(data stored in ACNUC7421 zone)

EMBL: CP000285

ID   CP000285; SV 1; circular; genomic DNA; STD; PRO; 3696649 BP.
XX
AC   CP000285; AAHZ01000000-AAHZ01000047;
XX
PR   Project:PRJNA12636;
XX
DT   14-APR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Chromohalobacter salexigens DSM 3043, complete genome.
XX
KW   .
XX
OS   Chromohalobacter salexigens DSM 3043
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Oceanospirillales;
OC   Halomonadaceae; Chromohalobacter.
XX
RN   [1]
RP   1-3696649
RX   DOI; 10.4056/sigs.2285059.
RX   PUBMED; 22675587.
RA   Copeland A., O'Connor K., Lucas S., Lapidus A., Berry K.W., Detter J.C.,
RA   Del Rio T.G., Hammon N., Dalin E., Tice H., Pitluck S., Bruce D.,
RA   Goodwin L., Han C., Tapia R., Saunders E., Schmutz J., Brettin T.,
RA   Larimer F., Land M., Hauser L., Vargas C., Nieto J.J., Kyrpides N.C.,
RA   Ivanova N., Goker M., Klenk H.P., Csonka L.N., Woyke T.;
RT   "Complete genome sequence of the halophilic and highly halotolerant
RT   Chromohalobacter salexigens type strain (1H11(T))";
RL   Stand Genomic Sci 5(3):379-388(2011).
XX
RN   [2]
RP   1-3696649
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Gilna P., Saunders E., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Csonka L.N.,
RA   O'Conner K., Vreeland R.H., Oren A., Vargas C., Nieto J., Arahal D.R.,
RA   Goodner B., Wheeler C., Hall P., Ewing A., Benson L., McBeath D.,
RA   Canovas D., Richardson P.;
RT   ;
RL   Submitted (15-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; be612fb439a18ca1a65bb6b1651ab429.
DR   BioSample; SAMN02598275.
DR   CABRI; DSM 3043.
DR   EnsemblGenomes-Gn; Csal_R0001.
DR   EnsemblGenomes-Gn; Csal_R0002.
DR   EnsemblGenomes-Gn; Csal_R0003.
DR   EnsemblGenomes-Gn; Csal_R0004.
DR   EnsemblGenomes-Gn; Csal_R0005.
DR   EnsemblGenomes-Gn; Csal_R0006.
DR   EnsemblGenomes-Gn; Csal_R0007.
DR   EnsemblGenomes-Gn; Csal_R0008.
DR   EnsemblGenomes-Gn; Csal_R0009.
DR   EnsemblGenomes-Gn; Csal_R0010.
DR   EnsemblGenomes-Gn; Csal_R0011.
DR   EnsemblGenomes-Gn; Csal_R0012.
DR   EnsemblGenomes-Gn; Csal_R0013.
DR   EnsemblGenomes-Gn; Csal_R0014.
DR   EnsemblGenomes-Gn; Csal_R0015.
DR   EnsemblGenomes-Gn; Csal_R0016.
DR   EnsemblGenomes-Gn; Csal_R0017.
DR   EnsemblGenomes-Gn; Csal_R0018.
DR   EnsemblGenomes-Gn; Csal_R0019.
DR   EnsemblGenomes-Gn; Csal_R0020.
DR   EnsemblGenomes-Gn; Csal_R0021.
DR   EnsemblGenomes-Gn; Csal_R0022.
DR   EnsemblGenomes-Gn; Csal_R0023.
DR   EnsemblGenomes-Gn; Csal_R0024.
DR   EnsemblGenomes-Gn; Csal_R0025.
DR   EnsemblGenomes-Gn; Csal_R0026.
DR   EnsemblGenomes-Gn; Csal_R0027.
DR   EnsemblGenomes-Gn; Csal_R0028.
DR   EnsemblGenomes-Gn; Csal_R0029.
DR   EnsemblGenomes-Gn; Csal_R0030.
DR   EnsemblGenomes-Gn; Csal_R0031.
DR   EnsemblGenomes-Gn; Csal_R0032.
DR   EnsemblGenomes-Gn; Csal_R0033.
DR   EnsemblGenomes-Gn; Csal_R0035.
DR   EnsemblGenomes-Gn; Csal_R0037.
DR   EnsemblGenomes-Gn; Csal_R0038.
DR   EnsemblGenomes-Gn; Csal_R0039.
DR   EnsemblGenomes-Gn; Csal_R0040.
DR   EnsemblGenomes-Gn; Csal_R0041.
DR   EnsemblGenomes-Gn; Csal_R0042.
DR   EnsemblGenomes-Gn; Csal_R0043.
DR   EnsemblGenomes-Gn; Csal_R0044.
DR   EnsemblGenomes-Gn; Csal_R0045.
DR   EnsemblGenomes-Gn; Csal_R0048.
DR   EnsemblGenomes-Gn; Csal_R0049.
DR   EnsemblGenomes-Gn; Csal_R0050.
DR   EnsemblGenomes-Gn; Csal_R0051.
DR   EnsemblGenomes-Gn; Csal_R0052.
DR   EnsemblGenomes-Gn; Csal_R0053.
DR   EnsemblGenomes-Gn; Csal_R0054.
DR   EnsemblGenomes-Gn; Csal_R0055.
DR   EnsemblGenomes-Gn; Csal_R0056.
DR   EnsemblGenomes-Gn; Csal_R0057.
DR   EnsemblGenomes-Gn; Csal_R0058.
DR   EnsemblGenomes-Gn; Csal_R0059.
DR   EnsemblGenomes-Gn; Csal_R0060.
DR   EnsemblGenomes-Gn; Csal_R0061.
DR   EnsemblGenomes-Gn; Csal_R0063.
DR   EnsemblGenomes-Gn; Csal_R0064.
DR   EnsemblGenomes-Gn; Csal_R0065.
DR   EnsemblGenomes-Gn; Csal_R0066.
DR   EnsemblGenomes-Gn; Csal_R0067.
DR   EnsemblGenomes-Gn; Csal_R0068.
DR   EnsemblGenomes-Gn; Csal_R0069.
DR   EnsemblGenomes-Gn; Csal_R0070.
DR   EnsemblGenomes-Gn; Csal_R0071.
DR   EnsemblGenomes-Gn; Csal_R0072.
DR   EnsemblGenomes-Gn; Csal_R0074.
DR   EnsemblGenomes-Gn; Csal_R0075.
DR   EnsemblGenomes-Gn; Csal_R0076.
DR   EnsemblGenomes-Gn; Csal_R0077.
DR   EnsemblGenomes-Gn; Csal_R0078.
DR   EnsemblGenomes-Gn; Csal_R0079.
DR   EnsemblGenomes-Gn; Csal_R0080.
DR   EnsemblGenomes-Gn; Csal_R0081.
DR   EnsemblGenomes-Gn; Csal_R0082.
DR   EnsemblGenomes-Gn; Csal_R0083.
DR   EnsemblGenomes-Gn; Csal_R0084.
DR   EnsemblGenomes-Gn; Csal_R0085.
DR   EnsemblGenomes-Gn; Csal_R0086.
DR   EnsemblGenomes-Gn; Csal_R0087.
DR   EnsemblGenomes-Gn; Csal_R0088.
DR   EnsemblGenomes-Gn; Csal_R0089.
DR   EnsemblGenomes-Gn; Csal_R0090.
DR   EnsemblGenomes-Gn; EBG00001045258.
DR   EnsemblGenomes-Gn; EBG00001045260.
DR   EnsemblGenomes-Gn; EBG00001045262.
DR   EnsemblGenomes-Gn; EBG00001045264.
DR   EnsemblGenomes-Gn; EBG00001045266.
DR   EnsemblGenomes-Gn; EBG00001045268.
DR   EnsemblGenomes-Gn; EBG00001045270.
DR   EnsemblGenomes-Gn; EBG00001045272.
DR   EnsemblGenomes-Gn; EBG00001045274.
DR   EnsemblGenomes-Gn; EBG00001045276.
DR   EnsemblGenomes-Gn; EBG00001045278.
DR   EnsemblGenomes-Gn; EBG00001045280.
DR   EnsemblGenomes-Gn; EBG00001045282.
DR   EnsemblGenomes-Gn; EBG00001045284.
DR   EnsemblGenomes-Gn; EBG00001045285.
DR   EnsemblGenomes-Gn; EBG00001045288.
DR   EnsemblGenomes-Gn; EBG00001045290.
DR   EnsemblGenomes-Gn; EBG00001045292.
DR   EnsemblGenomes-Gn; EBG00001045294.
DR   EnsemblGenomes-Gn; EBG00001045296.
DR   EnsemblGenomes-Gn; EBG00001045298.
DR   EnsemblGenomes-Gn; EBG00001045300.
DR   EnsemblGenomes-Gn; EBG00001045302.
DR   EnsemblGenomes-Gn; EBG00001045304.
DR   EnsemblGenomes-Gn; EBG00001045306.
DR   EnsemblGenomes-Gn; EBG00001045308.
DR   EnsemblGenomes-Gn; EBG00001045310.
DR   EnsemblGenomes-Gn; EBG00001045312.
DR   EnsemblGenomes-Gn; EBG00001045315.
DR   EnsemblGenomes-Gn; EBG00001045317.
DR   EnsemblGenomes-Gn; EBG00001045318.
DR   EnsemblGenomes-Gn; EBG00001045320.
DR   EnsemblGenomes-Gn; EBG00001045323.
DR   EnsemblGenomes-Gn; EBG00001045325.
DR   EnsemblGenomes-Gn; EBG00001045327.
DR   EnsemblGenomes-Gn; EBG00001045329.
DR   EnsemblGenomes-Gn; EBG00001045331.
DR   EnsemblGenomes-Gn; EBG00001045333.
DR   EnsemblGenomes-Gn; EBG00001045335.
DR   EnsemblGenomes-Gn; EBG00001045337.
DR   EnsemblGenomes-Gn; EBG00001045339.
DR   EnsemblGenomes-Gn; EBG00001045341.
DR   EnsemblGenomes-Gn; EBG00001045343.
DR   EnsemblGenomes-Gn; EBG00001045345.
DR   EnsemblGenomes-Gn; EBG00001045347.
DR   EnsemblGenomes-Gn; EBG00001045349.
DR   EnsemblGenomes-Gn; EBG00001045351.
DR   EnsemblGenomes-Gn; EBG00001045353.
DR   EnsemblGenomes-Gn; EBG00001045355.
DR   EnsemblGenomes-Gn; EBG00001045357.
DR   EnsemblGenomes-Gn; EBG00001045359.
DR   EnsemblGenomes-Gn; EBG00001045361.
DR   EnsemblGenomes-Gn; EBG00001045363.
DR   EnsemblGenomes-Gn; EBG00001045365.
DR   EnsemblGenomes-Gn; EBG00001045367.
DR   EnsemblGenomes-Gn; EBG00001045369.
DR   EnsemblGenomes-Gn; EBG00001045371.
DR   EnsemblGenomes-Gn; EBG00001045373.
DR   EnsemblGenomes-Gn; EBG00001045375.
DR   EnsemblGenomes-Gn; EBG00001045377.
DR   EnsemblGenomes-Gn; EBG00001045379.
DR   EnsemblGenomes-Gn; EBG00001045382.
DR   EnsemblGenomes-Gn; EBG00001045383.
DR   EnsemblGenomes-Gn; EBG00001045384.
DR   EnsemblGenomes-Gn; EBG00001045385.
DR   EnsemblGenomes-Gn; EBG00001045386.
DR   EnsemblGenomes-Gn; EBG00001045387.
DR   EnsemblGenomes-Gn; EBG00001045388.
DR   EnsemblGenomes-Gn; EBG00001045389.
DR   EnsemblGenomes-Gn; EBG00001045390.
DR   EnsemblGenomes-Gn; EBG00001045391.
DR   EnsemblGenomes-Gn; EBG00001045392.
DR   EnsemblGenomes-Gn; EBG00001045393.
DR   EnsemblGenomes-Gn; EBG00001045394.
DR   EnsemblGenomes-Gn; EBG00001045395.
DR   EnsemblGenomes-Gn; EBG00001045396.
DR   EnsemblGenomes-Gn; EBG00001045397.
DR   EnsemblGenomes-Gn; EBG00001045398.
DR   EnsemblGenomes-Gn; EBG00001045399.
DR   EnsemblGenomes-Gn; EBG00001045400.
DR   EnsemblGenomes-Gn; EBG00001045401.
DR   EnsemblGenomes-Gn; EBG00001045402.
DR   EnsemblGenomes-Gn; EBG00001045403.
DR   EnsemblGenomes-Gn; EBG00001045404.
DR   EnsemblGenomes-Gn; EBG00001045405.
DR   EnsemblGenomes-Gn; EBG00001045406.
DR   EnsemblGenomes-Gn; EBG00001045407.
DR   EnsemblGenomes-Gn; EBG00001045408.
DR   EnsemblGenomes-Gn; EBG00001045409.
DR   EnsemblGenomes-Gn; EBG00001045410.
DR   EnsemblGenomes-Gn; EBG00001045411.
DR   EnsemblGenomes-Gn; EBG00001045412.
DR   EnsemblGenomes-Gn; EBG00001045413.
DR   EnsemblGenomes-Gn; EBG00001045414.
DR   EnsemblGenomes-Gn; EBG00001045415.
DR   EnsemblGenomes-Gn; EBG00001045416.
DR   EnsemblGenomes-Gn; EBG00001045417.
DR   EnsemblGenomes-Gn; EBG00001045418.
DR   EnsemblGenomes-Gn; EBG00001045419.
DR   EnsemblGenomes-Gn; EBG00001045420.
DR   EnsemblGenomes-Gn; EBG00001045421.
DR   EnsemblGenomes-Gn; EBG00001045422.
DR   EnsemblGenomes-Tr; Csal_R0001-1.
DR   EnsemblGenomes-Tr; Csal_R0002-1.
DR   EnsemblGenomes-Tr; Csal_R0003-1.
DR   EnsemblGenomes-Tr; Csal_R0004-1.
DR   EnsemblGenomes-Tr; Csal_R0005-1.
DR   EnsemblGenomes-Tr; Csal_R0006-1.
DR   EnsemblGenomes-Tr; Csal_R0007-1.
DR   EnsemblGenomes-Tr; Csal_R0008-1.
DR   EnsemblGenomes-Tr; Csal_R0009-1.
DR   EnsemblGenomes-Tr; Csal_R0010-1.
DR   EnsemblGenomes-Tr; Csal_R0011-1.
DR   EnsemblGenomes-Tr; Csal_R0012-1.
DR   EnsemblGenomes-Tr; Csal_R0013-1.
DR   EnsemblGenomes-Tr; Csal_R0014-1.
DR   EnsemblGenomes-Tr; Csal_R0015-1.
DR   EnsemblGenomes-Tr; Csal_R0016-1.
DR   EnsemblGenomes-Tr; Csal_R0017-1.
DR   EnsemblGenomes-Tr; Csal_R0018-1.
DR   EnsemblGenomes-Tr; Csal_R0019-1.
DR   EnsemblGenomes-Tr; Csal_R0020-1.
DR   EnsemblGenomes-Tr; Csal_R0021-1.
DR   EnsemblGenomes-Tr; Csal_R0022-1.
DR   EnsemblGenomes-Tr; Csal_R0023-1.
DR   EnsemblGenomes-Tr; Csal_R0024-1.
DR   EnsemblGenomes-Tr; Csal_R0025-1.
DR   EnsemblGenomes-Tr; Csal_R0026-1.
DR   EnsemblGenomes-Tr; Csal_R0027-1.
DR   EnsemblGenomes-Tr; Csal_R0028-1.
DR   EnsemblGenomes-Tr; Csal_R0029-1.
DR   EnsemblGenomes-Tr; Csal_R0030-1.
DR   EnsemblGenomes-Tr; Csal_R0031-1.
DR   EnsemblGenomes-Tr; Csal_R0032-1.
DR   EnsemblGenomes-Tr; Csal_R0033-1.
DR   EnsemblGenomes-Tr; Csal_R0035-1.
DR   EnsemblGenomes-Tr; Csal_R0037-1.
DR   EnsemblGenomes-Tr; Csal_R0038-1.
DR   EnsemblGenomes-Tr; Csal_R0039-1.
DR   EnsemblGenomes-Tr; Csal_R0040-1.
DR   EnsemblGenomes-Tr; Csal_R0041-1.
DR   EnsemblGenomes-Tr; Csal_R0042-1.
DR   EnsemblGenomes-Tr; Csal_R0043-1.
DR   EnsemblGenomes-Tr; Csal_R0044-1.
DR   EnsemblGenomes-Tr; Csal_R0045-1.
DR   EnsemblGenomes-Tr; Csal_R0048-1.
DR   EnsemblGenomes-Tr; Csal_R0049-1.
DR   EnsemblGenomes-Tr; Csal_R0050-1.
DR   EnsemblGenomes-Tr; Csal_R0051-1.
DR   EnsemblGenomes-Tr; Csal_R0052-1.
DR   EnsemblGenomes-Tr; Csal_R0053-1.
DR   EnsemblGenomes-Tr; Csal_R0054-1.
DR   EnsemblGenomes-Tr; Csal_R0055-1.
DR   EnsemblGenomes-Tr; Csal_R0056-1.
DR   EnsemblGenomes-Tr; Csal_R0057-1.
DR   EnsemblGenomes-Tr; Csal_R0058-1.
DR   EnsemblGenomes-Tr; Csal_R0059-1.
DR   EnsemblGenomes-Tr; Csal_R0060-1.
DR   EnsemblGenomes-Tr; Csal_R0061-1.
DR   EnsemblGenomes-Tr; Csal_R0063-1.
DR   EnsemblGenomes-Tr; Csal_R0064-1.
DR   EnsemblGenomes-Tr; Csal_R0065-1.
DR   EnsemblGenomes-Tr; Csal_R0066-1.
DR   EnsemblGenomes-Tr; Csal_R0067-1.
DR   EnsemblGenomes-Tr; Csal_R0068-1.
DR   EnsemblGenomes-Tr; Csal_R0069-1.
DR   EnsemblGenomes-Tr; Csal_R0070-1.
DR   EnsemblGenomes-Tr; Csal_R0071-1.
DR   EnsemblGenomes-Tr; Csal_R0072-1.
DR   EnsemblGenomes-Tr; Csal_R0074-1.
DR   EnsemblGenomes-Tr; Csal_R0075-1.
DR   EnsemblGenomes-Tr; Csal_R0076-1.
DR   EnsemblGenomes-Tr; Csal_R0077-1.
DR   EnsemblGenomes-Tr; Csal_R0078-1.
DR   EnsemblGenomes-Tr; Csal_R0079-1.
DR   EnsemblGenomes-Tr; Csal_R0080-1.
DR   EnsemblGenomes-Tr; Csal_R0081-1.
DR   EnsemblGenomes-Tr; Csal_R0082-1.
DR   EnsemblGenomes-Tr; Csal_R0083-1.
DR   EnsemblGenomes-Tr; Csal_R0084-1.
DR   EnsemblGenomes-Tr; Csal_R0085-1.
DR   EnsemblGenomes-Tr; Csal_R0086-1.
DR   EnsemblGenomes-Tr; Csal_R0087-1.
DR   EnsemblGenomes-Tr; Csal_R0088-1.
DR   EnsemblGenomes-Tr; Csal_R0089-1.
DR   EnsemblGenomes-Tr; Csal_R0090-1.
DR   EnsemblGenomes-Tr; EBT00001647974.
DR   EnsemblGenomes-Tr; EBT00001647975.
DR   EnsemblGenomes-Tr; EBT00001647976.
DR   EnsemblGenomes-Tr; EBT00001647977.
DR   EnsemblGenomes-Tr; EBT00001647978.
DR   EnsemblGenomes-Tr; EBT00001647979.
DR   EnsemblGenomes-Tr; EBT00001647980.
DR   EnsemblGenomes-Tr; EBT00001647981.
DR   EnsemblGenomes-Tr; EBT00001647982.
DR   EnsemblGenomes-Tr; EBT00001647983.
DR   EnsemblGenomes-Tr; EBT00001647984.
DR   EnsemblGenomes-Tr; EBT00001647985.
DR   EnsemblGenomes-Tr; EBT00001647986.
DR   EnsemblGenomes-Tr; EBT00001647987.
DR   EnsemblGenomes-Tr; EBT00001647988.
DR   EnsemblGenomes-Tr; EBT00001647989.
DR   EnsemblGenomes-Tr; EBT00001647990.
DR   EnsemblGenomes-Tr; EBT00001647991.
DR   EnsemblGenomes-Tr; EBT00001647992.
DR   EnsemblGenomes-Tr; EBT00001647993.
DR   EnsemblGenomes-Tr; EBT00001647994.
DR   EnsemblGenomes-Tr; EBT00001647995.
DR   EnsemblGenomes-Tr; EBT00001647996.
DR   EnsemblGenomes-Tr; EBT00001647997.
DR   EnsemblGenomes-Tr; EBT00001647998.
DR   EnsemblGenomes-Tr; EBT00001647999.
DR   EnsemblGenomes-Tr; EBT00001648000.
DR   EnsemblGenomes-Tr; EBT00001648001.
DR   EnsemblGenomes-Tr; EBT00001648002.
DR   EnsemblGenomes-Tr; EBT00001648003.
DR   EnsemblGenomes-Tr; EBT00001648004.
DR   EnsemblGenomes-Tr; EBT00001648005.
DR   EnsemblGenomes-Tr; EBT00001648006.
DR   EnsemblGenomes-Tr; EBT00001648007.
DR   EnsemblGenomes-Tr; EBT00001648008.
DR   EnsemblGenomes-Tr; EBT00001648009.
DR   EnsemblGenomes-Tr; EBT00001648010.
DR   EnsemblGenomes-Tr; EBT00001648011.
DR   EnsemblGenomes-Tr; EBT00001648012.
DR   EnsemblGenomes-Tr; EBT00001648013.
DR   EnsemblGenomes-Tr; EBT00001648014.
DR   EnsemblGenomes-Tr; EBT00001648015.
DR   EnsemblGenomes-Tr; EBT00001648016.
DR   EnsemblGenomes-Tr; EBT00001648017.
DR   EnsemblGenomes-Tr; EBT00001648018.
DR   EnsemblGenomes-Tr; EBT00001648019.
DR   EnsemblGenomes-Tr; EBT00001648020.
DR   EnsemblGenomes-Tr; EBT00001648021.
DR   EnsemblGenomes-Tr; EBT00001648022.
DR   EnsemblGenomes-Tr; EBT00001648023.
DR   EnsemblGenomes-Tr; EBT00001648024.
DR   EnsemblGenomes-Tr; EBT00001648025.
DR   EnsemblGenomes-Tr; EBT00001648026.
DR   EnsemblGenomes-Tr; EBT00001648027.
DR   EnsemblGenomes-Tr; EBT00001648028.
DR   EnsemblGenomes-Tr; EBT00001648029.
DR   EnsemblGenomes-Tr; EBT00001648030.
DR   EnsemblGenomes-Tr; EBT00001648031.
DR   EnsemblGenomes-Tr; EBT00001648032.
DR   EnsemblGenomes-Tr; EBT00001648033.
DR   EnsemblGenomes-Tr; EBT00001648034.
DR   EnsemblGenomes-Tr; EBT00001648035.
DR   EnsemblGenomes-Tr; EBT00001648036.
DR   EnsemblGenomes-Tr; EBT00001648037.
DR   EnsemblGenomes-Tr; EBT00001648038.
DR   EnsemblGenomes-Tr; EBT00001648039.
DR   EnsemblGenomes-Tr; EBT00001648040.
DR   EnsemblGenomes-Tr; EBT00001648041.
DR   EnsemblGenomes-Tr; EBT00001648042.
DR   EnsemblGenomes-Tr; EBT00001648043.
DR   EnsemblGenomes-Tr; EBT00001648044.
DR   EnsemblGenomes-Tr; EBT00001648045.
DR   EnsemblGenomes-Tr; EBT00001648046.
DR   EnsemblGenomes-Tr; EBT00001648047.
DR   EnsemblGenomes-Tr; EBT00001648048.
DR   EnsemblGenomes-Tr; EBT00001648049.
DR   EnsemblGenomes-Tr; EBT00001648050.
DR   EnsemblGenomes-Tr; EBT00001648051.
DR   EnsemblGenomes-Tr; EBT00001648052.
DR   EnsemblGenomes-Tr; EBT00001648053.
DR   EnsemblGenomes-Tr; EBT00001648054.
DR   EnsemblGenomes-Tr; EBT00001648055.
DR   EnsemblGenomes-Tr; EBT00001648056.
DR   EnsemblGenomes-Tr; EBT00001648057.
DR   EnsemblGenomes-Tr; EBT00001648058.
DR   EnsemblGenomes-Tr; EBT00001648059.
DR   EnsemblGenomes-Tr; EBT00001648060.
DR   EnsemblGenomes-Tr; EBT00001648061.
DR   EnsemblGenomes-Tr; EBT00001648062.
DR   EnsemblGenomes-Tr; EBT00001648063.
DR   EnsemblGenomes-Tr; EBT00001648064.
DR   EnsemblGenomes-Tr; EBT00001648065.
DR   EnsemblGenomes-Tr; EBT00001648066.
DR   EnsemblGenomes-Tr; EBT00001648067.
DR   EnsemblGenomes-Tr; EBT00001648068.
DR   EnsemblGenomes-Tr; EBT00001648069.
DR   EnsemblGenomes-Tr; EBT00001648070.
DR   EnsemblGenomes-Tr; EBT00001648071.
DR   EnsemblGenomes-Tr; EBT00001648072.
DR   EnsemblGenomes-Tr; EBT00001648075.
DR   EnsemblGenomes-Tr; EBT00001648077.
DR   EnsemblGenomes-Tr; EBT00001648078.
DR   EuropePMC; PMC2223237; 17993567.
DR   EuropePMC; PMC2698493; 19376856.
DR   EuropePMC; PMC3384467; 22510370.
DR   EuropePMC; PMC3526280; 23034806.
DR   EuropePMC; PMC3783009; 24003073.
DR   EuropePMC; PMC5518125; 28729898.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000285.
DR   SILVA-SSU; CP000285.
DR   StrainInfo; 158279; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634505
CC   Source DNA available from Laszlo Csonka
CC   (lcsonka@bilbo.bio.purdue.edu)
CC   Bacteria available from DSMZ: DSM 3043
CC   Contacts:
CC             Laszlo Csonka (lcsonka@bilbo.bio.purdue.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3696649
FT                   /organism="Chromohalobacter salexigens DSM 3043"
FT                   /strain="DSM 3043"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Chromohalobacter salexigens"
FT                   /db_xref="taxon:290398"
FT   gene            93..1580
FT                   /locus_tag="Csal_0001"
FT   CDS_pept        93..1580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57366"
FT                   /db_xref="GOA:Q1R1P2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1P2"
FT                   /protein_id="ABE57366.1"
FT                   /translation="MSVALWQQCLNFLQDELSSQQFNTWIRPLQAEDGDANELCLLAPN
FT                   RFVRDWVNDKYLKRINELLRDLASGKPPKVQLTVGSRRNVAMSSPRDLGAPVSATTMNA
FT                   SRPTEAPAVHAAPRAKGDYADEQEIDRLREREETPRRGGGERQVQVEGSLKHQSGLNPN
FT                   FTFETFVEGKSNQLARAASRQVAENPGGAYNPLFLYGGVGLGKTHLMHAVGNHLAGQRE
FT                   NAKVVYLHSERFVADMVKALQLNAINDFKRFYRSVDALLIDDIQFFAGKERSQEEFFHT
FT                   FNALLEGGQQMILTSDRYPKEISGVEERLKSRFGWGLTVAIEPPELETRVAILMKKADQ
FT                   AKVDLPHDAAFFIAQKIRSNVRELEGALKKVIADSHFMGKPITQDFIRESLKDLLALQD
FT                   KQVGVDNIQRTVAEYYKIKLADLLSKRRSRSVARPRQVAMALAKELTNHSLPEIGDAFG
FT                   GRDHTTVLHACRKVQTLKEESADIREDYKNLLRLLTS"
FT   gene            1630..2733
FT                   /locus_tag="Csal_0002"
FT   CDS_pept        1630..2733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57367"
FT                   /db_xref="GOA:Q1R1P1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1P1"
FT                   /protein_id="ABE57367.1"
FT                   /translation="MRFTITREALLRPLSLVAGVVERRQTLPVLSNVLLQVQDSQLALT
FT                   GTDLEVELIGRTTPHHVDEPGSATVPARKLMDICKSLPEQTDITFTLEEGRAILRAGRS
FT                   RFTLSTLPVAEFPNIEGSQSDTTLTLARGTLKHLIDATSFAMAQQDVRYYLNGMLLEFG
FT                   HHLVRTVATDGHRLAVCARSADVEVEPSQKLIVPRKGILELARLLDGSDEPVELTIGGT
FT                   HLRAQTGDFTFTSKLVDGKFPDYDRVIPRGGDKVVIAERGELRQVLSRTAILSNEKYRG
FT                   VRLNLEENNLRVTANNPEQEEAEENVAIEYDGGALEVGFNVGYLVDVLGVLDADRVQMT
FT                   LSDPNSSALLEEPGGGDAMYVVMPMRL"
FT   gene            2832..3917
FT                   /locus_tag="Csal_0003"
FT   CDS_pept        2832..3917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57368"
FT                   /db_xref="GOA:Q1R1P0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1P0"
FT                   /protein_id="ABE57368.1"
FT                   /translation="MPLERLNFLGLRNLAALDMRPGPGINLITGANGSGKTSLLEGMHV
FT                   LGMARSFRTQKLKHAIAHDADAVTLHGRVAGDPPVALGVRRARDASELEIRLDGERGVR
FT                   VARLAEALPLQLINPDAFRLLEGSPAARREFLDWGVFHVKHEFFEAWRRVRRALKHRNA
FT                   LLRHDRIDARSMRVWEQELAHWSELLDALRSEYMAQFAKAFEDTLHELLPLSGLSLRYY
FT                   RGWDKQRGLLEVLEGGRDTDRQMGFTQQGPQRADLRLRIGKRAAVEELSRGQQKLVVSA
FT                   LKLAQGRLLDELTGRTCVYLIDDLPAELDVTHRRIFCHWLERLRCQVFITSVEREALAN
FT                   AWQSETDVAMFHVEHGRLLTE"
FT   gene            3937..6354
FT                   /locus_tag="Csal_0004"
FT   CDS_pept        3937..6354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57369"
FT                   /db_xref="GOA:Q1R1N9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N9"
FT                   /protein_id="ABE57369.1"
FT                   /translation="MSEQAYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFELV
FT                   DNSIDEALAGHCSEIRVVIHPDESITVSDNGRGIPTDIHSEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSEELKLTVWRAGQVYEQIYHHGVPDSPLDVVGKTEK
FT                   SGTQVNFKPSTETFANIEFHYDILAKRLRELSFLNSGVAIRLIDERSGAEELFHYEGGL
FT                   RAFVDHLNTNKTALNQIFHFETQRDDGIAVEVAMQWNDTFSENIFCYTNNIPQHDGGTH
FT                   LAGFRAALTRTLNHYIESEGLLKKAKVNTSGDDAREGLTAIVSVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVEQEMGRQFSDYLVERPNEAKAIVNKMLDAARAREAARKARDMTRRKGALD
FT                   IAGLPGKLADCQEKDPSLSELYLVEGDSAGGSAKQGRDRRTQAILPLKGKILNVEKARF
FT                   DKMLSSAEVGTLITALGCGIGREEFNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFFRQ
FT                   MPELIERGHVFIAQPPLYKIKRGKQETYLKDEQALTDYLTTTALDGARLYVNANAPGIA
FT                   GEQLENLVSQYRDVMRRIDRLSRVYPNLVLRKIVHTAKLENESLKDRVTMQNWIDHLQA
FT                   EMDSIIAYEGGPRYTFQLQEDTERGLFLPSVALTAHGVTTDYVWGVDFFRSADYHAMTA
FT                   LGETLDGLLEESAYVARGERQRSVGTFYEALDWLMSEAQRGLSVQRYKGLGEMNPEQLW
FT                   ETTMDPQSRRMLRVSIEDAVASDMMFNTLMGDEVEPRRDFIERNALVANLDI"
FT   gene            complement(6482..7039)
FT                   /locus_tag="Csal_0005"
FT   CDS_pept        complement(6482..7039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0005"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57370"
FT                   /db_xref="GOA:Q1R1N8"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N8"
FT                   /protein_id="ABE57370.1"
FT                   /translation="MPLPPKLVILDRDGVINQDSDAYIKSLEEWIAYPQAIEAIAYLTQ
FT                   HGWTVAIATNQSGIARGYFDTATLDAMHEELRHQVSRAGGEIAHIAYCPHGPDDRCDCR
FT                   KPLPGLLQQVHQALGLSTLEGSWMVGDSLRDLQAGQAAGCHAALVRTGKGVRTEQKGQG
FT                   LENVRIFDDLASFSRWLIPDDA"
FT   gene            complement(7384..9450)
FT                   /locus_tag="Csal_0006"
FT   CDS_pept        complement(7384..9450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0006"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57371"
FT                   /db_xref="GOA:Q1R1N7"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1N7"
FT                   /protein_id="ABE57371.1"
FT                   /translation="MASTPLLVELGAEELPPSAIEPLALALRDGIAKGLADADVAFASA
FT                   HAYATPRRLAVRVEGLDDKQPDRDIERRGPALAAAFKDGQPTKAAEGFARSCGVTVDDL
FT                   IHLETDKGTWLGYRYQESGEATTALLPAIVERAVQALPVPKNMRWGASRTEFSRPVHWL
FT                   VMLYGADVVPATVLGLEAGRTTRGHRFHAPDAIDLAHADDYLDALENAYVLADMQRRRE
FT                   RIREQVLAEAEVNEATAVIDEDLLDEVSGLVEWPVALTGSFDERFLDVPAECLISSMKA
FT                   NQKYFHLLDAQGTLKPLFITVSNIESRDPQQVIEGNEKVIRPRLADAAFFYDTDRKQSL
FT                   ASRRSALESVVFQQSLGTLADKAQRIEAISSFIASRIGGDADHASRAAQLAKCDLVTEM
FT                   VLEFPELQGIMGTYYARQDGEPEEVAQALHEQYLPRFASDDVPATPAGLALALADRLDT
FT                   LTGIFGIGQRPSGTKDPFALRRAAIGVLNILVKAELDLDLRELLELAAAQHGDLPKAEG
FT                   LVDDVLDYMLDRFRAWTQDEGIAVEVYLAVRARPVTRPLDFARRIRAVHAFSQREEAVA
FT                   LAAANKRVSNILSKQQHDGSTSVDTGLLQAEAETTLSTALEQCHQSVRPLLDAARYAEA
FT                   LDVLAQLRGPVDAFFEDVMVMAEDEAVRRNRLALLASLQSLFLEVADIAQLQQ"
FT   gene            complement(9453..10424)
FT                   /locus_tag="Csal_0007"
FT   CDS_pept        complement(9453..10424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0007"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57372"
FT                   /db_xref="GOA:Q1R1N6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N6"
FT                   /protein_id="ABE57372.1"
FT                   /translation="MTQSTPDVKTFQGLILALQQYWAEQGCVILQPLDMEVGAGTFHPA
FT                   TFLRSIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVMKPSPQALQALYLGSL
FT                   ERLGIDPQVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTG
FT                   ELTYGLERIAMYLQDVDSVYDLVWTYAPDGSSVSYGDVYLQNEREQSAYNFEHADVDYL
FT                   FGAFDHCEGECRKLLDAGLPLPAYEQVLKASHTFNLLDARHAISVTERQRYILRVRTMA
FT                   RDVAHAYFESRKAAGFPMASETLRQELLNQELPSQESNEGDA"
FT   gene            10507..11508
FT                   /locus_tag="Csal_0008"
FT   CDS_pept        10507..11508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0008"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase precursor"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57373"
FT                   /db_xref="GOA:Q1R1N5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1N5"
FT                   /protein_id="ABE57373.1"
FT                   /translation="MHASRVGARLEGIDDMIVVTGGAGFIGANLVKALNARGREDVLVV
FT                   DDLSDGTKFVNLADCTLGDYLDKDDFLARVKAELRGEPSELPPIEAIFHEGACSDTTEW
FT                   DGKFMLENNFEYSKVLLHFCQYKRIPFLYASSAATYGGSEVFVEAPEHEKPLNVYGYSK
FT                   LLFDQYVRVHWESFDAQVVGFRYFNVYGPREQHKGKMASVAYHHHSQVKRGENPKLFGA
FT                   WDGYEAGMQSRDFVYVGDVVDVNLWCLDHPEVSGIFNLGTGRAEPFKAIAETVIDYYAT
FT                   GKIDYIDFPEELKGRYQSYTRADISRLREAGYKAEFKTVREGVSAYLDWLNG"
FT   gene            11501..12550
FT                   /locus_tag="Csal_0009"
FT   CDS_pept        11501..12550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0009"
FT                   /product="Lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57374"
FT                   /db_xref="GOA:Q1R1N4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N4"
FT                   /protein_id="ABE57374.1"
FT                   /translation="MADDTATSPRLLVVGPSWVGDMVMAQSLFMTLKAHHPEAYIGVMA
FT                   PGWSLPILARMPEVDETIALDVKHGEFGWATRRAVAGKLKGRFDRAIVLPRSWKSALVP
FT                   FLARIPERVGFHGEQRYWLLNARRQLDKRVLDQTVKRFVSLGLPEEQALTGDFAIPAPR
FT                   LDVNGDEQQRLRDSLGLSSGPAIGMMPGAEFGPAKQWPLAHFRTLAERLVAEGYEVRVM
FT                   GGPKDADAGETISQALPGVHNLCGRTQLTEVVDLLADCQQVVTNDSGLMHVAAAVGTRV
FT                   QAVYGSSSPSYTPPLTENAEIHDLYLSCSPCFARECPLGHTNCLRHLEPARLLASIRAA
FT                   GSASPRSLS"
FT   gene            complement(12543..14012)
FT                   /locus_tag="Csal_0010"
FT   CDS_pept        complement(12543..14012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0010"
FT                   /product="Phosphatidylglycerol--membrane-oligosaccharide
FT                   glycerophosphotransferase"
FT                   /EC_number="2.7.8.20"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57375"
FT                   /db_xref="GOA:Q1R1N3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N3"
FT                   /protein_id="ABE57375.1"
FT                   /translation="MIPVAALWVAIAWRFRWGHPRQRASLRRVWPWSLVPLILWWVYLY
FT                   LDDSFGKLDLGAVIFHLQAGMTEHGGERRVFAAFAFTLCCILMLVAFTWLVRADHRWRL
FT                   WERVGAIFLLAFNPLLFGLSQRGASAITQGDWLRQHYQPPRIATTPQTRPNLIYLYLES
FT                   TERTYADRETFGNAYEDLAALGRRGTVFEGIKQLDNTGWTTAGMVATQCGVPLIPAGLM
FT                   HDNQFEPLDAVLPHTRCLGDMLNAQGYDLTYMGGASTRFAGKKVFYEGHGFDTVLGRDE
FT                   LEDDVTPPDYLNDWGLYDDTLLDMATQRIRELAGDASRQPYALFALTLAAHPPFGNPSQ
FT                   SCLENQGEFDGVDILYSVKCTGWLVRRFLERLDREGLLDNTLVVISSDHLSMKNSEWPQ
FT                   LVTAQRENTFMMLGQGVPAGKRIQRQGSMVDVYPTVLEAMGFTLETRAAGLGHSLFAER
FT                   PTLIEEYGLETINDHMQEEDALQSYMWKGVN"
FT   gene            complement(14218..14973)
FT                   /locus_tag="Csal_0011"
FT   CDS_pept        complement(14218..14973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0011"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57376"
FT                   /db_xref="GOA:Q1R1N2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N2"
FT                   /protein_id="ABE57376.1"
FT                   /translation="MKPLTGIVITLNEQANIADCVRSLRRVCDEVIVVDSLSTDDTVAI
FT                   AEAEGATVISQAYLGDGPQKAHGVPFAKHDWILALDADERLDDDAVALIESLALDDPRT
FT                   AYSFRRKNYVARHWIRAAGFYPDPVVRLYNRTTSGYLPKKAHSSVQAPRVEATSAHLRH
FT                   FTYEDMSHWIRRIDTLSSRDAWAMKERGKRPSRLSPILHATNAMLRKLVFKGGLFQGMD
FT                   GMTVAMTTAFHAYMKYAKLNELYELERDA"
FT   gene            complement(14970..16040)
FT                   /locus_tag="Csal_0012"
FT   CDS_pept        complement(14970..16040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0012"
FT                   /product="glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57377"
FT                   /db_xref="GOA:Q1R1N1"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N1"
FT                   /protein_id="ABE57377.1"
FT                   /translation="MTQPRPQRILVVRNDKLGDFMLAWPALACLKSAHPDNHVAVLVPT
FT                   YTAPLAHACPWVDEVILDPGDGAPRDQRKALRAALRAGGFDALLTLFSTPRIGWLGWRA
FT                   GISLRMAPATKWAQVFYNFRIKQRRSRSQKPEYVYNQELAHALLRALGQDIPATAPPYW
FT                   PLPAQARDTQRQRLREELGIASSAPWWFLHPGSGGSAVNLSVAQYIDLVVSLNGLLASP
FT                   PKWVITHGPNEEATAQGLVDTLEAHGIEAWLMPPRASLTDFALTLAAADAFIAGSTGPL
FT                   HIAGALNRPTIGFYPAKRSATPLRWQTCNAEERRLAFSPPADDASATDMSRIDIGAVAR
FT                   HIADAWPSRAATEETP"
FT   gene            16071..17240
FT                   /locus_tag="Csal_0013"
FT   CDS_pept        16071..17240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0013"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57378"
FT                   /db_xref="GOA:Q1R1N0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1N0"
FT                   /protein_id="ABE57378.1"
FT                   /translation="MSRPLSEELALQHKVLHICLSRGWGGLEMYPVRIIPELVRQGWRA
FT                   YVLTLEGTRLAQALADSKAVEVRSVRSPSRALWQLPALVRWLRRRGIGVVHCHKSSDLR
FT                   LGALLKCLCPELRLIFTDHMGVTRPKHDPYHRWVYRRVNRVLSISEATLARNRKAFPLP
FT                   ASRITPLYLGVDTARFTPRLEAAERQTLRDDLGIPREAVAIALPGRLTPGKGQQVLLDA
FT                   FMRLVDAGDRQSHLVLIGGLEAGEGGNSTFIASLRQQVTERGLQDRVTFTGFRRDLARL
FT                   FEVLDIVCVPSRNEAFGLTVIEAMAAGKAVVGSDSGAIPELIGAGCGRLVDPQDPAAWA
FT                   ATLRELRDAPALREQLGTAARRLANARFTLAKHVTGLRAVYEDIDQPWR"
FT   gene            complement(17225..19072)
FT                   /locus_tag="Csal_0014"
FT   CDS_pept        complement(17225..19072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0014"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57379"
FT                   /db_xref="GOA:Q1R1M9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M9"
FT                   /protein_id="ABE57379.1"
FT                   /translation="MQDTLRRRWRGTLAFALLQLPLIWLVALRYTPYLAVPDDPMGVAY
FT                   LVLTWIGHFGMLALLGWLPLGVLALLLKARWLWLPAALLGALGLCALLLDTVVYAQYRF
FT                   HVNYFMVSLFLNDENGEIFSFTTSTWLVVIGCVLLALTLEGWLAQRLIAGGRGRRLPVG
FT                   SACGVVLLALLGSHALHIVADARYMRSVTQQVGVYPLLFPTTAKDFMEEHGWLDPRAAR
FT                   AANADIEARQAQNLDWPKNPLSCQAMQPPNVLVVLIDSWRADEYGPKNTPNLHAALNES
FT                   GRRYLNHYSGGNATRNGTMSLFYGLTGNYYAYLNDSQTPPLLLTQLQKQDYALGIFSSA
FT                   SLGSVGFDRTIFSSIESLRMDTQGDSPADRDRQMTEDWMHWLGRQERQDATPWFGMLFY
FT                   DAPHGYDVPADAAQPFQPSVQNMDYLELGPETDPLPYFNRHRNAVHYDDVLLGKTIDDL
FT                   KAKGEWDETLLVVTSDHGQSFDDFDKNYWGHNGHFASPQTRVPMLVNGPGVEPGEVTGM
FT                   TSHLDVAPMLMRHALGCSNPLSDYAMGEDLLKPGIDHPWVQSSSYIDYGIIEPNRITVV
FT                   DGTGQWEIVDRQLDPIEGAEFSPAVFDAMQWFRRFYRQG"
