ARVLNEAEIFTPAPHHDYFESILKGYRAELARASREGQIRKLSASEVEVISLMLMSART
FT                   YFALHYSKQIHESRKVSSTVTNTYMDVVRRALSP"
FT   gene            complement(657601..658662)
FT                   /locus_tag="RPD_0584"
FT   CDS_pept        complement(657601..658662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0584"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37822"
FT                   /db_xref="GOA:Q13DL7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DL7"
FT                   /protein_id="ABE37822.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDV
FT                   VVEAADGLNTLIDYRYQQHFKAQKGVNGMGSDRHGANGKDIVLKVPVGTQIIDEDKETL
FT                   LHDFTKVGERFVLAEGGNGGFGNAHFKSSTNRAPRHANPGLPGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNSDGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHVERCRVLLHLIDATCEHAGKAYKTVRGELEAYADTLTDKIEIVALNKI
FT                   DAVEPDELKKQKDRLKRAAKKTPLLISGVTGAGVPEALRALAAVIGEAPVSDKAIGTAQ
FT                   NAADAKPWAPQDV"
FT   gene            658841..659761
FT                   /locus_tag="RPD_0585"
FT   CDS_pept        658841..659761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0585"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37823"
FT                   /db_xref="GOA:Q13DL6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL6"
FT                   /protein_id="ABE37823.1"
FT                   /translation="MGLFRKISTGPDEHGARAAGIALMLLAMLAFSFGDAVGKKVVATY
FT                   PVGQLLLLRAFAGLVVLAPLIWRQRAAFTRLERPGLQLVRVLISAFEVAAFFLATVYLP
FT                   LADVITFYLASALFVSVGAAVFLGEKIDRPQMIAILIGFLGVLIALQPSPQTMSWPALI
FT                   AILASILFAALMLITRFLRQTPEIALASQQFVGTALLGSALMAPSGWITPAPADWIWFA
FT                   LAGVASAAGLLCVNRSLRLAPASVVIPYQYTMIGFAAAFGWLFFGELPTLSTLIGVVVI
FT                   IGAGLFLALRERKAGNAPPQINERS"
FT   gene            complement(660063..660239)
FT                   /locus_tag="RPD_0586"
FT   CDS_pept        complement(660063..660239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37824"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL5"
FT                   /protein_id="ABE37824.1"
FT                   /translation="MLAHRYIQAVLARDLAEEIKQDADAFEKSERAVRAEEHRERAEQL
FT                   SFRFIDLDRRFGI"
FT   gene            complement(660440..661039)
FT                   /locus_tag="RPD_0587"
FT   CDS_pept        complement(660440..661039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0587"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37825"
FT                   /db_xref="GOA:Q13DL4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL4"
FT                   /protein_id="ABE37825.1"
FT                   /translation="MLQEIPTITPSLREARACVLETGRLTLRKPALADVAAIASLANDR
FT                   RVVEMTRRMPFPYTRDDAARFVGSLAHGHETVFLIEAEDFVPVGIVGVDWSNRDAPEIG
FT                   YWLGVQHWGQGYATEAARAVIDFTFEEYAINQMVSAARVINPASRNVLEKCGFQWTGVE
FT                   LHRMEAISSSTPVDCFRLTRGVWSSLKSWGTTRRSR"
FT   gene            complement(661176..661448)
FT                   /locus_tag="RPD_0588"
FT   CDS_pept        complement(661176..661448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0588"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37826"
FT                   /db_xref="GOA:Q13DL3"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DL3"
FT                   /protein_id="ABE37826.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGIKAYGGEYVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKVEGRVEFRAKANGRTFVSVLPIAAEAAE"
FT   gene            complement(661530..661916)
FT                   /locus_tag="RPD_0589"
FT   CDS_pept        complement(661530..661916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0589"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37827"
FT                   /db_xref="GOA:Q13DL2"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DL2"
FT                   /protein_id="ABE37827.1"
FT                   /translation="MFAVIKTGGRQYRVVPDDVLEVGKIEGEVGTIVQLGEVLMLGGDT
FT                   PQLGLPTIAGASVAAEVLDHKRGPKVISFKKRRRKNSKRKRGYRDEITVLRITEILADG
FT                   KKPSVGPRPKRVKAEPAPAADAAE"
FT   gene            662255..663403
FT                   /locus_tag="RPD_0590"
FT   CDS_pept        662255..663403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37828"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL1"
FT                   /protein_id="ABE37828.1"
FT                   /translation="MAEDTLTTHAGIAVHGAERLPSVDVDSYNIELKDDDGFLGDRASK
FT                   GAFQRILDASRKPLRKNGEDPLGKKATEEISKGTLDDILKGDDVGAAALVHGAIEEFAQ
FT                   ELAFVTRRFLKTKAWADTECIVVGGGFRQSRVGELAIARTDILLKSEGLKVDLVPIRFD
FT                   PDEAGLIGCLHLAPSWIFEGHDSILAVDIGGSNIRCGVVETFWKKAPDLSKASVWKVEL
FT                   WRHAEDEPTREGAVKRLTKMLKDLIADAEKEGFKLAPFIGISCPGVINADGSIEKGAQN
FT                   LPGNWESSKFHLPRSLIEGIPMIGDHDTAILMHNDGVAQGLSEVPFMQEFDRWGVLTIG
FT                   TGLGNARFTNRKTKEKAKKDKAKDDKPKEKEKEKDKERKEKA"
FT   gene            663698..663787
FT                   /locus_tag="RPD_R0016"
FT                   /note="tRNA-Ser1"
FT   tRNA            663698..663787
FT                   /locus_tag="RPD_R0016"
FT                   /product="tRNA-Ser"
FT   gene            664209..669098
FT                   /locus_tag="RPD_0591"
FT   CDS_pept        664209..669098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0591"
FT                   /product="DNA helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37829"
FT                   /db_xref="GOA:Q13DL0"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL0"
FT                   /protein_id="ABE37829.1"
FT                   /translation="MKGVEERRGGADETPALRLSELLDYVEQVIKLDERPTFRLSEYRL
FT                   ANGQTFTFHEHEFHALPGITHDLTDDDGAIWLSIERLKRNDPPTPPDRSVPWIELSPDP
FT                   EKTPITRGHVLITVPKAECDAFVASGRARAEDCAESLAVGAKGQFDIRLRLEDWPEIAT
FT                   EIEDYISQSWLPWSVAERPRRRSIALYQKLFEVAQISEMGGAEQAIELVWGIGLSRWMF
FT                   EGTLIDLPLIERLVEIEIDESAAGTIRVRPRQAPATVNLRPYDELKIDGVPMAQDAARR
FT                   ALSAVDEESGVSPFERDTFELVLRACQTQLDPGGVYLPDSERIEPTVPPPPASENLVVT
FT                   DRWVVAARKRSDNFLLQDIANLKHAIELSPADLPGPSRTLVMGPAPSRSNRWGALPGSL
FT                   GGASESTVADEPSAPLGDLFFPKPFNDEQVEIVRRLEENDGVVVQGPPGTGKTHTISNI
FT                   ICHYLALGRRVLVVSHGEPALSVLRDQLPPEVRDLAISITTSEKEGFKQLEGAVRLLQS
FT                   IIESIRPGEQHRLIRNLENSIIGMRGRIAEIDAEIGRLAEKQLSAVPGSDLRPAELAAA
FT                   VVASGDKYSWFVDRPAAFAADATFDDGDFERIREARLALGARIEHLRVDLPSVADLPSG
FT                   RVLANLHLDIQRTDSLNAEAAKDVSLVLRLHSVEALEKAELAAEALDVLVDACRHLERF
FT                   PFLRSICTASQLNKDDPVMQALRAFLPEAKSVVAEHGKYLQTPVTVQDDVSPEMEDLLA
FT                   RCAAGDKVFGIFAFKEKAFRPAVEAIRILSRQPSSSEEWLHVRDYVAWRKRFTDLRLRW
FT                   SRLVPELAADGVGIEAPRHLSELVDALEDVLIVAPGIHDGLQAGLRDVAIGDTNGLWAD
FT                   EAKLRTIRTALRNAIAAVRLASARLEVARLSELFGESGGKFGRMSKSFLDEVVGRAGLP
FT                   EARVEETWTKLLQAIDDLARHRSQFVTVREGADHLEAAGAPIWAAKLRDKAALDGQDLE
FT                   MPSDWREAWDWGAAQGYLSSLDQRGALGRLTTERSKLAETVAKSFEQLVRERTFYALAS
FT                   SMTGQVRAALMMFATALRKVGKGTGKGAMRHRRDARKAMAACYDGVPCWIMPSWRVAEQ
FT                   LPGELGTFDLVIMDEASQSDIKEVTALLRGRKILVVGDDKQVSPTAAFIDNAKIERLER
FT                   TFLTNQPFKTLLLPGASLYDLAKVMFPDKFVMLREHFRCVEPIIRFSTQFYTEALVPLR
FT                   IPTTHERIDPPLVDIYVPDGKRTGDKINHREAEVVVSEILKIVESPMLSKIGEGDRWRS
FT                   IGVISLIGSKQAALINRMLLDAVGEETYMRHRIACGDSATFQGNERDIVLLSMVADPAH
FT                   KQSQTALHFEQRFNVAMSRARDRLYLVRSVREEELKPEDLKAKVLRHFRDPMKGSQRPA
FT                   GDLASLCDSDFERAVLNRLVDRGYRVTPQVGAMGFKIDLVVEGVGDRRLAIECDGDKYH
FT                   GPEKWADDMSRQRVLERVGWRFWRCWASSFTVDPDGCMADLFRILDANGIQPAPAEFPP
FT                   ERYAEQRVADARNESKAKSDEVGVAGVRSESGIKIGDSIVVRYLDDNKTSSFVLSRDRH
FT                   DPVNGLIGADTAFGKQILGFSEEDEIEVEDAGRSRRLLIVRAAKEGIRLH"
FT   gene            complement(669310..670140)
FT                   /locus_tag="RPD_0592"
FT   CDS_pept        complement(669310..670140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0592"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37830"
FT                   /db_xref="GOA:Q13DK9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR030669"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK9"
FT                   /protein_id="ABE37830.1"
FT                   /translation="MADTNTIKHVASPLARQTLLDGDLTRPVAGRSPIRILPWLQVIKI
FT                   GGRSIMDRGADAILPIVDELRKLLPEHRLLILTGAGIRARHLYGVGLDLGLPVGSLAPL
FT                   AASEAGQNGHILASLLAPDGVSYVEHPTIANQLAIHLTAARAVVGSAFPPYHHHEFPGS
FT                   RIPPHRADTGAFLIADALGAAGLTIVEDVDGVYDSDPNGEGGDKATLLRDVSAADLARQ
FT                   SGTLPVDRAMVEVMANARHLAHVQLVNGLKPGRLTAALRGEHVGTIIRTGARPA"
FT   gene            complement(670154..671014)
FT                   /locus_tag="RPD_0593"
FT   CDS_pept        complement(670154..671014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0593"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37831"
FT                   /db_xref="GOA:Q13DK8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR030669"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK8"
FT                   /protein_id="ABE37831.1"
FT                   /translation="MSAVAPLFSHNKRKSPMANTTAELEALLMQRSLTDPQLLAAVDAA
FT                   ADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAVRKTHKLLIGTGAGTRARHLYSI
FT                   AAGLSLPAGVLSQLGASVADQNAAMLGQLLAKHGISAVEGAGLSAVPLYLAEVNAVVFS
FT                   GMPPYGLWMRPAPEGVIPPYRTDAGCFLVAEQFGCKAMIYVKDENGLYTANPKTAKDAT
FT                   FIPRISVDEMKAKGLQDSILEFPVLDLLKASRHVREVQVINGLVPGNLTRALAGEHVGT
FT                   IITAS"
FT   gene            complement(671337..672662)
FT                   /locus_tag="RPD_0594"