FT   gene            complement(19085..19804)
FT                   /locus_tag="Csal_0015"
FT   CDS_pept        complement(19085..19804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0015"
FT                   /product="lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57380"
FT                   /db_xref="GOA:Q1R1M8"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M8"
FT                   /protein_id="ABE57380.1"
FT                   /translation="MATFQTGKAFILYDADILCDAGQGPQIDADWFTPAFWRSRDAVIG
FT                   EAPGRGASLFVAHGDERWALRPYRRGGAIARVSERRYVWTGLERTRAFREMRLTAALEQ
FT                   RGLPVPTPVAAAVWRHALSYEAALITRVIPGVQALAERLPTADTPLLARVGQTIRRFHD
FT                   VGLDHVDLNARNLLVDADDRVWLIDLDRCRLRAPGRWQEANLARLERSLARFSPTTAGR
FT                   AFTAIVDGYRHAPRDSR"
FT   gene            19848..20921
FT                   /locus_tag="Csal_0016"
FT   CDS_pept        19848..20921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0016"
FT                   /product="glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57381"
FT                   /db_xref="GOA:Q1R1M7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M7"
FT                   /protein_id="ABE57381.1"
FT                   /translation="MLRLSALGDVCNLVPTIRVLQRLWPDARITWIIGKGEHSLLAGLS
FT                   GVEFIVYDKATGLAGMREVWRQLGDTRFDVLLHMQQALRASVLSLGLKADLRIGYDKAR
FT                   AKDWQHWFTHRQLTPHPRAHVLDSFLDFARLLGGAERVDAEPLRWDLAIPDTAYQEAAR
FT                   VTGDAPYIVISPCANPRLRNFRNWSAEGYAAVISHAWQEHGLRTVMTGGGSTQEQEMGA
FT                   RIRALCAEEAVIDAIGATSLKGLLAMLDRARMVIAPDSGPVHMANALRTPTLGLYATTN
FT                   PERAAPYCWRDFVVDRYPDAVRRYLHKSPEAITWGARVRHPDAMSLIHADDVIAQFDAL
FT                   LNAAPSASSRPEPDHET"
FT   gene            20911..22341
FT                   /locus_tag="Csal_0017"
FT   CDS_pept        20911..22341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0017"
FT                   /product="D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57382"
FT                   /db_xref="GOA:Q1R1M6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1M6"
FT                   /protein_id="ABE57382.1"
FT                   /translation="MKLDLTVLEQARLLVVGDVMLDRYWHGGTSRISPEAPVPVVKVGE
FT                   SEDRPGGAANVALNIAALGAHAALAGVVGEDENADLLAARLEACDVSTYFYRSPEIPTI
FT                   TKLRVMSRNQQLLRLDFEESLWEIDTQGLTERVEAALPEADVVILSDYGKGSLNRVETL
FT                   IATARGAGKRVLVDPKGHDFAKYRGASIITPNLGEFEAVVGPCPDDATLAEKGERLRAE
FT                   LELEALLVTRSEKGMTLIREGHAPLHLPTHAREVYDVTGAGDTVIGVLGLALAAGHGYP
FT                   EAIMLANLAAGLVVAKPGTATLSIAELYTALHGDKLAEFGPIEESALIDAVRAAKLRGE
FT                   RVVMTNGCFDILHAGHVAYLEQAKRLGDRLVVAVNDDASVGRLKGPKRPINALERRMQV
FT                   LAGLSAVDWVVPFGEETPARLIAEVLPDVLVKGGDYRPEDIAGGEAVMAAGGEVRVLNF
FT                   EDGVSTTAMIDTILDREG"
FT   gene            22348..23637
FT                   /locus_tag="Csal_0018"
FT   CDS_pept        22348..23637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0018"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid
FT                   transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57383"
FT                   /db_xref="GOA:Q1R1M5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M5"
FT                   /protein_id="ABE57383.1"
FT                   /translation="MLTPRLARGLYSGALYLLSPLIWWRVWREHALTNKRAERLGLIAA
FT                   VDETPTVWLHAASVGEVLAARPLIEALAERHADHRLVVTTMTATGAERVRALFPAERYA
FT                   LTHYFLPLDFPGAARRFMRRLRPRLAIIVETELWPNLLAACDRQRVPVVVANARLSEKA
FT                   FQGYRRVRALLHGALGAVSWLAAKSEADLERFVALGLPRARGDVVGSIKFDLPLNDGFR
FT                   DEGKRLHSAWGRRFVWVAGSTHDGEDEQVLDAHARLRERDPQALLVLVPRHPQRFAAVA
FT                   ELCMARGERIARRSQGETPDAATSVLLVDTMGELMRFYAAADVAFVGGSLMPIGGHNLL
FT                   EPAALGVPVLTGPHLENFEDIAATLREAQALREVDDAAALGDALVALADDPEARRGLGA
FT                   AGEAVVDANRGALEATLAGIAARLPATPTR"
FT   gene            complement(23672..24385)
FT                   /locus_tag="Csal_0019"
FT   CDS_pept        complement(23672..24385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0019"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57384"
FT                   /db_xref="GOA:Q1R1M4"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M4"
FT                   /protein_id="ABE57384.1"
FT                   /translation="MGTALRFTRQDGHDMTQDELKRAVAAAAIEEITPLLGRDTIIGVG
FT                   TGSTANFFVDLLAEHKHDFLGAVASSEATAKRLRDHGIDVYELNHVGTVPVYVDGADEI
FT                   DAHFNMIKGGGAALTREKIVAACAERFVCIADASKRVDVLGGFPLPIEVIPMARSYVAR
FT                   EMVKLGITPVYRDGVVTDNGNQILDGYECLFEDPRAMEQRLNNIVGVVTNGLFAQRGAD
FT                   VLLLGTEHGVERHTP"
FT   gene            24625..26139
FT                   /locus_tag="Csal_0020"
FT   CDS_pept        24625..26139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0020"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57385"
FT                   /db_xref="GOA:Q1R1M3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M3"
FT                   /protein_id="ABE57385.1"
FT                   /translation="MLEETVKKILQARVYEAARETPISPAPFLSRRLNNTILIKREDLQ
FT                   PVYSFKIRGAYNKMAQLSDEQKAKGVIAASAGNHAQGLAMAAKQMGVKAVIVMPRITPD
FT                   IKVQAVRARGAKVVLKGDAFGEALAHARELIDEHGYTYIPPFDDNDVIAGQGTVGMEIL
FT                   RQHSGPLDAVFVPVGGGGLLAGVVAYIKYLRPEIKVYGVEAEDAACLKAALEAGERVTL
FT                   DQVGVFAEGVAVAQIGEAPFEILRHWVDGVITVTTDEMCAAVKDIFEDTRAVAETSGAL
FT                   SLAGLKKYIQQQNAEGETLLCINSGANTNFDRLQHIAERTELGEQREAILAVTIPERPG
FT                   SFKKFCKTIGKRMVTEFNYRYADPDHAHIFVGVQVKPGGEDRQAVIDKLREAGYPVEDL
FT                   TDNELAKLHIRHLGGGRPKEHFSEEVYRFEFPERPGALMNFLTHLPGDWNISLFHYRNH
FT                   GAAYGRVLVGMQIPNGARAHVEEHFERIGYRYWKESDNPAYRLFMA"
FT   gene            complement(26582..27208)
FT                   /locus_tag="Csal_0021"
FT   CDS_pept        complement(26582..27208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0021"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57386"
FT                   /db_xref="GOA:Q1R1M2"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M2"
FT                   /protein_id="ABE57386.1"
FT                   /translation="MTHDATSDMPSRRQLRRTLRQRRRGLSAAQRRQAARLLSQRLRRL
FT                   PEVKRARRVALYLPNDGEIDPRPLIDWFRRRGAHVYLPVLRPLSDNRLWFVHYHASTPM
FT                   RTNRFSIPEPCTRHGAHHARRLPAWALDLVLMPLVGFDASGNRLGMGGGFYDRTFAFRR
FT                   LRRPHPCLIGLAHDCQYVERLPAADWDIPLDAIVSDARVVRPTRT"
FT   gene            complement(27443..27760)
FT                   /locus_tag="Csal_0022"
FT   CDS_pept        complement(27443..27760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0022"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57387"
FT                   /db_xref="GOA:Q1R1M1"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M1"
FT                   /protein_id="ABE57387.1"
FT                   /translation="MTDASRPTIEITLLGRPYVIACPPDQEDDLKRAARYLDRAMNGIH
FT                   AQGKVQGAERIAIMAALNITHELLEALDNQREGEASLSRVNERLENALANVPSNADDAA
FT                   T"
FT   gene            27974..28576
FT                   /locus_tag="Csal_0023"
FT   CDS_pept        27974..28576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57388"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1M0"
FT                   /protein_id="ABE57388.1"
FT                   /translation="MSLIDEQLDFSRVADTFLAHGSLQSPAFLDGRLCARLALDDIAAD
FT                   TWLEEVCATLGVDQPKSREDGEVLLAWRQQTLDALAAPELNFEPLLPDELFSLAERARG
FT                   LQEWTQGFLEAVAEVASDKRDGWSAALREVLEDLASLTEFDIELDETAENENDLFALTE
FT                   HARMAAMLLYTEQHPGQPQVERVDTEDDGSTPPDQTH"
FT   gene            28632..29969
FT                   /locus_tag="Csal_0024"
FT   CDS_pept        28632..29969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0024"
FT                   /product="aminopeptidase P, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57389"
FT                   /db_xref="GOA:Q1R1L9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L9"
FT                   /protein_id="ABE57389.1"
FT                   /translation="MPRTPLPRPAAISPAEYRARRQSLMAALPPQSAVLLSAASLKTRN
FT                   RDSEYPFRQDSDFHYLSGFPEPDALLVLLPGREDGEAVLFCQEKDPHMEAWTGLRIGAE
FT                   KAVTTYGLDAAYENDERDALLPELLDGRETLYLPFDDGETLALAESLRAELAAQARRGA
FT                   RAPRAFADVAPLIHERRLIKSEAELDLMRHAARISAAAHRRAMRSVCPGLQEYQLQAEL
FT                   EHEFAWHGARAPAYATIVGGGENACVLHYIENGATLNDGDLVLIDAGGEFDLYAGDITR
FT                   TFPVNGRFSSAQRELYDLVLEAQCRAVAAVAPGTTLQAIHEGVVRDLTDGLIRLGLLEG
FT                   PLETRIDDHGYRRFFLHATSHWLGLDVHDVGDYRLEGQPRELMPGMVLTVEPGLYIPDA
FT                   EDIPEAYRGIGIRIEDDVAVTATGREVLTTDVPKSVADIEALMHDR"
FT   gene            30148..31350
FT                   /locus_tag="Csal_0025"
FT   CDS_pept        30148..31350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0025"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase /
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57390"
FT                   /db_xref="GOA:Q1R1L8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L8"
FT                   /protein_id="ABE57390.1"
FT                   /translation="MPRNRVDIAIVGGGLVGASLACALAPLIERHGLRVAVIEAAPLND
FT                   AQAATFQPSFDARASAIAQGSRRHFERLGVWATMAERATPIRQIHVSERGRFGATRLTA
FT                   DEFDLDALGYVIPNAWMGQVLHAALGALPLTWHCPARVDDIVPIADGHRLALSDGACLE
FT                   AGLTVLADGGRSGLKERLGIASQAQPYEQHALIANVEVGRDHGGVAYERFSSQGPMALL
FT                   PMAGRRMALVWTHASERREDALAWSDDVCLRRLQDAFGDRLGRFRRIGRRDAYPLSLVT
FT                   ANEPVRPHLAVLGNAAHALHPVAGQGFNLALRGVMDLVATLEDGLSRGQAPGGAGLLGE
FT                   FENRRAADRRNVIRFSDGLIRLFGIEHAAFSHLRAAGLVGLNIVSPLRRTLARRAMGLE
FT                   R"
FT   sig_peptide     30148..30219
FT                   /locus_tag="Csal_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.727 at
FT                   residue 24"
FT   gene            31347..32603
FT                   /locus_tag="Csal_0026"
FT   CDS_pept        31347..32603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0026"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57391"
FT                   /db_xref="GOA:Q1R1L7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L7"
FT                   /protein_id="ABE57391.1"
FT                   /translation="MTADEETNMEETTHDEVIVVGGGMVGAALAALLGEAGISVTVLDA
FT                   RPAPLASDDVGRGLPAPRVSALTPVSQRLLTHLGVWSWMAERRVSPYQGMRVWDGEGSG
FT                   EIAFEAADIGLRELGHIVENDVVLAGLEARLAALPSVTQRFGARVSGIEREDETQTLTL
FT                   DDGSRWMAPLVVAADGARSPLRRLAGIEVREHDTGHVALVTTLRCEQAHGGVARQVFLP
FT                   DGPLAFLPLRVEEDDHHCSIVWSTRPEHAERLLALDPATFAEALNAAMEDRLGKIDVLD
FT                   EVHHFPLTQRHAHDYTAPGLALIGDAAHSIHPLAGQGVNLGFLDAAVLAEEIVHARQRG
FT                   VALGDARTLARYARRRRGDNAAMLALMDGFRLLFGARHPALRLIRNVGLSSTHRLMPLK
FT                   RLLIRQAAGERGELPAVCR"
FT   gene            complement(32610..34043)
FT                   /locus_tag="Csal_0027"
FT   CDS_pept        complement(32610..34043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0027"
FT                   /product="sigma-54 factor, interaction region"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57392"
FT                   /db_xref="GOA:Q1R1L6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L6"
FT                   /protein_id="ABE57392.1"
FT                   /translation="MNHGTLMPEQLLAILNALEDGIFITDLGGHPLWVNQASLSQLETT
FT                   EAHLYASDVYQLEEEGVFSPSVTRFVIDERRPVSVVHRYRGKDYLVNGSLFHLDSNDSG
FT                   EPDAVLVQTRNLDRDVLASRSPDTTQALLDHVMHQLKRIRQDQVATEANPAAPSRSPRY
FT                   RQCLERLDRAAASDTTVLVSGETGVGKSWLVNRLHQFSPRSERPLIHVNCAAIPEALLE
FT                   AELFGHERGAFTGAHRDGRVGYVALAEGGTLFLDEIGELPLALQPKLLQLLQEREYHPL
FT                   GGSTRKADVRIVAATNTDLPARVRDGSFRADLFYRLNIVPIEVPPLRERAEDIPHLANQ
FT                   LLAHISRRHKRRLTLERDALRALTRHHWPGNVRELENLLERLSVFCEDETIRVADLAPD
FT                   LDIEPAGSALPEGDTQPLPQRLAQLEHQAIREALALTGSTRKAARTLGVTQSWLMRRIK
FT                   RHAIDTDTPTSEHTSVDAS"
FT   gene            complement(34135..35727)
FT                   /locus_tag="Csal_0028"
FT   CDS_pept        complement(34135..35727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0028"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57393"
FT                   /db_xref="GOA:Q1R1L5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L5"
FT                   /protein_id="ABE57393.1"
FT                   /translation="MTLAIFATVLAAYVAVAAFLARRIKNKDDFYVMGEQGSTLLIVGT
FT                   LAATFLSAVTLMGIAGISYSEGPLVIAALGSFGAWVGTLVAVVFIGRKLKALNCRTMMD
FT                   FFDYRFNNKWVSVVALILMVVGLLGYGIIQLIGAGLVLAEIIDIPFPVIIVAFTLALLA
FT                   FCSLSGMYGVVYTDTMMFFTMLAIAFIIAPLLIGDAGFEAMKGLGETLPGFWTVGGASD
FT                   RPLSWSISQFLVWILFFACTPALVSRVFPAKNDFVILKVAVIGVFFAPAMQLLVFLAAS
FT                   AMQVTQPGIEPTDRAMIVGFMEHTNPTLAGIGLAGLMASIMSTASTLFVLTGFALARDL
FT                   YEKLFDRKVSEHKGVVLGRISQAIVALIVCAVAISRPAGIYWISIYAGAIFAVAWLPTI
FT                   VAALHWRRMNANAALACMLVGSITFIAVGELERHGVMSLPWNIDNLQVAIVLGTLSLVV
FT                   VGLKSRPNDYELRVFDDIRAKRLSDTTIRDILARPDGARELIREYRQVWAIMALFVIIA
FT                   AALWGYLFSKLGM"
FT   sig_peptide     complement(35665..35727)
FT                   /locus_tag="Csal_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.268 at
FT                   residue 21"
FT   gene            complement(35767..35946)
FT                   /locus_tag="Csal_0029"
FT   CDS_pept        complement(35767..35946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57394"
FT                   /db_xref="GOA:Q1R1L4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L4"
FT                   /protein_id="ABE57394.1"
FT                   /translation="MDFNPQVLLLFTNAFLTTALSVVIVGVILVREYRPTIRRLEQAPK
FT                   EEDTCASSEPDPRS"
FT   gene            complement(35997..37337)
FT                   /locus_tag="Csal_0030"
FT   CDS_pept        complement(35997..37337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0030"
FT                   /product="4-acetamidobutyryl-CoA deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57395"
FT                   /db_xref="GOA:Q1R1L3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L3"
FT                   /protein_id="ABE57395.1"
FT                   /translation="MSRKRLDRVHFDSPAYRRFDTAPTRTKHMKDRIRDAIDQQREAYT
FT                   ALLQEWVQDPTLSGQESRYQHRIADLYRELGLDTDLWEIDIASLKHNPLFHCQRESLAG
FT                   SPNVVGTWKGTGGGRSLILNGHVDVVPEGDHAQWHQPPYSGEIIDGCLYGRGVTDMKGG
FT                   NLSAYVAVATLKTLGVRLKGDVILQSVIEEEAGGAGTLAALERGYTADAALLPEPSEQK
FT                   IFPRQQGSRWFRLKVMGVKAHGGTRYEGVSALEKSVAVIAAIQALEAQRNADLNDPLYE
FT                   GVPIPLPINLGRIEGGDWPSSVPDEITLEGRIGVGPGETVETAEQALVSAMAALAEQDD
FT                   WFADHPVEVEFYGACWQPGGIDLDSPLVTQLCNAFERVHGRMPERQASPWGTDGGLLSQ
FT                   YGVPALVFGPGITRLAHFPNEHIRLDDIFDVAEIMALTLIDWCELAD"
FT   gene            complement(37334..38584)
FT                   /locus_tag="Csal_0031"
FT   CDS_pept        complement(37334..38584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0031"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57396"
FT                   /db_xref="GOA:Q1R1L2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L2"
FT                   /protein_id="ABE57396.1"
FT                   /translation="MPGATPRVSIDSDRLWNSLMRMAEIGPSPNGGSRRLAMTQEDAAG
FT                   RRLLLDWVEALGCTWQRDKAGNLFIHRPGRENRLPAVSLGSHLDTQPLGGRFDGVLGVL
FT                   AGLEVFRTLADNDITTRRPLSLIVWTNEEGSRFAPAMGGSGVWTGRLDEDTFFTATDSQ
FT                   GVSLREAIQACDEAGDLPLGEQDLDAYFELHIEQGPVLEEQGDPLGIVTGVQGIRWYDL
FT                   SLRGQSAHAGPTPMSYRHDPLMAATALIQALKEEVLADPEGAARLTVGDFQVVEPSRNV
FT                   IPGEIHLQLDLRHTDDERLAALDATVERLARTAAEAEGVTLSLERRWHSPVTPFDDTLI
FT                   ASLVEAAEALGLEAPTMMSGAGHDAVHLSHVTPTVMIFVPSRDGISHNEAEYTEPEHCA
FT                   LGTQLLCDAVLARAERE"
FT   gene            38847..39323
FT                   /locus_tag="Csal_0032"
FT   CDS_pept        38847..39323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0032"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57397"
FT                   /db_xref="GOA:Q1R1L1"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L1"
FT                   /protein_id="ABE57397.1"
FT                   /translation="MRLDGSCHCGAVRFGVDSPHPYPYQRCYCSICRKTAGGGGYAINL
FT                   SGRAETLDVQGREHINVYHAVIDGNTSTGERHFCRHCASALWVFDPQWPSLVHPFASAI
FT                   DTPLPIPPERVHLMLDSKASWVEVDARENDQCFAVYPQESIAEWHQRLGLEDDA"
FT   gene            39668..41449
FT                   /locus_tag="Csal_0033"
FT   CDS_pept        39668..41449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0033"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57398"
FT                   /db_xref="GOA:Q1R1L0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1L0"
FT                   /protein_id="ABE57398.1"
FT                   /translation="MHMPPSNRRERNNIVKNLFSWLRGTTIRARMTAGFASVLLLMIIL
FT                   TAEGVREVNLIDHSMKVINDVNSVKQQYAVDFRGSVHDRAIAVRDAVLVDDEADLAPIL
FT                   ADIRRLEGDYREAATGMREIFSESNVTAEERNALAAIQEIQATTMPLIEEVLERRQAGD
FT                   IAGAEQLLLDEAAPAFSTWLDDINTFITLQEELNAAETGFARNIAENFQITMILLCLGA
FT                   LVIGGLVATLLTRLLLREFGAEPYEVKAFAEAVGNGDLTRQVSLKPQYRNSIMAAQVAM
FT                   AERLKKTVWEVRGSAESVATNSEQIAEGNNDLASRTEQQASSLAETASAMEELGSTVQH
FT                   NADNAAEARKQAANASSIAEEGGEVVTQVVQTMRDIDASSNEVADIITMIDGIAFQTNI
FT                   LALNASVEAARAGEHGRGFAVVAQEVRELASRSAASAKEINTLITANRKRVEQGTELAT
FT                   RAGKTTEDVVASVKRVTELMEEISNATAEQSDGVQQAGEAVAQMDQVTQQNAALVEQSA
FT                   SASNNLKARAHKLMELMSAFELGTASAQDARHSAQQSWAATGGAQQQASTSAPAPRLAS
FT                   TRHTARHTTEEEEWETF"
FT   sig_peptide     39668..39811
FT                   /locus_tag="Csal_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.854) with cleavage site probability 0.644 at
FT                   residue 48"
FT   gene            41655..43862
FT                   /locus_tag="Csal_0034"
FT   CDS_pept        41655..43862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0034"
FT                   /product="protein of unknown function DUF181"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57399"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019938"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="InterPro:IPR041080"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K9"
FT                   /protein_id="ABE57399.1"
FT                   /translation="MEIKVNFLENLRLAAKFDDFTVETDQPIRYKGDGSAPSPFDYFLA
FT                   SSALCAAYFVRLYCNARDIPTENIRLSQNNIVDPENRYNQIFKIQVELPEDLSEKDRTG
FT                   ILRAAERCSVKRVIQNAPEFQIETVENIDEDAQALLMGTNAKDGDAGGETWIEGKDLPL
FT                   ERTIANMTRILEDLGMKIEIASWRNIVPNVWSLHLRDAASPMCFTNGKGATKEAALCSA
FT                   LGEFIERLSCNFFYNDQFFGEAIADSAFVHYPSERWFPLEDDDALPAGLLDAHCRAIFD
FT                   PDGELRGSHLIDTNSGRKDRGIVALPFKRRSDGETVYFPSNLIENLYLSNGMSAGNTLA
FT                   EAEVQCLSEIFERAVKKEIIEQEIVLPDVPEEVLAKYPGIQEGIAALEAQGFPVLVKDA
FT                   SLGGRYPVMCVTLMNPRTGGVFASFGAHPSFQVALERSLTELLQGRSFEGLNDLPQPTF
FT                   SSLAVSEPNNFVEHFIDSSGVISWRFFSDRTDLDFHEWDFAGTTAEEAERLYGLLADQG
FT                   LEAYVMEHEDLGAPVCRILVPGYSEVYPVEDLVWDNTNMALDFRADILHLHTLEDERLA
FT                   DLLERLEESQLDDHIKVGTLIGIEFDDNTVWSELTILELKLLIELALGEYEAALEHVQM
FT                   FLQFNDNTVQRGLFHQAMQAVLEIALDDDLDFNDYHRNLTRMFGEETMRQVIGAVNDEI
FT                   RFPGLTPTSMGLEGIDRHQRLIESYRKLHAARAAGAGIATS"
FT   gene            44214..44690
FT                   /locus_tag="Csal_0035"
FT   CDS_pept        44214..44690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0035"
FT                   /product="protein of unknown function DUF523"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57400"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K8"
FT                   /protein_id="ABE57400.1"
FT                   /translation="MSACLLGKRVRYDGGSLSVNDQVVARWMSEGRVVSVCPEVEAGMS
FT                   IPRKPAEILASSGEDVLEGGVDVIEKGGNIVTDNFIEGASIALGLCRKFNIKVAVLAEF
FT                   SPSCGSSAVYDGSFSGVKNPGMGVTAALLRKNGVQVFSQYEIVEAEKAVHSTNG"
FT   gene            45076..45540
FT                   /locus_tag="Csal_0036"
FT   CDS_pept        45076..45540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0036"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57401"
FT                   /db_xref="GOA:Q1R1K7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K7"
FT                   /protein_id="ABE57401.1"
FT                   /translation="MAICLQPAQRQHLDELLFFVRAYHKYEGIQLSDEVRRDAVISLLG
FT                   NSAFGRIFLIRLDAELIGYVAISFGFSIEFGGRDAFIDEIFISSEYRGSGYGREALALM
FT                   KAEVARHDIKALHLEVARTNKRAQQLYRSLGFSEREKYFLMSTEIFGVKG"
FT   gene            45665..46141
FT                   /locus_tag="Csal_0037"
FT   CDS_pept        45665..46141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0037"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57402"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K6"
FT                   /protein_id="ABE57402.1"
FT                   /translation="MPQRGEHNYSATVVWTGNSGEGTKHYRAFSRDHEITCGDKPTIAG
FT                   SADPAFLGDLSRYNPEELLLSSLSACHMLWYLHLCADAGITVSSYEDNAEGRMIETKSG
FT                   RGHFDKVTLKPIVSIGENDDSDLATSLHEKAHSLCFIANSVNFEVACEPEIRRG"
FT   gene            46306..46941
FT                   /locus_tag="Csal_0038"
FT   CDS_pept        46306..46941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0038"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57403"
FT                   /db_xref="GOA:Q1R1K5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K5"
FT                   /protein_id="ABE57403.1"
FT                   /translation="MFDYSLVHWLAFLSAAVLLNLSPGPDIAFMLGQTLRSGRRHGFAA
FT                   MLGGWSGTALHVAMAAAGLSAILATSAVAFSVIKWVGAAYLIWLGVKMLLSKGDSFISN
FT                   GGGRDAKAQSVYWQGVLVSALNPKVAVFFLAFLPQFVVAGAGPVGAQLFLHGSLIIVVA
FT                   AFIEPLLVMMGAKLGAFLKASPRVGMWMDRGLGAMFVALGARLAASTR"
FT   gene            complement(46996..47868)
FT                   /locus_tag="Csal_0039"
FT   CDS_pept        complement(46996..47868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0039"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57404"
FT                   /db_xref="GOA:Q1R1K4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K4"
FT                   /protein_id="ABE57404.1"
FT                   /translation="MAGATALVVLASFCWGLSGGIGGMLMADDWDAFVVSFYRGAIGLV
FT                   FVLGWLAIRPRHSGLSNPRLWGWSAVAGLGVAGNFAFYFLSISQGSVAVAATLMYSAPI
FT                   FVYLLSFVLKLEKPTPLKWTAIAVVMLGIVLLTRIYDVGAGGITLLGVGAGLLAGVSYA
FT                   VFIFGFKYAAPHGSPQAILVIAFAVLAVLLAGLGDTSQTLDVLHTPDWPLFITLGILGA
FT                   GLSFIFYVNGLHHTAPAVASIVAMVEPVTASLFGVVVLGESLVSIQIVGMVLILATVTA
FT                   LSVYSSPKE"
FT   sig_peptide     complement(47785..47868)
FT                   /locus_tag="Csal_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.979 at
FT                   residue 28"
FT   gene            complement(48242..49426)
FT                   /locus_tag="Csal_0040"
FT   CDS_pept        complement(48242..49426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0040"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57405"
FT                   /db_xref="GOA:Q1R1K3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K3"
FT                   /protein_id="ABE57405.1"
FT                   /translation="MTRTEFRLIVAGTMLIGTTYGLARFAYGLFLPSMRDEVGLSATLA
FT                   GIIGSGAYVGYCLAIVLSALLVERYGPRRIAVAAALIAAVGMAGVAVSTQAIWLAGAVL
FT                   LAGTSTGLASPPMAQAVSRAITAPRQGRANTVINAGTSLGVAVSGPVAFIATGQWRLAY
FT                   AAFAVTALLNALLLLISVPRTSANDTAKAADGQDDDLPGGLWRPRAVTLIAAATGMGVA
FT                   SAAFWTFSSEVVITLGHFEQATANIAWILIGVAGLVGGAAGDLIARLGLNTVHRGSLAA
FT                   MAGALGLLVLSPSNLAAVLVSGALFGAAYIMLTGVYLVWGIRLYADRPAIGLGLPFLMI
FT                   AAGQIVGSPLAGYLIGSRGYLVCFIAFALIAVATALIGARTTERAALQPASTSP"
FT   sig_peptide     complement(49346..49426)
FT                   /locus_tag="Csal_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.692) with cleavage site probability 0.521 at
FT                   residue 27"
FT   gene            complement(49618..50145)
FT                   /locus_tag="Csal_0041"
FT   CDS_pept        complement(49618..50145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0041"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57406"
FT                   /db_xref="GOA:Q1R1K2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K2"
FT                   /protein_id="ABE57406.1"
FT                   /translation="MDIRTRLLETAEQLFERHGFAATGMDRLTSAAGISSRTLYKHVGN
FT                   KNGLIAAVLNERDRRFHRLVEANSIDALFAALEAWFGQAGARGCLFLRAWGETGGGVPE
FT                   IAEAMERHKQRLRERINAIVLAEIGRHDDDLVEAIQLLFEGATHAATYRGEAAADAARR
FT                   AAHRLAGLARIA"
FT   gene            complement(50225..50875)
FT                   /locus_tag="Csal_0042"
FT   CDS_pept        complement(50225..50875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0042"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57407"
FT                   /db_xref="GOA:Q1R1K1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K1"
FT                   /protein_id="ABE57407.1"
FT                   /translation="MLQQFLLVAGAHFLALLSPGPDFFLILRYAIALGRGPAALVSLGI
FT                   GLANGLFILLAMGGLMALDAEAVLFIAVQWAGGVFLLYMGIQFIRQAGQTRLEAGSHRE
FT                   AEAPASTAPGALLAGLASGLLNPKNALFYASLFAVLHARSTPAGVQSLYALWMIAVVLG
FT                   WDLLVGHLAGHPVLIRRFGHGLRHIERLAGALLILLGLGIIAARLDPGLLAAF"
FT   gene            complement(50956..51756)
FT                   /locus_tag="Csal_0043"
FT   CDS_pept        complement(50956..51756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0043"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57408"
FT                   /db_xref="GOA:Q1R1K0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1K0"
FT                   /protein_id="ABE57408.1"
FT                   /translation="MTQFWRDPTLPFVESRRATDSRACYRPHSHPTLSIGVVDRGQSQF
FT                   QCQRRREWLTPGCLVSVPAGVVHDCNPLPDQPWSYQMLYLEPAWVSEVLDEASAETDAA
FT                   PTLPSTVFIARDVAPYQAFCRLNALLFSSAPRADKEAGLIEFLGSRLWCHGDAMAVHWP
FT                   NSSDLDDLQRHLLECLERPPSLEVLARDHGLSRYQVIRLFRRETGLTPHAWLLDRRIQQ
FT                   ARRRLCQGVELAELAQELGFADQGHFQRAFKARVAATPGRYRST"
FT   gene            complement(52018..53340)
FT                   /locus_tag="Csal_0044"
FT   CDS_pept        complement(52018..53340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0044"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57409"
FT                   /db_xref="GOA:Q1R1J9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J9"
FT                   /protein_id="ABE57409.1"
FT                   /translation="MTASQSRSPRLVVRHCLHLGMALAIGALTLPLPAHAQQPAGDDAL
FT                   PVEDVQTFAEVFERIKRAYVDEVDDTTLMRNAMRGMLGELDPHSAYLDAESFEALRETT
FT                   EGEFSGVGIEVGMQEGQLTIIAPIDDSPAARAGLQAQDVILRIDDTPTESLSLQEAVEM
FT                   MRGDEGEEIRLTILREGEEAPREVTLTRETIRTDSVKHEMLSPGYGYLRISQFQSRTGE
FT                   QARDAIAALREEGDGNLKGLVLDLRNNPGGVLDSAVDVADLFLDSGLIVYTEGRLADSD
FT                   MRFSASPQTSAPDVPMVVLINGGSASAAEIVAGALQDQQRAVLMGTESFGKGSVQQVLP
FT                   LNNGDGLKLTTALYYTPDGRSIQAQGIAPDVEVVRGRLEVAEATGLSIRESDLENHLRN
FT                   INGERERTERESSLAESDYQLGEALNLLKALNVLPRAQSGN"
FT   sig_peptide     complement(53230..53340)
FT                   /locus_tag="Csal_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 37"
FT   gene            complement(53492..54655)
FT                   /locus_tag="Csal_0045"
FT   CDS_pept        complement(53492..54655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0045"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57410"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J8"
FT                   /protein_id="ABE57410.1"
FT                   /translation="MRTPVSSKRIAMACAMAISCAWLFPPVAWAQDSPEEVHRQLEALG
FT                   ENIEQTQARLEGTRDARDEAQRELREVETRLAETHQRLTGLQREQDQLDQEVAELKKRR
FT                   QTLEIERRRQREALAKQLNALYRLGPTPQLKLLLNQSDPARLDRLQQYLNHLNQARQQR
FT                   LDALAKLEDQLDETQRALQSHQARLDDLGDELTARRETLSEQRGKRETILAQFKERYTT
FT                   QRAKLAALTDDRENAEQLLDRMRERLERLDQAPPSTQIEQTQGDLPWPVQGDMLTGYGN
FT                   GDGVDRNGILIGAASGTPVSAVHAGRVVFADWMRGFGNLVIIDHGDNIMTLYAHLQRFA
FT                   VGVGEQVERGATIAAVGDSGGRDTPALYFEVRENGDPIDPGDWIARR"
FT   sig_peptide     complement(54563..54655)
FT                   /locus_tag="Csal_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(54685..56262)
FT                   /locus_tag="Csal_0046"
FT   CDS_pept        complement(54685..56262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0046"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57411"
FT                   /db_xref="GOA:Q1R1J7"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1J7"
FT                   /protein_id="ABE57411.1"
FT                   /translation="MADTHTQRPRPVALLILDGYGQNDDTEYNAVYSARTPVMDALKQR
FT                   YPSTLLHTDGKYVGLPDGQMGNSEVGHMNLGAGRIVYQDFTRITKAIEDNELASNPVLT
FT                   APIDAAVAAGRAVHLLGLLSPGGVHSHEDHILAVAALAAERGAKHVYLHAFLDGRDTAP
FT                   KSARASLERANARLAELFGADNAYVASIVGRYYAMDRDNRWDRVEQAYRVIVEGEGSQV
FT                   ATSAEAGLDAAYERGETDEFVAATSIRPHGEPVRMADGDAALFLNFRADRARELTRAFV
FT                   EDDFSGFTRQARPKLAHEGLVMLTEYAADIPAPVAFPPTDLVNTLGETVAKRGLKQLRI
FT                   AETEKYAHVTFFFSGGREDEFEGEHRELIPSPQDVKTYDEKPEMSAYELTDKLVAAIDA
FT                   GTYDLIVCNYANGDMVGHSGNFDAAVKAIEAVDDCLGRVIEAIERAGGECLVTADHGNA
FT                   EQMVHPETGNPQTAHTTFQVPLIYVTPRQGATLADDGSLCDLAPTLLTMMHEPVPEEMT
FT                   GRVLIGNT"
FT   gene            56557..56976
FT                   /locus_tag="Csal_0047"
FT   CDS_pept        56557..56976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0047"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57412"
FT                   /db_xref="GOA:Q1R1J6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J6"
FT                   /protein_id="ABE57412.1"
FT                   /translation="MIDQLFEFVQNHLLLSGAFLVVLVAWIAYELRNSSNGVSPSEATA
FT                   LVNREDGLFLDIREVKDFKAGHIAGARNIPQGRLNDRLKELEAFKEKPVVVVCKHGQSS
FT                   GAAVGQLTQAGFTRATKLKGGMTQWQSDELPVVRK"
FT   gene            57048..57542
FT                   /locus_tag="Csal_0048"
FT   CDS_pept        57048..57542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0048"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57413"
FT                   /db_xref="GOA:Q1R1J5"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1J5"
FT                   /protein_id="ABE57413.1"
FT                   /translation="MAEDNNQAAQGGNDAQNQLQFSMQRIYVKDISFESPNAPSVFQNA
FT                   FKPKVGLDLNTTHKQVGENLYEVVVKVTAQVTNNEDGATAFLAEVEQAGLFRIAGLSDD
FT                   QLDHTLGAFCPNMLFPYARECIDNLVNRGSFPPLMLSPVNFEGMYAQKKKRESEAAENA
FT                   H"
FT   gene            57546..58274
FT                   /locus_tag="Csal_0049"