FT   CDS_pept        complement(671337..672662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0594"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37832"
FT                   /db_xref="GOA:Q13DK7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK7"
FT                   /protein_id="ABE37832.1"
FT                   /translation="MTDTTTAGLGSDPARKHVNPGEIAIGVIIGRTAEFFDFFVYAIAS
FT                   VIVFPRLVFPFASELTGTLYSFAIFAIAFIARPLGTVIFMAIDRRYGKSAKLILAMLLL
FT                   GTATVAIAFLPGYYEIGAAAIWLLALARAAQGLAWGGAWDGLASLLALNAPKQQRGWYA
FT                   MVPQLGAPLGLIVASALFAYFAGNLSSEDFFGWGWRYPFFVAFAINVVALFARLRMVVT
FT                   PEYSSLFESRELQPSRVLDTLRHDGRNIIIGAFAPLASFALFHMVTVFPLSWVFLFTRE
FT                   SPVRFLIIETIGAMFGVVAIIASGMLADRIGRKPLLMGSAIAIAVFSGFAPQMLDAGPV
FT                   GETAYMILGFILLGLSFGQSSGVIASSFRTTYRYTASALTADLAWLFGAGFAPLVALLL
FT                   ATDFGLISSGAYLLSGAVVTILALWISGLRESNEYRSPSESE"
FT   gene            672843..674000
FT                   /locus_tag="RPD_0595"
FT   CDS_pept        672843..674000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0595"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37833"
FT                   /db_xref="GOA:Q13DK6"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK6"
FT                   /protein_id="ABE37833.1"
FT                   /translation="MSRFKILALLPLAVLLGGCDFVVLAPAGDVAAQQRDLIVISTVLM
FT                   LLIVLPVMALTVWFAWRYRHSNEAARYDPDWDHSTGLELVIWSAPLAIIICLGAITWMG
FT                   THLLDPYRSLDRIAADRPIDRAKTPLEVNVVALDWKWLFIYPEYGIASLNELAAPVDRP
FT                   INFRITASSVMNSFYIPALAGQIYAMPGMETKLHAVVNHAGKYKGFSANYSGAGFSGMQ
FT                   FAFHGVDDSGFEQWVARTRASGNSLGRTEYLALERPSSNEPARGFGSVDSDLYRAILNM
FT                   CVDPGKMCMSEMMAIDARGGLGLAGLNNTLPIAYDKYARRGTALGPQPAFVAGTCTIAE
FT                   PQGRITAQARESTPLLGAGLKRPSLFTPPGSSTSLPLGATSKSDS"
FT   gene            674009..676018
FT                   /locus_tag="RPD_0596"
FT   CDS_pept        674009..676018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0596"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37834"
FT                   /db_xref="GOA:Q13DK5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK5"
FT                   /protein_id="ABE37834.1"
FT                   /translation="MFTNPDIVKAIFGRLSLESLPLHEPIVVLAFIGTALGGAAVAAGI
FT                   TYFKLWGYLWREWFTTVDHKRIGIMYMILGIVMLLRGFADAIMMRIQQAMAFNGSEGYL
FT                   NAHHYDQIFTAHGVIMIFFVAMPMVTGLMNYVVPLQIGARDVSFPFLNNFSFWMTTAGA
FT                   VLVMISLFVGEFARTGWLAYPPLSNIGYSPDVGVDYYIWSLQVAGVGTLLSGVNLICTI
FT                   VKLRAPGMTMMRMPIFTWTSLCTNILIVASFPVLTAVLALLTLDRYVGTNFFTNDFGGN
FT                   PMMYVNLIWIWGHPEVYILILPAFGIFSEVAATFSGKRLFGYTSMVYATVVITILSYLV
FT                   WLHHFFTMGSGASVNSFFGITTMIISIPTGAKMFNWLFTMYRGRIRYDLPMMWTVAFML
FT                   TFVIGGMTGVLLAVPPADFVLHNSLFLVAHFHNVIIGGVVFGAFAGIAYWFPKAFGFKL
FT                   DVFWGKVSFWCWVVGFYFAFMPLYVLGLMGVTRRLRVFDDPSYQIWFAIAAFGAFLVLI
FT                   GIVAFLIQIAVSVMRREQLRDVTGDPWNGRTLEWATSSPPPDYNFAFTPMVRDADAWWD
FT                   MKKHGYSRPLGGFKPIHMPSNTGTGVILAGLSTVMSFGLIWYIWWLAALSFIALLAVAI
FT                   GHTFNYHRDYHIPADEVVRVEDERTRLLAAGARP"
FT   gene            676015..676644
FT                   /locus_tag="RPD_0597"
FT   CDS_pept        676015..676644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0597"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37835"
FT                   /db_xref="GOA:Q13DK4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK4"
FT                   /protein_id="ABE37835.1"
FT                   /translation="MSVAVATPQTAEPVFHVVDEHAHPEGASTMLGFWLYLMSDCLIFA
FT                   ILFATYGVLGANYAAGPAPKDLFDLKLVAVNTAMLLLSSITYGFAMLEMARARVGATQL
FT                   WLGITGLFGLAFLGIELYEFAHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGIVWLVT
FT                   LMVQVARTGLIEANRRRLMCLSMFWHFLDVVWIGVFTFVYLLGTLR"
FT   gene            676641..677033
FT                   /locus_tag="RPD_0598"
FT   CDS_pept        676641..677033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0598"
FT                   /product="cytochrome C oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37836"
FT                   /db_xref="GOA:Q13DK3"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK3"
FT                   /protein_id="ABE37836.1"
FT                   /translation="MTLNSPPVDAHGHDHGHEAHVAAHNHGTLKSYLIGFGLSVVLTAI
FT                   PFWLVMGDVLGNKQATGLVIMAFAAVQIVVHMIYFLHMTTAAEEGWTMMALIFTIVMVV
FT                   IALAGSLWVMHHLTTNMMPAHDMIRR"
FT   gene            677051..677887
FT                   /locus_tag="RPD_0599"
FT   CDS_pept        677051..677887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0599"
FT                   /product="Surfeit locus 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37837"
FT                   /db_xref="GOA:Q13DK2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK2"
FT                   /protein_id="ABE37837.1"
FT                   /translation="MTPDSDPANGARPSARRPSLWLTIPAVAGVFGLIALGIWQIERRA
FT                   WKLALIDRVEQRADAVPVPLPPAASWPEVTAARDEYRRVTASGRFLHDRETLVKAVTDA
FT                   GGGSWVITPLRTGDGATVLINRGFVPPNQRDRATRSAREPAGEIAITGLLRVTEPGGGF
FT                   LRHNDPAGDRWYSRDVAAIAAARSVESVAPFFIDADASLNAPGQPIGGLTVVRFPNNHL
FT                   VYALTWFCLAFMLFGWLAVAFGSGFFRRARAGRGPGQEVRSALPTGSHAGPIAEHR"
FT   gene            677907..679256
FT                   /locus_tag="RPD_0600"
FT   CDS_pept        677907..679256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0600"
FT                   /product="ATP-binding region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37838"
FT                   /db_xref="GOA:Q13DK1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK1"
FT                   /protein_id="ABE37838.1"
FT                   /translation="MQDKTAPARLRPRLGDDVTLSPAASSPADDATDRKNMSLLIQLRW
FT                   TAVIGQIVTIGAVHLWLGAPLPVVPMGAVVLGLIALNIGSLAWMRYRVAVSNRDLLIAL
FT                   ILDVVALTAQLYLSGGITNPFTSLYLLQVTLGAVLLDSRASWSLVAVVFAAFIWLTGAS
FT                   RPLVLPQTAGDPVNLTVAGMLIGFALNAVLLVVFVTRIHRNLRERDAHLAALRQHAAEQ
FT                   DHIVRMGLLASGAAHELGTPLASVSVILSDWRRMPALTENRELAEDLTEMETSLKRCQS
FT                   IVTGILVSAGEARGEGSSPTTVAEFLSAIAEEWRNARCKTTLHVVNVFGEDLPIVSDVT
FT                   LKQAIFNVLDNAFEVSRHWIELVAERDGDDLVLSIIDRGPGFSKDMLTQIGKPYQSSKG
FT                   RVGGGLGLFLVMNVVRKLGGSMTAENLHNRGAKVKLVLPLKTLAIGDDFD"
FT   gene            679249..679782
FT                   /locus_tag="RPD_0601"
FT   CDS_pept        679249..679782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0601"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37839"
FT                   /db_xref="GOA:Q13DK0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK0"
FT                   /protein_id="ABE37839.1"
FT                   /translation="MTEERSLIVVEDDAGFARTLKRSFERRGYEVVHASTIEDVRDALD
FT                   ERSFGYAVVDLKLGIASGLACVELLHAQDPEMLIVVLTGFASIATAVEAIKLGACHYLA
FT                   KPSNTDDIEAAFRKAEGNADIALGSQPTSFKTLEWERIHQTLIDSEFNISEAARRLGMH
FT                   RRTLARKLEKRQVR"
FT   gene            679926..683234
FT                   /locus_tag="RPD_0602"
FT   CDS_pept        679926..683234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0602"
FT                   /product="Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37840"
FT                   /db_xref="GOA:Q13DJ9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ9"
FT                   /protein_id="ABE37840.1"
FT                   /translation="MPFRKLLIANRGEIAIRIARAAADAGLATVAIYPADDSASLHLRI
FT                   ADEAREIPGRGARAYLDIEGVIAAAKAAHCDALHPGYGFLSENADLARRCAEEGITFVG
FT                   PSPEALRLFGDKVAAKELAKRCGVPIIAGTTGPSTLQDVKAFFASLGDAAAVMIKAMAG
FT                   GGGRGMRIVERADDLEEAYARCQSEAKAAFGSDGVYAERLIRKARHIEVQIIGDRHGGI
FT                   SQLWERECTIQRRNQKLIEIAPSPSLSDSLRGRIVAAAKALAAAANYDSLGTFEFLVDG
FT                   EAGESDGAFAFIEANPRLQVEHTVTEEVLSIDLVRSQLAVAGGATLASLGLDQAAVPRP
FT                   RGFAMQLRINMETMDESGATKPTGGTLAIFEPPSGPGVRVDTFGYAGYKTSAAFDSLLA
FT                   KVIVHTPSQWPDVVAKAARALREFRIDGVGTNIPFIQAILAHADFKANRVSTGFIDRNV
FT                   AELVGAAQGFAGPLIATPGATAHQGAASAKIDSAPDGAVAITAPLQGTVVAITVAEGDV
FT                   VRPGQQLAVLESMKMEHLVIAEQGGRIRRIVTADGVTLMQGEAILYLEPQDIEGDQLAE
FT                   EDEVDLDEIRPDLAEMLARQGNTSDNSRPDAVERRRKTNQRTARENIAQLVDDGSFMEY
FT                   GSLAIAAQRRRRSLDDLIKNTPADGLIAGVATVNAAQFGEHGARCMVIAYDYTVLAGTQ
FT                   GHMNHKKIDRMLTLVEQWRIPLVFYAEGGGGRPGDTDRLGLTGLDGPSFVQFARLSGLV
FT                   PVVGVVSGYCFAGNAAMLGCCDVIIATQNASIGMGGPAMIEGGGLGVYHPAEVGPVSFQ
FT                   SPNGVVDILVEDEEEATRVAQKYLSYFQGAVSEWRASDQRLLRRAIPENRLRVYDIRHV
FT                   IDLIADEGSVLELRRDFGVGMITAFIRVEGKPFGLIANNPKHLGGAIDADAGDKAARFL
FT                   QLCDAFDIPIVSLCDTPGFMVGPEAEKTAIVRHVARMFVTGASLTVPLFGIVLRKGYGL
FT                   GAQSMLGGGFHASFFTAAWPTGEFGGMGLEGYVRLGFRKEMEAIADPVERETYYKNKVA
FT                   EMYANGKAVSIASVLEIDNVIDPAETRRWIMAGLRSVPTPPQRDGRKRPCIDAW"
FT   gene            complement(683350..684249)
FT                   /locus_tag="RPD_0603"
FT   CDS_pept        complement(683350..684249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0603"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37841"
FT                   /db_xref="GOA:Q13DJ8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ8"
FT                   /protein_id="ABE37841.1"
FT                   /translation="MKVAVMGAGAVGCYFGALLAQAGHDVTLIGRPNHVAAINADGLLL
FT                   ETRNGKTFIPLRAATDPASLDPPDLVLFCVKSADTEAAGAALAPRMRPDTAILSLQNGV
FT                   DNAQRLSATIDHPVIAAVVYVGTEMAGPGHVRHHGRGELLIGASPRSEALAAELTDAKI