FT   CDS_pept        57546..58274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0049"
FT                   /product="16S rRNA m(3)U-1498 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57414"
FT                   /db_xref="GOA:Q1R1J4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J4"
FT                   /protein_id="ABE57414.1"
FT                   /translation="MAGPRIHVAATLVAAAELTLPEGASRHVAGALRLREGAALRLFDG
FT                   EGHEADAEIVAVGRREVRVRITAVTEGGAESPLAVHLGQAISKGDRMDYAIQKATELGV
FT                   AAITPLYTEHGDVRLKGEREAKKLAHWQAVAVSACEQCGRSRVPTVHPPQTLDAWLARR
FT                   DETLRLVLHPSTDTTWRHASDVARVALLVGPEGGLSPNEIDTARAADFAALTLGPRILR
FT                   TETAPVVALTLLQYHFGDLG"
FT   gene            complement(58287..59192)
FT                   /locus_tag="Csal_0050"
FT   CDS_pept        complement(58287..59192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0050"
FT                   /product="Pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57415"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J3"
FT                   /protein_id="ABE57415.1"
FT                   /translation="MDGHRLIQPLHARTADVGGIPVNRVMPQRGRRLIGAWCFLDHAGP
FT                   ATFTVGAGGMRVGSHPHIGLQTFTWMLAGEIMHHDSLGNAQRIRPGELNLMTAGRGIAH
FT                   TEESILESGQLHAAQLWITLPHATRHTSPRFDHYPDLPRWSEQGTDVTLLRGDFQGREA
FT                   PTHAFSPLVGLDIVSPDATQLTLPARTDFEYGVLLLEGSLTIERDRFDTNEMAYLGSGL
FT                   DEITLAMEAGTRALMLGGEPLNEDILIWWNFVGHSKAEIAEAQKEWEEWEAGSDRFGDV
FT                   PEFDGERIMPPPIPWKVTAN"
FT   gene            complement(59322..59945)
FT                   /pseudo
FT                   /locus_tag="Csal_0051"
FT   gene            complement(60768..61955)
FT                   /locus_tag="Csal_0052"
FT   CDS_pept        complement(60768..61955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0052"
FT                   /product="Type I secretion membrane fusion protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57416"
FT                   /db_xref="GOA:Q1R1J2"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J2"
FT                   /protein_id="ABE57416.1"
FT                   /translation="MATTLSDQQLQRQLGDPRANLRHPLARPVVWAVLVCLLSFIGWSA
FT                   WAHIAVVTHGEGRVIPVSRIQSIQSLEGGIIDELEVREGDIVDKGQLLVKLSGTRFRSA
FT                   YQETENQVQALKAAIARLQAEVLEADSIDFPADVDAQSSLARSERELFHARREKLREAT
FT                   GSLDHEIQMASRRLNLIQPLVERKAVSQMESLQLQQDIASLRGKRAEIQNSYVQDAYTE
FT                   LTDKKGELSSLEQVLVQRQDQYQRTELNSPVHGRVNAINYTTRGGVVPPGETIMEVIPL
FT                   EDQLLLEAKIKPQDVAFLAPGMPASVKITAYDYTIYGDLEGTVEQISADTIEEETPRGT
FT                   ESYYKVYIRTESGSLTHNGKDLPIIPGMIAQVDIQTGERSVLDYLLKPLLKANLY"
FT   gene            complement(61956..64115)
FT                   /locus_tag="Csal_0053"
FT   CDS_pept        complement(61956..64115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0053"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57417"
FT                   /db_xref="GOA:Q1R1J1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J1"
FT                   /protein_id="ABE57417.1"
FT                   /translation="MSLSASERFTDPVDESNDPLREGMVLLCRRLDRPTSLSELGDGLP
FT                   LEQGRLPLREVSRALRRAGVSARVSRRSLKDISPRLLPALLILDNGDTALLESLDAGEA
FT                   RIALPEADGGEETLTPEALDALYSGTAIFARPAARSDDRAGNFAQAAPKHWLKEPLRAC
FT                   WPAYAEVGVAALAANVLAISTALFAMQVYDRVVPNAAFDTLWVLASGVALAVLLEFLLK
FT                   GLRAHLLEVIGKRLDLELSSKLFEQAVRLRLNAKPASTGAFTSQVREFESVREFFTSAT
FT                   AGAISDLPFVALFVLIIAWIGGPVAWVPVAAIAGMILPGLLLQRHLARLARENLREGAV
FT                   KNGVLLESLDQLETVKATRAEGRNLALWESLSAQLSNASIRLRAVTSMLTHSASLLQQL
FT                   GYVGIVIVGVYRISAGDMTIGALIACSILGSRAIAPMGQTSALLARWQHVKAAVEGLDE
FT                   LMQAPNESGAGQKVRKPRLHGDYRLEEVVVRHYEEGPAALKIDELTIEAGSRIALLGGN
FT                   GAGKSTLLRLLSGFVEPTAGRVMLDDINITQIESADRRRAIGYLPQDIALFYGTLRDNL
FT                   TLDGAAYEDEEIFQALDSVGLGRFVRSHPQGLELPIASSGSVSGGQRQAIGLARLVLQD
FT                   PRIVLLDEPTAAFDQNNEKRAVAFLKRWMEGRTLIVSTHKKPLLELTGRAIVLRDGKLA
FT                   MQGDLDQVVQGNRGASGSPTPREGR"
FT   gene            complement(64112..65674)
FT                   /locus_tag="Csal_0054"
FT   CDS_pept        complement(64112..65674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0054"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57418"
FT                   /db_xref="GOA:Q1R1J0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1J0"
FT                   /protein_id="ABE57418.1"
FT                   /translation="MAGRRRALRAAASATPNRQGWRRDIASQRISQAEGKTIIEDLSQH
FT                   AERWTLRKLAIVVCLAPTLAKGQEADWWNAVDHEANGRGASKAAPRISTTLPAEPWSPS
FT                   TTSTNRPAGSGSRTRSASLSGPLSLEGAVRRGLAINPAVRAAIADADAAGTEVDIAEWG
FT                   YFPTVDLSAGPEEFPFSEFGYDASARQMLYDWGRVDSQVASASASAREARRALGVAEEE
FT                   AALDIAEAYLDILAARRRLELTQDYVDELEALRSLTQDRGSNGYTDSSEQGRVALDLAQ
FT                   ARGELATERGSLNDARQQFRVLVGVSPDALDAPDPATLTDRLDDARLEQWIVAAPAYRQ
FT                   AVATAEQAQAELDETQASLKPQLNIEGSLERRQIGGELQNDSVIGLRLRMDTLQGLANF
FT                   QRPDAARQRLEAARYRVDDQRRKIRRSVLTLIENAEVYRQRQQALSDQVEEAQSVGDLY
FT                   DDQFSVGLRDVNDLLTIRQEAFSARRQLIDLESQQKRIQYRAASQLGLINPLITGRLGG
FT                   DAP"
FT   gene            complement(65678..75622)
FT                   /locus_tag="Csal_0055"
FT   CDS_pept        complement(65678..75622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0055"
FT                   /product="putative hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57419"
FT                   /db_xref="GOA:Q1R1I9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I9"
FT                   /protein_id="ABE57419.1"
FT                   /translation="MAISAKVAALQEDLAKSPAVAVDNGTLSVSESRHILLSLSPQDVA
FT                   SLSRDGNDLLVRTTDGQVIRIEGFYGTDEATTSQLYLTGDDQELIWADFGPSTSDGIVV
FT                   ADYLPQGEFGIFESAAVASEGTSGASVTPLGWAAIGGGALAAGALAGGSGGGRDDDDDD
FT                   GAAPPDDGGGETDNTPPDAPTIDPSNGKTISGEAEPGSTLTLYANGEAIGTTTANGQGE
FT                   WTFTTDDLDDGDYTFTATATDSAGNVSGVSDGYALTVDTSAPGSPTLDPSDGSILIGTA
FT                   EPGSAITLTDGDGNAIGQTTTDANGNWSFQPDAPLVDGTEVNATATDAAGNVSEPGTLT
FT                   VDGDLNDTTPPATPTITMGSDDTAPQTGDLDSGDSTNDTTPTLSGQAEARSIVTIYSGE
FT                   TELGTTIANAAGEWSFTPEALDDGDYDFTVTATGSTGNVSDASDPFTLTVDTQPPLAPE
FT                   VNPTNGEILTGSAEPSSSVTLTDEQGGTITTVETDRNGNWSYAPDTPLEDESTFTAVAR
FT                   DAAGNTSEPGNATVDADLEDNLPPSDPVIITSIDATEPVTGNIDNGGTTNDSNPTLQGT
FT                   AEATNMVQVWADKAMLGETQADNFGNWSFRISARLLDGTTTFRATSTDPEGQISAPSNT
FT                   YALNVDTTPPDEPTATVAEDGTAVTGTAEPGSTVTVTDADGNDIGSVTADPGDGSYSVL
FT                   LDPALTNGESVTATATDAADNESDPASATAPDLTAPDAPTAILANDTGLNDGDGITSDA
FT                   IVNVGGIEDGATWEYSIDGGDSWITGTGNSFELPEGDYDNGVVQVRQTDAAGNTSDLVT
FT                   LGPVAVDQTAPVVNVDDLDAPINDPSPALSGAVSDPDATVTVTVNGDDYTAANNGDGTW
FT                   TLAEGTVTLNEGDNSISAVATDAAGNTSEPVNETIELDTTAPGGVDDDGNSVVFGDDVY
FT                   NADEATSATLTGTVEDGATLVSLTIISDGGGDPLTIAGESITLNADGTFSYTADLTGLP
FT                   DGNLTATLSIADDAGNTGTLTDTAILDTIVDAAPLATLTSNDGDGLVSADEAGTASYTV
FT                   SGLDDDATAVATFTDINGDTATANVAADGTISVDLSGLADGEITSSLAITDTAGNTATV
FT                   DGESVTLDTIADTAPLATLTSNDDDGLISADEAGMTSYTVSGLDPDATAVATFTDVNGD
FT                   SVTATIDTDGDYAVDLSGLADGEITSSLAITDGAGNTATVTGDSVTLDTTADAAPLATL
FT                   TSNDGDGLVNVDEAGTASYTVSGLDDDATAVATFIDVNGDTATANVAADGTISVDLSGL
FT                   ADGEITSSLVITDGAGNTATVTGNSVTLDTTADAAPLATLTSNDGDGLVNADEAGTTSY
FT                   TVSGLDDDATAVATFTDINGDTATANVAADGTISVDLSGLADGEITSSLTITDTAGNTA
FT                   TVTGDSVTLDTLAPATPVINFSNATTISGTGDPGSNVTVTDSQGNIIGEPATVDENGNW
FT                   SVTADDALDDGSEINAVATDAAGNESDPALAFVDTDGNGNNAIAFAEGGDGFIDADEST
FT                   ATTLVGQIEDGTTIDSVTITSSGGGEDVVLDGATITVTNGTFTIDGVDLSGLEDGTLTA
FT                   TLATTDNNGNAGTATDTTILDTIADAAPLATLTSNDGDGLVNADEAGTTSYTVSGLDPD
FT                   ATAVASFTDGITTVTADVAADGTISVDLSSLADGEITSSLAITDGAGNTATIDGESVTL
FT                   DTTADAAPLATLTSNDDDGLISADEAGTTSYTVSGLDDGATAVATFTDVNGDTATATID
FT                   ANGDYTVDLSGLADGEITSSLTITDEAGNTATIDGESVTLDTTADAAPTAALTSNDDDG
FT                   LVNADEAGTTSYTVSGLDDDATAVATFTDINGDTVTATIDADGTFTVDLSGLADGEVTS
FT                   SLAITDGAGNTATVTGDSVTLDTTADAAPLASLASNDDDGLVNADEAGTTSYTVSGLDP
FT                   DATAVATFTDVNGDTATANVAADGTFTVDLSGLADGEITSSLAITDGAGNTATIDGESV
FT                   TLDTTADAAPTAALTSNDDDGLVNADEAGTTSYTVSGLDDDATAVATFTDGTTTVTADV
FT                   AADGTFTVDLSGLADGEITSSLAITDGAGNTASVTGDSVTLDVTAPSDGDGINSVTFVD
FT                   DDGIYNAADADGVTITGQVEDGASISTLTITSANGGEPVVVEGIDIDVIDGSFSYVADL
FT                   SGLADGELTATLTVTDAAGNDGTVSDTATLDTTADAAPLATLTSNDDDGLVSTDEAGTA
FT                   SYTVSGLDDDATAVATFTDVNGDTATADVAADGTFTVDLSGLADGEITSSLEITDTAGN
FT                   TATVDGDSVTLDQTAPAVDDAAANISEAGLDGAATVTVSGTMTIDDSGSGVESITVGGP
FT                   AGITARGETVDWSGSFSDGVYTLDGTANGTTVATLTVSTTGAYTYTQSQALDHPLAGAD
FT                   ILALGFDVTASDQLGNETSGKLTVNLADDVPVAAQPAFFEIDTDSTTASGSFVESYGVD
FT                   GGYVSELTIDGYTFSYDSETDSISATGNSELVVPFEDGDYDSASGELTVQTLKGETLTV
FT                   NLQDGSYDYDASGANLLDPEPEAAPVVALGDDNSLLGLIGAEALGLVDFSDEQAFAATD
FT                   ANNNILEVMISLSLDTMTVNVGGGFRYSSLLAQELGLDVSVDDFPTSGVGGSASITVST
FT                   TNENGISNQQLNELLGTIYINSGINLGVGQILSITAEDTEGNTTETSSSDVLSLGLLQS
FT                   NVPDYLIQGTSAAETLDGTADNDRLYGYGGNDTLNGGEGNDLLRGGAGNDTLNGGTGND
FT                   ILIGGTGDDTLAGGSGNDVFRWEQGHQGTIGTPANDTITDFNSARVSGGGDLLDLGNLL
FT                   QGEGKIGRSAGNLTNYLHFALVGTATLVYISSTGGFQGITEASAKEAAADQIITLQDVD
FT                   LVSDGGSDLQIIKTLLTNGNLIVEDASADTDLSGNVSTGVDAVISDNDGDTAGTSAEFD
FT                   STGQTPPTPDPDNVAPVVQANSSSLLGIAGVDLLGLIDFGDQDLFAADADGNLQSVTVA
FT                   YQPLLSLNLTALEFTASQKMADELGLNLAFDSDPGLLGLVAPSASVTITAADGGTIDNL
FT                   AINELLATVAFADTDGLLELDADLQLSLLNSTIITATDSDGRTATDSLGELANLDALST
FT                   LLGNNDNIVEGTSANETLDGGTGSQRLYGYEGNDTLNGGDGNDLLRGGAGDDTLNGGAG
FT                   NDLLIDGNGADTFNAGAGDDLIVTSGNGFTSIDGSDGFDTLLLDGGIDLDMVNGGLGLV
FT                   TNIERLDLGSGDDASRATLSAEDVDAMTDDDNVLQITGDQQDTLNLQGATSDGAVTLGG
FT                   TAYDQYTFGDATIQVEQGTVQVET"
FT   gene            75861..76766
FT                   /locus_tag="Csal_0056"
FT   CDS_pept        75861..76766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0056"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57420"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I8"
FT                   /protein_id="ABE57420.1"
FT                   /translation="MNAERQPSCCKVRLLLCDKSYPSHQSPIYTPTPPPWPLLALPGGV
FT                   IMRTYLSSVAAIMSRSPDPAPRSSAPGRRASSSTRPPLARIGEVAYLKVVAVNTTGAFL
FT                   DWGQPKDVLLPFAEQRFRPEVGKRVLVMLYEDAQGRPVASMRLDRFLADEATDLKAGDQ
FT                   VALVVAERTDLGFKAVVDHRYWGLLYADDIVHPPRRGQRLTGYIKRVREDGRLDLAMLP
FT                   PGEAGLDVVGDKVLALLRCHGGFVALGDKTPAAEIKARVGVSKSAFKQAVGRLYKKRLI
FT                   TIEAEGIRLTREAIDDASSD"
FT   gene            76845..77798
FT                   /locus_tag="Csal_0057"
FT   CDS_pept        76845..77798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0057"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57421"
FT                   /db_xref="GOA:Q1R1I7"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I7"
FT                   /protein_id="ABE57421.1"
FT                   /translation="MSERALKLGVVMDPIADIAYKKDTTLAMLWAAQERGWSLYYLEPE
FT                   DLYLEGGRAMGRMRALEAYRDPEAWYRLDVSRAAPLAELDVILMRQDPPVDGHFLNAVH
FT                   LLGFAEREGVLVVNPTQALLTSNEKLFAQQFPQCIPPSVVSCHDGVLRDFHARHGDVIL
FT                   KPLDGMGGSGIFHITPEGRNLGSVIEQLTERGTRQIMAQRYLPEIQAGDTRILLIDGEP
FT                   VPYGLARIPSAGETRGNLAAGGRGEARELTDRDHWLIEQVKPAILEKGLIFVGLDVIGD
FT                   YITEINVTSPTCVREIDAQRGTDIGGQLMEAIARRF"
FT   gene            77917..78474
FT                   /locus_tag="Csal_0058"
FT   CDS_pept        77917..78474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0058"
FT                   /product="protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57422"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1I6"
FT                   /protein_id="ABE57422.1"
FT                   /translation="MQSLKHHFLLAMPHLDDPNFKGTLTYLCDHDENGTMGVIVNRPME
FT                   LTLDALLEQLELDAAECPCREMPVHYGGPVHKDRGFILHRGSSLPWDSSLQVADDIALT
FT                   TSMDMLKAIANGQGPEDFIVCLGCAAWQAGQLEDELKQNTWLTVEGDASILFEVHAEQR
FT                   LSAAAGILGIDLNLMSREAGHS"
FT   gene            78474..78920
FT                   /locus_tag="Csal_0059"
FT   CDS_pept        78474..78920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0059"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57423"
FT                   /db_xref="GOA:Q1R1I5"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1I5"
FT                   /protein_id="ABE57423.1"
FT                   /translation="MAEAGQRLVLAFDFGTRRIGVAVGNEMLGSATALAPLPARDGIPD
FT                   WQQIAALLEEWQPDLLVVGLPLNMDGTESDMSRRARKFGNRLHGRFGKPVEVFDERGST
FT                   RAAKRIARDAGHRGNYRDDGVDGIAAQLILESFFADDTFLQRMP"
FT   gene            complement(78979..80301)
FT                   /locus_tag="Csal_0060"
FT   CDS_pept        complement(78979..80301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0060"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57424"
FT                   /db_xref="GOA:Q1R1I4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I4"
FT                   /protein_id="ABE57424.1"
FT                   /translation="MNQMKKTLSLGQVVLFGLAYMTPIIVLGTFGVLAVTTEGAVSGAY
FT                   LAALIAMLFTAHSYGRMASAYPVAGSAYAYVRHAIDDRLGFIAGWAILLDYLFLPMVIW
FT                   LIGAAYLHSAFPAVPTPLWLLAFIAVTTVINILGLRLASVVNSVMMLVQILVLVAFVGL
FT                   SMHYVLGDPTQPFWSLTPFLGADSAATLPVLMAGAAVACYSFLGFDAVTTLTEETKDPQ
FT                   RTLPRAILLITLIGGLIFVVVSYFVQLAAPGHDFANPDAAAYEIARNIGGDIFVSIFLI
FT                   GLVVGQFASGIAAQASGARLLYAMGRDDVLPKRWLGKLSRFGTPLGGLLLSGVVALLAL
FT                   TMDVLSAASFINFGAFLAFALVNLSVIFHYYLKERRRGGMETLWFLICPLIGLGAILWL
FT                   MLSLDHLAIMLGGAWLACGLAWLIWLTRGFSRPTPELHMDG"
FT   sig_peptide     complement(80197..80301)
FT                   /locus_tag="Csal_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.905 at
FT                   residue 35"
FT   gene            complement(80377..81186)
FT                   /locus_tag="Csal_0061"
FT   CDS_pept        complement(80377..81186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0061"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57425"
FT                   /db_xref="GOA:Q1R1I3"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I3"
FT                   /protein_id="ABE57425.1"
FT                   /translation="MQIALAQLAGREGDIAYNLSRTLACLRDADAETSLIVFPETHLTG
FT                   FAEPGHVEDRALALEGPELNALVTASREQDTALAVGFLERDAEGVFNTTVLITPEDGIA
FT                   LRYRKAHLWPDERQLVGEGHRVGCVEWRGLQVGLLICYDLEFPEPARALGQLGCDLLLV
FT                   TNGNMDPYGPVHARAAQARAQDNHYFVAMTNRAGEGAGLTFAGESALVAPDGETLFRAE
FT                   REESVTTLQLDLQRLPAARRDYDYQQDCRIGLQGRREDIGRGRYWHF"
FT   gene            81378..82205
FT                   /locus_tag="Csal_0062"
FT   CDS_pept        81378..82205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0062"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57426"
FT                   /db_xref="GOA:Q1R1I2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I2"
FT                   /protein_id="ABE57426.1"
FT                   /translation="MTSEPQPATSAPGQTSLESLAWHRAFGGLAASLDAPDFWLAAVRT
FT                   IGAHLAFDTWVALIFHHHRPPRILAESDEDDGADEALFQDYQRGLYLLDPFYIDAKGRA
FT                   REGLYTLADVAPQRFRHTEYYQRYFQRNIVADEVQFNCPLDAERTLCLSLGSTRAFDHA
FT                   ALGLLSLIQPWMLALMRQRMHFEFEGEDGTPPGPHPWHPRPGTPRELDSRYALTERERE
FT                   VSQLMLGGSSTKEIARRLAISVETVRAHKKHLYAKLGINSQSELFSLFWQARP"
FT   gene            complement(82250..83281)
FT                   /locus_tag="Csal_0063"
FT   CDS_pept        complement(82250..83281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0063"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57427"
FT                   /db_xref="GOA:Q1R1I1"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I1"
FT                   /protein_id="ABE57427.1"
FT                   /translation="MSPHLLSVDSLSRDYVEHLMQLAGRMEPFAQRRKVTRVLEGAVLG
FT                   NLFFEASTRTRISFHAAFSRLGGSVCDTTGFTFSSMAKGESLYDTSRVMGGYVDAIVLR
FT                   HPDQGAVAEFAEATRVPVINGGDGPGEHPSQALLDLYTIEKEFTRLGKRLEGAHLLLTG
FT                   DLKHGRTVHSLIKLLSLFDPLRITLVSPPGLEMPRHLIDLVASRGHRVEQRESLANDFG
FT                   DLDVIYTTRIQKERFTDEMSETFAGISQDFIVDRAFLDKRCSPTTIVMHPLPRDSRPGA
FT                   NDLNVDLNGDPRLAIFRQADNGIPMRMAIFANLLRVEDYIERDAQDVRWFVPPTFGVDD
FT                   RTL"
FT   gene            83464..84318
FT                   /locus_tag="Csal_0064"
FT   CDS_pept        83464..84318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0064"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57428"
FT                   /db_xref="GOA:Q1R1I0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1I0"
FT                   /protein_id="ABE57428.1"
FT                   /translation="MGEQHFPAQEQADQPGDEHAMRPEPEYIRDSYRGTGKLDGKVAII
FT                   TGGDSGIGRAVAVHFAREGANCVIVYLNEARDAEDTQALVEAEGRECVLVQGDVGDPVL
FT                   CRHVVDTTLASFGAVNILVNNAAEQYDWDDVTQIPDDQVQRTFQTNVFSHFYMAKYALP
FT                   HMHEGDTIIATSSVNAFKGNDTLIDYTATKGAIQGLVRSLAMSLVDRDIRVNAVAPGPV
FT                   WTPLIPASFDEDKVAGFGGQVPMDRAGQPSEMGPAYVYLASEESSYMNGQTLHLNGGVI
FT                   LNT"
FT   gene            complement(84609..85658)
FT                   /locus_tag="Csal_0065"
FT   CDS_pept        complement(84609..85658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0065"
FT                   /product="homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57429"
FT                   /db_xref="GOA:Q1R1H9"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H9"
FT                   /protein_id="ABE57429.1"
FT                   /translation="MTQDLITQRLDQGPLICAEGFLFELERRGYLSAGEFVPEVALLRP
FT                   DALEALHRDFQHAGSDVVQAFTYNGHREKMRVIGKEELLEPLNRAALKIARKVADEKPG
FT                   NLMAGNISNSNVWDPEDPAAQQSVRAMFDEMVQWAVEEGADFIIAETFYYAGEAEAALA
FT                   AIKAQGLPAVVTLAPMAENRMVDGLGIVETCVALEQQGASVVGLNCFRGPDTMRPWIQQ
FT                   IRDAVTCHVAALPVTYRTTEQEPTFFNLSDNQGCSCPAPHGRAFPTALDPLFCNRYELG
FT                   AFARDVHALGVNYLGVCCGASPMHVREVAMAVGREPEAAQFAERMENHFMYGSHERLPE
FT                   HIAALGEKA"
FT   gene            complement(85982..86836)
FT                   /locus_tag="Csal_0066"
FT   CDS_pept        complement(85982..86836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0066"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57430"
FT                   /db_xref="GOA:Q1R1H8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H8"
FT                   /protein_id="ABE57430.1"
FT                   /translation="MLREREPGVTESKRKTVGRPAGNGKAASGHSQSLVRGLNILEGLA
FT                   AAPGGLALSDIAQIVGLAPSTTHRLLQALHQQGFIAQDAEMGVWHIDAKTFRVGNAFLE
FT                   ARDFVATARPFLHQLTAETEETANLGIRDQGMAVFLAQSESPQMMRMITRLGSRAPLHA
FT                   SGVGKALLAWLPRDEVERILHTRGLDKVTPNTLDTPSRLRDALGEIRRQGYACDREEHA
FT                   IGLNCVAATLHDENGLPLAAISVSGPAARIPEARLAELGGLVSRAAREITARLGGRLPG
FT                   AQD"
FT   gene            complement(86922..87446)
FT                   /locus_tag="Csal_0067"
FT   CDS_pept        complement(86922..87446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57431"
FT                   /db_xref="GOA:Q1R1H7"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H7"
FT                   /protein_id="ABE57431.1"
FT                   /translation="MRHALLSPRPTQLDREAFVAAYGGIYEHSPWIAEAVWDAGLDTRH
FT                   DSPAGLAGAMAAVLDAAPAERQLTVIRAHPDLAGKVALAGGLTQASSQEQAGAGLDQCT
FT                   PDELARFERLNAAYQARFGFPFVMAVKGYHRHEILDAFELRLAHGPDEERRSAIAQIHR
FT                   IARLRLDAHAT"
FT   gene            87570..87926
FT                   /locus_tag="Csal_0068"
FT   CDS_pept        87570..87926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0068"
FT                   /product="Transthyretin"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57432"
FT                   /db_xref="GOA:Q1R1H6"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H6"
FT                   /protein_id="ABE57432.1"
FT                   /translation="MGYLTTHVLDTARGCPARGMRLSLYRLDGDTRQALGEFVTNEDGR
FT                   CDGPLLEGEAFRVGEYELLFEAGEYLDRQDEVPPTGPRFLARIPLRFGIDDAGAHYHVP
FT                   LLLSPFGYSTYRGS"
FT   gene            87977..88720
FT                   /locus_tag="Csal_0069"
FT   CDS_pept        87977..88720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0069"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57433"
FT                   /db_xref="GOA:Q1R1H5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H5"
FT                   /protein_id="ABE57433.1"
FT                   /translation="MSESRQAHAAKKTRRNEGKAGDGAQRHDAIYRAISDAIIEHRLQP
FT                   GARLREDALSDVFGVSRTGIRKILQRLALEHLVTLTPRRGASVSRPTAEEARDVFAARQ
FT                   LVECGLMEQVVQRATAADVARLRDDARRERQALKAGKQSEAIKLSAAFHVRLAELAGNA
FT                   TLSEFVGRLCSRSSLILAVYGNTGHLGCESHDHDELIRHLESGNGERARAFMQRHLKAI
FT                   EASLSIAEAPEETPDLKRIFDGALG"
FT   gene            complement(88871..89659)
FT                   /locus_tag="Csal_0070"
FT   CDS_pept        complement(88871..89659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0070"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57434"
FT                   /db_xref="GOA:Q1R1H4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H4"
FT                   /protein_id="ABE57434.1"
FT                   /translation="MKRHNPTKAALREGRTVSVLWLESASPDLAEAAVGAGWKTVLIDN
FT                   EHGVSSLEHTSHLVRAVEAAGGEVVLRIPANDPAYLKKVLDMGVRSIMVPMINNAAQAR
FT                   AFVDACRYPPQGNRGYAAPIVRASGYGAIDDYARHANDELLLIGQIEHVEAARDVDAIA
FT                   AVDGLDMLFIGPNDLAGSLGKLERLEDPEVRELIGELEQRIVAGGRWMGTITGPGRNVA
FT                   TLSESGYRFVAGPNDIALFASTLRDEANAWRARSADFDTV"
FT   gene            complement(89656..91173)
FT                   /locus_tag="Csal_0071"
FT   CDS_pept        complement(89656..91173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0071"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57435"
FT                   /db_xref="GOA:Q1R1H3"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H3"
FT                   /protein_id="ABE57435.1"
FT                   /translation="MFIETLANLFSLEYLAVIAACTLYGTVVGAMPGLTATMAVALLVP
FT                   FTYFMNPLMAISAIVATTSTAIFAGDIPGALMRIPGTPASAAYVEDAHRLSLAGRARST
FT                   LCVSLLAASIGGLVGVAILVLIAPQLARVAMQFSSYETFWLACLGLSCAVMTSNADVAK
FT                   SFASLFLGLFIASIGIDVAVGYPRFTFGNYELYDGISFIPAIIGLFALSEILRSARFGE
FT                   SGTRVTAKQERLPTALRETLATLRRYKRNVARSSVLGTLIGALPGAGADIAAWICYAVS
FT                   RRFSRQPERYGQGHVEGIVDGGSANNAAIGGAWTPALVFGIPGDSVTAIAIGILLLNGL
FT                   TPGPRIFTDSPELVHTLYGAFALTNLIMIPAGLLVILAASWLLRIPRRVLMPIVLLFSL
FT                   VGAYAITNSAIAIWIVLALGVLGYAMEANGFPLAPAILGIVLGGIVEDNFMTSMLKAQG
FT                   DLLAFFERPWAATLGTLTLLVWVLLVWRATRDTLRRRSPTPPKESSS"
FT   gene            complement(91178..91651)
FT                   /locus_tag="Csal_0072"
FT   CDS_pept        complement(91178..91651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57436"
FT                   /db_xref="GOA:Q1R1H2"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H2"
FT                   /protein_id="ABE57436.1"
FT                   /translation="MAHHDRLSGCLLILFGALVLWRAAGFPTMAGLVYGPGLFPSIAAI
FT                   GLMGCGAIIALGSRRSPSSTEATSPASRISRRRANARMASLIGVVLGYALLIEPLGFHV
FT                   ASLLLVAAAARIFGLSWGRCLLLAVPLVMAVHSLFYSLLHVPLPWGVLTPVAW"
FT   sig_peptide     complement(91559..91651)
FT                   /locus_tag="Csal_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.775) with cleavage site probability 0.707 at
FT                   residue 31"
FT   gene            complement(91688..92692)
FT                   /locus_tag="Csal_0073"
FT   CDS_pept        complement(91688..92692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0073"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57437"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H1"
FT                   /protein_id="ABE57437.1"
FT                   /translation="MNHVRSILSTATTLVFGVAAAAASSATEAATPNQCDWQPDRAVTV
FT                   IVPWGTGGGTDANARRLASLLEDEMGVPFNVVNRTGGNGVVGHTMLARGKPDGYTIGAA
FT                   TVEIDTMHWIGLTPLTYRDITPIALIDRTSPGVLVAKDSPYASLDDLLDEARNNPGELT
FT                   ASGTAQGGIWHLALAGMLKAEGLPPDAIRWIPSKGAGPALKELMAGGVDVATPALSEAL
FT                   PLVEQGEIKALGYMSEAPMEQLPDVPATGETLDSGWTLGAFVTISGPKGLPDEIACAYE
FT                   QAIDQAVHSDAWAEFKQSRGAPVVFENRQQTRQTLAEADDKLGDVIQSIGLAQ"
FT   sig_peptide     complement(92603..92692)
FT                   /locus_tag="Csal_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.672 at
FT                   residue 30"
FT   gene            92956..94011
FT                   /locus_tag="Csal_0074"
FT   CDS_pept        92956..94011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0074"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57438"
FT                   /db_xref="GOA:Q1R1H0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1H0"
FT                   /protein_id="ABE57438.1"
FT                   /translation="MTRRPTLKTIADRVGVTVSAVSLALRDDPRISATTRSRIQEAAEA
FT                   LGYVYNRHAAGLRRGDSGTVAVCLNDLSNPFFTEFLGHMETRFREAGRMMLFCHAHETP
FT                   SIQARFIRQMAEHGAAGLILVPVEGTSRADLEGPRVRHLRDFPLVLISRDVADTAFDRV
FT                   INDDERGIRLLFEHLYALGHRRLAWLGGGGDTSTAHDRERSFRREMDAAGLPIDDATMH
FT                   HGPTSLAFGDSMLDELMALPTPPTAIVCFSDVIAFGVLAACYRRGLRPGIDLSVTGFDD
FT                   MGAAAYSAPALTSVRVRTDLIGDRASELLLARIAGDRQPAVREMMPPELVVRETTGPPP
FT                   ETGMLPPRRRG"
FT   gene            complement(94103..95560)
FT                   /locus_tag="Csal_0075"
FT   CDS_pept        complement(94103..95560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0075"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57439"
FT                   /db_xref="GOA:Q1R1G9"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G9"
FT                   /protein_id="ABE57439.1"
FT                   /translation="MNDNDLRLTAPDASLYNADLAPLPHAERRWGAFEIFNVWANDIQS
FT                   LFGYTLAASLFLSYGLNGWAVMAAIILAGLVVMVLVNLTGRPSVKYGIPFPVVVRASLG
FT                   VHGANLPAMLRAVIGIFWYGVQTYFASTAVTLLLTALGVPEGGQFLGLSSVAWLAFVVV
FT                   WAFQLAMFWAGIERIKHFLNWAGPLVYAVMIVLMGVVWWQAGASLLPAIGNIFSGNSDA
FT                   AGSAVGAFFTVVGTMIAYFAAVVINFGDFARFVKSERAMRLGNWLGLPLNVAVFSFIAL
FT                   IITAGTLALFGEALTNPSDIVDRVDSLPLTIVAALTFFAATVGINLVANFIPPAYDLSN
FT                   LFPRRINFRIGGLITAIIAFFIGALWVSVISRIGIPGFVNAIGAVIAPFYGIIVIDYYV
FT                   IRRGRLDVQALFSTAPGSAYYYQNGWNRRALIAFAVGALFSLASVWVPALAALEGFAWL
FT                   LGASLGGACYYALMRGHTVSTAPSGAP"
FT   gene            complement(95608..96957)
FT                   /locus_tag="Csal_0076"
FT   CDS_pept        complement(95608..96957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0076"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57440"
FT                   /db_xref="GOA:Q1R1G8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G8"
FT                   /protein_id="ABE57440.1"
FT                   /translation="MTSDSATSEGPRPAGKAPGQESLDPQRTRIMGRLSYLLAWFGGCV
FT                   SIGTFAMGSSIVGTLNLLQASLAIAIGCFVIGVALTINGAAGYKYGIPFMVQARSAFGF
FT                   TGTRLPGLIRAVPAIVWYGFQSWIGAGALNAVSSTLLGFDNLVFYFIAFQLLQIALSVF
FT                   GFQGIKWLENIGSGFILASLVYMFFSVLDKYGDVIGEQLIDIDGTWGLPFWGATMLFLG
FT                   IYSTMILNASDYSRELKHGSGPGLLTTLYAMSILPCTLFMGLIGLMVSGATGVADPIDV
FT                   FANAVDNPPLLITTLLFIAFAQVTTNVLNNVVPPTYVLMDVFKLKFRSATVIVGLLAFA
FT                   TFPWELVKDDSAAGLQLFVQTYSAFLGPIFAIMAVDYYLIRQRTLDLDKLYDAHGPYRG
FT                   INYAACIATLIGALVALNVSAVSWYASLLPAGLAYYLLMRHWPACRRFNQ"
FT   gene            complement(97180..97911)
FT                   /locus_tag="Csal_0077"
FT   CDS_pept        complement(97180..97911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0077"
FT                   /product="Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57441"
FT                   /db_xref="GOA:Q1R1G7"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G7"
FT                   /protein_id="ABE57441.1"
FT                   /translation="MRLHLINPNTSTGMTTRIGESASRIAAPGTRIVATQPESGPVSIE
FT                   GHFDEAISAVGVTEEIAKGERDGSDAYIIACFGDPGLMAARELTRAPVLGIAEAGFHVA
FT                   SLISTRFSIVTTLSRTGIIAEHLLQAYGFAHHCRRIRAAEIPVLDLEDDGDAALTRVIE
FT                   TCRRARDEDGIGAIVLGCGGMADLRATIEEAVGIPIVEGVTAAVKLAEALVGLGLGTSK
FT                   HGDLAFPRPKSFTGHFAHLSR"
FT   gene            98181..99122
FT                   /locus_tag="Csal_0078"
FT   CDS_pept        98181..99122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0078"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57442"
FT                   /db_xref="GOA:Q1R1G6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G6"
FT                   /protein_id="ABE57442.1"
FT                   /translation="MGMASSTDPSEVYPRDLVGYGRTPPQANWPGQARVAVQFVLNYEE
FT                   GGENSVLHGDSHSEQFLSEIAGAEAYPDRHLSMESIYEYGSRAGVWRVLREFERRGLPL
FT                   TVFGVAMALERHPEVAQAFQELGHEIACHGWRWIHYQNVPEALERDHMQRAIEVFRRLY
FT                   GEAPLGWYTGRDSPNTRRLLLDQGGFLYDSDYYGDDLPFWSDVQDSQGQTHRHLIVPYT
FT                   LDTNDMRFASPTGFDHGEPFFQYLRDAFDVLYAEGAETPKMLSIGLHCRLIGRPGRFRA
FT                   LQRFLDHLETHDRVWITRRVDIARHWAATHPA"
FT   gene            99140..99988
FT                   /locus_tag="Csal_0079"
FT   CDS_pept        99140..99988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0079"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57443"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G5"
FT                   /protein_id="ABE57443.1"
FT                   /translation="MSQRSHDAPERTYYAPHGGLPPQSQLIHGRAVFTEAYAVIPKGVM
FT                   SDIVTSFLPHWEKTRLWVLSRPLSGFAETFSQYIMEVSPGGGSERPEPDEGAEGVLFVV
FT                   EGEMTLTIAGEAHAMGPGGYAYLPPGCDWQLRNGSDAPVRFHWIRKAYEFVEGLAVPEA
FT                   FVTSDNDIAPIAMPDTDGRWATTRFVDPQDVRHDMHVNIVTFQPGGVIPFDETHVMEHG
FT                   LYVLEGRAIYHLNQDWVEVEAGDYMWLRAFCPQSCYAAGPGPFRYLLYKDVNRHMKLRL
FT                   S"
FT   gene            100011..100499
FT                   /locus_tag="Csal_0080"
FT   CDS_pept        100011..100499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0080"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /EC_number="3.5.3.19"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57444"
FT                   /db_xref="GOA:Q1R1G4"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G4"
FT                   /protein_id="ABE57444.1"
FT                   /translation="MLELTAQPLTAEAFAPFGDVIDRRDADGFPINGGRTQRYHDLARI
FT                   ETLGEGARPLISLFVSQPVTLPLTLDFLERHPLGSQAFMPLHGERFIVVVAPPGEAVDP
FT                   ARVRAFVTDGRQGVNYRAGTWHAIHSVLDVEGEFLVVDRGGAGDNCDEFPLAMRVSLP"
FT   gene            complement(100528..101292)
FT                   /locus_tag="Csal_0081"
FT   CDS_pept        complement(100528..101292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57445"
FT                   /db_xref="GOA:Q1R1G3"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G3"
FT                   /protein_id="ABE57445.1"
FT                   /translation="MPNVAQWLALLAATLYLAGVWRTRHAGKPWSPWRSASFVVGTITL
FT                   AVAFAAPVNAFAHHDLRGHMLQHLLVGMFAPLGLVFGAPMSLLLRNLAPPRARAMVTLL
FT                   GSMPVRIVSHPLSAALLDIGGMYLLYLTPLYTQSIATPWLHHVIHLHFVISGCLFSWAI
FT                   AGPDPAPHRPRWRTRLGVLILAIATHATLGKLMYAWLLPAGTGASPGEIQAAAQWMYYG
FT                   GDLAELLLLVALMQQWLRERQRAARGKPLPAG"
FT   sig_peptide     complement(101212..101292)
FT                   /locus_tag="Csal_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.532 at
FT                   residue 27"
FT   gene            complement(101307..101777)
FT                   /locus_tag="Csal_0082"
FT   CDS_pept        complement(101307..101777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0082"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57446"
FT                   /db_xref="GOA:Q1R1G2"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G2"
FT                   /protein_id="ABE57446.1"
FT                   /translation="MSSLPYPSHADPRRTLLASALIGIGCMAAVDEIIFHQLLAWHHFV
FT                   DRDTAFALASDGVLHAIELVLLVVGFFMMIELHGAGRQAPGYRGPGFLLGAGGFQVFDG
FT                   VVDHKILRLHQVRYVDDLWLYDIAWIGFGVVVLAIGWLLLRRARRGHATSQH"
FT   gene            101972..103186
FT                   /locus_tag="Csal_0083"
FT   CDS_pept        101972..103186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0083"
FT                   /product="Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57447"
FT                   /db_xref="GOA:Q1R1G1"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G1"
FT                   /protein_id="ABE57447.1"
FT                   /translation="MRDARHSIERIKEVFFAFLVLGLTSFGGPIAHLGYFRAEFVTRRR
FT                   WLSEADYADLVALCQFLPGPASSQVGFALGLLRGGGWGAAAAWTAFTLPSALVLVLFAS
FT                   GAASFDGPVSEGILHGLKVAAVAIVAHAVWGMAHKLCPDQRRAGIALAAVLIVVLIGGP
FT                   AGMIAAILAGAVGGMLLCRDSAYRDQGDPGSRGLHFPVSRRAARIAAVCFVTLLIGLPG
FT                   LAWVSSSPVLSMADAFYRAGALVFGGGHVVLPLLESEIVQSGWVTPDSFLAGYGAAQAV
FT                   PGPLFTFAAYLGAEMGALSVPLLGAALALIMIFLPGLALLVAVLPHWNGFRRLERVQAL
FT                   MRGANAAVVGILGAALYQPVWTSVVVGPHEFALALVGFLLLSVWKWPAWAVVAILALGG
FT                   IVITL"
FT   gene            complement(103254..104741)
FT                   /locus_tag="Csal_0084"
FT   CDS_pept        complement(103254..104741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0084"
FT                   /product="N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57448"
FT                   /db_xref="GOA:Q1R1G0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1G0"
FT                   /protein_id="ABE57448.1"
FT                   /translation="MNAQTLANKVWNFCHTLRDDGVGYGDYLEQLTYLIFLKMAHEYSQ
FT                   PPYRRDTGIPAGYGWPSLVRRTGAELEAHYLDLLRTLGQQSGTLGQIFTKAQNKIQDPA
FT                   KLARVIHMIDAEKWAMLDADVKGDIYESLLEKNAEDTKSGAGQYFTPRALIQAMVACVQ
FT                   PQPGKTIADPSAGTGGFFLAAYDWITEHHGARMDREQKQFLKHHAFHGNEIVANTRRLC
FT                   LMNLFLHNIGEIDDQPNIAPTDALIGPAPARYDYVLANPPFGRKSSMTVTNEEGEQEKE
FT                   DFVYNRQDFWATTSNKQLNFVQHIRTMLKENGQAAVVVPDNVLFEGGAGETVRRKLLTT
FT                   TELHTILRLPTGIFYANGVKANVLFFDNKPGRAEPWTKDIWIYDYRTNVHHTLKRKPLR
FT                   LEHLQEFIDCYQPGQRDRRQETWSEATPDGRWRKYSLDEVLKRDKVSLDIFWLKDESLG
FT                   DMDNLPEPDVLIGDIIENLEAGLEAFRNVAQGLENSR"
FT   gene            complement(104738..106663)
FT                   /locus_tag="Csal_0085"
FT   CDS_pept        complement(104738..106663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0085"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57449"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F9"
FT                   /protein_id="ABE57449.1"
FT                   /translation="MTTAAALLEQLRLLDESERVEAKRAQKFGKSMLETICAFANEPGL
FT                   DGGHLLLGVVEDQGHYRVEGVPDPDTLLNDLHSACASTFNVPLRVQAATELVEGERLVV
FT                   IQVPEARPADKPVYFVKSALPRAAWRRGPNGDYRCNEHDLEVLYQQRSQVEFDRSVPHG
FT                   ATRDDIDPDALDDYRRDRRAMNAQAEELGYSDDELLEALGAAIWQHGELKPTLAGILLF
FT                   GRRMAIRRLVPAHRVDYIRVTGKEWIEDPDERFTTIDMRDTLPRLINRAVAAVLDDLPM
FT                   AFHLPQGSQQRADRPLIPAKVVREAIVNALMHRNYRAHQPLQIIRFSNRIEVRNPGYSL
FT                   KPEEQLGLPGSAWRNPTLATVLHEVGYAETKGSGIRVMRRQMEQAGLTPPVFESVRHED
FT                   RFMATLLFVHFLDDEAVEWLKHFRHWQLSDEECRALLFVRETGRITNADYRDQNRVDTL
FT                   AASQQLSRLRDLGLLHQVPKGAETYYLPGEHFPMQGSPAMELLSVLDRDLAAEQENLPQ
FT                   ESGGLPQESGGLPQESGGLPQEPEGQSRESLIAELPGWLALRLEAIGQRSRDKRRVREL
FT                   LRALCAERPYRAAELSRLLKRNQEYLQKEYITPMRQAGELAYQYQDDPNRPDQAYVSPT
FT                   ANREAE"
FT   gene            complement(106660..108276)
FT                   /locus_tag="Csal_0086"
FT   CDS_pept        complement(106660..108276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0086"
FT                   /product="restriction modification system DNA specificity
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57450"
FT                   /db_xref="GOA:Q1R1F8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F8"
FT                   /protein_id="ABE57450.1"
FT                   /translation="MNSPIDEALPVHSMEKKLANIKTPHWLWIEHNQIAEINPKKPKLD
FT                   EELSVSFIPMGAVAEESGRYTTDDSKKFEDVKKGYTYFSDGDILFAKITPCMENGKVAL
FT                   LSNLTNGVGFGSTEFHVSRLTEAVEKKFYFYFFVSKSFRKQAQANMAGSAGQLRVTTDY
FT                   FSNVSVPLCPTREQQRIVTKIEELFSEIDSGVESLKTAQAKLKTARQSLLKAAFEGKLT
FT                   EQWRKDNADRQESPEALLERIQAEREAHYQQQLTDWQHQLKDWEAAGKEGKKPRKPKVP
FT                   KALPPLTQQELAELPELPEGWKWINLGNISEISGGITKNQKRQSLPQKNPFLRVANVYA
FT                   NKLELDDIHFIGTTPDEAKRAKLKKDDLLIVEGNGSPDQIGRVAKWDGSIEHCTHQNHL
FT                   IRSRLASPISADFVLHFLLSATGRKAIKKVASSTSGLYTLSLAKVEKLCIPVCSKNEQM
FT                   MIVDQLESRLSQLDQLERTLTASMKQAEALKQSILKRAFAGRLVPQDPDDEPASELLAR
FT                   IRAERESQPRAPRKLHREPTP"
FT   gene            complement(108276..111053)
FT                   /locus_tag="Csal_0087"
FT   CDS_pept        complement(108276..111053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0087"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57451"
FT                   /db_xref="GOA:Q1R1F7"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F7"
FT                   /protein_id="ABE57451.1"
FT                   /translation="MTTLTPEQQARRRIDRQLEEAGWIVQSMSELNPAAGRGVAVREYP
FT                   TDSGPMDYLLMVDHQAVGVIEAKRDDEGHRLNAVELQSARYATSSLKHLGQVALRFVHE
FT                   ATGEITRYTDSRDPKPRAREVFQFPRPDTLAQRLKEPETLRARLTHVPTLQPHGLRDCQ
FT                   LHAITNLEQSLGENRPRALIQMATGAGKTFTAITSIYRLLKFSQAKRVLFLVDTKNLGE
FT                   QAEGEFHQYIPQDDNRKFTELYTVRRLTSSHIPDDAQVIICTIQRLYSILKGEPLDEAT
FT                   EETVPDGAAILRKPPLPVIYNARIPPEFFEFMVIDECHRSIYNLWRQVLEYFDSFLIGL
FT                   TATPDNRTYGFFQQNVVSEYTLEQSVADGVNVDHRVWRIDTEITQAGGRLEAEELVEKR
FT                   ERLSRKKRWEQLDQEIDYQGTQLDRSVVNPSQIRTVIQAFRDGLPQMFPDRVDDDGAFQ
FT                   VPKTLIFAKTDSHADDIIRIVREEFGEGNEFCKKITYRIDEDPKSVLASFRNDYHPRIA
FT                   VTVDMIATGTDVKPLECLLFMRDVKSRNYYMQMVGRGTRSLDADGLAVVSNAARGPKQE
FT                   FILVDAIGVKDSQKKETGSLEKTPSYSQKDLMNAVTMGVRDEEVLSSLSGRFARFAKRL
FT                   DAEQQRQVKDLTGGASLNDLAGQLLKVDDPDAIDAQTRKHFNLTPNETITSTQWDEVRK
FT                   QRAQQACAPITGPLNTLLEDIRERQEQTLDTVNIDTVTHSGWDRDLDTQRAHLRQEFEQ
FT                   WLQSHRDDITALTIYYAQPQRRAEITQQTIAALLESLKQERPRLAPVRIWDAYAALDDV
FT                   QVKRPEQELAQIVALVRRACGWDDKLTPYADTVRANFKKWIFARHAGNQTKFSPEQQAW
FT                   LEMIRDHIAVCLHLEVDDLDYIPFNEEGGAGKMYQLFGDEMDRVIDEINDALAA"
FT   gene            complement(111183..112127)
FT                   /locus_tag="Csal_0088"
FT   CDS_pept        complement(111183..112127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0088"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57452"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F6"
FT                   /protein_id="ABE57452.1"
FT                   /translation="MTDSHDTPPIVVAALYQFVTLDDYEALREPLLETMRAHDVKGTLL
FT                   LANEGINGTVSGTRESIDALLAWLRADPRLAAVDHKESYCDAHPFYRTKVKLKREIVTL
FT                   GVDGVDPNQKVGTYVEPEDWNDVIADPEVLVIDTRNDYEVEIGSFEGAIDPQTKTFREF
FT                   PDYVKAHYDPAKHKKVAMFCTGGIRCEKASSFMLNAGFEEVYHLKGGILNYLEKVPESQ
FT                   SRWQGECFVFDNRVTVRHDLAEGEYDQCHACRRPISEADMASEKYEPGVSCPHCWDSLP
FT                   EKTRASARERQRQIELAKQRGEPHPLGRDPRQI"
FT   gene            complement(112276..113766)
FT                   /locus_tag="Csal_0089"
FT   CDS_pept        complement(112276..113766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0089"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57453"
FT                   /db_xref="GOA:Q1R1F5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F5"
FT                   /protein_id="ABE57453.1"
FT                   /translation="MNSHVFLGAFVTYVVAMIAFGWWVSRHSRSNGDDFLLGGRSIPIF
FT                   LTIGTTVATMVGTGSSMGAVGFGYANGWAGALYGIGGSIGVLLLAAWFAPVRKLRFMTM
FT                   SEELSYYVGANRWVRNIVAVLIYIACIGWLGAHILGGGLYLSWMADIDLTTARVLVALG
FT                   FGIYCVIGGYMAVVWTDTVQAVILFVGFIVMAIIALFEVGGFSGLGANMDVATTSFLGI
FT                   DKIGVVPALSLAAVIAVGVLATPSYRQRIYSGNSVHSVRKSFVITGILYMIFSIIPAII
FT                   GMATHALNPGLDNSNFAFPFLATEILPLWLGLLLLVAGLSATMSSASSDAIAGVSILLR
FT                   DVYVLFTGHTPSAHKVVLLSRLALIATIGLALLFALTSDNVIDYITSMIATVMAGMFVC
FT                   GVLGRFWPRYNWQGAVATLIAASATSLAVIGVDSWSAFWGNPSIPAVLVALLVGVVVSL
FT                   ITPASKVTPEQALKIIDDERERMEMTEDPAEAIHHKTA"
FT   sig_peptide     complement(113701..113766)
FT                   /locus_tag="Csal_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.577 at
FT                   residue 22"
FT   gene            complement(113933..114325)
FT                   /locus_tag="Csal_0090"
FT   CDS_pept        complement(113933..114325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0090"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57454"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F4"
FT                   /protein_id="ABE57454.1"
FT                   /translation="MSIQRYGVEGGVGTGGQKLPFARATEAGGWLFVSGQTPMTDGEVV
FT                   EGSIVEQSRLAFANCLKIMEEAGYGVEHVVHVTAVLTDARYFSSFNKVFKEVFGEHPPA
FT                   RICSVQDLVVDCKVEVDVKCYRADRA"
FT   gene            complement(114354..115853)
FT                   /locus_tag="Csal_0091"
FT   CDS_pept        complement(114354..115853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0091"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57455"
FT                   /db_xref="GOA:Q1R1F3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F3"
FT                   /protein_id="ABE57455.1"
FT                   /translation="MHVDLLIRHATILDGRGGDAFTADVAIQGERIVALGTLVDTSAND
FT                   VIDAKGLTLAPGFIDVHTHDDTNVIRTPEMLPKLSQGVTTVVVGNCGISASPVTLTGDV
FT                   PDPMNLLGRAEDFRYPSFAAYAQAVDASTPSVNVAALIGHTSLRSQVMDRFDRPASDDE
FT                   IAAMREQLETALGEGAVGMSSGLAYRNAFCAPTEEMNALVEAVGRAGGVYTTHLRDEFA
FT                   GLPEAMDEAVATARHGQAPLVISHLKCAGAGNWGNAPKALSKLDDAARTHGVHCDCYPY
FT                   TAGSSTLDLGQVTDEIDIFITWSDPHPEVARQSLGAIAEQWGLSLMEAAERLQPAGAVY
FT                   HNMSEADMRLVLSHPLSMVGSDGLPNDPHPHPRLWGTFPRVLAHYSRDLKLLSLTEAVR
FT                   KMTALSAANFGLADRGVIRVGAFADLVLLDLETLEDTATYSTPMSLARGIELVIVNGCI
FT                   SYRHGQASGKRAGRLLRRNARLSPAPVSTGIHDGRDSATFP"
FT   gene            complement(115877..116740)
FT                   /locus_tag="Csal_0092"
FT   CDS_pept        complement(115877..116740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0092"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57456"
FT                   /db_xref="GOA:Q1R1F2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F2"
FT                   /protein_id="ABE57456.1"
FT                   /translation="MSQEFDILSHITACLPSLRVSEKKVATLVHDDIDFVTEASIGEIA
FT                   RRAEVSDATVTRFARAVGCRNVRDLKTRLTRALAAGRRFIQEANEEDGLGVIYDTAAQT
FT                   LSLNRELMEQADVEGAVAMLDDARQILVFGAGGGSTVMAQEMQFRLVRLGYAISAYPQA
FT                   LLPRMVASTLEPEDVVVTLSVTGYTPEIVEAAELARQYGARVLAITAVGSPLADTANIV
FT                   LPLAARETDYIYFPSSSRYAMMAAIDMLALGLALRHRDRTRDKLRRLKITLDAHRGGDN
FT                   RQPLGD"
FT   gene            116845..118059
FT                   /locus_tag="Csal_0093"
FT   CDS_pept        116845..118059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57457"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F1"
FT                   /protein_id="ABE57457.1"
FT                   /translation="MVAPGNWEMEKGMPPSRPAHLLHDVPLPAAAVFEAPLTHNLAWMQ
FT                   RFAEGHGAKLAPHGKTTMAPALFRRQLEAGAWGITLATAVQTVTAHAHGVDRVLMANQL
FT                   VGRPNMTLVADAIEAGLEYYCVVDGVDNVRDLGAFFADRELTLNVLIELGVDGGRCGCR
FT                   NAAQVDALVAEIARQPALALVGIEGYEGMIAGGDEAAAVRAYGERLVETVRTLQASDVL
FT                   QREAPIVTASGSKWFDLIAETFDRAELREHYTPVLRPGCYVVHDHKLYAGAMEAIKARD
FT                   PGLEGELRPALEVFAHVQSLPEPGLAIIALGKRDIGHEPDLPLPLRRYPREAGGTVSVD
FT                   VSGWRTTHIMDQHAFLEIPEHADIAVGDVLAFGTSHPCLTFDKWRRVLCVDEALAVKEV
FT                   MTTHF"
FT   gene            118198..120234
FT                   /locus_tag="Csal_0094"
FT   CDS_pept        118198..120234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0094"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57458"
FT                   /db_xref="GOA:Q1R1F0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1F0"
FT                   /protein_id="ABE57458.1"
FT                   /translation="MTHRYLPASLLLGALSASGAAFSQTISPEVMEVTAPRLDRELYAT
FT                   PAAVSVVDRDSIAQGQQRVRLDESLVTVPGVFLQNRDNFAQGERLAIRGFGARAPFGVR
FT                   GVTVMADGIPYTLPDGQAQLDAIDLDSAQRIEVIRGPSSVLYGNAAGGVLSVTTADGRD
FT                   DQKTRLGAEIGSDGYRKYRFSDGGVNGPWSHHVSVSALNFDGYRDQSQVEKYHLNAKVR
FT                   RELGNDRALTAIVNLLDNPRSEDPGGLTREQVDEDRNQAGDFTEEYDTGQNVDQQVLGL
FT                   QYEDLSAGPGELYVKGFYLQRDFEQQLPYPGDSLLGYERDYFGGSAEYHQDLLLGELPL
FT                   RYVVGVDVARQEDDRWRRNVEFDGTVGGDTADETQTATSLGIFAQGDLDLTDKLTLSLG
FT                   TRYDRVDFDIDDDFGSDGDQSGDRTFREWSGSAGLSYRYLPTHQAYVNTGTSFETPTFS
FT                   EFANPSGVGGFNPAVEPQKAWNREIGLRGNFDNGVDYDLALFSVRVRDELVPYNENGRD
FT                   FYRNAGDSSRDGIELALGWQMTPSWRLDSALTLARYEFDEYDTQDGNYGGNRIPGLPEQ
FT                   TWMNRLTWKGFDERFATLETQYIGDMVADDANDVAVDDYWLVHLRAGDGWHLGGDTLLK
FT                   GYVGVRNLFDREHFANVRINANNDRYFEPASGRTVYAGMEVAF"
FT   sig_peptide     118198..118269
FT                   /locus_tag="Csal_0094"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            complement(120323..120580)
FT                   /locus_tag="Csal_0095"
FT   CDS_pept        complement(120323..120580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57459"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E9"
FT                   /protein_id="ABE57459.1"
FT                   /translation="MRRTPCPDATRPLQGGAVFMAPAWRHALRGVSRSRRFRRARDIRR
FT                   VAGRTGLRHARLDLALAVVVGVDRAAGKSCHQQHSTCHCQ"
FT   gene            complement(120583..121833)
FT                   /locus_tag="Csal_0096"
FT   CDS_pept        complement(120583..121833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0096"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57460"
FT                   /db_xref="GOA:Q1R1E8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E8"
FT                   /protein_id="ABE57460.1"
FT                   /translation="MAKTSLDKSKIKILLLEGIHQSAVDNLLNAGYTNIETLSTSLSED
FT                   ELVEKIRDVHFIGLRSRTQLTERVFAAAEKLTAVGCFCIGTNQVDLNAALERGIPVFNA
FT                   PYSNTRSVAELVLAEAIMLLRGIPEKSARAHQGGWLKSAKNSHEARGKTLGIIGYGSIG
FT                   AQLSVLAESLGFDVLYYDVITKLAMGNARQVGSLEELLARADVVSLHVPDVPSTRWMIG
FT                   RDQLALMKQNAIFINASRGTVVDIEALAEVLESGKLLGAAIDVFPVEPKGTNEEFVSPL
FT                   RGKENVILTPHIGGSTLEAQENIGIEVSEKLITYSDNGTTITSVNFPEVALPAHPDKHR
FT                   LLHIHENVPGVMSEINKVLSDEGINISAQYLQTNSGVGYVVIDVDKAYGPKALEALKRV
FT                   NHTLRLRVLYSESNFEA"
FT   gene            122139..122444
FT                   /locus_tag="Csal_0097"
FT   CDS_pept        122139..122444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0097"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57461"
FT                   /db_xref="GOA:Q1R1E7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E7"
FT                   /protein_id="ABE57461.1"
FT                   /translation="MAETDASISGAAQPDETDVDERAPEDFAATLARLESLVAQLESGE
FT                   LSLEASLVAFERGVHLTRDAQQRLENAELRVKALLEQPDGSFQTVPFETGEADGER"
FT   gene            122467..123324
FT                   /locus_tag="Csal_0098"
FT   CDS_pept        122467..123324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0098"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57462"
FT                   /db_xref="GOA:Q1R1E6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E6"
FT                   /protein_id="ABE57462.1"
FT                   /translation="MTTARARTEQVLAGIVERAAPVSGELDAAMRYSVLGGGKRLRPIL
FT                   VYAAGHALGAEDKALDAPAAAVELIHAYSLVHDDLPAMDDDDMRRGRPTVHRAYSEAMA
FT                   ILAGDALQTLAFEVLAETRHPRLGAMVRALANASGREGMAAGQALDLSAVGGRLDVDAL
FT                   ATMHGYKTGALIRAAVRLGALAAADEDDPRVAALDTYAAAIGLAFQIQDDILDVAGDAA
FT                   TLGKATGADAARAKPTYPALLGLDGARAKARGLLDEALSALAPLGERAYPLAELARHMI
FT                   DRDH"
FT   gene            123344..125305
FT                   /locus_tag="Csal_0099"
FT   CDS_pept        123344..125305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0099"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57463"
FT                   /db_xref="GOA:Q1R1E5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1E5"
FT                   /protein_id="ABE57463.1"
FT                   /translation="MKLFDEIPAERPATPLLDTCEHPAALHDFNATQLRQLADELRAYL
FT                   LYSVGCTGGHFGAGLGVVELTVALHHILDTPYDRLVWDVGHQAYPHKILTGRREQMSTI
FT                   RQFGGLAAFPKRDESPYDTFGVGHSSTSISAALGMALAARTKGERRRVCAVIGDGALSA
FT                   GMAFEALAHAGHVDANMLVILNDNEMSISENVGGMASYLARILVSKPYTVMRENSKRVL
FT                   SHLPGALELARRTEEHVKGMVSPATLFEEMGFNYIGPIDGHDLPTLVQTLGNMANLEGP
FT                   QFLHIKTCKGRGFRPAEADPIGYHAITKLEKTTSEPPPKKEPRSPNAATAEPEAQPKPQ
FT                   PKPRKYCNVFGEWICDMAAVDARLIGITPAMREGSDLIRFSREYPERYYDVAIAEQHAV
FT                   TLAAGMACEAMKPVVAIYSTFLQRGYDQLIHDVAVQALDVTFAIDRAGVVGEDGPTHHG
FT                   ALDLSFLRCIPGMIVLAPADEAECRAMLSAAYHHPGPAAVRYPRGTGPGTQVASNLEAL
FT                   PIGEAETRRSGREGGVALLAFGSMNGPAGEVAERLDATHLNMRSVKPLDREAILAAARD
FT                   HRLLVTLEESVVAGGAGSGVNELLAAEGVQVEVLNLGLPDDFVEHGKPAELLAACGLDA
FT                   EGIETAVRRRLETSRADD"
FT   gene            125331..126104
FT                   /locus_tag="Csal_0100"
FT   CDS_pept        125331..126104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0100"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57464"
FT                   /db_xref="GOA:Q1R1E4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E4"
FT                   /protein_id="ABE57464.1"
FT                   /translation="MLIAILIGAGLGFMFGKLPGLIIGAVLGFWVARRLVRRVVVSKLS
FT                   KMQDQFLDSTFAVMGCICKADGDVSGDELRVVETLFQRLRLSEAQRERANAAFERGKAD
FT                   DFDLDAELATVRRVTGGQRALLQMFLQVQLSAIAADGQLHPAEHDMLLRVARGLGCSEA
FT                   EIAQIEAMLRGEQQQPGGAPSQQSLTDAYRVLGVESDASDAELKRAYRRLMSQNHPDKL
FT                   AGKGLPESMRDMAEARTQEISHAYDLIKKAREANA"
FT   gene            complement(126187..126594)
FT                   /locus_tag="Csal_0101"
FT   CDS_pept        complement(126187..126594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0101"
FT                   /product="Transthyretin"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57465"
FT                   /db_xref="GOA:Q1R1E3"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E3"
FT                   /protein_id="ABE57465.1"
FT                   /translation="MRLSRTLIAAIGLGATAPALAADNPLSVHVLDIQSGQPSPGIEVQ
FT                   LEKRTESGWESLATGITAESGRISALYPDDRDFTAGVYRVTFETGDWFAEHDTRTFFPE
FT                   IPVPFEVTDPSQHYHIPLLLSPYGYSTYRGS"
FT   sig_peptide     complement(126529..126594)
FT                   /locus_tag="Csal_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            126737..127408
FT                   /locus_tag="Csal_0102"
FT   CDS_pept        126737..127408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0102"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57466"
FT                   /db_xref="GOA:Q1R1E2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E2"
FT                   /protein_id="ABE57466.1"
FT                   /translation="MRILLVEDESKTADYLARGLGEAGYRVEVARDGLDGRHLIEEADF
FT                   ELIILDVMLPGLDGWELLRLIRRHGQVPVLFLTARDAVEYRVKGLELGADDYLVKPFSF
FT                   VELLARVRTLLRRGPLRERERFQVADLHMDVLKRRVTRGETRLALTNKEFALLQLLLER
FT                   EGEVLSRTLIASEVWGMNFDSDTNVVEVAVRRLRAKVDDPFTRRLIHTERGMGYVLEDR
FT                   G"
FT   gene            127408..128805
FT                   /locus_tag="Csal_0103"
FT   CDS_pept        127408..128805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0103"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57467"
FT                   /db_xref="GOA:Q1R1E1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E1"
FT                   /protein_id="ABE57467.1"
FT                   /translation="MRAPASLSMRLSLLFALVSLGLLGGLGAYLYHALGQQIAWRDDQM
FT                   LQGRLERMEALLDDGESIAALRRRPLLYANMLGNRESLLWMLDARGVPLIEVNPPGLPV
FT                   PELPPAPEGRLGEHPAAGSTRLAWRSLEHDGRRLTLVAGKTLDERERMLAAYRLRLWLA
FT                   MGAGAVLACGLGWVVVRRGLRPVRRLAARARTIDVAHLHRRLEANDETAELRELSRALN
FT                   QMLARLEEGFAQLSRFSEDLAHEMRTPLGNLLGATQQALQRERTAEEYRQLLGSHVEEY
FT                   ERLSRMIETMLFLARTEQPARVLPRETVDLRGLADQLCDYFEGMADEDGRELASDMQGR
FT                   VTANLDLLRRALANLIDNALRHGRSGTEIRLVSRREAGDWHLGVVNHGEPIPDAERARL
FT                   FERFYRGDPARSRPVGTGGLGLAIVRSVAQLHGGEAWCESDAAVNVFWLSLPADDDDRV
FT                   DSCPVRR"
FT   sig_peptide     127408..127494
FT                   /locus_tag="Csal_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.288 at
FT                   residue 29"
FT   gene            128852..129454
FT                   /locus_tag="Csal_0104"
FT   CDS_pept        128852..129454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0104"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57468"
FT                   /db_xref="GOA:Q1R1E0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1E0"
FT                   /protein_id="ABE57468.1"
FT                   /translation="MPARLKTYRAVAHLLGVLDGLGWRVGYRYGDRQLLEKVILPSLAA
FT                   DVGAGHVLLVGCAWYTRDYPEFFARARVSTLDVDPAKSPFGSRRHVVADMTSMERHFAP
FT                   ASLDAVICNGVLGWGLNAPDDIEAAFSAVATCLRPGGHLLLGWNDIPPYNAVPPEAVTA
FT                   LEALHPGTIPGLDQHSVIALERNQHCYQAFRKPEVRA"
FT   gene            129477..130463
FT                   /locus_tag="Csal_0105"
FT   CDS_pept        129477..130463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0105"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57469"
FT                   /db_xref="GOA:Q1R1D9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D9"
FT                   /protein_id="ABE57469.1"
FT                   /translation="MLIAGWGVLFGVLLCGLLLVVACLLGLRRMTRALARDAEARLPPR
FT                   GAFIETPGGRLHYVEAGSGPPLVLIHGLGGQLQHFTYAVIEALRDDYRVIAFDRPGSGY
FT                   SDTTDNERARLPCQARAVHEAWRALGVERPLLVGHSMGGTLALTLALEFPDDVAGLALL
FT                   APLIERVDDVPPPMRLLAIRSPRRRRWMADTLAVPLTSWTSRRTLAQVFAPEPVPGDYA
FT                   VRGGGILALRPQAFHAASTDLAMLEHELPRQVRRYAALKVPLGIMFGTHDRILDPACHT
FT                   RPMQRRYPDMLLHLEPGAGHMLPITRPEATVAFIRRMAERSHLATTA"
FT   sig_peptide     129477..129545
FT                   /locus_tag="Csal_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.390 at
FT                   residue 23"
FT   gene            complement(130491..131135)
FT                   /locus_tag="Csal_0106"
FT   CDS_pept        complement(130491..131135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0106"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57470"
FT                   /db_xref="GOA:Q1R1D8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D8"
FT                   /protein_id="ABE57470.1"
FT                   /translation="MTWQSRARAAIMRTFTQAQEFFVHTRDKLKQTGLALFARHGYEGT
FT                   SLAHIAAETGIKKPSIYNHFPNKAALFLAIFEDVESGIVTLIDDSLTHSRGLPTRARFE
FT                   RLIRACATFIRREHQGVFYKRYLLFPPTDVAADVAAISNDNENRINAHLHTLFTEGRQS
FT                   GELRALPEAQFIAAFYCLMDGLFAENFYYDADTFEQRLEGAWAVFWAGLEA"
FT   gene            131233..131607
FT                   /locus_tag="Csal_0107"
FT   CDS_pept        131233..131607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0107"
FT                   /product="small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57471"
FT                   /db_xref="GOA:Q1R1D7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D7"
FT                   /protein_id="ABE57471.1"
FT                   /translation="MTMRWLILPLAALAEVGWATGLKLASSPLEWLATVIVAAMSLLLA
FT                   VRAVRFLPASTVYTVFVGLGAAGTVVADAWLFGTRFSWPSLACIGLILVGVIGLHQFSG
FT                   KPAAPASVSRTDASREGVSS"
FT   sig_peptide     131233..131292
FT                   /locus_tag="Csal_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.727) with cleavage site probability 0.680 at
FT                   residue 20"
FT   gene            131604..131924
FT                   /locus_tag="Csal_0108"
FT   CDS_pept        131604..131924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0108"
FT                   /product="small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57472"
FT                   /db_xref="GOA:Q1R1D6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D6"
FT                   /protein_id="ABE57472.1"
FT                   /translation="MTWHWLALLGAGIFEVLGVVGFARVSRGRALAGGLLMTLGFGTAL
FT                   GFLALAMRGIDLGIAYAVFTGIGTVCGTLLGMLYWGESRHPLRIAFTALIVLGVVGLKL
FT                   LA"
FT   gene            132013..132366
FT                   /locus_tag="Csal_0109"
FT   CDS_pept        132013..132366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57473"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D5"
FT                   /protein_id="ABE57473.1"
FT                   /translation="MCRVHSRQGDIPMARSITAIALLAAALPLAAQASTASQQAAAVNH
FT                   EPLQVASQTTTGSSVRHADAAGYRDAGMSVAMADSQRAVNADAHDADRADDDRSWLEIL
FT                   SDNNRDLGAPAGW"
FT   sig_peptide     132013..132114
FT                   /locus_tag="Csal_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.885 at
FT                   residue 34"
FT   gene            complement(132464..133333)
FT                   /locus_tag="Csal_0110"
FT   CDS_pept        complement(132464..133333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0110"
FT                   /product="nucleoside-specific channel-forming protein, Tsx"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57474"
FT                   /db_xref="GOA:Q1R1D4"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D4"
FT                   /protein_id="ABE57474.1"
FT                   /translation="METTTMTKTTTSKWLGATFLATMVCSSPALAADYSDGIHEDDNLW
FT                   LTFNLMHSEDNRLPFRNAQDTYVEMEFGGRSGIVDLYGYVDMFDALDDGSDDQNGGDNV
FT                   FIKLAPRFSLDAMSGRDLSVGPVKEWYIATVTNIGDNGPGGGLWEHYVGLGSDVAVPWF
FT                   GEIGLNLTARYVRENYGGPDENSWDGFMVSTDWFKPFYTFGNGDFLAYQGYLDYKFGAD
FT                   TVADQAGRSSNSLEWFNGLYYHADRFAIGYGLKLYNNMAFYRDDTDASGVRQDTSGPGH
FT                   YFSINYKF"
FT   sig_peptide     complement(133238..133333)
FT                   /locus_tag="Csal_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(133431..134693)
FT                   /locus_tag="Csal_0111"
FT   CDS_pept        complement(133431..134693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0111"
FT                   /product="nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57475"
FT                   /db_xref="GOA:Q1R1D3"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D3"
FT                   /protein_id="ABE57475.1"
FT                   /translation="MTTIMSLVGMATLILIAVLFSSDRKSIRLRTVGGAFAIQAAIGAF
FT                   VLYIPFGQAVLATLSEGVSQVIVYADDGINFLFGDLANPESVGFVFAFKVLPIIIFFSS
FT                   LIAVLYHLKIMQWIIRLLGGALQRVLGTSRTESMSATANIFVGQTEAPLVVRPFIASMT
FT                   RSELFAVMCGGLASVAGSVLAGYASLGIPMEYLIAASFMAAPGGLLFAKLLMPETEKPD
FT                   DSISRAEEKIEEDEKPANVLDAAATGATSGMMLAANVGAMLLAFIGLIALLNGILGGVG
FT                   GWFGMESLSLEMILGWLFAPLAFLLGIPWSEATLAGSFIGQKIVVNEFVAFINLAPYIS
FT                   GDTVVAATGEAMSKHTAAVLSFALCGFANLSSIAILLGGLGLMAPNRRQEIARYGLKAV
FT                   LAGTLSNLMSATIAGLFISLA"
FT   sig_peptide     complement(134628..134693)
FT                   /locus_tag="Csal_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.846 at
FT                   residue 22"
FT   gene            135060..135560
FT                   /locus_tag="Csal_0112"
FT   CDS_pept        135060..135560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57476"
FT                   /db_xref="GOA:Q1R1D2"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D2"
FT                   /protein_id="ABE57476.1"
FT                   /translation="MHPVVHTLVIGVISYLVLIVIIRLSGKRTLSKWNAFDFVVTIALG
FT                   STLSTALVSTQVSLAQSITAFVLIVALQFAITFTSVRSRRVKNLVKSQPTLLLFQGRFR
FT                   AETMAQERVVDAEVRAAIRENGIADVERVYAVVLETDGTFSVIPEAGDSDSALQGVAGL
FT                   PTS"
FT   gene            complement(135593..137452)
FT                   /locus_tag="Csal_0113"
FT   CDS_pept        complement(135593..137452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0113"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57477"
FT                   /db_xref="GOA:Q1R1D1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D1"
FT                   /protein_id="ABE57477.1"
FT                   /translation="MFRWFENRLAPFPPEEPQRPPDTLIAFCLHYTRGAWPYLLTATVL
FT                   MALIAGIEVWMFGFLGNIVDWLAAQDRETFLADQGWKLTGMALIVLVLLPGMVWLHSLF
FT                   QQQTLMGNFPMRIRWQAHRYLLRQSMGFYQDEFAGRIATKVMQTALAVRECVIKLFDVL
FT                   NYVSVYFLGTLLLVGNADWRLALPLVAWLAGYLVLLRVFVPLMGRVSKSQADARSRMTG
FT                   RIVDSYSNIQTVKLFSHAQREAAFAKEGMHGFLLTVHRQMRLVTGLYGLLYLLNALLLF
FT                   SIGWLSIHLWLIEAVSVGAVAVALGLVMRLWGMSQWIMWEVSALFENIGTVQDGMATLS
FT                   LPRQIEDSPEAKPLAIDRGEIVFDHIRFHYGKGSGVIDDLSLHIRPGEKIGLIGPSGAG
FT                   KSTLVNLLLRFFELEGGAIRIDGQDIADVTQESLRAKIGMVTQDTSLLHRSVRDNLLYG