FT                   PTAIAADIDQALWSKLLMNCAYNALSAVADIAYGPIFEVEGARDVVVSVITECAAVARA
FT                   SGVALPNDMLETALALPASMPNQKSSTAQDLARGKPSEIDFLNGAVVRKGAALGIPTPT
FT                   NQALQVMVKLAERSRGIG"
FT   gene            684420..685463
FT                   /locus_tag="RPD_0604"
FT   CDS_pept        684420..685463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0604"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37842"
FT                   /db_xref="GOA:Q13DJ7"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ7"
FT                   /protein_id="ABE37842.1"
FT                   /translation="MHIDLNPKLDFRDVLIRPKRSVLASRFEANISRTFGFRHSSREWT
FT                   GFPLIASNMDTIGTLEMADAFRPFGALVALHKFYDPERLAKYLDDHANPNVFLTVGTGA
FT                   SDWDRLAAVKKQTKVPVLNIDVANGYTENFVRAVSKLREENPDAIIMAGTVVTAEMTEA
FT                   LVIAGADIVRVGIGSGSVCTTRDLTGVGYPQLSAVIECADAAHGLKGHVCSDGGCTVPG
FT                   DVAKAYGGGADFVMLGGMLAGHVECGGELRYLEEGGKRVPKSMVFYGMSSETAMNKYHG
FT                   GVADYRAAEGKTVEVPYRGEVRATVETIAGGLRSAMTYMGAENLKEIPKRTTFILVNAQ
FT                   RNTVFDR"
FT   gene            complement(685502..686233)
FT                   /locus_tag="RPD_0605"
FT   CDS_pept        complement(685502..686233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0605"
FT                   /product="regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37843"
FT                   /db_xref="GOA:Q13DJ6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ6"
FT                   /protein_id="ABE37843.1"
FT                   /translation="MIVRQAANVLEILEYFARVKKPATLAEIADHFGWPRSSTFNLLTT
FT                   LADKGYLYEPRPRAGYYPTPRWLVLAREVSEVEPLPAWSRALITSLSSETGETVAIAAP
FT                   AGVMAVFIDVIESSAAIRYFAHIGHRVPIHATSSGRALLLQYSQDERDSLYRKIEFKQY
FT                   NPSTPISIDAVEAELSKSIERGYCQSFADYSRDLAGVAVPLPIGERRLSVVVAGPEFRI
FT                   GDRTAEIAATLKQFVERFRGK"
FT   gene            complement(686274..687122)
FT                   /locus_tag="RPD_0606"
FT   CDS_pept        complement(686274..687122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0606"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37844"
FT                   /db_xref="GOA:Q13DJ5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ5"
FT                   /protein_id="ABE37844.1"
FT                   /translation="MRSMLFVPGDSPRKFEKASQGAADALIIDLEDSVVTDRKDDARGM
FT                   TRTMLHAPRGKPQLYVRVNALDTGRTLGDLAAVMPARPDGIVLPKSRGGEDVRMVALWL
FT                   DAFEAAAGLTPGSTRIVVVATETAGSIFGLGSYKDCSPRLAGLMWGAEDLAASLGATEN
FT                   GSGGVFHSPYRLARDLCLMGAAAAEVTAIDTVYTDIDNLAGLEQETRAARRDGFTCKAL
FT                   IHPKHVDIVNAAFAPTAAERGWAEKVVAAFAENPDAGTLRLDGKMLDKPHLRAAQRILG
FT                   T"
FT   gene            complement(687122..687574)
FT                   /locus_tag="RPD_0607"
FT   CDS_pept        complement(687122..687574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0607"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37845"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ4"
FT                   /protein_id="ABE37845.1"
FT                   /translation="MAGLYFEDFEVGQEFKHALTRTVTEMDNTMFSLLTLNPQPLHIDA
FT                   HFAAQTEFGQRIFNSLYTLGIMIGMTVYDTTLGTTVANLGMTDVTFPKPVFHGDTLRAT
FT                   TKVLSMRPSKSRPTAGIVEFEHHALNQNNEIVGQCRRMALMHKRPV"
FT   gene            complement(687619..688815)
FT                   /locus_tag="RPD_0608"
FT   CDS_pept        complement(687619..688815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0608"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37846"
FT                   /db_xref="GOA:Q13DJ3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ3"
FT                   /protein_id="ABE37846.1"
FT                   /translation="MGPLSGVTILDLTSVLMGPYATQTLADMGANVIKVESPDGDIVRH
FT                   IGPGRTPGMGGMFLNTNRGKRSIVIDLKQDEGRATLLRLAATANVVIYNVRPQAMARLG
FT                   LGYEQFAAANPSIIYVGVFGYGQNGPYAAKPAYDDLIQGAAGVPTLLAAAGDGTPRYVP
FT                   ITIADRIVGLMAVNATLGGLMHQQRTGQGQRIDVPMFESMAEFVLVDHLGGLTYDPPLD
FT                   HGGYARLLSRYRKPYKTSDGYLCVLIYNDKQWRSFFEAIDRNDFLAQPRFANHAARTQH
FT                   IDEIYEEIGGIFLTRTTADWRELLERADIPVMPMHTMESILEDPHLDAVGFFKTLDHPV
FT                   EGRIRQTQVASTWSVTQPQAGGPAPTLGEHARDILGEAGFSTDEIERLGRTKAVHLPG"
FT   gene            689010..690035
FT                   /locus_tag="RPD_0609"
FT   CDS_pept        689010..690035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0609"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37847"
FT                   /db_xref="GOA:Q13DJ2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ2"
FT                   /protein_id="ABE37847.1"
FT                   /translation="MRRTLGLSVAVSLSVTMALTSAQALELKVADSFPAGHYLVRLMLK
FT                   PWMDDVTKRTNGAVTFSYYPNQQMGKATDLLRLTQSGVVDIGYIAPSYASDKMPLSEVA
FT                   QLPESFSTSCQGTLAYWKSAREGVLAQKEYAPNKIKLLMAVVLPPYQVFTVKNKIESIS
FT                   DIQGLKLRTTGGAQDLTLRALGAVPVRMSAPDAYESLARGTMDGVLFPADSIPSYGLDK
FT                   LVKHATDGVSFGSFIVAYSISQAAWNKLPADVKAAMDEASEAIEPKVCADVDKEQAQTR
FT                   KQLNDAGVAYDPIPDATKAQMKDRLKGVSVEWAAAIDARGKPASEALKEFESLLAASAN
FT                   K"
FT   gene            690069..690623
FT                   /locus_tag="RPD_0610"
FT   CDS_pept        690069..690623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0610"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37848"
FT                   /db_xref="GOA:Q13DJ1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ1"
FT                   /protein_id="ABE37848.1"
FT                   /translation="MIKRAGAILAAIERALTVVAVVFLFVIMVLVVADVFMRYALNRPF
FT                   SFTYDLIGLYLMAGVFFLTLSDALREHVHVGVDILVPRFSPAGRRLAEIVTAFTGLFVF
FT                   VLLCKVGFDRAVENFEQKDVLAGAIPWPTWISAALVPLGCGVLVLRLVLQLVGHALSLV
FT                   TGRNFYPLPPLVGVGEAKSYE"
FT   gene            690637..691926
FT                   /locus_tag="RPD_0611"
FT   CDS_pept        690637..691926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0611"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37849"
FT                   /db_xref="GOA:Q13DJ0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ0"
FT                   /protein_id="ABE37849.1"
FT                   /translation="MTTLIVLGLLFALLAIGTPVGFAMAFSGSIGLLMVGGPGTLFGIL
FT                   ETAPLSTVSSYELITIPMFLLMAELVLLSGVADALFKTASAWVGRIPGGLGMATALAGA
FT                   GFGAICGTSTASAATLSSTSLPAMIRQGYEPKMAAGVVAISGTLAMLIPPSVALVIFGL
FT                   LAEVNIGQLLIGGIIPAALVTATIMATIYVLVWLDPSRAPRVEAVPWRERFTLLWQIGP
FT                   MVALFTLVTGTIYLGVATPTEASALGAAGALVLAISKRKVTVASLYKALLSASYGTCMI
FT                   VTILVGASVFGYFFTLTHVTQDLVAWVGSLETSRWVIITLILCGYIVLGSFMDQIAILV
FT                   LTVPIVLPLIKTLGFDPIWFGVIKIVTAEVGMITPPVGLNCFIVARYAKRPVSEVFHGT
FT                   FPHFIAHLIAIAIMVAFPSIILWLPSQMAN"
FT   gene            691986..693152
FT                   /locus_tag="RPD_0612"
FT   CDS_pept        691986..693152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0612"
FT                   /product="acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37850"
FT                   /db_xref="GOA:Q13DI9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI9"
FT                   /protein_id="ABE37850.1"
FT                   /translation="MDFALTDQQEAIRDAIARICEGFDDAYWLRKDREGGFPHDFHKAL
FT                   ADAGWLGICVPEDYGGSGLGITEAAIMMRTISESGAGMSGASAVHINVFGLNPVVVFGT
FT                   EEQRKRMLPPMVEGREKACFAVTEPNTGLNTTQLKTRAVRNGDRYIVNGQKVWISTAQV
FT                   AHKILLLARTTPLEEVKSPTHGLSLFYTDFDRTKIQVHEIEKMGRKIVDSNELFFEDFE
FT                   IPLEDRIGEEGRGFQYILEGMNPERILIAAEAVGLGKLASSRASEYAKTRIVFNRPIGQ
FT                   NQAIQHPLAKNWVELEAAWLMVMSAAWQYDKGMPCAAAANAAKYLAGEAGFQACEQAVM
FT                   THGGFGYAKEYHVERYLREVLIPRIAPVSPQLALSFIAEKVLGLAKSY"
FT   gene            693181..694428
FT                   /locus_tag="RPD_0613"
FT   CDS_pept        693181..694428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0613"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37851"
FT                   /db_xref="GOA:Q13DI8"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI8"
FT                   /protein_id="ABE37851.1"
FT                   /translation="MPVATSAIDFAGLIRAGDLVVCGQATAEPRTLTEALAEQSFGLPP
FT                   FRLMVGPLFSDTFSRTDTSNISFLSYGVIGHARKLARAGRLDVVPSNYSAFCADFASGR
FT                   HRADVVLVQLAVSADGRLSASLSRDYVIDAARRARLVIAEINPDAPFTCGAEWPDDVPI
FT                   HLRIAARHPPLELPSDAPDEVSRRIAANAAALIADGSTLQFGVGKIPDAILSSLTHARH
FT                   LGIHSGLINDAVVDLIARGVVTNACKGIDPGVTVTNQLIGTQRLYCFADRNKAVAMHPA
FT                   SYTHDHGVLSRINRLVAINSALQVGVDGSVNAETLNGVAIGAIGGQLDFVRGANASPGG
FT                   RAIIALPAAAPDGSSRIVASVETVTTPRADVDAIVTEWGVAELRGCSLSERARRMIAIA
FT                   APQHRDRLTHQSKPMT"
FT   gene            complement(694606..695994)
FT                   /locus_tag="RPD_0614"
FT   CDS_pept        complement(694606..695994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0614"
FT                   /product="VWA containing CoxE-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37852"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI7"
FT                   /protein_id="ABE37852.1"
FT                   /translation="MREELHRFFRAARGAGVRVSPAESIDAMRAVADVGFADRGVLRDT
FT                   LLLTLAKSQDEKQALGDCFDLFFSHPEPKSEMDDASGSDASASGDSSDATSPASAGGAP
FT                   QDGGGETAELGELAQMLLAQDRSAIAAALAGAANAAELSAIRYFTQRGLFQSRMMEALG
FT                   VGRLRDDLDQLKTANPAEAERLANLLDGLRDAVRERVSQALLLYGREETENLRHEILRN
FT                   APLARLERRQVDQMKLLIRAIARRLRERYSKPRKRQRRGHLDVRRTMRRNAAWGGIPFL
FT                   TAWKRRHRDRPKIVALCDVSGSVAQVSDFFLLLIHSLHEVVDDVRSFAFSGHLIEVSDI
FT                   LDKQEPEAAMREIMTKVGFGSSDYGNSFADFEKRWLRAVTPKTTVIVLGDARTNKLDPR
FT                   TDILRTISERAKRVVWLNPEGRMGWGWGDSEMFRYAPFCTVVRQCATAKQLERAVSDIV
FT                   AAYQ"
FT   gene            complement(695994..696941)
FT                   /locus_tag="RPD_0615"
FT   CDS_pept        complement(695994..696941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0615"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37853"
FT                   /db_xref="GOA:Q13DI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI6"
FT                   /protein_id="ABE37853.1"
FT                   /translation="MNAQLPIESIDAVTAGLASVGYIASRQIATAVYLAERIEKPILVE
FT                   GPAGVGKTELAKALAKWRGLRMIRMQCYEGLDEAKALYEWKYAKQLLYTQILKDKLGEV
FT                   LGGADTLAVALDRLHDFGDVFFSKEFVEPRPLLQALEQPEGCVLLVDEIDKSDAEFESL
FT                   LLEILSDYQVSIPELGTISAVVKPFVLLTSNGERDLSDALKRRCLHLHIGFPEQKLEER
FT                   IVESRVPGASQALRAQLVGFINQVRALDLKKLPSVSETIDWARVLVLLQSTELDHETVK
FT                   DTLNVLLKYEADIETTMPQVAGFVAKSGRAGVFG"
FT   gene            complement(696938..698014)
FT                   /locus_tag="RPD_0616"
FT   CDS_pept        complement(696938..698014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0616"
FT                   /product="acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37854"
FT                   /db_xref="GOA:Q13DI5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI5"
FT                   /protein_id="ABE37854.1"
FT                   /translation="MLQDTSAAVAETIQRWRAIDAAERRRDPFGAFQRAGLFQIGLPGG
FT                   GTALDSFSAIAIAEQAIAAATGELGLATAFAGRQLIARFFVAGFADDAQRSDLLPRIVA
FT                   GTCWAAVAISEPGAGAHPKHLQTKAEPRDGGFVLRGRKAWITNGPVADVFLVLAIVAIE
FT                   DGRKRYGLFAVPRDTAGLTITPMPALDVLAPASHCELALDDCVVPASARIGGDADAYPA
FT                   MALPFRDIEDTVGTATTAGFLAWLVRTAAARIERTDDHALQLGRLEGLVALVDAASHNA
FT                   VQALDGKGPREPARLIGVRALARTIVDEIRAMLASLPPDDATTRALAAFDVLANVAREP
FT                   RKQRQMTLGQSLWSERQE"
FT   gene            complement(698230..700362)
FT                   /locus_tag="RPD_0617"
FT   CDS_pept        complement(698230..700362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0617"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37855"
FT                   /db_xref="GOA:Q13DI4"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI4"
FT                   /protein_id="ABE37855.1"
FT                   /translation="MSPKKSLTKSSAPENSETTSATIADASIQRGQGGETHQIATGKTP
FT                   VLTTRQGVPVSDDQNSLKIGPRGPTLMEDFHFREKIFHFDHERIPERVVHARGFGAHGF
FT                   FETYESLADITRADIFQRAGEKTPAFVRFSTVAGNKGSADLARDVRGFAVKLYTQEGNW
FT                   DIVGNNIPVFFIQDAIKFPDLIHAAKQEPDRGFPQAQTAHDNFWDFISLMPESINMALW
FT                   IMSDRTIPRSFRFMEGFGVHTFRLINAEGKSTYVKFHWKPKLGMQSVAWNEAVKLNGAD
FT                   PDFHRRDLWDAIQAGDYPEWELGLQLFDDAFADEFEFDILDATKIIPEERVPIRRVGRL
FT                   VLDRTVDNFFNETEQVAFQTGNIVPGVDFTNDPLLQGRNFSYLDTQLKRLGSPNFNDLP
FT                   INAPKCPFHTFQQDGHMTLNNPKGRANYEPNSWGAAGGPRETPNGFQTFPAEETGERRR
FT                   ARGELFADHYSQARQFYISQTEIEQTHIKDAFTFELSKVERPDIRARVVSHLVNVDEEL
FT                   AGKVADGLGMELPAAAEPARAVMTDLDPSPALSILKNGPKDFSGRKIGILVSDGADAKL
FT                   LAALQAAAGKHGVLVELVAPKVGGFETSDGELLPAKQKINGGPSVLYDAVAILVSDEGA
FT                   EMLLGEATARDFVADAFAHAKFIAYTEAAQPLLDKAGVEPDDGFLALSKPADAERFLKL
FT                   CAKLRFWEREASVHAV"
FT   gene            complement(700581..701219)
FT                   /locus_tag="RPD_0618"
FT   CDS_pept        complement(700581..701219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0618"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37856"
FT                   /db_xref="GOA:Q13DI3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI3"
FT                   /protein_id="ABE37856.1"
FT                   /translation="MSRLSIGPSTNKKRLTMNRCAAALILVALGTAGASTALRAADLEA
FT                   GRAKAELCTGCHGENGVSGMEYTPSLAGQPDLFIQWQLIFFRSGTRQNASMRPFVDDLS
FT                   NEDIRNLGAYYASLPPMTNRKPDDDPDLSRKGAQAAAGRRCASCHTDNYAGIKATARLA
FT                   GQREEYLIKALNEFKSGQRSGGAMAAMADVAYPLSEEEIYALAHYLAHL"
FT   gene            complement(701286..702539)
FT                   /locus_tag="RPD_0619"
FT   CDS_pept        complement(701286..702539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0619"
FT                   /product="putative L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37857"
FT                   /db_xref="GOA:Q13DI2"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI2"
FT                   /protein_id="ABE37857.1"
FT                   /translation="MKSIFRRSVVACAAVLAIGALDQAVAQGLKKYDSDKKDFWTNPPP
FT                   DWFLGDETEAQKGLAPPAGPPTGSSDAELAAMMKKIKLPPGFKIEVYASGVLAARQMAW
FT                   GDNGTLFVGSFGLGNVYAITEKDAKKQVKTVLKGMKMPTGIAFQNGALYVIDIDKLIRY
FT                   DNAEANLDKLGDGKVVYDDMPSYVAHGWKYLAADKDGWFYVPFGPPFNIGLPPTSLSQI
FT                   RRIDPKTGNAELVALGVRNSVGGDVDPRTGKYWFTENARDWISDDMPSDKLNMISKLGE
FT                   HFGYPYCHQGDMPDPKFAMGHKCSEFTPPVLNLGAHVAPLGMKFYTGDQFPAEYKNNIF
FT                   IAEHGSWNRHKYQGALIKRVIVDPDGKNAKQENFATGWIEGDQGYLGRPADIVLAKDGS
FT                   MLVADDWAGAIYRISYSK"
FT   gene            complement(702900..704549)
FT                   /locus_tag="RPD_0620"
FT   CDS_pept        complement(702900..704549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0620"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37858"
FT                   /db_xref="GOA:Q13DI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI1"
FT                   /protein_id="ABE37858.1"
FT                   /translation="MTTLEGTGRLSGARPGLLDRERIIAAAGYNRWLVPPAALCIHLCI
FT                   GMAYGFSVFWLPLSRAVGLSAPQVCSDMTIFQELVTTTCDWRVASMGWMYTLFFVLLGA
FT                   SAAIWGGWLERAGPRKAGFVSAICWSGGLVLGAIGIYTHQLWLLWLGSGVIGGIGLGLG
FT                   YISPVSTLVKWFPDRRGMATGMAIMGFGGGAMIGAPLANMLMNYFKTPTDVGVWQTFLV
FT                   MGLIYFVFMTIGAFAYRITPPNWRPEGWTPPAKANTMITEHHVHLKDAHKTKQFWLIWT
FT                   VLCLNVSAGIGVIGMASPMLQEIFAGKLIGLPDLSFNQLSAEQKTMIAGIAAGFAGLLS
FT                   LFNIVGRFFWASLSDHIGRKNTYYVFFLLGILLYALAPTLAAMGSKVLFVVAFGIILSM
FT                   YGGGFATVPAYLADIFGTQFVGAIHGRLLTAWATAGIIGPVVVNYIREAQIAAGVPRAQ
FT                   VYDFTMYILAGMLVVGLICNALVKPLADKWFMKPADVAALQAKGAAASSGGGSYGIGKG
FT                   GLDARTAAFWAFVGIPLAWGMWVTLQNALRIF"
FT   gene            complement(704612..704827)
FT                   /locus_tag="RPD_0621"
FT   CDS_pept        complement(704612..704827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0621"
FT                   /product="formate dehydrogenase delta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37859"
FT                   /db_xref="GOA:Q13DI0"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI0"
FT                   /protein_id="ABE37859.1"
FT                   /translation="MSPDRLVYMANQIGTFFRSQGADRAVPGIAEHLRKFWDPRMRTAI
FT                   VAHLDAGGEGLAPDVRAAVEALKTTT"
FT   gene            complement(704817..705644)
FT                   /locus_tag="RPD_0622"
FT   CDS_pept        complement(704817..705644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0622"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37860"
FT                   /db_xref="GOA:Q13DH9"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH9"
FT                   /protein_id="ABE37860.1"
FT                   /translation="MRPTVQTTTTRTWRNGRMQDGARAIPEETPVAISYNGGTHAVMMA
FT                   TPADLEDFAIGFSLSEGVIDTPSQIDTFEIVPLDDGIELRMWIGGAEAERLQQRRRHIA
FT                   GPTGCGLCGVDSITEALRPAAIVGAGGHFAPEQIIAAIEAMPPLQTLNIETRAVHAAAF
FT                   WTSARGIVSLREDVGRHNALDKLAGALARQQIATGDGIVLLTSRVSVEMVQKTAALGAP
FT                   LLVAVSAPTALAVRMAEAAGVTLAAIARADGFEVFSHPGRISGGTHEEATDVA"
FT   gene            complement(705647..708493)
FT                   /locus_tag="RPD_0623"
FT   CDS_pept        complement(705647..708493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0623"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37861"
FT                   /db_xref="GOA:Q13DH8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH8"
FT                   /protein_id="ABE37861.1"
FT                   /translation="MALVHEIDFGTPRSPSETMVTLTIDGRSVSVPEGTSIMRAAMEIG
FT                   TAIPKLCATDMVDAFGSCRLCLVEIDGRSGTPASCTTPVADGLVVKTQTERLKQIRKGV
FT                   MELYISDHPLDCLTCSANGDCELQDMAGAVGLRDVRYGYSGNKHPNPGLDESNPYFTYD
FT                   ASKCIVCSRCVRACEEVQGTFALTIAGRGFGSVVSPGMQESFLGSECVSCGACVQACPT
FT                   ATLNEKSVIEIGTPERSVVTTCAYCGVGCTFKAEMRGEEVVRMVPYKDGKANRGHSCVK
FT                   GRFAWGYTNHKERILKPMIRARITDPWREVSWDEAFSHAASELKRIQAKYGRDSIGGIT
FT                   SSRCTNEETFLVQKLIRAGFGNNNVDTCARVCHSPTGYGLSTAFGTSAGTQDFDSVEHT
FT                   DVVMIIGANPTDGHPVFASRLKKRLRAGAKLIVVDPRRIDLVRSAHVEAAQHLPLKPGT
FT                   NVAVLTALAHVIVTEGLANEAFVRERCDWSEYEHWASFVAQPNNSPEATAAMTGVDPQA
FT                   LREAARLYATGGNGAIYYGLGVTEHSQGSTTVMAIANLAMVTGNLGRQGVGVNPLRGQN
FT                   NVQGACDMGSFPHELPGYRHISTDAVRDSFEALWGVTLNSEPGLRIPNMLDAAVDGSFK
FT                   ALYVQGEDILQSDPNTKHVAAGLEAMECVIVHDLFLNETANYAHIFLPGSTFLEKNGTF
FT                   TNAERRIQRVRKVMTPKNGLEDWEVTLRLAEAMGFKMSYDHPSQIMDEIATLTPTFTGV
FT                   SYARLDELGSIQWPCNANAPEGTPVMHIDHFVRGKGKFVITEYVATDERTGPRFPLLLT
FT                   TGRILSQYNVGAQTRRTANTVWHDEDRLEIHPHDAEQRGVRDGDWVRLASRAGETTLRA
FT                   LITDRVAPGVVYTTFHHPDTQANVVTTEYSDWATNCPEYKVTAVQVSPSNGPSEWQRAY
FT                   EEQATAARRIASAAEAAE"
FT   gene            complement(708505..710061)
FT                   /locus_tag="RPD_0624"
FT   CDS_pept        complement(708505..710061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0624"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37862"