FT                   RPDATDDMAWQAAKQAHVAEFIESLRDIHGRRGFEAHVGERGVKLSGGQRQRLAIARVM
FT                   LKDAPILILDEATSALDSDVEAAIQENLDQLMRGKTVIAIAHRLSTIAAMDRLVVMEQG
FT                   RIVEQGSHAELIRQNGLYARLWRRQSGGFLEAATTPSSAHEAN"
FT   gene            complement(137618..138301)
FT                   /locus_tag="Csal_0114"
FT   CDS_pept        complement(137618..138301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0114"
FT                   /product="channel protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57478"
FT                   /db_xref="GOA:Q1R1D0"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1D0"
FT                   /protein_id="ABE57478.1"
FT                   /translation="MSHASQPSPPEGDVPYSRLEEALHSITHGIGAALSLAGMVVLIVV
FT                   ASLASHVDPWKIVSVSLYGVCLLLLYTTSTLYHGLRHARLKRLFQVLDHCAIYLLIAGT
FT                   YTPFLLVNLRGPLGWTLLATIWSLALGGIALKLIWPHRFGMLRVGVYLLMGWMIVLAAG
FT                   ELDARLNTPGLALLVAGGITYTVGVVFYAIRAIPFHHAIWHLFVIGGSVCHYFAVYTAV
FT                   LPFQA"
FT   gene            complement(138386..139009)
FT                   /locus_tag="Csal_0115"
FT   CDS_pept        complement(138386..139009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0115"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57479"
FT                   /db_xref="GOA:Q1R1C9"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C9"
FT                   /protein_id="ABE57479.1"
FT                   /translation="MTIRFIAASQLPTPWATFTMHGFEDDATGKEHVALTLGDVSTSEP
FT                   VLGRVHSECLTGDALFSMRCDCGYQLQEALKRIADEGRGVLLYLRQEGRGIGLLNKIRA
FT                   YHLQDQGYDTVEANEHLGFGADMRRYDLCVPMLDHLGVQALKLMTNNPRKVEALTRDGV
FT                   RVAERLAITAGRNPHNEHYLATKVGKLGHMMALGDPAARDDREH"
FT   gene            139207..140268
FT                   /locus_tag="Csal_0116"
FT   CDS_pept        139207..140268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0116"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57480"
FT                   /db_xref="GOA:Q1R1C8"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R1C8"
FT                   /protein_id="ABE57480.1"
FT                   /translation="MPLQNDRLLRALARQPVDRTPVWMMRQAGRYLPEYRETRGQAGSF
FT                   MDLCRNAELACEVTMQPLRRYALDAAILFSDILTIPDAMDLGLYFETGEGPKFRKTVRS
FT                   AEAVDALPVPDAERDLDYVMNAVRTIRHELADSVPLIGFSGSPWTLATYMIEGGSSKDF
FT                   RHAKALMYGDPAAMHALLDKLARSVTDYLNAQIRAGAQIVQIFDTWGGVLSTPAYREFS
FT                   LAYMARIVEGLIREHEGRHVPVILFTKQGGQWLETIADSGADAVGLDWTTELSDARARV
FT                   GDRVALQGNLDPNVLFASPQAIRDEVARILASYGSGPGHVFNLGHGVSQFTDPDHVAAF
FT                   IEALHELSPRYHG"
FT   gene            140261..140740
FT                   /locus_tag="Csal_0117"
FT   CDS_pept        140261..140740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0117"
FT                   /product="putative thiol-disulfide oxidoreductase DCC"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57481"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C7"
FT                   /protein_id="ABE57481.1"
FT                   /translation="MAERAMLLVLDAECPLCRRAAHFVLRHARAPVYLASLHDATARRL
FT                   GEHFGVDSGQLDSVWLVREGELHRDSAALWRLAQGLRWPWRGLAGLRWLPRAWRDGAYH
FT                   AVGRRRHRLAPATDWSREVEGHWVARLDASVCRRLALPRALASDDAAPVHSSSGA"
FT   gene            140744..141112
FT                   /locus_tag="Csal_0118"
FT   CDS_pept        140744..141112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0118"
FT                   /product="VanZ like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57482"
FT                   /db_xref="GOA:Q1R1C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C6"
FT                   /protein_id="ABE57482.1"
FT                   /translation="MRVSLRHLRRLCLALAVVSAAVIAWGSLTPGADMPQELPWDKFNH
FT                   FIAYAGLAALLRLGGLRAVTALGLAIGYGLLVEGLQLGVPGRSGADGADALANALGALA
FT                   AVAACRWLLPRRFLVAHG"
FT   sig_peptide     140744..140824
FT                   /locus_tag="Csal_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.730 at
FT                   residue 27"
FT   gene            141196..142074
FT                   /locus_tag="Csal_0119"
FT   CDS_pept        141196..142074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0119"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57483"
FT                   /db_xref="GOA:Q1R1C5"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C5"
FT                   /protein_id="ABE57483.1"
FT                   /translation="MTRIPMTERLDQGWFTEVFDSHGSAFSLMIKDKLHEVQSPYQHLE
FT                   VYATETYGNLMVLDGCVMLSTRDNFLYHEMMAHPALFAHAAPKRVVIIGGGDCGTLREV
FT                   LKHPGVEQVVQIDIDEEVTRASQRYFPELTASNDDPRATLKFEDGVKWVESAPEGSVDV
FT                   MIIDSTDPVGPAEGLFEVDFLTRCHRLLADGGVLVQQSESPLYHTGSIIRELRADMQRA
FT                   GFDSVATLPFPQPVYPSGWWSATLAGKGSDVTRFRERDAAAVEFPLEYYSVETHRGALA
FT                   LPPFMRRALSA"
FT   gene            142200..143228
FT                   /locus_tag="Csal_0120"
FT   CDS_pept        142200..143228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0120"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57484"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C4"
FT                   /protein_id="ABE57484.1"
FT                   /translation="MLYKNKFIVAVPAALLLSGFATASQAATLDDVKERGNLNCGVNVG
FT                   LAGFSAPDADGNWQGLDVETCRGIASAIFGDPDNVVFTPLTAKERFTALQSGEIDVLSR
FT                   NTTWTATRDNSLGLNFTATTFYDGQGFMVSKDLNIESLEGLNGASICIQSGTTHELNLA
FT                   DYFPSRDIEIKTVTFDTPDQTAQGFAHGRCDVLTSDTSQLSALRLQLPEPDSVEILETL
FT                   ISKEPLGPVVRQGDDQWLDIVQWTIFAMVNAEEMGVNSDNVDEMRDNPPNPGVARLLGK
FT                   DGNYGEQLGLPNDWAYNIIKNVGNYGEVFATTVGEDSPLKIQRGMNALWNEGGILYAPP
FT                   IR"
FT   sig_peptide     142200..142280
FT                   /locus_tag="Csal_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 27"
FT   gene            143381..144559
FT                   /locus_tag="Csal_0121"
FT   CDS_pept        143381..144559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0121"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57485"
FT                   /db_xref="GOA:Q1R1C3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C3"
FT                   /protein_id="ABE57485.1"
FT                   /translation="MSRSPSGDRVALWRNPTFRALLLQGVLLAALVALIAFIVGNTMAN
FT                   LEARGITTGFGFLDERAGFSIPQTLIEFSGDSTYGRTFLVGLLNTLLVSAMGIVAATII
FT                   GFAVGIARLSPNWLLARLAGAYVEIFRNIPLLVQILFWYFAVLQALPSPRDSLSLMEVV
FT                   FINVRGLVIPDPQPLSGFAATPWALLVGIVAAIALGIYAKRRQARTGQALPIYWLGAGL
FT                   IIGTPLAVFLLTGAPLEWSIPELKGFNFSGGVTVIPELAALWLALSIYTASFIAEIVRS
FT                   GILSVPSGQVEASRALSLPEAITLRKVVIPQAMRVIVPQLTSQYLNLIKNSSLATAIGY
FT                   PDLVAVFAGTTLNQTGQAIEIVAMTMAVYLTISLIVSALMNMYNARTLLKER"
FT   sig_peptide     143381..143515
FT                   /locus_tag="Csal_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.935 at
FT                   residue 45"
FT   gene            144561..145670
FT                   /locus_tag="Csal_0122"
FT   CDS_pept        144561..145670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0122"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57486"
FT                   /db_xref="GOA:Q1R1C2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C2"
FT                   /protein_id="ABE57486.1"
FT                   /translation="MSGEFMRDEMIEARRPPDARRGIWRWFHRNLFNGPINSVVTVVTI
FT                   GLLAWGLWPFVQWALIQADWIGDSRQACSGEGACWVFISARFESIIYGFYPEAARWRVD
FT                   IVFALMAGLLAWLAIPRVPGKRWAAVIAVIGFPIAAYVLLLGGHFGLIYVPTREWGGLM
FT                   LTLTVATIGIVGSLPIGIVLALGRRSNLPFVRAVSVVFIEFWRGVPLITVLFMASVMLP
FT                   LFVPTQVEFDKLLRALVGIMLFWSAYMAEVVRGGLQAIPSGQDEAGKALGLGYWQRMGL
FT                   IVLPQALKLVIPGIVNTFIALFKDTSLVLIIGLFDLLAIIRAGLTDSDWLGFATEGYVF
FT                   AALVFWVFCFSMSRYSQYIERRLQTGHTS"
FT   gene            145718..146485
FT                   /locus_tag="Csal_0123"
FT   CDS_pept        145718..146485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0123"
FT                   /product="L-glutamine ABC transporter ATP-binding protein /
FT                   L-aspartate ABC transporter ATP-binding protein /
FT                   L-glutamate ABC transporter ATP-binding protein /
FT                   L-asparagine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57487"
FT                   /db_xref="GOA:Q1R1C1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C1"
FT                   /protein_id="ABE57487.1"
FT                   /translation="MSQATATSHGDTPMIEMTGLNKWYGDFHVLRDIDLTVARGERIVI
FT                   CGPSGSGKSTLIRCINHLESHQQGEIVVNGVPMTQDVKRIEQIRRNVGMVFQHFNLFPH
FT                   LSVLENCCLSQTWVQKKPRAEAEKTAMEYLERVQIADQAHKYPGQLSGGQQQRVAIARS
FT                   LCMRPEVMLFDEPTSALDPEMIKEVLDVMIELAREGMTMLCVTHEMGFAKTVADRVIFM
FT                   DQGQIIEEAPPETFFNQPRSERTKLFLSQILGH"
FT   gene            complement(146520..147014)
FT                   /locus_tag="Csal_0124"
FT   CDS_pept        complement(146520..147014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57488"
FT                   /db_xref="GOA:Q1R1C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1C0"
FT                   /protein_id="ABE57488.1"
FT                   /translation="MRDFIMMRRPLPRRTLIFSHCLLQLGLLLAGGVWLWRHSPSVSGA
FT                   SWQASWPMMALGGGALLLAMALLRLLAELWMAPHHMLARRGGFAPGDVMTRAIDRRPAM
FT                   HDPEQSWIGTARPLDPDEGVVGQARVTQPRQPLAARHDTTSRQDAAPQRADASQRQEPT
FT                   L"
FT   gene            147278..147712
FT                   /locus_tag="Csal_0125"
FT   CDS_pept        147278..147712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57489"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B9"
FT                   /protein_id="ABE57489.1"
FT                   /translation="MNKRYIVTANAARARIFAHQAGVVREVETLVHPEGRLHTGDLRTG
FT                   GKGEADDSATHSPRQSGNDDATMEKHAAFFAKEVADYMRQARTQGKADEFIIAAAPHFL
FT                   GLLRQKLDKPTQECVIHTLDKDLSGASEEDLAEKFRPPLG"
FT   gene            147812..149653
FT                   /locus_tag="Csal_0126"
FT   CDS_pept        147812..149653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0126"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57490"
FT                   /db_xref="GOA:Q1R1B8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B8"
FT                   /protein_id="ABE57490.1"
FT                   /translation="MFTSLRTRIMVACVAMILVALAVTGGVSYWLVSQQQRATNIDMLS
FT                   AVARGNVDAIADWATSKKRLIEALPPALDNDDFVPALQQTAAAGGFSQVYVGLPDKRLI
FT                   TNDNWQPPEDYDPTQRPWYQSAVETGDTVVSPPYLDMVTDSLVVAFTTPVIEDGETRAV
FT                   IGADVSLADVTANVTSIHPTPSSFAMLVNRDDNIVAYRDADLMLESASALDETLTPAWL
FT                   DTLIDDGEPRETVIEGRDVLVYGVPVPGTNWRLLIALDQAEANAGVQGVLHSTLVAMVL
FT                   SGLIAALLLWTLLSPIFRRLRQARDAMFDIASGEGDLTRRLEIDGRDEVAQIAQGFNGF
FT                   ADTVNDVLLEVRASSSSVNEASSEIANGSQDLSRRTEQAASNLQETSTAMEQIASTVEN
FT                   TAQSARQADQLSQEATSAANRGGEIARQAVNTMEAVDAQTTQISDIVRLIDEIAFQTNL
FT                   LALNASVEAARAGEQGRGFAVVAGEVRQLASRSASAAADIKKLIDTSVAQTREGTDLVR
FT                   TAGDSMQEIVTAVARVSDVLAEINAATQEQSQGVTQVNQAVNDLDQMTQHNASMVEEST
FT                   VAAEQMRDQAARLAEVVGRFNLREDGHAQTRPALPQS"
FT   sig_peptide     147812..147880
FT                   /locus_tag="Csal_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.705 at
FT                   residue 23"
FT   gene            complement(149760..150686)
FT                   /locus_tag="Csal_0127"
FT   CDS_pept        complement(149760..150686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0127"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57491"
FT                   /db_xref="GOA:Q1R1B7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B7"
FT                   /protein_id="ABE57491.1"
FT                   /translation="MRYTLRQLEVFVAIAQHESVSLAARRLAMSQSATSTALAELERQF
FT                   DCQLLDRIGKRLKLNALGFQLLPKAVALLDRGEEIEELLKGQRGIGSLDVGATLTIGNY
FT                   LATLLISDFMRRHPGSRVRLHVRNTASIVDRVTHHDLDLGLIEGDCQHDDIVMQPWVED
FT                   ELTVFCSPRHPLANAGEADLEALMREDWIMREEGSGTRRTLDQAMRHRRGRLNVLLELE
FT                   HTEAIKRAVESGLGIGCVSHLALRDAFRRGSLVPIATPELDLTRQFTFIWHRHKYLTTA
FT                   MREFLRLCREMTAGVQRSDEIDLPAVP"
FT   gene            150829..151605
FT                   /locus_tag="Csal_0128"
FT   CDS_pept        150829..151605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0128"
FT                   /product="Oxidoreductase FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57492"
FT                   /db_xref="GOA:Q1R1B6"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B6"
FT                   /protein_id="ABE57492.1"
FT                   /translation="MSKLALEEVLSVHHWNDTLFSFRTTRERSLRFKNGQFVMIGLEVD
FT                   NKPLLRAYSIASPNYEDHLEFFSIKVPDGPLTSRLQHLKVGDQVMVSRKPTGTLVVDDL
FT                   LPGRNLYLLSTGTGLAPFMSLIQDPEVYERFEKIVLVHGVRSVSELAYADFITQDLPAH
FT                   EYLGDEIREKLVYYPTVTREEFHTMGRLTDHIRGGRIFTDTGLPELDPKQDRAMICGSP
FT                   AMLDETSAMLDDMGFNISPRMGEPGDYVIERAFVEK"
FT   gene            151845..152549
FT                   /locus_tag="Csal_0129"
FT   CDS_pept        151845..152549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0129"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57493"
FT                   /db_xref="GOA:Q1R1B5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B5"
FT                   /protein_id="ABE57493.1"
FT                   /translation="MRDAIIELIVEGVLPEGTKLPTEQALASALPLSLGTVQKALRDLV
FT                   ESGDLYRKRRLGTFVAGGDHRRQISTPAFIFMRPDETPVKMVFIRLLKRERVYREGPWS
FT                   QSLGHCETGYIRLTRLDRIDGAFDCHTVIYLRDDVAGELMEIDAEALEHESVLPLLQAR
FT                   GRVARFTAENRVRVMRLPRAVAGMIAPDGEADAWGIKLETHYLQHAETPIAWQVMHIPL
FT                   NDYRLVFATGHS"
FT   gene            152801..153121
FT                   /locus_tag="Csal_0130"
FT   CDS_pept        152801..153121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0130"
FT                   /product="Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57494"
FT                   /db_xref="GOA:Q1R1B4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B4"
FT                   /protein_id="ABE57494.1"
FT                   /translation="MKWTTVCKRDQVQEDFPFSAKVDDKEVGIYLLDGEYFALEDVCPH
FT                   AYALLSQGFVEDGMVECPLHEAAFDIRTGKCLREPGERDLDVYPVRIVDDHVQLNMNEQ
FT                   GA"
FT   gene            153125..153430
FT                   /locus_tag="Csal_0131"
FT   CDS_pept        153125..153430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57495"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B3"
FT                   /protein_id="ABE57495.1"
FT                   /translation="MAERQYNDQLNQWANIIPSSEAGQGHIERPGGFDNRVWQTRSRAP
FT                   EAFELALLEALEAVFEGGATELEAVVDGLNARQCFDRDGLAWSQDSFLREMAVLGH"
FT   gene            153481..154512
FT                   /locus_tag="Csal_0132"
FT   CDS_pept        153481..154512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0132"
FT                   /product="Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57496"
FT                   /db_xref="GOA:Q1R1B2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B2"
FT                   /protein_id="ABE57496.1"
FT                   /translation="MNDLSLTDSAIQDYLDAGLRSLWYPVVASWEVGSEPLGITRLGEN
FT                   LVLWRDHQGEIHAIEDRCPHRGARLSMGWNLGDRLACWYHGVEVDNAGVVRDVPAIANS
FT                   PLVDKPCVRRYPVQEANGAVFVYFAATADETPAPLTLPEQLADETAYANFVCTASWQCN
FT                   YQYAVDNVMDPMHGTYLHANSHSMAEGDRQAEMALEPTDSGFIFKKTGQTGVNFDWVEY
FT                   GNTGAMWLRLSIPYKQRFGPGGPFWIIGMATPEDSEHCRVFFWRVRRVEGWQRQVWRFF
FT                   YRTKLEGLHWDVLEQDRLILEDMAPCARDHENLYQHDVGLSRLRRVMRKAAKQQLSRRQ
FT                   EVA"
FT   gene            154514..155284
FT                   /locus_tag="Csal_0133"
FT   CDS_pept        154514..155284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0133"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57497"
FT                   /db_xref="GOA:Q1R1B1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B1"
FT                   /protein_id="ABE57497.1"
FT                   /translation="MRSGLAGKRVLITGAARGLGRSIAEAAAEQGARLVLSDILTEELA
FT                   QVAESLRERGADVETQPMDQGDEDSIRNAMAAIGAGGALDGLVNNAALATQVGGKTLVD
FT                   YDPALWDRVMRINVRGLWLVTREAIPLLSREADAGSARAKIVNLASDTALWGAPRLMAY
FT                   VASKGAVIAMTRSMARELGEQGICVNAIAPGLTHCEATEYVPAERYAHYAAGRALPAEQ
FT                   QPGDIDGTVLYLLSEWSDFVTGQLIPVNGGFVCR"
FT   gene            155311..156117
FT                   /locus_tag="Csal_0134"
FT   CDS_pept        155311..156117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0134"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57498"
FT                   /db_xref="GOA:Q1R1B0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1B0"
FT                   /protein_id="ABE57498.1"
FT                   /translation="MADDETRKYVIPGLERGLTILMALSRSHREMSLAEIVKCVEWPKA
FT                   SVYRAVQTLEYMGFVRRHPSSGLYSLGVSVLRLGFEYVSSLDLVQVGQPVIESLRDRSG
FT                   CSSHIVIRDGRDVIYVARVSAAGTTTHRVSVGTRLPVHRTSLGRVLLTGMSREAFERLY
FT                   PDPELPDTRPGAPADREALWQLVQDDRARGYVVGESFFQLGISSIVYPLFTQEGDVAGA
FT                   ISIMVPVHEIPAEDRERLRGYVEDAAMTISEMLGYHDPRARRSDMP"
FT   gene            156283..157227
FT                   /locus_tag="Csal_0135"
FT   CDS_pept        156283..157227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0135"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57499"
FT                   /db_xref="GOA:Q1R1A9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A9"
FT                   /protein_id="ABE57499.1"
FT                   /translation="MSIVGIEELEFGVEDTEKGKRFAADFGLRPRQQDGDQAVSDTFEA
FT                   LNGARLRVRAVDDVDLPEAFESGSTLRRMTWGAASSEALQTLRERLADQPGFVDHGDAL
FT                   ECRDPNGLTVRIRVSTLRDVELEVPAINQWGDIRRVDQPSPVYEAAHPVGIGHAVFFVD
FT                   DLTATEHFYRECLGFHVSDRYIDRAVFLRMQARGGHHNLFLLKVPHRGRGLNHVAFTVR
FT                   DIHEVIGGGLAMTRQAWTTFIGPGRHPISSAYFWYVNSPLGGAFEYYTNEDFLTEAWSP
FT                   RELEHSLASFTEWAVEGGIDIETRRQKAPHERA"
FT   gene            157230..158429
FT                   /locus_tag="Csal_0136"
FT   CDS_pept        157230..158429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0136"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57500"
FT                   /db_xref="GOA:Q1R1A8"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A8"
FT                   /protein_id="ABE57500.1"
FT                   /translation="MSEPISRIVVIGGGQAAGWACKTLREEGFGGTLTVVADEPHDFYE
FT                   RPPLSKAVLSGDASLPRLFPEDDVAGWSIDWRRPKRATHIDSHAHTVTLDDGERLAYDR
FT                   LLIATGATPRLPDPRWAEHDDVLTLRSWDDAQRLKRRLADARRLAVVGGGWIGLEVAAT
FT                   ARRLGLEVEVFERQAALCARSVGPEVSEALAALHLRENVALRLNCGDVAITPLASGVRI
FT                   TSDVHDTQADLAVVGTGVDFGLELAREAGVATQQGIVVDQAGATSVADIFAAGDVTQHP
FT                   VLGQCLQSWGYAQNQAIAAARGLLGKAAAYDDPAWLWSDQYGTNIQILGTPCPDTRCVV
FT                   RQEPLGTSFFYLDAADRLCQAVTFDQPRHIKLAKRWLAARRVLDPDMLGDPTSNLMRLR
FT                   "
FT   gene            158478..159761
FT                   /locus_tag="Csal_0137"
FT   CDS_pept        158478..159761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0137"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57501"
FT                   /db_xref="GOA:Q1R1A7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A7"
FT                   /protein_id="ABE57501.1"
FT                   /translation="MTTTTASSQSSAPAAETPDDVQHAGIKRWAIPFALLCCVILSFFD
FT                   KISIAVLLSSPAFQGALGVEGETTKLGFLMTGFLLSYGFSSMFLGFLSDIISPKKCLYA
FT                   MLVLTAVIMTIMGFAESYAQMLTLRIVLGIAEGPMFAIAYTIVKRTFAPREQARATMLW
FT                   LLGTPIGASIGFPFTIYILDNFGWRATFFAMALLTIPLLMLVVWVFRKVDVSTKSPLQK
FT                   ARGDKHVPLSSHRQSTRELFGNLSFWAICVFNIAFLAYLWGLNSWLPTYLVEDKGIDLD
FT                   SAGIFSSLPFIAMLVGEVVGAFVSDRFDKRALMCAFSLFGAGLGLLLVLSIDASNIAMI
FT                   SAMSFSAMCWGVGAPNIFALLAKATPAKVSATAGGILNGFGNFSGALTPVIIGALIAST
FT                   GNMTAGLLFMAVLAFAGGAVLLPLVRRY"
FT   gene            159826..160350
FT                   /locus_tag="Csal_0138"
FT   CDS_pept        159826..160350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0138"
FT                   /product="Cupin 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57502"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A6"
FT                   /protein_id="ABE57502.1"
FT                   /translation="MTQSIATWKRPEDMSFSDWIESRVARFAGRKYDWNALKFQADFDP
FT                   KYRRAQMRYIGTGATGVADDSNTIPAEHFTFSTMVLPSQCEGPLHVHDDVEEVFFVLKG
FT                   RIRLYLKEGDNYTETVLHERDVVSVPPGIYRGLLNESEEEALMCVMLGTPKPQIPTYPD
FT                   DHPLSKIKRQS"
FT   gene            160347..161201
FT                   /locus_tag="Csal_0139"
FT   CDS_pept        160347..161201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0139"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57503"
FT                   /db_xref="GOA:Q1R1A5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A5"
FT                   /protein_id="ABE57503.1"
FT                   /translation="MNVPDDALEAAEVQCREVSLASGRQAFCDMGSGIPVVLLHGISSG
FT                   ARSWAPLMHQATGVRWLAWDAPGYGESSALAEPHPTARDYALRLAAWLEALALERVVLI
FT                   GHSLGALIASAYARDFPDRVSGLLLADPAQGYRHADPDKRDAVYRSRWTQLAAQGHAAY
FT                   AAARAPRLLRENARVEDIARVQAGMHRLEVSGFAQASWMLANDSLEDHASGTSVPTRVL
FT                   CGDEDRITPPSGARALAERLGVAYRDIPCAGHISYIDAPAAFAAAVADFMATLSPSQEK
FT                   SDL"
FT   gene            161198..161992
FT                   /locus_tag="Csal_0140"
FT   CDS_pept        161198..161992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0140"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57504"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A4"
FT                   /protein_id="ABE57504.1"
FT                   /translation="MSFQIERRVAVVTGGSSGIGLETVRLLLESGASVAFCGRDASRLE
FT                   AARDRLAEAHPEGEIFTAPCDVLDAEACREFAAQVEARFGGIDMLIANAGQGYVAHLDE
FT                   TPDTAWLDETNLKLRGVLNPLAAFRGALRDSDIGSLTCVNSLLALQPEPHMIATSAARA
FT                   ALLNLTHSLAHELIAEGIRVNSILLGMVESGQWRRRFEQREDRSQSWQEWVAGIATKRG
FT                   IPMKRLGRPEEPARALVFLASPLASFTTGAALDVSGGFNRHL"
FT   gene            162007..162804
FT                   /locus_tag="Csal_0141"
FT   CDS_pept        162007..162804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0141"
FT                   /product="aspartate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57505"
FT                   /db_xref="GOA:Q1R1A3"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR020626"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A3"
FT                   /protein_id="ABE57505.1"
FT                   /translation="MTAKTVMMIGYGAMGRAVHELLPSGLALRWVVVPELSVAETVARL
FT                   GQDVEVMTSVDTCRERPDLVVECAGQAGLAEHGGAVLARGWSLAVVSVGALADDALYGR
FT                   LHDAARRSGGKLHVLAGAVAGMDGLAAAREGGLESVTYEARKAPASWRGSHAEELVDLD
FT                   AVTQPTVFFEGSAGDAARRFPANANVAATVALAGLGMENTTVRLTVDPDTTRNTHRIHA
FT                   RGHFGEFEIELSGYPLASNPKTSTLAALSVVRACRQVLEPVVV"
FT   gene            162832..164301
FT                   /locus_tag="Csal_0142"
FT   CDS_pept        162832..164301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0142"
FT                   /product="Aldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57506"
FT                   /db_xref="GOA:Q1R1A2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A2"
FT                   /protein_id="ABE57506.1"
FT                   /translation="MTMHKIFIAGEWREGRGEPLISTFPADGSINAELNAASLEDVDDA
FT                   VAAADRAWREPAWRDLPPHRRADVLYRVSRLIEARCEALAALQTRDNGKPLAEARGLVM
FT                   SAAGTARYFAAACETLEGELPTPRSADVMTFSHYEPLGVIAAITPWNSPIASEMQKVAP
FT                   ALAGGNAVILKPAEATPLMALELAALFEEAGLPKGLLSVLPGKGRVIGEALARHPGVRR
FT                   ISFTGGTETGRHLAHVAADKLISTSLELGGKSPTIVLPDADMEQAAKGVAYGIFSSAGQ
FT                   ACIAGSRLYVHADCYTAFMERLEEITRGLRVGHPETPGTHLGPLINIRHRDSVAAYVDQ
FT                   ARQDGGHVRIGGQVPTDPSLAAGSYYLPTIIEGLAPTSRVCREEIFGPVLVAAPFDDED
FT                   DLVAQANDSVYGLAAGIWTRDYRDALRLGARLEAGTVWVNTYKTFSISTPFGGFKESGL
FT                   GREKGRQGIHAYMQQKSFYLGLGQTPNPWCD"
FT   gene            164363..166003
FT                   /locus_tag="Csal_0143"
FT   CDS_pept        164363..166003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0143"
FT                   /product="thiamine pyrophosphate enzyme-like TPP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57507"
FT                   /db_xref="GOA:Q1R1A1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A1"
FT                   /protein_id="ABE57507.1"
FT                   /translation="MSTPNTVGDAIVETLIQQGVSAVYGVISIHNLPIADAIGRHEALR
FT                   FVPARGEAGAVTMADAHGRQRGLGVALTSTGAGAGNAVGALLEALNAGAPLLHITGQVE
FT                   RDYLGRESGFIHETQDQIGFLRACSKRAYSAHTAEQVVPVLRRAMRDAMTPPMGPVSVE
FT                   IPIDLQGATIESQTLGYAVARAAAPTFDEGGFASLVERLKQARRPMLWVGGGALQAGDA
FT                   VRRLADAGLPVISSTHGRGILADSHPRSLRAFHNAAAVEELLAQSDLLIVAGSKLRSNE
FT                   TKTFTLPLPRPLVQIDIDPAACHRTYLVDEFLEGDCTEVLEALAEHFEATRLGDDDYDT
FT                   EVARAVAAAERALRQQMGPYAELCDALRRALPGDGILVRDITMSGSTWGSRLFPIETPN
FT                   TNVHSLAGAIGMGLSMAIGSAVAKPTCKVVGLVGDGGLMLGVGELATMVQENLDMTLIV
FT                   MNDGGYGVMRGIQRNHFSDRQYYNELLTPSFTRLADAMGLPHWHLSSADEAARVLQDAV
FT                   AHAGPALVEVDMASFGELVFAGPPQKKLY"
FT   gene            166260..167510
FT                   /locus_tag="Csal_0144"
FT   CDS_pept        166260..167510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57508"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R1A0"
FT                   /protein_id="ABE57508.1"
FT                   /translation="MNPVAMTSTPILACWTLSLFGAASIAHAAPADEATPPVREDAPTT
FT                   PQTAQSWADALELGGALRFNHRYEDWSSSDKQQGGGDIDFDAFYLDLEAEKDDLFLDLS
FT                   YWFKDNDVRVLEHGFFGYRFSSRSRLEMGATFEPFGIMPYPQFGWTFNIPFYLGMGHNT
FT                   ALGAKYVYEGPEWEAQVGFFKNPLSLDTRYAPNMASADDVDDAFLAPTNSGQANEKQNQ
FT                   LSGRLVRTFQGDGWESRLGASAYVGQLHNDTTDRNGSYWGTELHALTTFGPWQVQLQGI
FT                   RYVFDPENPEGVSDDSVLFAGPGTPSYRVAAKGTVGVLNIAYDLPTPRLGPVKKLRFYN
FT                   DYSRLVKDRSGWDDSQMETVGVQFFALPVMGWLDVTWGKNMNMMGGMPGGVGLASADAE
FT                   GSGEWELRTNLNIGYYF"
FT   sig_peptide     166260..166346
FT                   /locus_tag="Csal_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(167567..167965)
FT                   /locus_tag="Csal_0145"
FT   CDS_pept        complement(167567..167965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0145"
FT                   /product="protein of unknown function DUF1232"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57509"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R199"
FT                   /protein_id="ABE57509.1"
FT                   /translation="MTSSHEPVDTLPVPATASVAPEDVAAYEETFREPRFWHKITRYGR
FT                   RAGREVTRRALQLYFVMQRPDVPLWAKSTILGALGYFISPLDAIPDLIPAGGYVDDASV
FT                   LGAALIAVSVYIDDDVKARAEQAMPKWL"
FT   gene            complement(168112..168387)
FT                   /locus_tag="Csal_0146"
FT   CDS_pept        complement(168112..168387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R198"
FT                   /protein_id="ABE57510.1"
FT                   /translation="MEIIIENAGMEADEFHAMAGGETGEALRKTAKNYLGSQNVTEHQL
FT                   EELRMAGGEDYEALRRDMTRHALSVVNVPQDAAISLDIAFKGGAKA"
FT   gene            complement(168507..169256)
FT                   /locus_tag="Csal_0147"
FT   CDS_pept        complement(168507..169256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0147"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57511"
FT                   /db_xref="GOA:Q1R197"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R197"
FT                   /protein_id="ABE57511.1"
FT                   /translation="MNILIVHCHPEPRSFNAALSDIAMTSLTREGHEVHVSDLYAEGFD
FT                   PVERASHFESRADPEYFSALTEQRHHVQSGTLPCDVQREIDRLQHADLVILQFPLWWHA
FT                   QPAMLKGWFDRVFVYGGLYSGTRRYDRGPLQGKRAMCSVTTGAPEPTFSPTGRSGDIVS
FT                   LMWPLHCSLYYVGFDVLPPQITYGVQGGGLSYQEDAAFQCHLEDAKQQWSQRLRHWQTD
FT                   RPIPFTGWQDWNAQGETLPEHPLRWRI"
FT   gene            169302..170225
FT                   /locus_tag="Csal_0148"
FT   CDS_pept        169302..170225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0148"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57512"
FT                   /db_xref="GOA:Q1R196"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R196"
FT                   /protein_id="ABE57512.1"
FT                   /translation="MEEIKFPTNESGLCMNEKGVPWEDLKIVQAIADSGSLAGAGRTLG
FT                   ISHATVFRRLGALESRLGVRLFERHRTGYVPTLAGDDLATTAARVALDIEAVERRLMGR
FT                   DARLSGTLRVTTTDTLLMGMLSDELAGFQRTYPHIVLEVEVSNRTYDLSRRDADVAIRP
FT                   TSAPPETLIGRQVGQIAQAVYVSRCHRETSGWVGPDPHLGYPVLERWMARQGVDAQCRY
FT                   HVDSMLGMLAGVRSGMGRGVLPCYLADMADDLVRASEPLPELQTELWLLTHPDLRNTAR
FT                   VQALFAYLSDSLKARQASLLGTMAAS"
FT   gene            complement(170232..171230)
FT                   /locus_tag="Csal_0149"
FT   CDS_pept        complement(170232..171230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57513"
FT                   /db_xref="GOA:Q1R195"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R195"
FT                   /protein_id="ABE57513.1"
FT                   /translation="MVKTARLRAAPGRRVRQSGIYQKAPHAGSTGVFVLSPFALALIVV
FT                   SAALHAGWNLLGKRGVPSLAFFARAMAAGSVLYAPLLLWGPAPMQLPWSFWGWLVATGA
FT                   CQALYMGGLAWAYARGDVSLLYPMARALPVLWVPAVALLVLPTPALDLDDGLGMGLIAI
FT                   SALIMPLTHWRAFRLESYLTPALGFVLLAAAGTTGYSLIDKRALGLMTASGYTPLQAGL
FT                   HYMVLQAMTTWLWMWPLVRALPSERLAARRLRYTSAAHRAWLAGAMILGTYGLVLIAMS
FT                   SSADVSHVVALRQLSIPLGVLAAVYWFKERLPPLRLGAIAIMLTGLALVAW"
FT   sig_peptide     complement(171075..171230)
FT                   /locus_tag="Csal_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.634) with cleavage site probability 0.561 at
FT                   residue 52"
FT   gene            171412..172653
FT                   /locus_tag="Csal_0150"
FT   CDS_pept        171412..172653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0150"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57514"
FT                   /db_xref="GOA:Q1R194"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R194"
FT                   /protein_id="ABE57514.1"
FT                   /translation="MTSLHSQRARLLPALILLVVFAIALCTLSVAEAAPNPRYASIVID
FT                   TENGAVLHADNADAPRYPASLTKMMTLYLLFEAIEDDTLSLESRLPVSQYAAAKPPSKM
FT                   GVTPGETVKVEDAINILIVKSANDVAAVVAEGLAGSESVFAGQMTDKARALGMMDTTFR
FT                   NASGLPDAGQVTTARDMAILALRLMQDFPGYYPYFGKTQFTWQGKRYQGHNRLLDSYAG
FT                   ADGLKTGYIRASGFNVATSAVHDGRRILSVVMGGFTAQSRDAHMRELLDSGFARVASLA
FT                   QGDWVAQADIYGERLQSPASPAPTRDDPIRELIAQAQSEQGDARPTPTAERSTGGAWAV