FT                   /db_xref="GOA:Q13DH7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH7"
FT                   /protein_id="ABE37862.1"
FT                   /translation="MTIRAFVPRDSGALAVGADEVAAELCRLAHERGLMLDLVRPGSRG
FT                   LYWLEPMLEVDTPAGRVAFGPTTIADVPSILDAILSDGDHPLKLGLTEEIPWLKRQTRL
FT                   TFVRCGIVDPRSIDDYRAHGGYRGLEHALRMSSDAIIDDVVKSGLRGRGGAGFPTGTKW
FT                   RTVAQAGRGQKYICCNADEGDSGTFADRMLMEGDPFMVIEGMTIAGIAVGATKGYIYIR
FT                   SEYPHAVEAMNAAIEAARRTGYLGDHICHSTDSFDIEVRVGAGAYICGEETSMLESLEG
FT                   KRGTVRAKPPLPAHKGLFGRPSVINNVLTFSAVPYILDGGAQAYADCGMGRSRGTKPIQ
FT                   LGGNVKHGGLFEVAFGITLGELIDEIGGGTLSGRPVRAVQVGGPLGAYFPRALFDTPFD
FT                   YEAFAARSGMVGHGGVVVFDDTVDMAKQARFAMEFCAIESCGKCTPCRIGSTRGAEMVD
FT                   KIIAGDKPAADIAVLEDLCNTMKFGSLCALGGLAPIPVLSALTHFPEDFGLAPRRLQAA
FT                   E"
FT   gene            complement(710058..710528)
FT                   /locus_tag="RPD_0625"
FT   CDS_pept        complement(710058..710528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0625"
FT                   /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37863"
FT                   /db_xref="GOA:Q13DH6"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH6"
FT                   /protein_id="ABE37863.1"
FT                   /translation="MKNEPWDTTRAAEIIAGLTHKEGPTLVILHALQEAFGYVPEAAEP
FT                   MVAQALNLSRAEIHGVVTFYPDFRREPPGRHVLKLCRAEACQAAGGDALAAQAETRLGV
FT                   TFGATSADGAVSLEPVYCLGLCATAPSAMLDDRVIGRLDTHRLDALMTEAQR"
FT   gene            complement(710645..711601)
FT                   /locus_tag="RPD_0626"
FT   CDS_pept        complement(710645..711601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0626"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37864"
FT                   /db_xref="GOA:Q13DH5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH5"
FT                   /protein_id="ABE37864.1"
FT                   /translation="MPNAARSGKTHEILSKLIEAGVIDKLELLLALAKERHFGRAAEAC
FT                   GVTQPTMSTSIKQLEEILGVMLVQRGSRFLGFTPEGQRTLDWARRIVADTRAMKQEINT
FT                   LKDGLSGELRIAAIPTVLGMVASLTTPFRARYPNVRFSILSCTSSEVLGLLENLEADAG
FT                   LTYIENEPLGKVRSVPLYQESYRLITSPDGMFGDRDQVTWKEVGQVPLCLLTPNMQNRR
FT                   IIDRALREAGTAAHPTLTSNSIIVLYTHVKTGRWASVMPAKLAETLGLGDGVRTIPIVD
FT                   PMVSYSIGLVVPPREPYTPQVAALMQVAREVAPSLQS"
FT   gene            complement(711847..713070)
FT                   /locus_tag="RPD_0627"
FT   CDS_pept        complement(711847..713070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0627"
FT                   /product="S-adenosylmethionine:diacylglycerol
FT                   3-amino-3-carboxypropyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37865"
FT                   /db_xref="GOA:Q13DH4"
FT                   /db_xref="InterPro:IPR021829"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH4"
FT                   /protein_id="ABE37865.1"
FT                   /translation="MNTQQLIADAVRNSKDRSESTIWDRLFSIWFRRLVYTQIWEDPEA
FT                   DLAALQLPIGSTIVTISSGGCNALSYLTAKPAQVFAVDLNEAHLALLKLKLAGLRALPD
FT                   YEQFWRFFGEGMADDNSDLYRQRLRPQLDGDARSYWDERDFRGRPRYRYFTNGFYRHGA
FT                   LGSFIGFAHLLAKIAKIDLSALLEAAPESPERQAALQRLDRLFHSRFAKLLTRTPALLF
FT                   SLGIPPQQRDLLGGDQPLNEVLHARLLRLINGYPNETNYFAWQALSRRYPGPGDDCLPL
FT                   YLQRSRYAQMRSGAGLIIPVHENLRVFLESLPARQIDALVLLDSQDWMAADEVRALWDA
FT                   IDRAGKDSVQVIFRTAGAESPLETDALAPLQQVWQRDEDRSAIGFARDRSGIYGGFHCY
FT                   ARRAGGGR"
FT   gene            713221..713928
FT                   /locus_tag="RPD_0628"
FT   CDS_pept        713221..713928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0628"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37866"
FT                   /db_xref="GOA:Q13DH3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH3"
FT                   /protein_id="ABE37866.1"
FT                   /translation="MTMIRSEISADSSWPIDATTRMNRMYRYQRHIYDTTRRYYLLGRD
FT                   ELIAGLAPAVGDNVLEVGCGTGRNLIAAASRYPNARFYGFDVSTEMLTSAISAIARAGL
FT                   SGSAKVAHGDATAFTARAVFGQPIAFDRVMISYSLSMIPDWTAVIERAIASLKPGGQLH
FT                   IVDFGDQRGLPRLARDALRRWLGMFGVTPRDGLEATLMQIAVRTGAGLKFDRPYRGYAQ
FT                   VAVLTLPSRRPAA"
FT   gene            714109..714317
FT                   /locus_tag="RPD_R0017"
FT   misc_RNA        714109..714317
FT                   /locus_tag="RPD_R0017"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 117.98"
FT   gene            714391..715464
FT                   /locus_tag="RPD_0629"
FT   CDS_pept        714391..715464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0629"
FT                   /product="high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37867"
FT                   /db_xref="GOA:Q13DH2"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH2"
FT                   /protein_id="ABE37867.1"
FT                   /translation="MSETITQKTALSAPSDGFRIRLVALLGGLVIANIAAWAWALTAFA
FT                   GQPVLIGTAVLAYSLGLRHALDADHIAAIDNVTRKLMQEGKRPIAVGFFFALGHSTVVL
FT                   VASLAIALAASSLTERFSGYREIGGVIGTSASALFLFAIAIANLSVLSGVYRAFKKVRA
FT                   GEVVHDDDIDALLQQRGWLARLFRPLFRFVSKSWQLYPIGLLFALGFETASEISLFGLA
FT                   ANASGTISHWSILIFPALFAAGMTLVDTLDGVLMLGAYGWAYRNPVRKLYYNMTITSVS
FT                   VLVAIVIGGIETLGLMAGRLHLEGAFWEWISDLNANFGTLGYGIVALFVASWIISTIIY
FT                   RANGYHRLDERAPVVQE"
FT   gene            715471..716496
FT                   /locus_tag="RPD_0630"
FT   CDS_pept        715471..716496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0630"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37868"
FT                   /db_xref="GOA:Q13DH1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH1"
FT                   /protein_id="ABE37868.1"
FT                   /translation="MTTRPKPDSRASVVTAALLILVGVLALGSLGVGPVKLSPLTVIDA
FT                   LIGRAGDVQQIIVQQIRLPRAILALAIGGILGLSGAALQGLLRNPLASPSLFGAPQSAA
FT                   FGAVLIIALGWADVRSYALPVAGITMAFVSVFMLLAVAGRSANLLLLILAGLAISSLAG
FT                   AATALVMNLSPNPFASLEIAFWLLGSLEDRSFRHVALALPFILAGGVLLLSQRAAFRAL
FT                   SLGEETAQSLGVDVGRLRLIVIIGVALGVGGAVSVSGTIGFIGLVAPHLVRPLIGHDPA
FT                   RLLVPSALAGAALLLAADIAVRVIPSTTDIKVGVLTSIIGVPFFLYLIVRERRALGGGF
FT                   S"
FT   gene            716493..717275
FT                   /locus_tag="RPD_0631"
FT   CDS_pept        716493..717275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0631"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37869"
FT                   /db_xref="GOA:Q13DH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH0"
FT                   /protein_id="ABE37869.1"
FT                   /translation="MTEPALLVARNLGVALSGREVLHGLSLDLTRGHLVALVGPNGAGK
FT                   TTLLRALAGLIESRGEVTIGGDGLSKLALRQRAKRFGYLPQGHLVHWPLPVRDVVALGR
FT                   FPHGATDPARLSPYDAEAVARAMRVTDVARFADRNVNELSGGERSRVALARVLAVEAPV
FT                   VLADEPTASLDPRYQLDVMQTLRQAADAGTLVIVVTHDLGLAARFADTVLVMADGRLAA
FT                   QGAPHQALSDAVLQQVFRVSAYRADYQDSGVILPWTGV"
FT   gene            717279..718118
FT                   /locus_tag="RPD_0632"
FT   CDS_pept        717279..718118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0632"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37870"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG9"
FT                   /protein_id="ABE37870.1"
FT                   /translation="MRRRALSALVVALAAAVLSGAVAAPLPRLASINVCTDQLLMTLAD
FT                   PEQILGLSPYARDEARSFLANKAAAFPMLSGEAEDVLMLKPDIVVTGRYTKRATRELLK
FT                   QQGQRVIEFDTPRTLDEVKALIRTMGDLVGHPDRAVAANARIDTATATARKAASDKAFR
FT                   VLPLERRGWVSGGDSLMTSLLSTVGLVNAASALGIKLGGFASLEAVVSLRPDYLLISED
FT                   GDFAEDEGRAFVLHPALERFYPPSKRITIPERLTVCGGPMLADALDHLSAELSRVEH"
FT   gene            718120..719091
FT                   /locus_tag="RPD_0633"
FT   CDS_pept        718120..719091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0633"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37871"
FT                   /db_xref="GOA:Q13DG8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG8"
FT                   /protein_id="ABE37871.1"
FT                   /translation="MLLDSNALLIVVAALLIDAVIGDPDWLWKRLAHPVVLIGALIGWL
FT                   DGVLNRESWSDGRRKSAGILAILAVIAVTGSIGFFIEAPLRQGWGGWGAIAAVAATLIA
FT                   QRSLYDHVARVRDAFAAGGLEAAREKVALIVGRDPQTLDEAGVSRAAIESCAENFSDGV
FT                   VAPVFWLAVLGLPGLLIYKGINTADSMIGHLNPRYRAFGWAAARLDDLVNWIPARLSGV
FT                   LIALAAPVVRGSIKQSFAVMRRDARKHRSPNAGWPEAAMAGALGIALAGPRIYGGQLTD
FT                   DPFLNDGARAAATPDDIRRATRVLIAVCVLQAAIYAALWFVL"
FT   gene            complement(719064..720551)
FT                   /locus_tag="RPD_0634"
FT   CDS_pept        complement(719064..720551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0634"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37872"
FT                   /db_xref="GOA:Q13DG7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG7"
FT                   /protein_id="ABE37872.1"
FT                   /translation="MTTPTPALMIQGTCSNAGKSTLVAGLCRALVRRGLKVAPFKSQNM
FT                   SNNAAVTADGGEIGRAQAVQARAARLPPSVHMNPVLLKPETDTGAQMIVQGQRFGRLGA
FT                   KNFLDKKAALMPHVLDSFARVARDADIVLIEGAGSPAEINLRAGDIANMGFAIAAQVPV
FT                   VIAGDIERGGVIASLAGTHLVLDGDERAMVRGYLINKFRGDVRLFDQGLTAITDLTGWP
FT                   SLGVVPWLPQAALLPAEDAVDLDRARASSSTRVIAVPMLARIANFDDLDPLGMEPGVKL
FT                   VFVPPGQPIPAEASVVIIPGSKSTLGDLAFLRAQGWDIDIAAHVRRGGHLLGLCGGYQM
FT                   LGRSIADPDGIDGAAGTVQGLGLLDIETIMQGDKSTTLVSGTHCATGAPVEGYEIHLGR