FT                   QVGAFSDRMRARHQADQAADFLDLGGRVAVSSTQGARSIFRAQLVDLEESQARRSCQQL
FT                   AREGIDCVVVASGR"
FT   sig_peptide     171412..171513
FT                   /locus_tag="Csal_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.705 at
FT                   residue 34"
FT   gene            complement(172673..173386)
FT                   /locus_tag="Csal_0151"
FT   CDS_pept        complement(172673..173386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0151"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57515"
FT                   /db_xref="GOA:Q1R193"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R193"
FT                   /protein_id="ABE57515.1"
FT                   /translation="MPDTPFYLQLCDRLVALIESGELGPASRLPAERLLAERFATTRVT
FT                   LRQALSQLESEGRIHRRNRRGWFVSPPRVDYAPDRDQSFTQYVTAQGRRPFTQVLSVCH
FT                   RPAPPTVAQALAIPPEHTVLQVQRRRYIDDRAVLLERIWLRDDLLPGLSEVDFTASLWQ
FT                   RLHDDYGIDQLRKSLRLYPTALTGTEAETLGVHSGCAGLCVTRTTYDRDGRALEYDEDH
FT                   WLHDAICIRADVDMT"
FT   gene            173556..174971
FT                   /locus_tag="Csal_0152"
FT   CDS_pept        173556..174971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0152"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57516"
FT                   /db_xref="GOA:Q1R192"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R192"
FT                   /protein_id="ABE57516.1"
FT                   /translation="MQETDLGMMDAGQLTALFESGEASPLEATRAALSRIERFNDAVNA
FT                   YVHVDHEGAEQAAKASARRWGQGKPLSPIDGMPVSMKDLTEVAGMPARDGSLTSKETPC
FT                   EHDAPPARMLREAGAIFLGKTNTPEFGWKAVTDNRVFGATYNPWDTRLTPGGSSGGAAA
FT                   AAALNMGVLHQGGDSGGSIRIPAAFTGVFGFKPTFGWTPQWPPATEPSLSHIGPLTRNV
FT                   PDAARMLNVIGRYDYRDPYATRGQPDDWGVDLDCDLRGLRIAYSPDLGYAQVEPQIAAR
FT                   VREAAEKLQALGAEVEEIHPGFESPIAIFQQLWFTASLEVWSRSTEHERTLLDPGLVAN
FT                   ARIAERWSALDFFRALEARARLTQRLEHFNQKYHLLMTPSVAVSPFEANHEVPPGSGMQ
FT                   DWEEWAPFSYPFNLSQQPAASVPCGFTDAGMPVGFQLAGGKFDDIRVLRACHAFMQAHP
FT                   PRFPTVPDPAQQG"
FT   gene            complement(174998..175786)
FT                   /locus_tag="Csal_0153"
FT   CDS_pept        complement(174998..175786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0153"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57517"
FT                   /db_xref="GOA:Q1R191"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R191"
FT                   /protein_id="ABE57517.1"
FT                   /translation="MSDANTSETAAVSIRHLSKSFDDVEVLRDVELEVKTGDVVTIIGS
FT                   SGSGKSTLLRCINWLEQPDRGSIHIAGQRIGVNDAGRPMPVRELAKVRAKTGMVFQGFN
FT                   LWPHLNVLHNVTEAPIHVQGTPRREAEERAMALLEKVGMAHKRDSYPNTLSGGQKQRVA
FT                   IARALAMQPTVMLFDEPTSALDPELVGEVLAVIKDLSAEGYTMIMVTHEMAFARAVSDQ
FT                   VVFLEKGLIIERADPETFFTAPRTDRVRRFLENHDTPSPA"
FT   gene            complement(175779..176444)
FT                   /locus_tag="Csal_0154"
FT   CDS_pept        complement(175779..176444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0154"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57518"
FT                   /db_xref="GOA:Q1R190"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R190"
FT                   /protein_id="ABE57518.1"
FT                   /translation="MSNWDILWEARGEFLIGFWRTLEIFGLSIVGAFLIGCGLLYLLEG
FT                   SRKRLTMPLRIVIDAMRMLPFLILVYLLYYGLPTFGIRLDAWWSGVGALAVYHGMYFAE
FT                   IFRGNRLTFPPGQIEAAKAHGFTKGKMFFRLILPQVIMQTRPLMGNQLIYALKDTAFLV
FT                   IITVRELTAAANSLSSTYFIPTEAFIVVIGFYWALSVAMEIIIKQCGRFGAKRGFDNV"
FT   gene            complement(176455..177096)
FT                   /locus_tag="Csal_0155"
FT   CDS_pept        complement(176455..177096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0155"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57519"
FT                   /db_xref="GOA:Q1R189"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R189"
FT                   /protein_id="ABE57519.1"
FT                   /translation="MNASAWQMLLEGAWTTVWISAVSIAIGVVAGLVIALIRLARIPIV
FT                   DQLLVLYISVARATPLVTLALFIFLSAPDLGLDLNRSVAGILALTLNTTAFNAEIWRSA
FT                   FRNFSRDQREAAMATGMTPWITFRRIMLPQMVITSLPGLVNEMSFLIKGSPAIAVIGIV
FT                   DLTRVTNRISAVTYEPLPPILVAGALYMMVIGCLVWLQRIFERRANRLAM"
FT   gene            complement(177179..178102)
FT                   /locus_tag="Csal_0156"
FT   CDS_pept        complement(177179..178102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0156"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57520"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R188"
FT                   /protein_id="ABE57520.1"
FT                   /translation="MLPTTRYAGRPMDSTLRHRVSRTRVSRTLAATVAGALMSLSLPAL
FT                   AADLAEIQERGYMEVATEDNYAPFNFIENGEAKGFNADMLEELRDYADFEIRQEILPWT
FT                   GLLAAVSNDQYDMALTGASVSDERLRVFNYTPPYASAQHFYIKRADDDSLQSVADLSGK
FT                   TLGVQAGSVLLSRLPELEQMLEEQDGELGEVVEYESYPEAFADLANGRLDYVIDSAVPV
FT                   NTLVASKPEIFAKGQAVSGAGYVSWPIPKDSPELLDYMTEFLAHMQESGRLAELQEKWF
FT                   GESFSDLPSKPLTSVEQFHELAGLDD"
FT   sig_peptide     complement(177962..178102)
FT                   /locus_tag="Csal_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 47"
FT   gene            178356..179816
FT                   /locus_tag="Csal_0157"
FT   CDS_pept        178356..179816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0157"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57521"
FT                   /db_xref="GOA:Q1R187"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R187"
FT                   /protein_id="ABE57521.1"
FT                   /translation="MLDHYFHLDFDAQRGLQEQLREALLDAIHTGTIPADEALPSCRRL
FT                   SLQLGISRNTVALVYEGLVEDGYLVSRPRSGYYLHDAYHDSDALELAQTTRQPVRDAPS
FT                   WSKRFTHRPSHLQGVLRPSNWMDYEFPFVYGQLDTRLFPLEQWRETSRRLLGGNRERHW
FT                   LSDRYDQDDPMLIEQLRTRVLPKRGIHAQSDEILVTLGSQNALFLIAQLLFDRKTRVAV
FT                   ENPGYREAVNVFLRQGAQLHYQHVDGEGMQLDAETPRCDYLYVTPSHQGPTGATMSRER
FT                   REQLIKQIQRFDQIVLEDDYDAEVNFDRHAQPALKASRAGGRVIYMSSLSKPLSPGLRL
FT                   GYLVADAELIDELRALRRLMYRHPPSSLQQQLAQFLAQGHYDRYLRQFADEMRHRWECM
FT                   NDAIARHLPGCRRVGGDHASVFWLEAPENVDTQRLAWQAAQNGVLIEPGFQHFFERVPP
FT                   RNFMRLGFGAIEGERIAPGIERLAQTLG"
FT   gene            complement(179903..181219)
FT                   /locus_tag="Csal_0158"
FT   CDS_pept        complement(179903..181219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0158"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57522"
FT                   /db_xref="GOA:Q1R186"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R186"
FT                   /protein_id="ABE57522.1"
FT                   /translation="MTTTNDLVHQLDRQHVFHSWSRQGQLDPLVIAGAEGCRMWDYAGK
FT                   EYLDFSSQLVNTNIGHQHPKVIAAIKEQAETLATVAPAHANLARGEAAKRILERAPRGF
FT                   SKVFFTNAGADANENAIRMARSFTGRDKILSAYRSYHGNTGSAIAATGDPRRVPNEFAR
FT                   GHAHFFNPYLYRSDFWASNAEEECQRALQHLRRVIECEGPEAIAAILLEPIPGTAGVLT
FT                   PPPGYLRGVRELADEFGILLIFDEVMAGFGRTGRWFAFEHFDVTPDLIVFAKGVNSGYV
FT                   PAGGVVVSDAISRHFDAHMFFGGLTYSGHPLAMAAIVATLDAMREEGVVENAARIGDGV
FT                   LGQGLERLAHRHAIVGETRGLGVFHALELVSDRERRTPLAADAMNEIKHALLAEGMLPF
FT                   VAGNRIHVVPPCIIGEDEVEQGLATLDKVLGEVSAKYAA"
FT   gene            181533..183686
FT                   /locus_tag="Csal_0159"
FT   CDS_pept        181533..183686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0159"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57523"
FT                   /db_xref="GOA:Q1R185"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R185"
FT                   /protein_id="ABE57523.1"
FT                   /translation="MSGKCPVMHGGNTSTGTSNKDWWPEGINLDILHQHDRKTNPMDPD
FT                   FNYREEVKKLDVQALKNDLRQLMVDSQAWWPADWGSYVGMFARVAWHSAGSYRLADGRG
FT                   GGGTGNQRFAPLNSWPDNVNTDKGRRLLWPIKKKYGNKISWADLMVLSGTIAYEVAGLK
FT                   TYGFAFGREDIWHPEKDIYWGDEKEWLAPSDERYADVEKPDTMENPLAAVQMGLIYVNP
FT                   EGVNGQPDPQKTAEQVRETFARMAMNDEETAALTAGGHTIGKCHGNGEAENLSAEPEAA
FT                   DVEYQGIGWMNTKGRGIGRDTVVSGIEGAWTKNPTQWDMGWFDMLFNHEWELKKSPAGA
FT                   WQWEPVDIAEEDMPVDVEDPSIRRMPIMTDADMAMKVDPVYNEICRKFMDDPEYFSETF
FT                   AKAWFKLTHRDLGPKARYIGPDVPADDLIWQDPIPAGSIAYCEEVVKQKIAESGLSIGE
FT                   MVSTAWDSARTYRGSDMRGGANGARIRLAPQKTWPGNEPERLAKVLDVYERISAETGAS
FT                   IADVIVLGGSVGIERAAKAAGHDVHVPFLKGRGDATDEMTDAASFAPLEPLADGFRNWQ
FT                   KQDYVVKPEEMLLDRAQLMGLTGPEMTVLIGGMRVLGTNHGGTRHGVFTDREGQLTNDF
FT                   FVNLTDMGNTWKPAGNNVYEIRDRETDAVKWTASRVDLVFGSNSLLRSYAEVYAQDDNE
FT                   EKFVNDFVAAWTKVMNADRFDVA"
FT   gene            183976..184728
FT                   /locus_tag="Csal_0160"
FT   CDS_pept        183976..184728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0160"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57524"
FT                   /db_xref="GOA:Q1R184"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R184"
FT                   /protein_id="ABE57524.1"
FT                   /translation="MPPTLPTLVAAMSLALLAGGVRGYCGFGFAMLLALGLTLFMPPIQ
FT                   AVPLALLLDLVTSLGLWRRALRHADWPCLRPLVLGMAMATGLGVWLLASVPAVPMRIVV
FT                   ALLALSGAVALLCQRDVAAPGRGAQARGVVLGAGGLSGLCMTLASSGGPPLMLYLLYRR
FT                   MPSLSARATAIVFFAASSSASLLGLGLAGALTAGTWQWAAWLLLPALLGNALGQWRFER
FT                   APPRSLKFSVAPLLIALSLWVLLREAIG"
FT   sig_peptide     183976..184032
FT                   /locus_tag="Csal_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.572 at
FT                   residue 19"
FT   gene            184763..185524
FT                   /locus_tag="Csal_0161"
FT   CDS_pept        184763..185524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0161"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57525"
FT                   /db_xref="GOA:Q1R183"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R183"
FT                   /protein_id="ABE57525.1"
FT                   /translation="MTDCVFITGATSGFGRAAAHRFAAAGWSLVLTGRRLERLEALKEE
FT                   LQGRVPVHIIALDVRDSDVVDAAVAALPEGFTRVRTLLNNAGLALAPQSAQHTDRSDWH
FT                   TMIDTNVTGLVNVTHALLPTLIDVGEGATIVNVGSIAGQWPYPGSHVYGASKAFVKQFS
FT                   YNLRCDLLGTGVRVTDLAPGIAETEFTLVRTGGDQAASDALYRGTTALTAEDIAEQMFY
FT                   IATLPPHVNFNRLEVMPTRQAWSAFAIDYDA"
FT   gene            complement(185581..186489)
FT                   /locus_tag="Csal_0162"
FT   CDS_pept        complement(185581..186489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0162"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57526"
FT                   /db_xref="GOA:Q1R182"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R182"
FT                   /protein_id="ABE57526.1"
FT                   /translation="MLHRLEFLDLQAFILVAELGSFHEAAQRLHLSQPALSRRIQKLEE
FT                   ILEVELLERTTRRTRLTPIGTDFLPRARRMIEEYESSILGIRELATHQKGTVTIACIPT
FT                   AAFYFLPSVIRGFSEAWPGIRIRILDVSAKEGLERVISGEADFGINMFSAQSPEVSFTP
FT                   LLKDPFVLALRSDHPLVDKPRIEWSDLEQVRLITVSRDSGNRILLDNTLSAEGIRLNSF
FT                   YEVQHLSTSLGLVESGLGVAILPRMTMPGADHDSLRARELPKPRIQRTIGLVRSNSHSI
FT                   SSTAQLFIDMLLERWGNSACT"
FT   gene            186583..187767
FT                   /locus_tag="Csal_0163"
FT   CDS_pept        186583..187767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0163"
FT                   /product="methylitaconate delta2-delta3-isomerase"
FT                   /EC_number="5.3.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57527"
FT                   /db_xref="GOA:Q1R181"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R181"
FT                   /protein_id="ABE57527.1"
FT                   /translation="MKSALTCSYHDFSTRYGMTMMNSIPCMIMRGGTSRGPFLRMKDLP
FT                   DNQAAQAEILISLMGSGHALQVDGIGGGDPLTSKVAIVERSSHPEADVDYLFAQVDVLN
FT                   RRVDFNPNCGNMLSAVGPYALETGLVALQEGMTTVRVRNLNTQRLIECHVPTPGGQVAY
FT                   EGDTTISGVPGCAAGIQLGFLDIVGTKTGALLPTGNAIDTIDGLQVTCLDAATPIMMVN
FT                   AADLGLSGQESPAELDAHSAMLERLESVRREAGLRMGLGDVSQSVLPKPVLVSAPIDDD
FT                   STLCTRYFVPHRCHKAIAVTGAIAVATAVSVPGTVANRIVVEAGKLEVDGQLSQVSLEH
FT                   PSGFIDLDVEHRNGNPVDIARVSLIRTARKIMSGTLFYSLPSAPGQDMLTSRAS"
FT   gene            187833..188951
FT                   /locus_tag="Csal_0164"
FT   CDS_pept        187833..188951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0164"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57528"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R180"
FT                   /protein_id="ABE57528.1"
FT                   /translation="MPIKKTATACLSLGRLKKALLLGGAIAGLGMTTAVQAQDVEVPGN
FT                   IKWTIPFGVGGGTDVWARFFSPWLSESLPGEPTIMIDNVPGGGSINGANLFAVRAKSDG
FT                   SDWLGTSASTQYPAMLGDPRVRYDYSDWTPILATPTGGVVYAQPSLGESAETALDALLE
FT                   QPVKLAAQNPTGVELPVLIALDMLGADVQAVFGMRSRGEGRLAFERGEADIDFQTTSAY
FT                   LSNVEPLVKAGKAVPLFSLGVLNDEGKIVRDPAFPDLPTFNEVYQARHGEAPSGNEYEA
FT                   FRKFFASGYALQKLIMVPKDTPQALIETYRQAARDFVDTKAFKKAADAQLGPYTPVIGD
FT                   TVQRHLDDAMSIDDATRDWLADWLESEHGAKI"
FT   sig_peptide     187833..187946
FT                   /locus_tag="Csal_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 38"
FT   gene            189031..190980
FT                   /locus_tag="Csal_0165"
FT   CDS_pept        189031..190980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0165"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57529"
FT                   /db_xref="GOA:Q1R179"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R179"
FT                   /protein_id="ABE57529.1"
FT                   /translation="MLDILLSSLGQLFTLSHLLFMVLGVLVGLVVGIIPGLGGIAGMSL
FT                   LLPFLYGMEPAVALGMLMGLVAVIPTGDTFASVLLGIPGSSASQATVIDGFSLAKRGQA
FT                   ARALSSAFLSSMIGGIVGAVILTGFILIARPLVLSFSSSELFMLTLLGLSMVAVLSGRD
FT                   LFKGLAACGLGLLVGAIGMAPATGEFRMNFGLDYLYDGLPLVVVGLGIFALPEIVDLLV
FT                   KRGSIAEEPCELGEGWRAGIRNVREQRGLVARCAAIGSLIGTIPGLAGSVVDWLTYGHA
FT                   VQSAKDKSEFGKGDIRGVIAPESANNACACGAMVPTLLFGVPGSGTAAVFLGGLLLLGL
FT                   QPGVGMIETHLDLTYTIIWSLALANILGAALCLVLARPVASLTRVPFATLAPLITVLIM
FT                   FAAFQATRSTGDLIALGAVGILGVLFKQANWSRPAFLIGFVLAPGAEGYFYQAVQFQGV
FT                   NAFARPGVLIIGALILAALFIPLLRSLWIKRRQAASVGAAATARTEPPTLGGIDVVLFA
FT                   ALLGTAAIAWIDVADLTLIGGIMPRLAIAILAVSCLLEIARCLMHRPQWQPQAIGQQGL
FT                   WLAGFFALVGAMQLLGFITAATLFCLVFLLVIARLKPWVAVIMALGVTAFLAGMAEFLT
FT                   LTYPSGLVDPWLFG"
FT   gene            191207..191947
FT                   /locus_tag="Csal_0166"
FT   CDS_pept        191207..191947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0166"
FT                   /product="dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57530"
FT                   /db_xref="GOA:Q1R178"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R178"
FT                   /protein_id="ABE57530.1"
FT                   /translation="MSRAIEIPAADGTIDAHIFTPEHADGPLPAVVLFTDIGGLRPCYH
FT                   EKAQQIANNGYAVLMPNVYYRDASGHIVPEGKSFRDPDVRPTLLEYAAHLTPEAQSRDF
FT                   AALLDGIDHETEFADGKIAVVGYCMTGAFALRMAAEHADRVAAAAGFHSARLAEANDPN
FT                   SLVNVVDAIEGRVYFGHADKDELLPPDQIARMDEALAAAGVHFTTELYKGAAHGFTAKD
FT                   APSYDAAADALHHKRLSQLLEETL"
FT   gene            complement(191993..192526)
FT                   /locus_tag="Csal_0167"
FT   CDS_pept        complement(191993..192526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0167"
FT                   /product="Cupin 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57531"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R177"
FT                   /protein_id="ABE57531.1"
FT                   /translation="MPAHATTEFWKDLAPIAESFKPDARPEVHIANAPTDDERYYVPFS
FT                   DTVSSRPLWISPSQNRWCDVLMAKGAGLVNRHYHPHEVFAYTISGKWGYLEHDWVATAG
FT                   DFIYETPGEGHTLVAYDHPDPMRVFFIVTGPLIWLDENGDSCGHFDVHDYIALCRDHYD
FT                   KVGLGADLVDSLFR"
FT   gene            complement(192648..193145)
FT                   /locus_tag="Csal_0168"
FT   CDS_pept        complement(192648..193145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0168"
FT                   /product="TspO and MBR like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57532"
FT                   /db_xref="GOA:Q1R176"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R176"
FT                   /protein_id="ABE57532.1"
FT                   /translation="MRAFSTRHQLLGLVGWLVISFITAGIGAIASVDATQFYADLTQPD
FT                   WAPPAGAFGPVWTTLFALMGIAAWLVWREGGWRRHQGALTLFLVHLAVNALWSWLFFVW
FT                   HLGALAFVEVILLWGMILATLIAFWRVRPLAGLLLVPYLAWVSLATALTYTVWQLNPQL
FT                   LG"
FT   sig_peptide     complement(193053..193145)
FT                   /locus_tag="Csal_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.329 at
FT                   residue 31"
FT   gene            193485..194075
FT                   /locus_tag="Csal_0169"
FT   CDS_pept        193485..194075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0169"
FT                   /product="protein of unknown function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57533"
FT                   /db_xref="GOA:Q1R175"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R175"
FT                   /protein_id="ABE57533.1"
FT                   /translation="MNPASLILLAFAMSTDAFAASIGRGAELRKVRLLSALRIGAVFGV
FT                   VEAIMPLLGWALGHVAMRFVSGVDHWIAFVMLALLGGHMIWAGVKKEDCAAIKAAETQP
FT                   ENRSIWLIAFTALATSIDAMAVGITLALTDINIIAASVAIGLATALMVTLGTLLGRAIG
FT                   TIVGKWAEILGGLILIGIGIAVLYEHLAGLASA"
FT   sig_peptide     193485..193544
FT                   /locus_tag="Csal_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(194256..196298)
FT                   /locus_tag="Csal_0170"
FT   CDS_pept        complement(194256..196298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0170"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57534"
FT                   /db_xref="GOA:Q1R174"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R174"
FT                   /protein_id="ABE57534.1"
FT                   /translation="MPTLRFSAQRLGTTAALALLLTPTALLAQETSAEQDASNTQNTST
FT                   QDNGTAPEQAQSEPVPLVPGTPTWDSFHGQLNAQKYSPLDQINADNVGDLEKVWEVHTG
FT                   DVSDGSGDLPPTVWSATPVFANDTLYIGTPFYRILALDPATGEQKWSFDTESSLEALTQ
FT                   PALKSRGVAYWEADDPVEGESCQKIVYLGTMDAQLFAVDADTGEKCTSFADNGVLDVNQ
FT                   WNDTHDKWPLSLLQPPTVVGDHLILGWAGKDWAFEQAPPGTVFSINARTGEREWSFNAL
FT                   SEEMREKSGTANVWTHMSADEENGLVYLPISSPSPNYWGGNRTEDVPLATSTTALDVDT
FT                   GEVVWSRQWVHHDVWDYDINAAPTLMDITVDGEEIPALVQATKMGFLFVVNRLTGEDVW
FT                   PIEERPVPQGDGSVEGEEYADTQPFPTKPAPLLDQAEKPEVWGLADAVSFGQCSALWDD
FT                   LAYEGMYTPPTTQGEGALTYPDSAGGVQWGGVAFDPQSQTAIVNTSHIVQYVKLYDREA
FT                   YEKADSGSGNESGFAPQTGAPYGMRLEVALNWLGMPCWKPPFGEIVALDMKTGDVKWRR
FT                   PIGASQQYGFFMPESWGSPTIGGPAVTAGNVIFIGASMDAKLRAYSLETGEELWEDQAE
FT                   APGVSNPAVYEYEGREYVAFIAGGNSILKDQVGDQVVVYALPEDE"
FT   sig_peptide     complement(196212..196298)
FT                   /locus_tag="Csal_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            complement(196310..196675)
FT                   /locus_tag="Csal_0171"
FT   CDS_pept        complement(196310..196675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57535"
FT                   /db_xref="GOA:Q1R173"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R173"
FT                   /protein_id="ABE57535.1"
FT                   /translation="MPQSRSQRLGAIVLLVASLVGLAIALYAYFMPLTGVTGTLGALVA
FT                   IIATLILAVLSLALPAFKGNGSRNAWRVLIFLGLAGTCFAGLLLQQWWLCVAMVVGLIG
FT                   LILDMVLANRPAHPAHT"
FT   sig_peptide     complement(196604..196675)
FT                   /locus_tag="Csal_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.278 at
FT                   residue 24"
FT   gene            197015..197188
FT                   /locus_tag="Csal_0172"
FT   CDS_pept        197015..197188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57536"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R172"
FT                   /protein_id="ABE57536.1"
FT                   /translation="MKALNKLFSMLATIVVSALLPFSLVAESEANQHVSVHDATAKVST
FT                   LNEDNRQDDDAA"
FT   sig_peptide     197015..197095
FT                   /locus_tag="Csal_0172"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 27"
FT   gene            197265..197678
FT                   /locus_tag="Csal_0173"
FT   CDS_pept        197265..197678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0173"
FT                   /product="Class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57537"
FT                   /db_xref="GOA:Q1R171"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R171"
FT                   /protein_id="ABE57537.1"
FT                   /translation="MLTISNTVALADWEIDISQIRAQGAGGQNVNKVASAVHLRFDILR
FT                   SSLPPFYKERLMALSDQRISKDGVVIIKAQRHRTLEANKEEALARLKALIQGAVQQRKV
FT                   RRPTQPSKGAKRRRVDKKTRKGKTKALRGKVEV"
FT   gene            complement(197727..198311)
FT                   /locus_tag="Csal_0174"
FT   CDS_pept        complement(197727..198311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0174"
FT                   /product="ChaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57538"
FT                   /db_xref="GOA:Q1R170"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R170"
FT                   /protein_id="ABE57538.1"
FT                   /translation="MTLDTTAINQQMTHFDDHEAIWLFGYGSLIWKADFPFLERRPAHI
FT                   VGWTRRFWQGSHDHRGTPEAPGRVATLTESPGAICHGMAYRITRDVLGPLDVREKNGYL
FT                   RVVTPLHFDDSGHVESHEGLVYLASEDNAAFLGPASNAEIARQIAESHGPSGPNRDYLL
FT                   NLADALREMGHDDPHIFALERELLALPKQPA"
FT   gene            198561..199406
FT                   /locus_tag="Csal_0175"
FT   CDS_pept        198561..199406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0175"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57539"
FT                   /db_xref="GOA:Q1R169"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R169"
FT                   /protein_id="ABE57539.1"
FT                   /translation="MCAGVLCLALGDAVSKWLGATYEPIQIIFFRTLISLPLIALLARF
FT                   NGGWRKLKTRRPGVHLLRGMIFAGTMFCFVTGLTLLPLAEATAIAFAAPLFVTLLSGPL
FT                   LKERVERLPFIASLVGFAGVLVVVRPGAAGFQWGALIVVGAAVCYALMMITARRYGGKE
FT                   SLWAMVFYATLVPLILSALLLPSVWKMPEGLAWLGFIGSGIFGVGAVSCITLAFRYAPA
FT                   ALAAPFDYTAMVWAVLLGWWLWDEVPDVWVFVGAAVIIGSGVAIALYERRVAIKARPTT
FT                   "
FT   gene            199527..200810
FT                   /locus_tag="Csal_0176"
FT   CDS_pept        199527..200810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0176"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57540"
FT                   /db_xref="GOA:Q1R168"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R168"
FT                   /protein_id="ABE57540.1"
FT                   /translation="MSLMRRFSVRVRMVGAIVVVLALLGVLGGTGVWGIYRLYDASLGL
FT                   LDQGLVQETQAGVMAARLVEVAQGSLLLFVVAGLVTVLVVAPLTWLNMRAICAPVREAK
FT                   DYATAIAGGDLTQPIACQGRDEISELQEALGTMQTGLGGMVAQVRDASDSVAIASEEIA
FT                   LGNQDLATRTEQSVGNLQQSVASIAQLTESIQQTAQAAQRADELATHTAEAAVRGGEAV
FT                   KDVVTRMHAIAEAERRIGDIVGLIDDIAFQTNLLALNASVEAARAGGQGRGFAVVASEV
FT                   RNLAGRSATAANEIKTLIRDSGETVAAGVSQAEATRTTIEEIVAGVQRVSGAISEISSA
FT                   AGEQSSGIEQVNHAVERIDRMIQQNAALVEQSAAAAASLRDQSSRLASVVHRFRLMEAS
FT                   QEAPVSRDAAPRWALPAHHQVESHAAWA"
FT   sig_peptide     199527..199613
FT                   /locus_tag="Csal_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.721 at
FT                   residue 29"
FT   gene            complement(201178..201750)
FT                   /locus_tag="Csal_0177"
FT   CDS_pept        complement(201178..201750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0177"
FT                   /product="protein of unknown function DUF1470"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57541"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R167"
FT                   /protein_id="ABE57541.1"
FT                   /translation="MSSGITPPLIAGNLALDFINTQFGVGADRYECLNDDSSVVEWLHQ
FT                   AGVLNDTLAAPPAGLVERARELREDMQTLIVSAREGRGADPAIVNQVLERGHPIERLEW
FT                   VPAYAAFQKQTYRRDLTSESLLQPVAQALVELLTKEDLHLVKECQAPDCVLLFHDQTKS
FT                   HRRRWCSMASCGNRMKAAAHRARKSAT"
FT   gene            201842..202813
FT                   /locus_tag="Csal_0178"
FT   CDS_pept        201842..202813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0178"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57542"
FT                   /db_xref="GOA:Q1R166"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R166"
FT                   /protein_id="ABE57542.1"
FT                   /translation="MTTDSLTTVSASETRGDHAPGGRASAAPQVHYRVEQVGDVKVFYR
FT                   EAGDPAAPAVLLLHGFAASSYMWRDVIEALADGYHVIAPDLPAFGYTEAPARGQYDYTF
FT                   ANLTKTIERFTDQLKLTRYAMAVHDYGAPVGWRLALAHPSRITAIISQNGNAYEEGLSA
FT                   GWEPIRKYWNDPTAENRQALSDFPTPASIKWQYVEGVSDTSLVAPDAYTLEGAQILRPG
FT                   MADIQLDLLLDYATNVEQYPAFQAYFREYQPPLLAVWGEHDPFFLPPGAEAWKRDIPDA
FT                   DIRLYDTGHFALETHSEVIIPTIRQFLDDHVSLHRQEGAHAK"
FT   gene            complement(202906..203538)
FT                   /locus_tag="Csal_0179"
FT   CDS_pept        complement(202906..203538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0179"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57543"
FT                   /db_xref="GOA:Q1R165"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R165"
FT                   /protein_id="ABE57543.1"
FT                   /translation="MALQLGDIAPDFTQDSTDGTINFHEWAGDNWVILFSHPKDFTPVC
FT                   TTELGEVSRLKPEFEKRNAKAIGLSVDPLDDHKAWEGDIKETQGHGLNFPLLADADRKV
FT                   SSLYGMIHPNANDTLTVRSVFIIDPSKKVRLTLTYPASTGRNFAEILRVLDSLQLTDSQ
FT                   KVATPVNWTEGDDCIIVPSVDNETAKGLFPQGWDEKKPYLRMVKLQK"
FT   gene            complement(203725..204027)
FT                   /locus_tag="Csal_0180"
FT   CDS_pept        complement(203725..204027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57544"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R164"
FT                   /protein_id="ABE57544.1"
FT                   /translation="MSALRVVLHAPTADGLARARRNALNLTRARPDTEVLIVANGAAVA
FT                   AALDTPDPATDAWLRLCRNTLAAQALDNPGGLGEVEAAVVTLAELQAQGWAYIRA"
FT   gene            complement(204024..204806)
FT                   /locus_tag="Csal_0181"
FT   CDS_pept        complement(204024..204806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0181"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57545"
FT                   /db_xref="GOA:Q1R163"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R163"
FT                   /protein_id="ABE57545.1"
FT                   /translation="MNDASAPVLTARGVRLGFADDVVLDDIDLEVAPREFVAMVGASGV
FT                   GKSTLLRAFAGLLAPQRGDVHLSTAEAPASRAWSMVFQAPRLFPWRRVRANVELGLEGL
FT                   GLSRDERRARAMEPLSLVGLEELAERWPRTLSGGQQQRVGIARALAVRPRVLFMDEPFS
FT                   ALDALTRQRLQSELTELRQRSDAAIVFVTHDIEEAVLLADRVVVLAKHDKGTPATVRDI
FT                   VTIDLPLARSREQSGFREHVQRLEQHIGVAATPEETTS"
FT   gene            complement(204803..205564)
FT                   /locus_tag="Csal_0182"
FT   CDS_pept        complement(204803..205564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0182"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57546"
FT                   /db_xref="GOA:Q1R162"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R162"
FT                   /protein_id="ABE57546.1"
FT                   /translation="MTRSARHRRTLISAVSLTALVAAWEAALRVGWLPSNLVPLPSQIP
FT                   GVLWAEVLDGIWLDVVLSSLSHYSIGLGIGSVLGIAVGMAAALLPRFDAAHSWLARLLR
FT                   PIPPLAWIPFAIIWFGVTETAAAFIISIGVFWINYFTSYSAVRAIDDGYYEVARAFGQG
FT                   GFGARLAKISLPAAAPGILGGLRAGLGQGWMTVVAAELFGIPGIGQRMMEASGLLATDV
FT                   VVVYMLTIAALYALFDFLFMRIQRRVLRWQQ"
FT   sig_peptide     complement(205493..205564)
FT                   /locus_tag="Csal_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.554 at
FT                   residue 24"
FT   gene            complement(205561..206598)
FT                   /locus_tag="Csal_0183"
FT   CDS_pept        complement(205561..206598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0183"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57547"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R161"
FT                   /protein_id="ABE57547.1"
FT                   /translation="MRRLFHWIGALALTALLPSTALAQNDETTTLEVGYMPILPVAQLF
FT                   VMEGAGWTDEAGLDLELTRFSSGPAMVQALASGKLDVMNFGIGPAMVARANGVPIKVLA
FT                   ASIQEQIGLIARGEFATAFEGNDPAAAIAQFTETQGRKPKIATFPNGSVPYTVLRYWLE
FT                   EQVGLDADAVDIVTMGASRVQQSLLAGAVDAASTLEPILSVVQQRDPDARVVARGNDML
FT                   PHQPGAVLAVREAVLEEHPEAIQALVAQHVRATEMLENDPAQAAPYVREFVGKRLIDEE
FT                   TVTAALSSPSSNYLADPHMIIDATRTMADFQRRIGTLKKPVDVDALFDTSVYDAVRSST
FT                   ENAAP"
FT   sig_peptide     complement(206527..206598)
FT                   /locus_tag="Csal_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            complement(206715..207239)
FT                   /locus_tag="Csal_0184"
FT   CDS_pept        complement(206715..207239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0184"
FT                   /product="NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57548"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R160"
FT                   /protein_id="ABE57548.1"
FT                   /translation="MGRSRSSSSPLIPCSPRHTLVWVIMLLALLAGCSSSQRIATQDPG
FT                   PIDAENLSMERVLILASAKQALGTPYQWGGNSLESGVDCSGLVQMSYAAAGIQVPRTSN
FT                   QQYQALDHRDRARPGDLLFFGAGGRATHVGIYLGDRRMIHAPGSGREVTVSSLDIRYWR
FT                   QHYLGAAGPAP"
FT   sig_peptide     complement(207117..207239)
FT                   /locus_tag="Csal_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.873 at
FT                   residue 41"
FT   gene            complement(207340..208239)
FT                   /locus_tag="Csal_0185"
FT   CDS_pept        complement(207340..208239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0185"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57549"
FT                   /db_xref="GOA:Q1R159"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R159"
FT                   /protein_id="ABE57549.1"
FT                   /translation="MANFRPLDLVVLNTFVTVVDKGGFTAAADALYLAQSTVSAHMKRL
FT                   EDTFGQPLLQRGRKTPVPSPAGERLLSHARQMLRQNALAWQDVSEQRLDGVVRLGIPDD
FT                   YVVYLPEALSEFEAQYPGVELQVDCGLSVDLVQSVRAGSLDLAITTRQPKSPGGEVLCR
FT                   EPTVWAGAAGHDTQRRTPLPLAVSKDGVCIFRERALAALDAMGIPWRIAYTSASLSGLT
FT                   AAVRAGLAITVLTPSMLGAGLRVIGSGEGLPELPMTEIALHRSPGRPNEATRQLALSLQ
FT                   THIQARSATLPVTAAPMS"
FT   gene            208363..209244
FT                   /locus_tag="Csal_0186"
FT   CDS_pept        208363..209244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0186"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57550"
FT                   /db_xref="GOA:Q1R158"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R158"
FT                   /protein_id="ABE57550.1"
FT                   /translation="MTSKRTSAGLLAGLLTVTLWASLPVLRDLITLPPMLTAAVAMGAA
FT                   ALMALLMGWRGASSGVAAWRDGKFWLIGVGGLTGALYFYFSALGKGDPAKITLVTYLWP
FT                   LGFMLVADVLAGRGLRARTLLGSAVAFSGLVPLVLSNAQGESTSALGYMQGMASGASWI
FT                   MFSLYLRGRAALSWVDYKHLFAAAAVASWGLHRAFETAPEHATAMDWGVAALIGVGPYG
FT                   LAFITWGYALLRSSSTLLGVLTYFVPVMSSVLLILVGRAAFSLPLVIAFVGVLGSAVIT
FT                   QLTRRPQGAVSS"
FT   sig_peptide     208363..208428
FT                   /locus_tag="Csal_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(209309..210010)
FT                   /locus_tag="Csal_0187"
FT   CDS_pept        complement(209309..210010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57551"
FT                   /db_xref="GOA:Q1R157"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R157"
FT                   /protein_id="ABE57551.1"
FT                   /translation="MRHLSAHAALALGLLSLASVPPAVAQQDDHDHHAHEHDHSHDHGH
FT                   EHEHSHDHHDSDIYAGYFDDDQVEDRALSDWEGDWQSVYPYLQNGTLDDVFAHKAAHSD
FT                   DKTAAEYKEYYTTGYRTDVDRIVIEGDQVSFYDNGDKRMGEYTYDGYEILTYEAGNRGV
FT                   RYIFERDGGSADAPRYIQFSDHAIYPTDADHYHLYWGDDRAALLDEVTNWPTYYPSHLD
FT                   GDAIAREMMAH"
FT   sig_peptide     complement(209933..210010)
FT                   /locus_tag="Csal_0187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            complement(210123..211127)
FT                   /locus_tag="Csal_0188"
FT   CDS_pept        complement(210123..211127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0188"
FT                   /product="periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57552"
FT                   /db_xref="GOA:Q1R156"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R156"
FT                   /protein_id="ABE57552.1"
FT                   /translation="MPRFSPYLAVLLMSPAAASAAVPSVAVDIPSVYSLVDRVMGDLGA
FT                   PSLLIQQGASPHRYDMRPSEAEALENADAVFWIGEDLTPWLAHSMDTLGDDALSVELMD
FT                   LPETQTLAYRQGATFEPHQHDHGPHDHAHGHDHSHSHDHDHDHDHDHDSHDHDHSHEGR
FT                   NPHVWLDPQNAQAWLDVIADDLARLDPAHADTYRNNARLGKDELNTLTKALQQQLANAS
FT                   SANFIVFHDAYQYFEHRFDVHAAGAISLGDARKPSPSRIAELHTLVETHDIDCVFSEPQ
FT                   YNPELVKSVFGDTGVNTSIVVDPLGTDLALGDDLYPNLMHKLADAVSQCASDA"
FT   sig_peptide     complement(211047..211127)
FT                   /locus_tag="Csal_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 27"
FT   gene            211224..211994
FT                   /locus_tag="Csal_0189"
FT   CDS_pept        211224..211994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0189"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57553"
FT                   /db_xref="GOA:Q1R155"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R155"
FT                   /protein_id="ABE57553.1"
FT                   /translation="MASSLRGATTYAPGYPMSLLSIAALDLALGGHLVLENVHLTLERG
FT                   EIVTIVGPNGSGKTTLLKSIIGALTPQRGCIDKSPGMVIGYVPQRLHLDATLPMTVSRL
FT                   MRLPRRRPTHEIETALDRAGVTQQASSQVSDLSGGQFQRVLLARALLSSPDLLILDEAT
FT                   QGLDQQGMADFYRQIERVRHELGCAVLMVSHELHVVMRASDRVICLNRSICCAGTPERV
FT                   AASPAYRAMFGLDDEDALALYRHHHSRSSLEMSP"
FT   gene            211991..212818
FT                   /locus_tag="Csal_0190"
FT   CDS_pept        211991..212818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0190"
FT                   /product="ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57554"
FT                   /db_xref="GOA:Q1R154"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R154"
FT                   /protein_id="ABE57554.1"
FT                   /translation="MIFDDFLVRATLAGVGVALAAAPLGCLVVWRRMAFFGDATAHAAI
FT                   LGVALALLLSTSIFAGVLVVSLLMATLVSLLSGKGYAMDTLLGVMAHSSLALGLVAVSF
FT                   VSGVRIDLMAYLFGDILAVGKGDLAIIWSGAALVVALMGWRWSRLLTATLNADLAYASG
FT                   IDPQREQLILTLSLAIVVAVALKVVGILLIAALLIIPAATARTFSRTPETMVVAAALVG
FT                   MMAAVGGLQTAYWLDTPTGPTIVSLAAALFALAGLIANSRRLLWWAMASRTGG"
FT   sig_peptide     211991..212053
FT                   /locus_tag="Csal_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.752 at
FT                   residue 21"
FT   gene            complement(212877..213791)
FT                   /locus_tag="Csal_0191"
FT   CDS_pept        complement(212877..213791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0191"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57555"
FT                   /db_xref="GOA:Q1R153"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R153"
FT                   /protein_id="ABE57555.1"
FT                   /translation="MQEPKNSQTLHDVANGASDLEGPLAWVGMEDIALPFRLANSAVNG
FT                   RASAGVSLDATSARGIHMSRLYLALEALEHEEVTLSGLGAVLQRFLASHDGLARTAFLD
FT                   LSGDVLIKRPALISPRAGWKAYPCALRCRQDTQGMQAVLEVTIGYSSTCPCSAALARQS
FT                   IQQAFDEDFTDMPISHEAVRTWLGSEQGILATPHSQRSQAHLSLRLADDLETLPVTALI
FT                   DTVEDALGTALQTAVKRVDEQAFALANGQNLMFCEDAARRVRHALQARDEVQGFRVRIV
FT                   HAESLHAHDAVAHAEWNWTPNSP"
FT   gene            complement(213799..215031)
FT                   /locus_tag="Csal_0192"
FT   CDS_pept        complement(213799..215031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0192"
FT                   /product="cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57556"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R152"
FT                   /protein_id="ABE57556.1"
FT                   /translation="MASSQPTLPVTVLSGFLGAGKTTLLNHILANREGRRVAVIVNDMS
FT                   EVNIDASLVRGAPDKEHSDTNAVTLNRAEERLVEMSNGCICCTLREDLLIEVRRLAAEE
FT                   RFDHLVIESTGISEPLPVAETFTFTDEGGQSLSQVARLDTLVTVVDGANFLSQYHEAQS
FT                   LAEAGESLGEEDERNVADLLVDQVEFCDVLLISKTDLMEPRQLNELTAVLRSLNPEAEL
FT                   IPIAHGQVPLDKVLDTGRFSFERAQQAPGWLKEMRGEHVPETEEYGISSFTYQARRPFH
FT                   PQKFYELLHGDGFDATLLRSKGFFWLATRPQYVGQWSQAGGIAHYAFAGMFWKAVPESH
FT                   WPDDPEYRAAIMEKWQEPFGDMRQELVFIGQHLDRAQVRQALDSCLLNDEEMLAGNTHW
FT                   QTLPDPFPAWD"
FT   gene            215209..216372
FT                   /locus_tag="Csal_0193"
FT   CDS_pept        215209..216372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0193"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57557"
FT                   /db_xref="GOA:Q1R151"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R151"
FT                   /protein_id="ABE57557.1"
FT                   /translation="MKGWLLGVSLTLLGASGVAQAQAQDEASNKQVLDPIVASLMEAQQ
FT                   IPGMAVALIGPKGTTIADYGVADRKTGTPVDDDTLFEIGSLSKTLTATLASLAAVEGEL
FT                   DLEAPVSRYLPELEGSAFDRIDGLNLGTHTGGGLPLFVPDEVTDRASLMAWYRDWQPSE
FT                   PIGESRTYSNLGIGLLGLEAAASLGGEFVPTMRTKVLAPLGMRDTWYDVPEARMAHYAM
FT                   GETKDGQPIHVSSGVLDDEAYGLKTTAADLAGLVRANLHLADVDAELQQAIDATRQGHY
FT                   RVGDMTQALIWEQYPLPVALDTLRAGNGYDMILEPNAAEAIVPPQAPRDDVWINKTGST
FT                   NGFGGYIVMLPGEQTGLVMLANKNYPNDARVEAAYRILSGLDVIDAL"
FT   sig_peptide     215209..215274
FT                   /locus_tag="Csal_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.736 at
FT                   residue 22"
FT   gene            216584..216781
FT                   /locus_tag="Csal_0194"
FT   CDS_pept        216584..216781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57558"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R150"
FT                   /protein_id="ABE57558.1"
FT                   /translation="MSTQLDPIVSEFATQEQADSYDRWFRAKVQHSLDNPGQGMPHDQV
FT                   MAKADGIIAAAERRQDGKAL"
FT   gene            216778..217053
FT                   /locus_tag="Csal_0195"
FT   CDS_pept        216778..217053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0195"
FT                   /product="plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57559"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R149"
FT                   /protein_id="ABE57559.1"
FT                   /translation="MSLLIHWHDDAIADLIELITYIAERDPQAAQRLRTRLEVAIASVA
FT                   EYPYLHQVGRVPGTREIVAHPNFIVVYQVTDRIEVTSVVHARQNYP"
FT   gene            complement(217131..218048)
FT                   /locus_tag="Csal_0196"
FT   CDS_pept        complement(217131..218048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0196"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57560"
FT                   /db_xref="GOA:Q1R148"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R148"
FT                   /protein_id="ABE57560.1"
FT                   /translation="MPQKQGGVMSVAVREFVARVWPVAMLIVAMCSIQTGASIAKTLFP
FT                   VIGATGTTSIRLILAAGLLLIVMRPWRQRFSRRAWKSTMIYGVALGVMNLLFYQALQTV
FT                   PLGIAVALEFTGPLAVAVLSSRRWLDLLWVAFAVLGLACLLLLGDESNGAVDPYGAACA
FT                   LGAGVCWALYILFGQKAGSVNGAQSATLGITIAAVVIAPVGLIDVGPAIFAPEVLPLAF
FT                   AVAVLSTALPYTLEMVALPRLPTQTFGTLMSLEPAIGALSGLLFLSQLLSGLQWLAIGL
FT                   IIVASIGTTLTVRRRDTFETPAPD"
FT   gene            218114..218686
FT                   /locus_tag="Csal_0197"
FT   CDS_pept        218114..218686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0197"
FT                   /product="transcriptional regulator, XRE family with cupin
FT                   sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57561"
FT                   /db_xref="GOA:Q1R147"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R147"
FT                   /protein_id="ABE57561.1"
FT                   /translation="MGNIVHKSSERPDVLVHVAANVRRLRQGASLSQQALAERAGVSRR
FT                   MLVNIEKGDVNVSLSTLDRLAEALGVLFYALVQPPGSEDSARIDEVAWVGRFPDSHARL
FT                   LASKPARQEVELWSWSMEPGESYESVADGTGWHEMLVVIEGTLTLELADHEVTIEAGDF
FT                   HVYPSDQFHRYRNEGTGRLRFIRNVVH"
FT   gene            complement(218775..219125)
FT                   /locus_tag="Csal_0198"
FT   CDS_pept        complement(218775..219125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0198"
FT                   /product="protein of unknown function DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57562"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R146"
FT                   /protein_id="ABE57562.1"
FT                   /translation="MSADTSQDRISLHPHTHRVRVWHGDTLLADSTRAVELREQGYPPR
FT                   QYLPESDVQMAQLLRSTTVTHCPFKGDATYYRTDDHPDVAWQYAEPLADMAAIAGRLAF
FT                   DDSVVTVQVDAG"
FT   gene            complement(219139..219858)
FT                   /locus_tag="Csal_0199"
FT   CDS_pept        complement(219139..219858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0199"
FT                   /product="Aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57563"
FT                   /db_xref="GOA:Q1R145"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R145"
FT                   /protein_id="ABE57563.1"
FT                   /translation="MRTIGLLGGMSWESTESYYRALNEGVKQALGGFHSAKIAMVSVDF
FT                   AEIETLQRDGRWDTAGETLAAAARQIEHAGADFLLIATNTMHKVAPQVEAAIDIPLLHI
FT                   ADATAESLVADGITRVGLLGTRFTMEQDFYKQRLSERYGIDVVVPDDTQRERVHQVIFE
FT                   ELCLGRIESASREAFLAVIDALHARGAQAVILGCTEIAMLIKATDTQVPLYDTTALHAQ
FT                   AAVKCALSGSLLSEDTQ"
FT   gene            220124..220519
FT                   /locus_tag="Csal_0200"
FT   CDS_pept        220124..220519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57564"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R144"
FT                   /protein_id="ABE57564.1"
FT                   /translation="MPFSPRTSLRRVTAWLSLFAMLLVVCGPVVGQASASLRHDAMPSH
FT                   AMMHAEAGHGDHTRGGHVASVGLHDQCLYCSLFGHFPVLEGASTASMADNAAVIAPRVP
FT                   RVLASQAVTTTFPNALTRAPPYACHHA"
FT   sig_peptide     220124..220219
FT                   /locus_tag="Csal_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.771 at
FT                   residue 32"
FT   gene            220634..221989
FT                   /locus_tag="Csal_0201"
FT   CDS_pept        220634..221989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0201"
FT                   /product="Propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57565"
FT                   /db_xref="GOA:Q1R143"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R143"
FT                   /protein_id="ABE57565.1"
FT                   /translation="MSRTSARSSRDASDLYRAVWRWHFYAGLIAIPFLISLAVTGGLYL
FT                   FKDEIDQWLNADIVRVEAQSSAAVSPQQQLDAAMAAHPGEAFRYVPPAASNLAAEVDIT
FT                   TADGKQAVYVDPYTGEVTGTIPYRGSVMWIVRTIHSLSYFGETASLIIEIVGGWSILLV
FT                   LTGIYLWWPRGRRGGVMTVRATPAKRLFWRDLHAVTGIFVGGFILFLAMTGMPWSTLWG
FT                   SKVNELANGHNFGYPDGVRVNVPVSDERLAEREMTTWSLEQARLPESTPGREGAPGIGL
FT                   NGAVKAFDALGLAPGYAVSLPSSPTGVYTGSIYPDDLSRQRVVHLDRYSGEPLLDMSYA
FT                   DYGPLGKSLEWGINVHMGQQYGLANQLILALACAGIVLLCVSSGVMWWKRRPSGKLGIP
FT                   PEPKDPRRLRGVLALLAIGGVIFPLVGASMIVMAVVDALVRRRGARRAATTA"
FT   gene            complement(222053..222784)
FT                   /locus_tag="Csal_0202"
FT   CDS_pept        complement(222053..222784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0202"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57566"
FT                   /db_xref="GOA:Q1R142"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R142"
FT                   /protein_id="ABE57566.1"
FT                   /translation="MNPVIELLNAHRSIRRFTDRKIAPELLQELIQAGQSAATSSHVQA
FT                   YSVIHVKNPANRETLAELAGGQDYIATCSDFLVFCADMKRPAEAAERAGADATRGMTEQ
FT                   LLVASVDTALMAQNVVVAAESEGLGICYIGGIRNNPQAVSDLLRLPEHVYPVFGLCLGY
FT                   PDQTPEVKPRLPVEAILKEDYYRDDQAQVDAFDATMREYYQARGSAQKDTTWSQNLMPL
FT                   FEHKVRPHMRDFLVSRGFEMK"
FT   gene            222948..224279
FT                   /locus_tag="Csal_0203"
FT   CDS_pept        222948..224279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0203"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57567"
FT                   /db_xref="GOA:Q1R141"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R141"
FT                   /protein_id="ABE57567.1"
FT                   /translation="MKAATTRPTTLSAAWSLWTLLLGVGLLMMGNGLQGSLLGVRASAA
FT                   DFGNTVTGLVMSSYFVGFLVGSVLTPRKLREVGHVRVFAALASITSVAILIHALFVEPL
FT                   VWAAMRFVTGFTYAGLYVVAESWLNGYASNRLRGRLLAIYMVISYLGMGGGQLLLGSAD
FT                   PSGMALFLLVSILVSLALVPILISYTPQPELSQPEAMSLRALYRLSPLGTVGCFMTGIT
FT                   NGAVFGMGAVFATNSGLSVAQVSVFMSAFIFGGAILQWPLGKLSDKADRQWVIVGVALV
FT                   AVMLALVGALVSGWSPMALTLLGALLGATTLTLYSIFLACANDFLTDQQTVAASASLVL
FT                   ALGIGAILGPASAGVLMEWLGPDGFLWDLAVMHIVMVLFGLYCIRHYPTSESPEQGHYV
FT                   MVASDTTPLGTAWTEEAAQEEGQLELALELEGEGDDESAEGMTR"
FT   sig_peptide     222948..223082
FT                   /locus_tag="Csal_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.347 at
FT                   residue 45"
FT   gene            224469..227078
FT                   /locus_tag="Csal_0204"
FT   CDS_pept        224469..227078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0204"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57568"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R140"
FT                   /protein_id="ABE57568.1"
FT                   /translation="MSDSFFDTFDIDLSSSQRLLTLEVAGTALLPHRLVGEDRVSAPFT
FT                   YTLDCISQRSDIELKTLLAQPARLSILQADGSYRPLHGLVSEAALLGEDGGVTYYQLTL
FT                   VPWLKMLELGRDSRIFQDRSVVDVLTQVFEGHALAKGRYRFDLRRDYPARSYCVQYRES
FT                   DLNFISRLCEEEGLFYYAEFAGDDDDFDGHRIVFTDDVDTTQPVSPQAIRFHRQDATET
FT                   EDALNQWGGVRTQQPTRVSVGTFDYKQPSLTKRTGLETLSDQGNLPPTEVYDYAGEYYY
FT                   HGFERGERLTENRLEAHESLAKRFRGSGGARQLQAGRWFELTQHPLHDRGGEEERQFLL
FT                   LGVTVHAENALPVSTQHQALPGSLQPQLDAAKQAHGLEGETADPTGERLSDYATGGTGH
FT                   FLVDLEAQRRSQPYRHPLTHRRPVIGGPQTATVVGPANEEIHTDPLNRVRVQFHWDRQG
FT                   QHDENSSVWLRVSQPNAGAGWGGVFVPRIGQEVLVDFLEGDADRPLITGRVYNGEQSPD
FT                   WHSHGLLSGFKSKTYRGSKYNELVFDDATDQERVRLSSEAEKSQLNLGYLIHQTGNTRG
FT                   AFRGTGFELRSDAYGAIRANQGLYLTSWGQLGASGDQLDLTPAKQQLDSAYQLSDMLSQ
FT                   SAQDHNAEALDSRTHLKQAGEDADDRYGNSEQLTSTDQTSASGATDSGGRGEAARMKAP
FT                   WLHLASPAGITLSTPESTHLAQGRSLSVSSGEDVNVATGKSLVASISETLSLFVQKAGI
FT                   KLFAARGKVEMQAQSDNLEATARQNLNVTSTDEKVDLSAAEEILLVSGGAYVRIKGGNI
FT                   ELHAPGKVTVKGATQDFSGPAEMHVDKPVLPEADDPICVSCWLKALKEQRALVKVQS"
FT   gene            227075..227962
FT                   /locus_tag="Csal_0205"
FT   CDS_pept        227075..227962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R139"
FT                   /protein_id="ABE57569.1"
FT                   /translation="MSLSDEALKARISRYVLALEECERDSVSVCAIVETGLLSEEERNA
FT                   LWKRFSGQPWLQQPQFQVLQPLGPWLFGGDIETLLSELYPMAERGFHGLLITHQPVAQE
FT                   AVKLGELCAVQDTNEEEQLLRYYAPHVFPVLHRFSDTSWYDRLFGSLSFWWLPGLEGWK
FT                   EYAGTWHHQGDIIDTDDTIALTPALLQALGSDPLAHQILAELEALSPALFDVACSGIRL
FT                   AIVDKAISRAREAGLSSTQDLSVYAAYCVAYGMEVTCEPEFARAVELSLSGSRSLAEHL
FT                   KATGSQSISEAHHG"
FT   gene            227955..230618
FT                   /locus_tag="Csal_0206"
FT   CDS_pept        227955..230618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57570"
FT                   /db_xref="GOA:Q1R138"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R138"
FT                   /protein_id="ABE57570.1"
FT                   /translation="MGSVLDPLSIGQSVGDRLSALPQTDDDGTTVDCKKSINILPLRYS
FT                   AIYAEEEDRAALGSVPEYRGDPVSDIGLSQAKYTARFLREGYLYVLVNRLGTYRWEHCY
FT                   YVSADALLSRINPYEPTKESGGISYFAINDVEDVSEGYMLFLPDPLSVRMLERLKSNAH
FT                   LRESLQRFAIAELAHSCSGESVIPPTMLQSEVAEFVGYQDESVGHLLQKQTFPSLTDPF
FT                   DEDAQPADLQRYWSRFESLQRALEGLQGFAVVLADPIGITQELNNHRNDALEPLKDWME
FT                   KEDEDGLSNEQRFYTSELIRNLRQNYVEGRINSLAQRDVRRFRLQVGNRYLPHVRAVGE
FT                   AEIGGNRQPTARDYELAEEYEERQAEILESSSQRITAERGEEFRQEYDSQYAPLLDQNA
FT                   RKAFDDSMAKQSQIQEVLMAHRVSDHLAWLQSTSFLDALDYYDSRDPIWGWAYSIQVVQ
FT                   ATVGMEGTEEGAALLDQWWRDMNMNDRSNLAWAVYCLNQYDIRRAGQQDIDAFRAKETR
FT                   VADTDDDSWMGPEPQNILQGFKHLTTAFNTANAALEGESPSWFRTNRLGVTMAWYTQFM
FT                   KGFFEKARSETMDRTTLRISLGLMRAQLARHAAQIGVNRRWFSKGSSRELAKAKRFLSR
FT                   DMQTALEGNGSQFMQFRLGVAVAIIESYALYQTLSKQDKDARDYTKMAGAFVLVASAIA
FT                   DTAASSINMVMVMGKYRATDVGKAAQFRLGGFSFWGGMLASVGALFGAIDDFSEVVKRY
FT                   SNQNYTLASFYFVRFVANVGIAVLGTAITLASSVAYLARVSQQGKTALARRLASILAPL
FT                   ARSLASAAIRGVLMASFAVVSWAGIILTIGFWIFGDDALEAWCKRCVFTTESVPDHYAD
FT                   YAEEVGAFHQALQDVT"
FT   gene            230693..231622
FT                   /locus_tag="Csal_0207"
FT   CDS_pept        230693..231622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57571"
FT                   /db_xref="GOA:Q1R137"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R137"
FT                   /protein_id="ABE57571.1"
FT                   /translation="MKQFEKATEKYGKQYRGMQERQVSDAPSDARSIYKMNDTYMDVRT
FT                   FFDEWRGGVILGLAPIFIGLIGIPFFFLFPALSVFFNGISLGSGESAVAGEFFFLGLVW
FT                   CSWLGFLIVFIKYLLWIFRMECLVQRHIVVRFNRKKRKIYINRPNFAGGNQVYDWDDVV
FT                   ASVDPDDQVVTKKRKREILMLFFFKQRTGAEYHDVVFLGAPLRSDHELYALWEYIRRYM
FT                   EEGPESIPKPKCVTSFPWPWRSLLAPWSFLENKWAAAPWSPRMIALVLIASPVMLLHAV
FT                   AHWCSLLLCWPVYWPRQLRRESTASEPV"
FT   gene            231848..233053
FT                   /locus_tag="Csal_0208"
FT   CDS_pept        231848..233053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0208"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57572"
FT                   /db_xref="GOA:Q1R136"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR039570"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R136"
FT                   /protein_id="ABE57572.1"
FT                   /translation="MTSATKPERPMRRSGFFCGLAMKPEIAVGLLYSTTGTYQRISNNA
FT                   RSGALQAVADINADATSGVTLVAHEYDPHGELEAYHRGVEDLLARGVRHVVGTTTSASR
FT                   KDIVPDVERDEALLWYACPYEGFECSENVLYSGGCPSQNLVPLLAYALRERGKRGVLIG
FT                   SNYVWGWESNRIARELVEASHGRIVAEKYFHFGDCDFEAIVPRILEGAADFVLNNLVGE
FT                   SSYAFLAQLEAACERQGTGITVLSCNFTECELPAIPRLRHVRLLSCGPWFDHPGNGFSA
FT                   RQRVRHGAQIYSSCYTNAYNAVQLLARGCDAVGSDDPSKVLAWLHATSHSTLMGELAFN
FT                   PRNNHLALPCCIAEAGDEGFRIVHRESGVRDADPYLTRTGIPQFRDVVGAAPTPPHLRV
FT                   VK"
FT   gene            233050..233637
FT                   /locus_tag="Csal_0209"
FT   CDS_pept        233050..233637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0209"
FT                   /product="response regulator receiver (CheY-like) and ANTAR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57573"
FT                   /db_xref="GOA:Q1R135"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R135"
FT                   /protein_id="ABE57573.1"
FT                   /translation="MNAEPLTPRLLLVDCEPRSQAMLDKSLARLGLHGWAVIEDAEIAL
FT                   TNVDGVIVELDHFASPRLLEAARVAGLPIVAMTHHQTLSQIQRARRLGATAILNKPITQ
FT                   HTVYTTLAMARTLRERLTELEAAHDRLTVQLDHQGLIARAVARIMVSSDLDEAQAFERL
FT                   RSDAMSRQLTLVQASERLLAQMAPARRQGGPS"
FT   gene            233634..234482
FT                   /locus_tag="Csal_0210"
FT   CDS_pept        233634..234482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0210"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57574"
FT                   /db_xref="GOA:Q1R134"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R134"
FT                   /protein_id="ABE57574.1"
FT                   /translation="MTVLKALLKRKAVAIALIYILIVVVAAIFAPWLAPHDPAEQFFEG
FT                   LSLEGAPLPPGGEFWLGTDLLGRDLLSRVIYGARTSLIIGIVSNGIAVVIGTLVGVTAG
FT                   FVRGWLGSVLMRLTDLMMAFPALLLAIALAAILQPSLWIVAMVIAMVNWVQIARVIYSE
FT                   TISLSSKDFVAVERTIGVSARRILFSHLLPHLLPTILVWATLGISTTVLLEATLSFLGV
FT                   GVQPPMPSWGNIIFESQTYFISAMWLVLFPGIAIIALSLSFNLVGDALRDELDPTLKGR
FT                   R"
FT   sig_peptide     233634..233714
FT                   /locus_tag="Csal_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.771 at
FT                   residue 27"
FT   gene            234482..235408
FT                   /locus_tag="Csal_0211"
FT   CDS_pept        234482..235408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0211"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57575"
FT                   /db_xref="GOA:Q1R133"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R133"
FT                   /protein_id="ABE57575.1"
FT                   /translation="MVWYIAKRIAYSLLILLGVTFITYLLLYMIPADPARQIAGRSATA
FT                   EVVANIRHQLGLDLPFYEQYVRYLGNLLQGDLGRSYVQRSEVSTLLAARVGPTLQLMAA
FT                   GIGFELLIGITLGIVAALKRNSVLDQVLMAFSFIGVSSPHFIAAMLALYFFAVYLGWFP
FT                   LGGYGGVEHLLLPAITLGVLGSGWYSRMVRSSMIDVLHQDFIRTARAKGLGRVRVLLRH
FT                   VLPNAIVPVIPMIGIDIGIFMSGLVVVESVFGWPGLGQLAWQAIQQVDIPIIVGVTMLS
FT                   AVAIVLGNLVADLAVLFVDPRIDVTQT"
FT   gene            235428..237044
FT                   /locus_tag="Csal_0212"
FT   CDS_pept        235428..237044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0212"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57576"
FT                   /db_xref="GOA:Q1R132"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R132"
FT                   /protein_id="ABE57576.1"
FT                   /translation="MNNKLKGFALTALCATISSQALAQQTPQEGGDIVVTYQNDVATLD
FT                   PAIGYDWQNWSMIKSLFDGLIDYEPGTTELKTDLAKDYEISDNGLTYTFHLREGVTFHN
FT                   GREMVASDVKYSLERTVNPETQSPGAGFFSSIEGFDAVASGESMALSGITTPDDYTVKI
FT                   QLSAPDAAFLHIMALNFASVVPKESVEKWGRDFGKHPVGTGAFELQDWALGQRLTFVKN
FT                   DDYYRDGIPYLDRIDFEIGQEPNVALMRLQRGEVDIAGDGIPPAQFLQFRNDPEFKDLM
FT                   VIGDQLHTGYLTMNVTMPPLDEVEVRRAINMAINKERIVRIINGRAIPANQPLPPAMPG
FT                   YDEEYEGYPYDVAQAKALLEEAGYGDGFDTEIYVMNTDPQPRIAQAIQQDLAQIGVRAE
FT                   IKSLAQANVIAAGGDKEQAPMVWSGGMAWIADFPDPSNFWGPILGCEGAVPGGWNWAWY
FT                   CNEELDAEADAADAMVAPDQQQARAERWGKIFTTAMDDAPWVPIFNEQRFTVHSARMGG
FT                   DDALYVDPVHVPVNYDYIWVK"
FT   sig_peptide     235428..235499
FT                   /locus_tag="Csal_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            237044..237991
FT                   /locus_tag="Csal_0213"
FT   CDS_pept        237044..237991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0213"
FT                   /product="Acetamidase/Formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57577"
FT                   /db_xref="GOA:Q1R131"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R131"
FT                   /protein_id="ABE57577.1"
FT                   /translation="MCDNGLIKTIHGHHSHLGWDNAIAPAAHVAPGTRLTFACNDSSGG
FT                   HFTPTSDASAVADMPFDRINPVTGPIFVDGAEPGDILVVHIDDFTPSGFGWTANIPGFG
FT                   LLADQFETPALALWHYDTHTMTPAAFGTHARVPLKPFAGTLGVAPAAPGTHSIVPPRRV
FT                   GGNLDVRDIGAGSTLYLPVEVAGALFSIGDTHAAQGDGEVCGTALESAMDVSLRLDLIK
FT                   QTPLAMPRFSTPGPVTRHLDGAGYEVFTGVGPDLMEGARQALSGAIEWLIKTRDMPAEQ
FT                   AYMLCSVCGDLRINEIVDMPNWVVSFYVPRIVFE"
FT   gene            238002..239762
FT                   /locus_tag="Csal_0214"
FT   CDS_pept        238002..239762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0214"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57578"
FT                   /db_xref="GOA:Q1R130"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R130"
FT                   /protein_id="ABE57578.1"
FT                   /translation="MTTQSESSERRVLSVERLSIDISHEHDTQRVVDDLSFTLHAGRTL
FT                   CIAGESGSGKSLSSLAIMGLLPKVARLPSGAILYGERDLLELPERAMQRLRGRDIAMIF
FT                   QEPMTSLNPLMTVGQQLEETIRRHKLAEGGQARRRALEMLDAVRVPHVEQRLKQHPHEL
FT                   SGGMRQRVMIAMAMVCHPKVLIADEPTTALDVTIQAQILELMRELQREFDTALLMITHD
FT                   MGVVAEMADEVVVMNRGIVEESASARTLFTDPRSAYTRKLLAAVPRLGTAAVRPLASEA
FT                   HAPMLAVEGLRVRFPVKRRSPFETRREVCAVEDVNFTLHAGETLGIVGESGCGKSTTGK
FT                   ALMNMLDYTGSVRFEGRELNGLRGAALKAVRRDIQMIFQDPFAALNARKSVGDLVGEPL
FT                   LVHGLADAAERRRRVAELLEQVGLPAEVALRYPHQFSGGQRQRICIARALALNPKVIIA
FT                   DEAVSALDVSVQAQVLALLEDLQQRLNLSYLFISHDMAVIEQISHRVAVMYAGQIVEIG
FT                   SCQQVLHDPRHPYTRRLLSAVPMPDVDAKRDFAALLQASEAPDPIKPHGYQLPPLRYAE
FT                   PQTGHWVALA"
FT   gene            complement(239784..240728)
FT                   /locus_tag="Csal_0215"
FT   CDS_pept        complement(239784..240728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0215"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57579"
FT                   /db_xref="GOA:Q1R129"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R129"
FT                   /protein_id="ABE57579.1"
FT                   /translation="MTISSRARRYVRPLLTLAILALAVIAIAQIWNHYMHDPWTRDGRV
FT                   RADIINLGTDVSGLVENLQVEDNDFVHAGDVLFTIDKQRYALALSEARANLNNLEQQRA
FT                   EAKAANARRQKLGDYASQEDRDDARFAYSSAQAQVEQAEVAVEQAKLDLERATVRAPVD
FT                   GYVTNLLLRPGEYVSAGEDAVTLVDAGSFHVLGYFEETKLDAIDIGAPARIQLLASDTP
FT                   LWGHVDSIARGISDKSLDSQGTGLANVSTSFDWVRLSQRIPVRIALDDVPEDIDLAAGL
FT                   TATVYLNDTRSEHRQAPDWQRTLTRWWESLVSI"
FT   sig_peptide     complement(240642..240728)
FT                   /locus_tag="Csal_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(240950..243049)
FT                   /locus_tag="Csal_0216"
FT   CDS_pept        complement(240950..243049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0216"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57580"
FT                   /db_xref="GOA:Q1R128"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R128"
FT                   /protein_id="ABE57580.1"
FT                   /translation="MLRISTDHWLLALRTVLAVWLALFLALRLDLYQPAWAILAVMIVT
FT                   LQPVMFTGGTPPIGIIIGRGVARFFGTLFGAVAGLVLIAFFGQQPMLYLLFSGAWLAFC
FT                   MYWVMLEQDEYLGYVMMLSGYTATLVSLTALGTGVEDIWTIALGRFTETALGIGCGVLM
FT                   HLLIAPRFGSRALPEALSGFLKNAAEETLAALDSPRPRATQDARLKALLGDYQQFEKLR
FT                   GLTHLETRRLSRFIPALDRFASDSLALITAIRELETALDYLRACEDGEHWLAQLNAHAA
FT                   PLLATIAEQPAGEPLEKLTLPDFAWDPERVSPRSRVRAELARQRLGEVLGLLQHGRRLR
FT                   HALNAPASARVHALPREKRTRTTHNEHFVARYNALRVFVAFELLGLFWIHSGWHSGYLA
FT                   MMLLGVFTMLFAKAPNPAAVVYQFLWGTLAAVTLGAVLLFLVLPVINGFPLLAIAIGIP
FT                   VMVGTLLTPRPRWAAMGLSGAITLMTLLNLHSTYTFSPTTYINGGLASLIGTTTAMFTY
FT                   ALMRQRSPAERIRTLLGAYWRGVARLMCEPALPNRARLESRLYDRLGRLVALGGTDDTL
FT                   REALDLHALALCVWRIRRLREELAPHRRELEAWLDDIGQRLVARRHHSPEVWHELSNQA
FT                   RQWVDRFYHEPRLSVATAGEIAMLGHLMREAPGVTLEAQADDDAPTAPHDRRTTPPRQE
FT                   TPHVR"
FT   gene            243171..243788
FT                   /locus_tag="Csal_0217"
FT   CDS_pept        243171..243788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0217"
FT                   /product="Glyoxalase I"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57581"
FT                   /db_xref="GOA:Q1R127"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R127"
FT                   /protein_id="ABE57581.1"
FT                   /translation="MPPGNFIECPHLPSQPDTDSHPRDQEDAMSFQGEQYPGVQTPSAE
FT                   TQGFRFNHTMLRMKDPERSLAFYSRVFGMRVLRKLDFPEMQFSLYFLANVDDNDAVPED
FT                   TAERNVYTFSQKGILELTHNWGTEDQEGFAYHDGNAEPQGFGHICFSVPDLPAAVAWFD
FT                   ANQVEFKKRPDEGKMKDVVFVKDPDGYWLEVVQPERSRELGQ"
FT   gene            243982..245634
FT                   /locus_tag="Csal_0218"
FT   CDS_pept        243982..245634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0218"
FT                   /product="periplasmic glucan biosynthesis protein, MdoG"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57582"
FT                   /db_xref="GOA:Q1R126"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R126"
FT                   /protein_id="ABE57582.1"
FT                   /translation="MDRRTLLKRSLALAAFYGLPAAPLLAATRQMPAIADGEAQRFSFD
FT                   WLQRLAREMANAPYRNNMRELPETLASLTPQQYNAIGYDAGHSLWHDLDGKLDVQFFHV
FT                   GMGFNQPVRMYALDPDSHQAREIHFDPDIFRYDGANVDVAQLEGEDTLGFAGFRVFKVP
FT                   SLTERDIVSFLGASYFRAVDDTYQYGISARGLAVNTFAESEDEEFPTYTRFWLETPAPD
FT                   STTFTAYALLDSPKVAGAYRFVIDCQPTRVVMDIEKHLYPREAIKQLGIAPMTSMFSCG
FT                   THQRRMCDTIHPQIHDSDRLTMWRGNGEWVCRPLNNPPVLQYNAFADESPKGFGLLQTE
FT                   RDFEAYEDVIGNYHERPSLWIEPRSDWGKGEIQLMEIPTTGETMDNVVAFWKPAAPVEP