FT                   SHGADCARPVVTIGDRPDGAISPGGRVQGTYLHGLFTNDTFRKAWLAGLGIASELAYDQ
FT                   QVEAALDALADHLETHLDVDRMIAIARSRHSTNQSAA"
FT   gene            complement(720805..721431)
FT                   /locus_tag="RPD_0635"
FT   CDS_pept        complement(720805..721431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0635"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37873"
FT                   /db_xref="GOA:Q13DG6"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG6"
FT                   /protein_id="ABE37873.1"
FT                   /translation="MTDAAPDRDDNARHAEKAKKRKAAHDRKLEGMTDQKGLLIVHTGT
FT                   GKGKTSAALGMVFRHIGHDMPVGVVHFTKSEKWNTGEAKLLAKFPELVTLHIMGEGFTW
FT                   ETQDRERDVAAARAGWERAKALIRDDRHRMVLLDELNIVLRYDYLPISEVIDFLRDEKP
FT                   ADKHVVITGRNANPALIEIADLVTEMTLVKHPFRSGVKAQKGVEF"
FT   gene            complement(721428..725171)
FT                   /locus_tag="RPD_0636"
FT   CDS_pept        complement(721428..725171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0636"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37874"
FT                   /db_xref="GOA:Q13DG5"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG5"
FT                   /protein_id="ABE37874.1"
FT                   /translation="MRGCAGVRRMHLKLDATASIDDGDVARDLQQAPAEIVVLSAADTD
FT                   LAAFAAARATLPDDFPSLRLTNLLALGHPASVDLYVERTLAKARIVILRMLGGEAYWPH
FT                   GVESLRRDAFARGALFACIPGEMQWNADLAARGNVDADDAHSLWRYCTEGGVDNLQLAL
FT                   RYAAWMIMRGDPPPPPRPMPAAGFWPDEPQKSQRRRALVIFYRALAASGDTAAIDALRL
FT                   ALDARGLDAACLYVTSLKDARSIAFLRSALAADPPDIIVNATAFATATATDDSGVLASA
FT                   DCPVLQIAQAGISRDSWEQSSRGLNPRDLAMHVVLPEVDGRIFAGAVAFKQRGTDETDY
FT                   APTIYQPLDDRIAAAADLAQAWVRLRRLPRDQRRVGVVLANYPNRDGRLGNGVGLDTPQ
FT                   SLQDLLTALRAEGYLTGDLPADTAALMQILQRGPTNALTGRDLRDGGVAWPVADYNGAF
FT                   ATLPDAVRSAVTTRWGQPDADPHVADGCFRLGLHRFGNVLVGVQPARGYNIDPKSSFHD
FT                   PDLAPPHHYLAFYLWLRREFDAHAIVHLGKHGNLEWLPGKSAGLSRDCFPAALLGPLPH
FT                   LYPFIVNDPGEGIQAKRRSAAVIIDHLTPPMTRAELHDEMARLEALVDEYALAADLDPK
FT                   RADVIAEDILSLARATRLDADVEIDRSTPTLDALRAIDAHLCDLKEMQIRDGLHVFGRT
FT                   PQPSQRDDLLVSIARLPRSELKPQDASLHRALAQDLGLGEFDPLTRDLAADYTGPRPTV
FT                   LADLCDRPWRTSGDTVERIELLASRLVSTLHRARPDPLPSWPHTWPVLDWIAASLRPAI
FT                   DACGDAERNALLRGLDGHFVRPGPSGAPTRGRPDVLPTGRNFFAVDVRAVPTPSAWRIG
FT                   ALAAERLVEAYWQDAGEWPRAIALSAWGTANMRTGGDDVAQALALIGARPTWEDATGRV
FT                   TGFAIVPLSELQRPRVDVTFRVSGLFRDAFPVQMDLIASAIAAIAALDEPDDANPIAAH
FT                   VRTRTDHLIQTGVAPDAAQRQAGLRVFGSKPGAYGAGLQALIDEGGWETRGDLADAYLA
FT                   WGGYAYGAGRDGDEARDAFAARLTATQLVAQSQDNREHDILDSDDYYQFIGGLAATVET
FT                   LSGAAPKIAHLDTSRPEAPLPRTLAHEIGRVVRGRAANPKWIAGVMRHGYKGAVEIAAT
FT                   VDYLFGFAASTDAVGSHHFDQLFAAYLDDEQVRDFLRDANPAAMRETAERFAEAIRRGL
FT                   WTPRSNHAADLLAELLTRKETA"
FT   gene            complement(725307..726314)
FT                   /locus_tag="RPD_0637"
FT   CDS_pept        complement(725307..726314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0637"
FT                   /product="Cobalamin (vitamin B12) biosynthesis CobW"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37875"
FT                   /db_xref="GOA:Q13DG4"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG4"
FT                   /protein_id="ABE37875.1"
FT                   /translation="MTARVPVTVITGFLGAGKTTLLRALLNQSSGRRIAVIVNEFGDAG
FT                   FDGALVEECGDSVCAPGDIVELTNGCICCTVADDFIPTMEKLLSRERPLDAIVIETSGL
FT                   ALPQPLLKAFAWPAVKTRATADGVVTVVDALALAQGQIPLDDDAVKARRDATHDDPVEE
FT                   VFEDQLACADLVVLSKSDLVAPDQLAALEARLAAKLRPNVRIVRSHGALAPSVLIGLDS
FT                   AAEDDLAARAGHHAEGEEHDHDDFDSIVITPQPADTIETMRSRVGAALGLDGVLRVKGH
FT                   ARIAGKPAPVVVQAVGARVDLAFARPDAQRAEHLVVIGLKGFDTEAARRALADA"
FT   gene            complement(726318..726851)
FT                   /locus_tag="RPD_0638"
FT   CDS_pept        complement(726318..726851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0638"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37876"
FT                   /db_xref="GOA:Q13DG3"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG3"
FT                   /protein_id="ABE37876.1"
FT                   /translation="MTTLVSTLVLGGARSGKSVFGEKLVADSALSRIYLATATRSDDEM
FT                   TQRIAHHRSRRGDGWTTVEEPLALVDALTREAGRGRAVLVDCLTLWLFNLMEAGRDPEI
FT                   EARRLTRFLGVAAAPIVLVSNEVGLGLVPETPLGRTFRDAQGRLNQIIAAAVPDVVFVA
FT                   AGLPLWLKRAQQEN"
FT   gene            complement(726848..727435)
FT                   /locus_tag="RPD_0639"
FT   CDS_pept        complement(726848..727435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0639"
FT                   /product="protein of unknown function DUF1636"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37877"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG2"
FT                   /protein_id="ABE37877.1"
FT                   /translation="MVLWRRRGGVHRTDSRAVAHRSSPRAIRQSSKPQGVAESQGMDRS
FT                   PDHDHTTAPTAELQTDITTDGSTRPAGPVVISVCISCKAADGSNAGAPMLDAIRAAQGG
FT                   AADLRVRPVQCLSVCKRAATVAVSSADGYSFVFGDLVPETGADAIIGFAAAYQHSDYGL
FT                   VPWRQRADVLRKGMVARLPPLRWSPDDGRAPS"
FT   gene            complement(727425..727646)
FT                   /locus_tag="RPD_R0018"
FT   misc_RNA        complement(727425..727646)
FT                   /locus_tag="RPD_R0018"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 122.72"
FT   gene            727743..728798
FT                   /locus_tag="RPD_0640"
FT   CDS_pept        727743..728798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0640"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37878"
FT                   /db_xref="GOA:Q13DG1"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG1"
FT                   /protein_id="ABE37878.1"
FT                   /translation="MPIDTLAAWQPPLIAPVDRALEASLRARIDGKAKPLGSLGRIEEL
FT                   AIELGAISHPAEPRGDNAVLMVFAGDHGLNAEGVSQYPSAVTVAMVMTYLAGKACANAF
FT                   ATACRVDVQVIDSGVAAELPAHPDLIDAKVRMGTGNAAREPAMSAQDAALALTRGIELT
FT                   VAEIKAGADIIALGEMGIGNTASSSLLLHRLAPAPLADCIGVGAGQDAPGMAKKRAAIE
FT                   MAAARSDATAPFEVLCEFGGLEIAMMTGAILGAASQRRPVIVDGFIATAAALLAVRLAP
FT                   AARGYCVFAHRSAERGHDIALQALRARPLLDLDLRLGEGTGAILAVPLLRAAARLSTDV
FT                   ADLSDVLEGKL"
FT   gene            728795..729496
FT                   /locus_tag="RPD_0641"
FT   CDS_pept        728795..729496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0641"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37879"
FT                   /db_xref="GOA:Q13DG0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG0"
FT                   /protein_id="ABE37879.1"
FT                   /translation="MSALDNKAPGMIDPQAAAAANANPPVFDAAFQARFAELLAWRRDV
FT                   RRFRRDGVDPALIEHLLDLAQLAPSVGNSQPWRWVSVDSAATRDKVRANFLRCNEIAAG
FT                   AYQGERAALYARLKLEGIDVAPRQFALFCDRGTAQGLGVGRQTMPEALDYSVVAMIETF
FT                   WLAARTHGLGVGWVSILDPQAITTELDVPAGWKFIAYLCVGWPVEQHVDPELVRHHWQD
FT                   RTSAGRDVLSR"
FT   gene            729640..729906
FT                   /locus_tag="RPD_0642"
FT   CDS_pept        729640..729906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37880"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF9"
FT                   /protein_id="ABE37880.1"
FT                   /translation="MTTSRIHIIGIATIAAMGLLAGPALASNQGPQGSVSEPPSAGCSS
FT                   YMKAPDGSWTKIPCAEAGARAAAAKRNNTRTSAQSQDRSESQD"
FT   gene            complement(729952..730470)
FT                   /locus_tag="RPD_0643"
FT   CDS_pept        complement(729952..730470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0643"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37881"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF8"
FT                   /protein_id="ABE37881.1"
FT                   /translation="MTQITRVFDNPGRARAALDELKAQRFDSAEMVAGPEGRGQTLLRV
FT                   EAPFGTAIRVEEILDRHANAGTPAPTAAAAKPAVTAAPPQAAQPPSRLPAAKTEPAKSP
FT                   SAEPAAPARKLDVDRVASRPRTLSQILGIPELIDSDTFFSGFPLLIRPAPKRAKAEEPV
FT                   AKQPVAKPN"
FT   gene            complement(730592..730804)
FT                   /locus_tag="RPD_0644"
FT   CDS_pept        complement(730592..730804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37882"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF7"
FT                   /protein_id="ABE37882.1"
FT                   /translation="MPIYGYVCNKCGHGFETLLYAHETAACPSCESTDLDQQLSLIAKP
FT                   AKGGPDVPMCDGAGGCGRCSPDLCA"
FT   gene            730929..731258
FT                   /locus_tag="RPD_0645"
FT   CDS_pept        730929..731258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0645"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37883"
FT                   /db_xref="GOA:Q13DF6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF6"
FT                   /protein_id="ABE37883.1"
FT                   /translation="MMDQAEACVVMVTAASKEEAERLAIATLEARLAACVQIQAIASHY
FT                   WWDGKITSDSEQLLLFKTLPAKFAALRDLIISLHSYQTPEIIQLPVTAGADSYLAWIRR
FT                   EVGAE"
FT   gene            complement(731296..731760)
FT                   /locus_tag="RPD_0646"
FT   CDS_pept        complement(731296..731760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0646"
FT                   /product="protein of unknown function DUF123"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37884"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF5"
FT                   /protein_id="ABE37884.1"
FT                   /translation="MPQPQLAQCPDRKGAYVVALAIAAPIEIRLGKAAPAVLRAGRYLY
FT                   CGSAYGPGGLRARLGRHFRKTKTLRWHVDRLTTAGEVRGAWAITQGDECELVRRLGFLT
FT                   APIDGFGASDCAHCRSHLLRWPQRIPRSAIVAALAADRSAAPVWLRAERE"
FT   gene            complement(731828..732022)
FT                   /locus_tag="RPD_0647"
FT   CDS_pept        complement(731828..732022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37885"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF4"
FT                   /protein_id="ABE37885.1"
FT                   /translation="MKARDSGQFRHLSPDELECLAAAEWAQAEAMSDDLKDLVMKSANA
FT                   MHARAKLKRILLSQVPTKH"
FT   gene            732250..733221
FT                   /locus_tag="RPD_0648"
FT   CDS_pept        732250..733221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37886"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF3"
FT                   /protein_id="ABE37886.1"
FT                   /translation="MRNYRAPWWLPGGHLQTIWPTLFARPRPAEALRMGRDRWRAPDGD
FT                   FIDVDHLPGADGAPWLVLFHGLEGSSSSRYAIAFAQAARARGWRFSVPHFRGCSGEINL
FT                   APRSYHSGDFEEIGWMLGRIRERAGRPVFAAGVSLGGNALLRWTEEAGESAAQTVRAVA
FT                   AISAPLDLIAAGAAIDTGLNRQIYTRNFLRTMKPRALAKWRQHPGLFDRDKLTAATTLR
FT                   AFDDAFTAPLHGFRDVDDYWTRASSQPHLHRIRVPALVMNARNDPFVPGASLPAPHQVG
FT                   DNVTLWQPDDGGHVGFAGAPWPGHVHAMPEAVCDWLADRATT"
FT   gene            733338..733526
FT                   /locus_tag="RPD_0649"
FT   CDS_pept        733338..733526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37887"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF2"
FT                   /protein_id="ABE37887.1"
FT                   /translation="MVDGEDDDALAPDDFPIEAEQTALKTQDGETIAQAKTKQIAENIA
FT                   QRLNEQADREEEDRWSA"
FT   gene            complement(733611..734483)
FT                   /locus_tag="RPD_0650"
FT   CDS_pept        complement(733611..734483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37888"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF1"
FT                   /protein_id="ABE37888.1"
FT                   /translation="MPQPPDKRPYRNIAAVLTSMHAKERVIGPILRDELGLIVGLATGV
FT                   DTDRFGAFSREVARTGSQLDAARAKIAAGFDAAPLARVGLASEGSFGPHPYIPFLAIGR
FT                   ELVLMVDRESGLELTGYDASPDTNFGHVVARDVEAAFAFAQRIGFPEHGVIVIGCSDEQ
FT                   PAPEVMLDKQITDAAALEAAVLNAVGLCGAAFVETDMRAHRNPTRMAAIARATRDLARR
FT                   FHSRCPHCGHRGFDVTERLPGLPCAWCGEPTRVIMAEGLMCRSCGHSEQRPVATVPTAD
FT                   PGLCEACNP"
FT   gene            complement(734561..735268)
FT                   /locus_tag="RPD_0651"
FT   CDS_pept        complement(734561..735268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0651"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37889"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF0"
FT                   /protein_id="ABE37889.1"
FT                   /translation="MPTRIYLVRHGATQLTEEDRFAGSSDVHLSDEGRRQVASLAERLK
FT                   NETLDAIYTSPLARTVETARILASPHGLEPIPEAYLKEIDYGRWEGLRRSEVERDFKAE
FT                   YAIWQEDPFTIAPKGGESGLNTLNRILPGVRRIVETHRHRSVLVVSHKGANRLLISSLL
FT                   GFDMRSYRDRLDQSPAALNILDFMSEVRPRLRLFNDVSHYEGIPARVLGQRLSKWWSPQ
FT                   EHVPPVPAAAARS"
FT   gene            complement(735384..737810)
FT                   /locus_tag="RPD_0652"
FT   CDS_pept        complement(735384..737810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37890"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DE9"
FT                   /protein_id="ABE37890.1"
FT                   /translation="MSHPQSPAMADLKRLEAAADRAARAIPPVWPLASSVAVNPFLGQT
FT                   SESLATAGARLARVAGVAVTMPRRWFHDRISAGVISDEDLLEAWLSAPRDLRPADLAAL
FT                   KAAAASDTPKPRALPSIADLAADVSGVDWPGLIAERFGAWAAGYFDEGQALWAAPHGKG
FT                   AFAAWQAVTTHDLTPEIAGLRGFAFHVSEAPDSALAVIARAAERLGLKQAAMDSYFHQM
FT                   LMTLGGWAQYARYALWQAELAGGSDQTITDLLAIRLIWEEALWLRYAPQIAARWASVSA
FT                   AHGAPIAATPDLVTDAILQEAAERAAQRALANTLAKPAIAAIADRPALQAAFCIDVRSE
FT                   VFRRALESVNPKVQTLGFAGFFGLATAHRRLASDIDELRLPVLLNPALRSCAGGPDVAS
FT                   RDRSERVKARATRAWGRFKFAAVSSFAFVEATGPIYVGKLVTDALGLRPAPAANDPAPL
FT                   LSPALDLADRTRAAAAVLRAMSLTDRFARLVVLAGHGANVVNNPHASGLQCGACGGYSG
FT                   EVNARLLAALLNDTKVRAGLTPDGIAIPADTLFLAALHDTTTDAVTLYADDHPSAAHQH
FT                   DISQARIWFAAAGKLARGERALRLPRAAHQGSVARRGRDWAETRPEWSLAGCKAFIAAP
FT                   RTRTTGRSLDGRAFLHDYDWKQDTSFGVLELILTAPVVVASWISLQYYGSTVAPEIFGA
FT                   GNKLLHNVTGGIGVVEGNGGLLRAGLPWQSVHDGASYAHDPLRLSVCIEAPREAISDVL
FT                   SRHDNVRALFDNGWLHLFALDEAGRMAWRYAGDLQWSAMSPVEAADPQPRLKVAV"
FT   gene            complement(737830..739389)
FT                   /locus_tag="RPD_0653"
FT   CDS_pept        complement(737830..739389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0653"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37891"
FT                   /db_xref="GOA:Q13DE8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE8"
FT                   /protein_id="ABE37891.1"
FT                   /translation="MPIHHLPLLAPIALLAVAAVSFANTGLRPKRLPGLAEAAALLALA
FT                   AALASAAGLIVSGTHVSPVLGLYGAGFSLRLDAVSAVMLLLVSFIGWVVVRYAGTYLDG
FT                   EARQGPFTGWLCMTLAAVLLLVTAGNLVQLVLCWIATSVFLHRLLLFYPDRLPARRAAR
FT                   KKLVTARLGDVALIGSAALLAAAYGTADIGSILQAARLGEGGSLAVGAAGLLAFAAVLK
FT                   SAQFPAHGWLTEVMETPTPVSALLHAGVINAGGFLLIRFADVMLLAPAVLAALVMIGGF
FT                   TAVFGGLVMLTQPAVKTSLAWSTVAQMGFMILECGLALFPVALLHIVAHSLYKAHSFLA
FT                   SGGAVERVAAIRRPGPVAIPDAGAVGRAFLAALVIYILVGLGFGLTHKSPQVVALGAIL
FT                   IFGVAYMLAQGFADAAPKALTLRTAVYAVATSVGYFALQSSATLLTASVLPATPTPGPL
FT                   EWALIVIALVSFGLIAIVQAMFPLWAYHPAAAGLRVHLSNGFYANAVFDRLVGGWATRN
FT                   AS"
FT   gene            739498..740397
FT                   /locus_tag="RPD_0654"
FT   CDS_pept        739498..740397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0654"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37892"
FT                   /db_xref="GOA:Q13DE7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE7"
FT                   /protein_id="ABE37892.1"
FT                   /translation="MRDLNFNHLRYFWAVAHQGSLTRAAQHMNLSQSALSVQIQKLEHQ
FT                   MGHPLFERVGKRLVLTEAGKIALDYADTVFKAGDELMSTLRGSPVASRQVFSVGALTTL
FT                   SRNFQLEFLRPLVGRADVELIVRSGNIRDLLAQLEAHTVDVVLANSAAPQDARSPLRNH
FT                   LLAEQPVSLVGRPRKDQHPFRFPEDLRTEPLLLPSLDSDIRVAFDRVLELAGIRPTILA
FT                   EVDDMAMLRLLAREREGVTLVPPIVVRDELEAGILVEHCRIPEVTESFYAIVKKRRFPN
FT                   RLLTDVLGIAKAATSKAA"
FT   gene            complement(740427..740645)
FT                   /locus_tag="RPD_0655"
FT   CDS_pept        complement(740427..740645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37893"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE6"
FT                   /protein_id="ABE37893.1"
FT                   /translation="MLSVLAVALSATVLWLQLIPSWLAFASLGITLAAAGMASDARYGR
FT                   SKSNRTRPAAGRLRNRRSTDGADRSPV"
FT   gene            complement(740669..741208)
FT                   /locus_tag="RPD_0656"
FT   CDS_pept        complement(740669..741208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37894"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE5"
FT                   /protein_id="ABE37894.1"
FT                   /translation="MQREPCSTTAKRDGGATRQLRRPDRNVLSEAIAVFFIGRDSDGFW
FT                   VARDADRPIGGLFLLRSSALAFARNICEPHGCAFVFETDRFELDVENRGNRFAVRIGRF
FT                   KRVLRNIGRRGTFWLGARHRRSRRILDRHHLLGRLDELPNRASMGFVLPVDVSTTIGTP
FT                   RRSIGAAQWHERTTRR"
FT   gene            741649..742233
FT                   /locus_tag="RPD_0657"
FT   CDS_pept        741649..742233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37895"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE4"
FT                   /protein_id="ABE37895.1"
FT                   /translation="MGNAADEGDGGDLTRNDSYRFYLITRDAAWSERDGKRHREHGGLI
FT                   HGRQALRYLGRPFGALVNVITRAKVRRLARELELRGVCYDQPSHSRVTAVSIASMIETI
FT                   DKVGAAPRQPQPQPQPKAPAADTPPRRAPVAAMVRRAIKSVATFLFPEWGQRASKYQPE
FT                   RHYMRGPGPKWREKQGQYAVVARSSSRSQHH"
FT   gene            complement(742397..743344)
FT                   /locus_tag="RPD_0658"
FT   CDS_pept        complement(742397..743344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0658"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37896"
FT                   /db_xref="GOA:Q13DE3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE3"
FT                   /protein_id="ABE37896.1"
FT                   /translation="MTNPINSSTPWLTGFIADLPTPFDANDRIDWGSFEMLCEQQIRSG
FT                   ARAVLVAETMGEASTLTLTEHDALIGAAVAISCGRVAVIAGAGSNSTSQAIDLTRRAEA
FT                   NGADAVMSVVPYYNKPMQSGIVAHFSAIAQATALPIILHDAPGRTARELSDETMQRLAD
FT                   IPRFAGAKDATGDIARLVRLRSKLPPDFHLLSGDDSTAGAYLAAGGDGCVSILSNIAPD
FT                   LCRSIYQYCRQADLVSSRTLAAHLAPLGQAVLPDATPAALKYALCLLGLAAPWVRLPLV
FT                   ELDQSAKMAVAKAVAGVFLSYRGYGGEHRDLIAV"
FT   gene            complement(743349..743792)
FT                   /locus_tag="RPD_0659"
FT   CDS_pept        complement(743349..743792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37897"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE2"
FT                   /protein_id="ABE37897.1"
FT                   /translation="MTSLARPTSSDLAVETMIGLARLATSHPIIVAGADSLLLHRDLHR
FT                   RGYLRCATASGLYVRRGQYCAALIAGDRTHQAIEASIVSASRFLGATATIVVAIQSDEK
FT                   GIGLKVRSRLEQLGFRIEAGVRCPSAFLLSAYRCNFASVGKAA"
FT   gene            complement(743823..744101)
FT                   /locus_tag="RPD_0660"
FT   CDS_pept        complement(743823..744101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE1"
FT                   /protein_id="ABE37898.1"
FT                   /translation="MEQTEPPSCSSHIVLIGKNHRGGWVALEQTGRYGGLFVSRAAALK
FT                   FALLQNGSHPETIFDAAHVLELSLNGIPSSPRLASRIEHAAPCRRAA"
FT   gene            complement(744381..744644)
FT                   /locus_tag="RPD_0661"
FT   CDS_pept        complement(744381..744644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37899"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE0"
FT                   /protein_id="ABE37899.1"
FT                   /translation="MSIQVSWSFSSKPIAGVCVADRQREEADTEGQHDDVQHEMCSLRL
FT                   PITDRRANDRCRSQITRPRPIATDGYVPHWAYGFEGRPLSKL"
FT   gene            744806..746509
FT                   /locus_tag="RPD_0662"
FT   CDS_pept        744806..746509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0662"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37900"
FT                   /db_xref="GOA:Q13DD9"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD9"
FT                   /protein_id="ABE37900.1"
FT                   /translation="MTLFGWIQILLFCAILIASVIPLGWYMTRVFNGEWTPLTPVLRPI
FT                   EQALYWAGGVDPKREQHWLTYAVAMLLFNVGGLLILYGLLRLQAVLPFNPAEQSSVAPD
FT                   LAFNTAVSFVTNTNWQAYGGETTVSYLTQMLGLTNQNFLSAATGIAIAMALIRGFARAS
FT                   ARTVGNFWVDVTRTTLYVLLPICIVGTMVLVWQGVPQNLGAYTEATTLEGAKQVIAQGP
FT                   VASQMMIKHLGTNGGGFFNVNASHPFENPTALTNFIHMFAILLLGAGLTNVFGRMVGNQ
FT                   RQGWAIFGAMGVLFIAGISVAYWAEASGTSGLSSLGLTGGNMEGKEVRFGIAASALFAV
FT                   VTTAASCGAVNSMHDSFTALGGMIPLINMQLGEIIIGGVGAGLYGMLLFVVLAIFIAGL
FT                   MVGRTPEYVGKKIEAREVKMAMLAILVLPLMYLGWTAVAVVMPSAVASMANAGPHGFTE
FT                   VLYAFTSATGNNGSAFGGLSANTMFYNLTLACSMLVGRFFMIIPAMALAGSLAAKRSIP
FT                   PSAGTLPTTGPLFVGLVVGVILIIGGLTFFPALALGPIVEHLSMSANTLF"
FT   gene            746532..748655
FT                   /locus_tag="RPD_0663"
FT   CDS_pept        746532..748655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0663"
FT                   /product="Potassium-translocating P-type ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37901"
FT                   /db_xref="GOA:Q13DD8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD8"
FT                   /protein_id="ABE37901.1"
FT                   /translation="MSAVKTTRRTTGSAMLDPAIVIPAIGSAFVKLDPRAMIKNPVMFV
FT                   VEVVAALTTAIFIKSIVTDGGGDGFGFTLQIILWLWFTVLFANFAEAVAEGRGKAQADT
FT                   LRQTMTNTKAKKLLMEGNYELYEGVPAENLEQGDLVLVEAGDLIPSDGEIIHGVASVNE
FT                   AAITGESAPVIRESGGDRSAVTGGTMVISDRIVVRITAAKGNSFLDRMIKLVEGAARQK
FT                   TPNEIALNILLAGLTIIFVFATVTIPSYAAYAGGQISVVVLAALFVTLIPTTIGALLSA
FT                   IGIAGMDRLVRFNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRQATAFRPVTGVSEEA
FT                   LADAAQLASLADETPEGRSIVVLAKEKYGLRGRDLAELSATFVPFTAQTRMSGVDAGHS
FT                   SVRKGAVDAILNYVNGGGSRAVASGNAVRALHPGMSDAAREISAIADEVAKAGGTPLAV
FT                   AKDGRLLGVVHLKDIVKGGIRERFAELRRMGIRTVMITGDNPMTAAAIAAEAGVDDFLA
FT                   QATPEDKLKLIRDEQAKGKLVAMCGDGTNDAPALAQADVGVAMNTGTQAAREAGNMVDL
FT                   DSNPTKLIEVVEIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFLAFYPQLGVLNVMQL
FT                   ESPQSAILSAIIFNALIIIALIPLSLKGVAYRAVGAGALLRRNLLIYGLGGIVIPFAGI
FT                   KAIDLAITALHLV"
FT   gene            748667..749272
FT                   /locus_tag="RPD_0664"
FT   CDS_pept        748667..749272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0664"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37902"
FT                   /db_xref="GOA:Q13DD7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DD7"
FT                   /protein_id="ABE37902.1"
FT                   /translation="MLKEIRPALVVLVVLTVICGLAYPLAMTGIAGVLFPEQAAGSLIV
FT                   KDGAVIGSALIGQEFKDDKYFHGRPSATSAADPADPTKTVSSPYNAANSSGSNLGPTSK
FT                   ALNDRVKEDVDKLKAENPSAAVPVDLVTASGSGLDPEISPEAALFQVPRVARARGLSED
FT                   GVRKLVNAQTKGRFAGLLGEPRVNVLALNLALDATTRK"
FT   gene            749315..752038
FT                   /locus_tag="RPD_0665"
FT   CDS_pept        749315..752038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0665"
FT                   /product="Osmosensitive K+ channel His kinase sensor"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37903"
FT                   /db_xref="GOA:Q13DD6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD6"
FT                   /protein_id="ABE37903.1"
FT                   /translation="MANPHSDFDQRPSPEALLEKARREDAGVGRLKIFVGAAPGVGKTY
FT                   EMLQSAHAKLKAGVDVVVGVVETHGRAETEALLQGLEILPRQRLDYRDQVLEELDLDGL
FT                   IARRPQLALVDELAHTNAPGSRHPKRYLDVEELLTHGIDVYTAVNIQHIESLNDVVAQI
FT                   THVRVRETVPDSVFDRADALELVDLTPDDLIQRLKEGKVYVPKQAERALEHYFSPGNLT
FT                   ALRELALRRTAERVDEQLLTHMQANAISGPWAVGERILVCVNDDLRAAGLVRYTKRLAD
FT                   RLRAPWTAVNIETRRNLQLSEERRDRLADTLRLAEALGGEALSIPSAGHGIAADILRFA
FT                   RANNVTQIVIGTAPRSWWTGMLRNSVVHGLVGHAGNISVHVIAGDNLAAEPVPKKTVRT
FT                   AERTEPFDVRAYLMALLLVGIGLGIAELIEPLFGIENVDLVFLTAVVGVAVLYGLWPSM
FT                   LASVTASLCYNFFFLPPVYTLTITDPTNIAAFFLFMLIALLVSNLAARLRTQAIAAAGR
FT                   VRTTESLYAFSRKLAGTAALDDVLWATAYQTALMLKVRVVLLLPEAGIIAVKAGYPPED
FT                   QLDPADLAAANWAWNNDRPAGRGSDTLPGGKRLFLPMRTGRGPIGVIGIDNDRTGPLLT
FT                   PDQRRLLDALVDQGALAIERVQLVEDMDRVKRSIETDRLRSALLTSISHDLKTPLASVL
FT                   GAAGTLRGFWTKLSEAERTELLSTIVDESERLNRFIANLLDMTRLESGAVVPNTAPHDL
FT                   SEVVGSALSRASKILSHHKVELDLAPELPMVNLDAVLFEQALFNLLDNAAKYAPEQTTI
FT                   CIRARREGRSVILQVIDEGGGIPPHDLDSVFEKFYRAQKGDHVRAGTGLGLAIARGFVE
FT                   ALHGTIVAANRTDRSGAAMTITLPVPVSTKSLDTAA"
FT   gene            752035..752757
FT                   /locus_tag="RPD_0666"
FT   CDS_pept        752035..752757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0666"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37904"
FT                   /db_xref="GOA:Q13DD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD5"
FT                   /protein_id="ABE37904.1"
FT                   /translation="MNGAPLKILIVDDEPPIRKLLRMGLGTQGYEVLEASNGKIALELL
FT                   KQGPALIILDLGLPDIQGHELLRMIRGRNDSVPIVVLSSRGDEAGKVEALDLGADDYLT
FT                   KPFGMDELLARMRAALRHQLQVHGERPVFRSGDLSVDLVRRLVKVGDRDVKLSPKEYDL
FT                   LRILVQHAGKVLTHKFLLGELWDPLTDAQYLRVYVRQLRQKIEADPERPQFVLTETGIG
FT                   YRLRAPDDPAKTVLSLEH"
FT   gene            752792..753238
FT                   /locus_tag="RPD_0667"
FT   CDS_pept        752792..753238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0667"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37905"
FT                   /db_xref="GOA:Q13DD4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD4"
FT                   /protein_id="ABE37905.1"
FT                   /translation="MKIADFLSPANVLFDLRGSDKSKLLADLSARAAAGVDLAPTQVAP
FT                   YLIKREELGSTGIGEGVAIPHTRLPDLRRPFGLLAKLRTPVEFDAIDAQAVDIVFVLLL
FT                   PAVADNAHLGEIALVARTFRSAETRERVRRAKDASQLYAAVSCA"
FT   gene            complement(753652..754383)
FT                   /locus_tag="RPD_0668"
FT   CDS_pept        complement(753652..754383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD3"
FT                   /protein_id="ABE37906.1"
FT                   /translation="MRMVARPAGWLPGAPTSFNRNGESACVLLPTPDRGRLPAVTVCAR
FT                   RPRHRTPAALGNAPSLPGRRRADKRPLLAPDQAPKDEIETMLATMPPRISPPHDAGLRS
FT                   FSPQPPHTSKLDAIPKLHERLMRVWQLAILRFAVTRDDSDRQSVLALAGEIDRLGHAGR
FT                   ADSFGFFRRTSTRVCAAILADERDSSETLHRFLQEIEAPRLRSAFAAAVGIADKPEPPQ
FT                   KRRREQKRDLFKGLPSRSACP"
FT   gene            complement(754399..754674)
FT                   /locus_tag="RPD_0669"
FT   CDS_pept        complement(754399..754674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37907"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD2"
FT                   /protein_id="ABE37907.1"
FT                   /translation="MKGLNMSIVEPPLRGEQLNVVLIGRDNRGRWIAREQHGRFGGLFV
FT                   SREHAVKYALFENGRRREAIIELATEVELAFDTMPTAAPVLQRRAA"
FT   gene            complement(755121..756110)
FT                   /locus_tag="RPD_0670"
FT   CDS_pept        complement(755121..756110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0670"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37908"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD1"
FT                   /protein_id="ABE37908.1"
FT                   /translation="MSAKLDRRHFIAAGVTAIAMPSVLRGASAQEAWPSRSIRMICSYP
FT                   AGGQTDLLARAFGDFLAKQLDKTVVIENKAGASGSIGTAEVARAEPDGHTILCSISTTF
FT                   LMNRVMMKNPGYDMDKDLTLISVIPGGGLLLVASAKHGIKTLDDFVAFARNSGKVNFGT
FT                   YSAGSAPHITVNELKKQYGLSIEPIHYRGEAPMWTGLLEGSLDVAMGSYTAAQAALQND
FT                   RGTVFAVHSKKVDALPAIKTLPEQGATAKFFTVSGFTGWAVPKATPQPIVDRLAKLFVA
FT                   ANDDPKVKAVLATFMLEPALGFKDSNELYQRELPVWVESGQALGLQPT"
FT   gene            complement(756225..756647)
FT                   /locus_tag="RPD_0671"
FT   CDS_pept        complement(756225..756647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0671"
FT                   /product="Na+/H+ antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37909"
FT                   /db_xref="GOA:Q13DD0"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD0"
FT                   /protein_id="ABE37909.1"
FT                   /translation="MAWLSEILVSALILIGALFLFVGSFGLVKLPDIMRRLHAPTKSTT
FT                   LGIGALLIASMLYFALLQDTLSLHELVITVFLFLTAP