FT                   GDSLTFAYRQYWSALPPVRPDLARIRETRSGMGAFPEGWAPGEHYPEEWARRFAVDYVG
FT                   GDILNIAKNGPPIMAQLEISGGRTSDIQIFQVEEFEGIRVIFDWYPTDASTDPIDMRMV
FT                   LEGDGDPLSETWLYQYFPPPPEQREHPPHPLDD"
FT   sig_peptide     243982..244062
FT                   /locus_tag="Csal_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            245720..246688
FT                   /locus_tag="Csal_0219"
FT   CDS_pept        245720..246688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0219"
FT                   /product="ABC-type glycine betaine transport system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57583"
FT                   /db_xref="GOA:Q1R125"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R125"
FT                   /protein_id="ABE57583.1"
FT                   /translation="MMTASHPLARGTKAALLGACLAGLPLGMAQAQDDTTDVRFSVPPW
FT                   PGVTVKTELAAQLLDTLGYTPQQEQLGTTITYQALNQNELDAFLAGWLPAQQGMYDTAL
FT                   EKGKLVDLGNNVDGARIGFAVPSYVFDAGVTSAEDLDTPENAERFGRTVYSIETGTGMS
FT                   EQLNAGVASDTYGLGDWELSETSTPGMLGAADSAIDNQEWIVFAGWTPHWMNIKYDIAY
FT                   LDDPEDLWGEDGGRSDVRTLVTKTFSETHPNATRLLDQLDFTADDQSDMIRRYDQDGMP
FT                   KDEAAIAWMRDNADKVEGFVDGVTTRDGEPAWPVVKEAFDL"
FT   sig_peptide     245720..245815
FT                   /locus_tag="Csal_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 32"
FT   gene            complement(246764..247765)
FT                   /locus_tag="Csal_0220"
FT   CDS_pept        complement(246764..247765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0220"
FT                   /product="periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57584"
FT                   /db_xref="GOA:Q1R124"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R124"
FT                   /protein_id="ABE57584.1"
FT                   /translation="MSKSFTLLLGAAALTLSGAARAEGPMSVVASFSILGDMVEEVGGE
FT                   HVDVTTLVGPDGDAHVFSPSPTDARAVGEADLFVVNGLHFEGWLDRLVEASGYEGPVVV
FT                   ASRGIDALSFDEEREEHSSDHEGHDHATGHDHDHDHDHDHDHDHDHSEHAGHDHGPEDP
FT                   HAWQDLQNGKQYVANIRDALVAADPEHAADYRRNAEQYVEAMDTLDAEVHRRIGAIPEA
FT                   NRVLITNHDAFGYFANAYGLDVLSPVGLSTAAEPSAAGMAKLIEQIQARNVKALFLENM
FT                   TSPALLEQLADETGVTIGGTLYAGALAAEGEASTYLGMFRHNVDTLTEALKD"
FT   sig_peptide     complement(247697..247765)
FT                   /locus_tag="Csal_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(247815..248717)
FT                   /locus_tag="Csal_0221"
FT   CDS_pept        complement(247815..248717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0221"
FT                   /product="ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57585"
FT                   /db_xref="GOA:Q1R123"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R123"
FT                   /protein_id="ABE57585.1"
FT                   /translation="MTTLGAWLIAPLTDYAFMRRALVGGLALSLAAPPLGVFLMLRGMS
FT                   LVGDAMAHAVLPGVALGFVLAGFSLPAMSLGGLVAGLLVAGLAGSVSRMTGHREDSAMA
FT                   SFYLISLALGVMLVSLRGSSVDLTHVLFGSILAIDDTALWLIASVTSATLLVLALIFRV
FT                   LVVECLDPLFLRGQGIRGGLVHGIFLGLMVLNLTAGFQTLGTLMAVGLMMLPATAARFW
FT                   SQRLEGLIGLAIVIAMLSSAGGLLLSYHLGLPSGPCIILIAGTIYLVSALCGRHGSLLA
FT                   RLRRRAAPLEKNEDTCTSP"
FT   gene            complement(248714..249463)
FT                   /locus_tag="Csal_0222"
FT   CDS_pept        complement(248714..249463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0222"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57586"
FT                   /db_xref="GOA:Q1R122"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R122"
FT                   /protein_id="ABE57586.1"
FT                   /translation="MSRLTLDKLTLAQGGRTVLEDVSGTFEDGAITALVGANGAGKSTL
FT                   IQAIMGLLSPLSGQVHCSMPKERRAWLPQQLALDLTFPMSVEELMLTGRWPTHGTFKRY
FT                   GPDDYRHMHGVMQRLGLSGLAHRPLGELSGGQRQRALLGRTLMQEAELLLLDEPFANVD
FT                   THTVEILCDTLRDIANQGATVIVVLHDMEQLARLADCVLLLAGGHAQWVEPETLLERHH
FT                   APARRHAHTQAPFISLNLPDVPPCSTY"
FT   gene            249948..252008
FT                   /locus_tag="Csal_0223"
FT   CDS_pept        249948..252008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0223"
FT                   /product="choline/carnitine/betaine transport"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57587"
FT                   /db_xref="GOA:Q1R121"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R121"
FT                   /protein_id="ABE57587.1"
FT                   /translation="MTTQSNNEAPTRDRLNGPVFYSSVIGIVAFSLWTMVATDQANTII
FT                   NAILGWISNTFGWYYFLTVVIYLVFVIYLGVSRYGSIRLGPEHSRPDFNIFSWSAMLFS
FT                   AGIGIGVIFFALAEPLTQFYNAPDAPEDQVAAARHAMELTFLHWGLSGWGIYTLVGMAL
FT                   AFFSYRHNLPLTIRSALYPIFGERIYGMIGHVVDTAAVLGTVFGIAASLGIGVIQLNFG
FT                   LDYMFGIPKGTWTQVVLVLGIVLFATISAVTGVERGIRRLSEFNILLAVLLLLFVLFAG
FT                   KTIFLLNALVMNIGDYLTNFVSLSFNTYAFDRPTGWLNGWTLFFWAWWIAWGPFVGLFL
FT                   ARISRGRTIRTFVLGTMTLPIIFMFLWMSLLGNSAIDMAMNGASEFGEQVMNNPPAGIY
FT                   LFLESYPMPLLTTAAVSILAIVFFITSGDSGALVLSNFTSKLKNVNSDAPVWMRILWSA
FT                   VIGILTLSLLLAGGLTTLQSAVVITGLPFSIVLFFMMAGLLKALKLEAFKEDSRRLSLA
FT                   GQLSGRTGGGERDSRNWQQRLRRAMSFPGKKQARRFMEETCKPAMEAVRDSLQEQGVSV
FT                   EINQGVQNGDDYLSLNVDFEDEQNFTYQVWSQGFSTPGFAMHAPHADSRYYRLEVYLLE
FT                   GSQGYDLMGYTRDQVIGDILDQYELHMQFLHLNRIEPGNINMPDSPEQPPS"
FT   gene            253773..256466
FT                   /locus_tag="Csal_0224"
FT   CDS_pept        253773..256466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0224"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57588"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R120"
FT                   /protein_id="ABE57588.1"
FT                   /translation="MSADNDAIAFYHRYAGKAMPGQSGDSCHLLAWHSLDVAAVGWHLL
FT                   APERPLTQQLALRLGIETEPLRRLLVFLLGLHDLGKFSRAFQEVLKLTLEGMAKPLGKP
FT                   YLERHDRLGVLLWDAWWRQWRREGVLHWPPDDQTPARKLLEPMASLMAPFFGHHGRPVV
FT                   TGRLNVEAFYGSDAQVDDVTAARDFIADWAKVVEPHWPVELLLDEEWLDVFRTLSWTIA
FT                   GWATLSDWLGSHREYFPYCERAMSLSEYWSRALGQAESVLQATGFAASPDPVPYESLAQ
FT                   WFSADITPTPLQQKAEAISLEAGPQLFILEDVTGAGKTEAACILAQRLLAAGHGEGLYF
FT                   ALPTMATSNAMYARLGDLHYRFYSAESRPSFVLAHGARQLNEDFERAVMAAQPGDNDYA
FT                   AIDASASTQCSRWLADSNKKALLADVGVGTIDQALMGLLPFRHQSLRLLGLARKVLIVD
FT                   EVHAFDHYMQTLLHQLLAHHARQGGSAILLTATLPFAMRQALVNAWQQGLGYESAALSS
FT                   TDYPLLTHSGQGAHRETPLATRPEVMRRVEIGWLTQEEDAIAEVSRGIEAGDCIVWVRN
FT                   TVDDAIRAWQAIRDIHSDPERCLLFHARFAMVDRRRIESDVIERFGKTSTPSIRRGQVL
FT                   ITTQVFQESLDCDADRMISDIAPIDLLIQRAGRLQRHQRGERQPPRLLVLAPEWEESPK
FT                   ADWLSRAHRGTQAVYQDTSLIWLTQRVLRELGAIEMPDAARELIERVYACSIDEIPEAL
FT                   EQARLERSGMNKMVGSMATHNTLDLQDGYRLNEDFDQWQEERDVGTRLSDESSVNVVLL
FT                   KRQDDSLVLWADGEHHADMLSQCRLRESQVRKLAELPERDAESWEALQERYKALRFTRP
FT                   WLPEEDDDCRYDSQWGVELARSEQKR"
FT   gene            256545..256880
FT                   /locus_tag="Csal_0225"
FT   CDS_pept        256545..256880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57589"
FT                   /db_xref="GOA:Q1R119"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R119"
FT                   /protein_id="ABE57589.1"
FT                   /translation="MATPHNPPAAVRRALRKLGADIHDARRRRRLTMAVVAERAFTSRS
FT                   TLQRIEAGDASVGIGIYASVLQALGLLDGLADIADIGNDSVGQALASAELPKRVGSKRL
FT                   PRSSHND"
FT   gene            256873..258120
FT                   /locus_tag="Csal_0226"
FT   CDS_pept        256873..258120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0226"
FT                   /product="HipA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57590"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R118"
FT                   /protein_id="ABE57590.1"
FT                   /translation="MTEFEVHIDLGGSTFPVGLARCNRVRGTERILFEYDAEWLASPDR
FT                   FSLEPALALTRGAFAPPAGMTSFGSIGDSAPDTWGRRLMQRAERRRAAREGRSVRTLAE
FT                   SDYLLGVSDETRLGALRFRRVGETSFQAPIQAGVPALVELGRLLQVTERVLRDEETDED
FT                   LQLIFAPGSSLGGARPKASVIDQYGHLAIAKFPKDTDEYSVETWEEIALRLANQAGIVT
FT                   PQHELVDVGGRAVMLSRRFDRDGTIRIPFLSAMAMMGARDGEPGSYPEMVDALTAHGAQ
FT                   GKTDAHALYRRVVFSVMISNVDDHLRNHGFLWLGNAGWSLAPAYDLNPVPSDLKARVLT
FT                   TNIDLDESTCSVDLLEAASGYFGLTLANARRIIKDVASVTATWRNTARAVGARPAEIER
FT                   MASAFEHDDLQHGLAL"
FT   gene            258294..259988
FT                   /locus_tag="Csal_0227"
FT   CDS_pept        258294..259988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0227"
FT                   /product="CRISPR-associated protein, Cse1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57591"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R117"
FT                   /protein_id="ABE57591.1"
FT                   /translation="MPMNLLTDPWLPFRRSDGSLLYRPPSALADPDILDLALPRADFQG
FT                   AAWQFLIALLQTAMTPKNTDAWLDRYQTPPSVEEFEAALAPFSRAFELDGEGPRFMQDL
FT                   DPLEDVKDAPVAGLLIDSPGANGIKNNTDFFVKRGRVEAVCPDCAALALYTMQINAPAG
FT                   GAGIRVGLRGGGPLTTLILPEDETKSLWERLWPNVMPADAVGQPGQTWRPPTVDDADLF
FT                   FWMSDTRVSDKKGTEVFPDQVHPLHALWSMPRRYRLLFEDESGCCDLCGRECSRLVRRL
FT                   RSKKQGANYDGPWRHPLTPYRRLNPKKTDELPLSSKGQPGGLGYRHWPGLVLEDEASSG
FT                   AMPARVVTHHLHKYRMVESARDDGEAFDAMFRHARLWVFGYDMDNMKPRGWYSVEMPLV
FT                   GVPEAHQEILRDWVKRFVDLASDVAWQVRNQLKRAWFKRPEDAKGDMSQIDAQFFEATQ
FT                   LAFFDVLRQMSETLRDYGDTPALSPEIHQKWHLTLKREALRLFDAQAISGPLEGMKMQQ
FT                   LERITSARRYLLAYLNGSGKKVQVFAQVGGFELKAPQSEGNRKGNAA"
FT   gene            259985..260677
FT                   /locus_tag="Csal_0228"
FT   CDS_pept        259985..260677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0228"
FT                   /product="CRISPR-associated protein, Cse2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57592"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R116"
FT                   /protein_id="ABE57592.1"
FT                   /translation="MSEIEQDAVSEDASEAGKSAVESHLYALDNNEAFELRLWWQRLVM
FT                   DEQELKRYTKRRPYPRGVRAALRRCDAIESVLLTEAFRHLWQALETRVWKEMPGDGPSQ
FT                   WRDRRLEAWAVIAAIVSELRAETFGAPLGKRLGENRPNTGDTPRMSDLRFQQLLDCHTP
FT                   KELIRRFRRALKLADGTGVSVVRLADMVALWHREQRGQYRPEATQRFAFLMSDDYFKAR
FT                   SQKMATSD"
FT   gene            260737..261843
FT                   /locus_tag="Csal_0229"
FT   CDS_pept        260737..261843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0229"
FT                   /product="CRISPR-associated protein, Cse4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57593"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R115"
FT                   /protein_id="ABE57593.1"
FT                   /translation="MSHFIQLHLLTSYPPSNLNRDDLGRPKTAFMGGARRLRVSSQSLK
FT                   RNWRTSTLFEEAVDGHRGTRTKRLGKQVFDRMKDAGADDKIAGSSAEKIASIFGTLRKV
FT                   GKGEKHEFEIEQLVHVGPEEIAALETLANTLGAEKREPTDEEITNVLLRRPTAVDIALF
FT                   GRMLTGEKNKLVKYSVEAACQVAHAITVHAAEVEDDYFTAVDDLNTGDEDRGAAHIGEA
FT                   GFAAGLFYLYLCIDRDLLVENLQGNADLADRAIAALVESAVKVSPKGKQNSFGSRAHAS
FT                   YLLAEKGDQQPRSLSASFLQPVNGEGQAIKAISKLERQAQAFDDAYGAGADSRFVLSAE
FT                   PDYEKPPLKGDVQTGNLQDLLTFLKGDD"
FT   gene            261855..262637
FT                   /locus_tag="Csal_0230"
FT   CDS_pept        261855..262637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0230"
FT                   /product="CRISPR-associated protein, Cas5e family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57594"
FT                   /db_xref="GOA:Q1R114"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R114"
FT                   /protein_id="ABE57594.1"
FT                   /translation="MTGHLVFRLYAPMASWGEAAVGEARPTATYPGRGAILGLIGAALG
FT                   IRRDDDEGQLRLRQSLGIAVKQRSPGWLLRDYHTVQVPPSQSKVNYRSRREELSVPKDA
FT                   LNTILSSRDYRCDGLWVVALRLMPDAVWTLDELKSALERPRFTLYLGRKACPLAAPLTP
FT                   AIVEADHWRGALDHGFDSATDPERTWLPLIGNEAQDLRLLRLPGQVLYAWEGEADALDG
FT                   NADMAESSETWDEPLHRRRWQFGARLEHRRIESVEGQS"
FT   gene            262637..263329
FT                   /locus_tag="Csal_0231"
FT   CDS_pept        262637..263329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0231"
FT                   /product="CRISPR-associated protein, Cse3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57595"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R113"
FT                   /protein_id="ABE57595.1"
FT                   /translation="MYLSSVRVDLNALTREQLFDVLEGGAYTAHQLLWTLFADTSEGER
FT                   PFLFRQEMEEAANGKSQGLPRFYVYSTRRPEAVAGLDVQCKPFAPQLAKGERLAFRLRA
FT                   NPTVAKSAGEGQRSHRADVLMNARKPFSPGERTSQACVDAMETAARDWLAERAPRFGFE
FT                   LPVAPEMGAYRQHELKKSDRREPIRFSSVDYEGLLEVTDPRRLIETLAHGVGRAKAFGC
FT                   GLMLLRRP"
FT   gene            263339..264259
FT                   /locus_tag="Csal_0232"
FT   CDS_pept        263339..264259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0232"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57596"
FT                   /db_xref="GOA:Q1R112"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R112"
FT                   /protein_id="ABE57596.1"
FT                   /translation="MGFIPLKPIPVKDRMSMIFVGMGQIDVRDGAFVVIDDVNGERMHI
FT                   PVGSVACLLLEPGTRVSHAAVKLASVVGTLLIWVGDAGVRLYSAGQPGGARSDKLLYQA
FT                   QLARDEKLRLKVVRKMFELRFGEEPPSRRSVDQLRGMEGARVRKTYQLLAKQYGVKWHG
FT                   RRYDPTQWDASDVANQCLSAATACLYGITEAAILAAGYAPAIGFLHTGKPLSFVYDIAD
FT                   IVKFETVVPAAFRVAARNPPMPEREVRVACRDAFKQARLLQRLIPMIEDVLAAGEIEPP
FT                   PPPPDAVPPAIPEPESVGDAGHRSQ"
FT   gene            264261..264557
FT                   /locus_tag="Csal_0233"
FT   CDS_pept        264261..264557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0233"
FT                   /product="CRISPR-associated protein, Cas2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57597"
FT                   /db_xref="InterPro:IPR010152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R111"
FT                   /protein_id="ABE57597.1"
FT                   /translation="MAMLVVVTEAVPPRLRGRLAVWLLEIRAGVYVGDVSKRIREMIWE
FT                   QIEVLAEEGGNVAMAWASNHESGFEFQTYGDNRRVPIDHDGLRLVRFLPPQGN"
FT   gene            complement(266625..268001)
FT                   /locus_tag="Csal_0234"
FT   CDS_pept        complement(266625..268001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0234"
FT                   /product="trehalose 6-phosphate synthase"
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57598"
FT                   /db_xref="GOA:Q1R110"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R110"
FT                   /protein_id="ABE57598.1"
FT                   /translation="MTRLVVVSNRVSIPEEGKPQAGGLAVAITGALSEHGGLWFGWDGR
FT                   VKQVPSNRPSVVTRDNIDYATLSLSKEDYDNYYLGFANEVLWPVFHFNLGAMDFQLDHV
FT                   KAYSRVNARFAEALVTLVQGDELIWVHDYHLLPLGKELRERGIRQPLGFFLHIPFPSFD
FT                   LLRALPCYRELLEDLLHYDLVGFQTENDRHAFHEALVETFDATLEGDNVIDCLGHRLRT
FT                   GVYPVGIDVDEAIAEAEHAITQAPACQFQADLGKRDLIIGADRLDYSKGLVQRFNAIET
FT                   LLTHFKHRRQRTIFMQIASPSRSAIPEYDELRRQLEGMAGHINGTYADIDWLPVHYLNQ
FT                   TYAHADLMGLFRAARVGLVTPLRDGMNLVCKEFVAAQDPDDPGVLVLSDLAGAARELSG
FT                   ALLVNPYDVHDITSAIERALNMPRDERRQRYREMIDVLRRNSLLTWRQRFIDDLAQQAG
FT                   "
FT   gene            complement(267998..269797)
FT                   /locus_tag="Csal_0235"
FT   CDS_pept        complement(267998..269797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0235"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57599"
FT                   /db_xref="GOA:Q1R109"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R109"
FT                   /protein_id="ABE57599.1"
FT                   /translation="MTESTDMPSTSLELGLIGNCQIGALIDTDGRIVWCCLPRFDGDPF
FT                   FSRLMDTTDRGYFAIELQDQVESRQYYQRNTAILCTELTDKYGGRIRITDFCPRFRLYD
FT                   RTFRPEIVVRRVKCLSGTPVIRIRLRPTTAYGEREPETTHGSHHIRYLGQGRVTRLTTD
FT                   ASITHVLQESPIVLEGELNFALGPDESVTESVNAMCQRFETQTTTYWQEWARGLAIPFE
FT                   WQNAVIRAATTLKLSTFEDTGAVIAAMTTSVPEAADTQRNWDYRYCWLRDAYFVVHALN
FT                   RLGATATMENYLNYIINLVVGAAEHELQPLYGIGGETRIEEYEVSGLAGYRGMGPVRVG
FT                   NAAYHQVQHDVYGAVVLAANQAFFDERLARPGDEALFRRLTILGEQAARLFDKPDAGIW
FT                   EYRGRARVHTYSSIMCWAACDRLARIAAHLGLDEDATRWRQQADRMHDVICREAWSESR
FT                   QAFTESFGGDTMDASLLLMHELDFLAADDPRFVSTVGAIEAELRRGDHLFRYAAADDFG
FT                   DPENAFNICTFWYIDALWAIGRRDEARRLFENMLECRNAQGLLSEDLDTISHELWGNFP
FT                   QTYSMVGLINSALHLSRSWEEAV"
FT   gene            complement(269794..270540)
FT                   /locus_tag="Csal_0236"
FT   CDS_pept        complement(269794..270540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0236"
FT                   /product="trehalose 6-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57600"
FT                   /db_xref="GOA:Q1R108"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R108"
FT                   /protein_id="ABE57600.1"
FT                   /translation="MMPETPPPLPRHDWALFLDFDGTLVPLADHPRDTSVSEALRHLVA
FT                   RLAHELDGAVAIISGRPVADLEALLAPLDLPLAGVHGLEWRDTSGGYHSAVAHPERLAA
FT                   CRDALADFVAGHDGLHYEDKRVALALHYRGAPELAAECRHFMAEWQQALGDDVETVAGK
FT                   CVIELRPAGVHKGTAIARLLDDPVFQGRRPVFVGDDVTDEDAFREVNARGGLSVRVGDG
FT                   KTAATYYLESVKKVLTWLEHLPSRPT"
FT   gene            complement(270653..270964)
FT                   /locus_tag="Csal_0237"
FT   CDS_pept        complement(270653..270964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57601"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R107"
FT                   /protein_id="ABE57601.1"
FT                   /translation="MHKHIDWDAPGNASVTRHYASDKQHEVQPHPGMMLSARYQGMVVR
FT                   VEVEAYREDDALSIGKVAALIDSHGKRHQTHGDLSIGDYVRLPDDKRALEPAVEDEED"
FT   gene            complement(271038..271667)
FT                   /locus_tag="Csal_0238"
FT   CDS_pept        complement(271038..271667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0238"
FT                   /product="OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57602"
FT                   /db_xref="GOA:Q1R106"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R106"
FT                   /protein_id="ABE57602.1"
FT                   /translation="MRRALLVSSLALTAALVPATSAFAYGEGDFYTRFGVAKVAPQSDN
FT                   GDFGAPLDMQIDADDDSGFAFTLGYRFHDKFGVELLAAQRFEHQVALDGDDLASIKHLP
FT                   PTLTLQYYPLGGTDARVQPYLGAGLNYTHFSDEHLDGGKLDLDDSWGAAAQLGIDLLID
FT                   DHWALNAAAWYLDIDSDATATLAGNDYDAKIHIDPIVVMGGLSYRF"
FT   sig_peptide     complement(271593..271667)
FT                   /locus_tag="Csal_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            complement(271846..273672)
FT                   /locus_tag="Csal_0239"
FT   CDS_pept        complement(271846..273672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0239"
FT                   /product="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57603"
FT                   /db_xref="GOA:Q1R105"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R105"
FT                   /protein_id="ABE57603.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLSQSGTLDRKAEGQERIMDS
FT                   NDQEKERGITILSKNTAIRWQSPDERDYHINIVDTPGHADFGGEVERVMSMVDSVLLLV
FT                   DAVDGPMPQTRFVTQKAFDRGLKPIVVVNKIDRPGARPDWVIDQIFDLFDNLGATEEQL
FT                   DFPIIYCSALDGVAGHEPDQLADDMTPMFKSIVDIVEPPKVELDAPFQMQISALDYNSY
FT                   VGVIGLGRIKRGSVRPGQQISVISKEGNVRKGKVGQVMTHLGLERVQTEEASAGDIICI
FT                   TGIDDLAISDTLCDPAAVEAMPALTVDEPTVSMTFQVNDSPFAGKEGKFVTSRNIKERL
FT                   EQELIHNVALRVEQGDSPEKFTVSGRGELHLSVLIESMRREGYELAVGRPEVIIREIDG
FT                   VKQEPYEEVIIDCEEQHQGAVMEELGYRKGEMTNMNPDGKGRVRLDFIIPARGLIGFRG
FT                   QFLTLTSGTGILTSRFDHYGPLKPDASIERRNGVLVSMVSGKALAYALFALQDRGKLIV
FT                   EHGTEVYEGMLVGINNRADDMAVNPTKAKKLDNMRASGNDENLVLTPPVRFTLEQAIEF
FT                   LDDDELVEITPQHIRLRKKHLTENERKRAKKK"
FT   gene            complement(273929..274921)
FT                   /locus_tag="Csal_0240"
FT   CDS_pept        complement(273929..274921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0240"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57604"
FT                   /db_xref="GOA:Q1R104"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R104"
FT                   /protein_id="ABE57604.1"
FT                   /translation="MSHLSLAYDVVQRLRGHWRRSLSEPLRGRSAILVLPRVLADDATA
FT                   RLPHHAPYALGPESFRRLLDHLTDHAQIVTLANARRLHRDPLPRIALTFDGGWRDTAEV
FT                   ALRQLERLALPASMFLTTGWVNRARGDWWNTLGDALWEGIQPARVRDCLGDAGLPLPPA
FT                   RPAHPGTAYSHALRAYLEGLAHHTDPLTLARLGDALGDELDIPPQTLDPFSIRRLESSG
FT                   LVRFGARGVSATPLDALDDAQVQWQIRQSRRQLGVLCRDPLPGFAYPQAEASPRVRLLA
FT                   QRCGIQEGLHGHAGWLSHRDDPLALPRFPITLPVASSAGRLYDWLLGQP"
FT   gene            complement(275063..276028)
FT                   /locus_tag="Csal_0241"
FT   CDS_pept        complement(275063..276028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57605"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R103"
FT                   /protein_id="ABE57605.1"
FT                   /translation="MRTYSLLIDASHAPEHLERCLSALARSISGFRGHTETLVQLRTLD
FT                   TRTQLLLEQRDIRFALLPQHGQGALRHHGATHLNGEVLIFLDAALEVPDDWLDRLAEAF
FT                   RKQSADAVVFAQAPADPLVPALADWYATRIRRGFGDHPWEWPTGQLAITREWYERLGGH
FT                   DPRLETCADLDILVRLWRCHARLRWQTSPSLIDHGAPRRLGPWWRRQRRHQARYLYTAS
FT                   AARHPRFVIPRLGGTLVQWGSVPLALLLWIPPAPTPGVASLVISAWPATVMTWRDGMPP
FT                   RSRACRLALWRWCLHALQLTATGAALLSPPCRRRLRRDPV"
FT   gene            276169..276438
FT                   /locus_tag="Csal_0242"
FT   CDS_pept        276169..276438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R102"
FT                   /protein_id="ABE57606.1"
FT                   /translation="MRSPIAPKWCIGQQVCTFMMLMWCPCTFMWRGGRYPGAEPCTTLV
FT                   DFLSLDHALSVFAPKCINGWHSFCIAKRKRIPVGSRRRACYKRR"
FT   gene            276486..277895
FT                   /locus_tag="Csal_0243"
FT   CDS_pept        276486..277895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0243"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57607"
FT                   /db_xref="GOA:Q1R101"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R101"
FT                   /protein_id="ABE57607.1"
FT                   /translation="MSEKTLALIEEHDIKWVDLRFTDTKGKEQHVTIPAGAVDDEFFEN
FT                   GQMFDGSSISGWKGINESDMILRPEDGSGYLDPFTEDATLVLRCDIIEPATMQGYERDP
FT                   RSIAKRAEAYLKSTGLGDTAFFGPEPEFFIFDEVHWNADIQGAMYKITSEEGAWATDST
FT                   TVEGGNLGHRPRVKGGYFPVPPVDSFHDIRSAMCNTLEAIGQSVEVHHHEVANAGQNEI
FT                   GVKFNTLVKKADEVQEMKYVIHNVAHAYGKTATFMPKPLVGDNGSGMHVHQSFWKDGTN
FT                   MFAGDEYAGLSETALYYIGGIIKHARALNAFTNASTNSYKRLVPGFEAPVMLAYSARNR
FT                   SASIRIPYTASPKGKRVELRFPDPTANPYLCFSAMLMAGIDGIKNKIHPGDAMDKNLYD
FT                   LPPEEGKSVPTVASSLDQALEALDADRAFLTEGDVFTDSMIDAYLELKQEEVDRLRMAT
FT                   HPIEFDMYYSC"
FT   gene            278093..278692
FT                   /locus_tag="Csal_0244"
FT   CDS_pept        278093..278692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57608"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R100"
FT                   /protein_id="ABE57608.1"
FT                   /translation="MRGLIPIGGWTVLMVGACLSVSLAQATPIYRSVDSQGNVTYSDRP
FT                   GGDQVEVAPVNTVPSRPAPAPRETAANEAASGAGEPKASTFTPYERLRIAAPTNESTLP
FT                   TGAAGDTQVSVALSPELREGHRLRLVVDDEVRQPPQQATTFSLTGLERGEHTLRVELVD
FT                   SEGQVRQRSAPVTLYVQRASVYLPANPNNPRNSGNP"
FT   sig_peptide     278093..278173
FT                   /locus_tag="Csal_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.643 at
FT                   residue 27"
FT   gene            278829..279926
FT                   /locus_tag="Csal_0245"
FT   CDS_pept        278829..279926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0245"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57609"
FT                   /db_xref="GOA:Q1R0Z9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z9"
FT                   /protein_id="ABE57609.1"
FT                   /translation="MTMDNGRAMPEPSQQQFLEQQRLLEHLTTAVVLLDGELRLRWMNP
FT                   AAESLLATSRVRVVGQCLESLAGVEGSVEAVLIKARDELHPFTQREATLVLPSGDTATV
FT                   DFTVTPLSADELLIEIEPRDRLLRISREEALIARQETIKVLTRGLAHEVKNPLGGIRGA
FT                   AQLLERDLPDPQLAEFTRVIVEEADRLRDLVDRMLGPNSMSRHEPLNIHKVLERVRTLL
FT                   EAEHPRIDYVRDYDPSLPDLEGDEAQLIQAVLNVARNAVQAMEEHGVETPRLILRTRAR
FT                   RQFTLGAERHRLVCELGILDNGPGIPETLRETLFYPMVSGRAEGSGLGLSIAQSILHQH
FT                   QGLIECDSVPGCTEFRLLIPLESHH"
FT   gene            279942..281351
FT                   /locus_tag="Csal_0246"
FT   CDS_pept        279942..281351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0246"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57610"
FT                   /db_xref="GOA:Q1R0Z8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z8"
FT                   /protein_id="ABE57610.1"
FT                   /translation="MTDVARIMIVDDDRAIRWVLERALAQPDLEVESFERADSALERIL
FT                   RQPPDVLLTDIRMPGLDGLDLMARIREKYPDLPVIVMTAHSDLDSAVASYQGGAFEYLP
FT                   KPFDVDEALALVRRGVAHARERRTPAAVPEGLSAEIIGEAPAMQEVFRAIGRLSQSHIT
FT                   VMINGESGTGKERVAQALHQHSPRHAAPFIALNMAAIPKDLMESELFGHEKGAFTGATS
FT                   QRRGRFEQADGGTLFLDEIGDMPAETQTRLLRVLADGEFYRVGGHTPVKVDVRIIAATH
FT                   QHLERLVEDGRFREDLFHRLNVIRVHLPRLAERREDIPRLAQHFLAEAAKELATEPKVL
FT                   TQEAEQHLTRLPWPGNVRQLENTCRWLTVMASGREVLIEDLPPELRDVEGTESAGGDWR
FT                   GAFREWADRALAAGHTHLLEEAVPDFERILIETALKHTGGRKGEAAELLGWGRNTLTRK
FT                   LKVLLPALADE"
FT   gene            281484..282458
FT                   /locus_tag="Csal_0247"
FT   CDS_pept        281484..282458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0247"
FT                   /product="Phosphonate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57611"
FT                   /db_xref="GOA:Q1R0Z7"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z7"
FT                   /protein_id="ABE57611.1"
FT                   /translation="MFSQTLPLTRPALGLAFAALVAGVSTAQADFQLSERYTDADGDLV
FT                   ADVPEDESQWRDPDTLVFAYTPVEDPAVYADVWSGFLDHMEEVTGKKVRFFPVQSNAAQ
FT                   IEAMRAGRLHVAGFNTGSNPLAVACAGFRPFAMMAAEDGSFGYEMEIITYPGSGIDEVE
FT                   DIKGKTLTHTSETSNSGYKAPTALMASEFGMTSGEDYEVDFSGKHDNSILGVANHDYEV
FT                   ATIANSVKARMLERDVIDADQIEVIYQSDTFPTTAYGVAHDLAPELQEAIKEAFFGFDW
FT                   EGSALAEEFGKNGESQFIPITFKKHWSVIRQIDAANGVDYQCS"
FT   sig_peptide     281484..281573
FT                   /locus_tag="Csal_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 30"
FT   gene            282536..283354
FT                   /locus_tag="Csal_0248"
FT   CDS_pept        282536..283354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0248"
FT                   /product="Phosphonate ABC transporter PhnC, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57612"
FT                   /db_xref="GOA:Q1R0Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0Z6"
FT                   /protein_id="ABE57612.1"
FT                   /translation="MLELQRLTKTYATGDTALREVSLAVPRGQVVGLIGPSGAGKSTLI
FT                   RCINRLVAPSGGRILLGDVDLAAVGRAELRRQRRRIGMIFQEYALVERLTVMENVLSGR
FT                   LGYVPFWRSFTRRFPGRDIENAYRLLDRVGLLAHADKRADALSGGQRQRVGIARALAQE
FT                   PALLLVDEPTASLDPKTSRQIMRLILEVCEERDLPAIVNIHDVPLAQQFMHRLVGLHAG
FT                   EVVFDGAPVALDETVLATIYGAEDWASSGREPAPEREPEDTERHLAEVGR"
FT   gene            283351..284163
FT                   /locus_tag="Csal_0249"
FT   CDS_pept        283351..284163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0249"
FT                   /product="Phosphonate uptake transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57613"
FT                   /db_xref="GOA:Q1R0Z5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z5"
FT                   /protein_id="ABE57613.1"
FT                   /translation="MNEATPAYPTHWRRPARMLHDRRWRWLVQASVLAYLVLALGSFDV
FT                   EWARVMEGLSRAQRFAHGFLQPDFTSRWSDIRQGLIESLTMTLTATVVGVAISVPIGIG
FT                   AARNLVSAWIYRCCRAIIAVSRSLQEIIVAIFLVAMFGFGPLAGFATLSFASIGFIAKL
FT                   LADDIEEADPRQVEAIRATGAGWWQVLHYAIQPQVMPRLIGLSLYRLDINFRESAVIGI
FT                   VGAGGIGATLNTAIDRYEYGSAGAILLIVIAIVMVAEYGSSYLRRFLQ"
FT   gene            284160..284993
FT                   /locus_tag="Csal_0250"
FT   CDS_pept        284160..284993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0250"
FT                   /product="Phosphonate uptake transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57614"
FT                   /db_xref="GOA:Q1R0Z4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z4"
FT                   /protein_id="ABE57614.1"
FT                   /translation="MKSTSANAGAPASHADAWTFRTPRARLALWFGWLALVALFVYCWR
FT                   VMNADTMWVFVADAPRQAADLGSRMWPPSLTYLPELLAPLWDTLNIATLGTVGGVIMAV
FT                   PVAFLAARNTTPSRLWVRPVALWVIVTSRSINSLIWALLLVAVLGPGLLAGVVAIALRS
FT                   IGFVGKLLYEAIEETDARQVEAISATGASAAQRLDYAIVPQVMPAFWAIALFRWDINIR
FT                   ESTILGLVGAGGIGLKLQASINVLAWPQVATILLVILATVLVSEWVSARVRQAIM"
FT   gene            285207..286070
FT                   /locus_tag="Csal_0251"
FT   CDS_pept        285207..286070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0251"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /EC_number="4.1.3.32"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57615"
FT                   /db_xref="GOA:Q1R0Z3"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023687"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0Z3"
FT                   /protein_id="ABE57615.1"
FT                   /translation="MATPSQHDLRNDFRALLASSECYFTASVFDPMSARIAADLGFEVG
FT                   ILGGSVASLQVLAAPDFALITLSEFVEQATRIGRVTRLPVIADADHGYGNALNVMRTIT
FT                   ELERAGVAALTIEDTLLPAQYGHKSTDLIPLDEGVGKMRAALEARIDPAMAIIARTNAG
FT                   QLDDEAAVERVCAYQAAGVDAICLVGVRDFDHLERLAAPLDIPLMLVTYGNPELRDRAR
FT                   LAALGVRVVVNGHAAYFAAIKATYDCLREQRDIAASELNASQLATRYSTLDEYREWARD
FT                   YMDVKE"
FT   gene            286182..287519
FT                   /locus_tag="Csal_0252"
FT   CDS_pept        286182..287519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0252"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57616"
FT                   /db_xref="GOA:Q1R0Z2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z2"
FT                   /protein_id="ABE57616.1"
FT                   /translation="MSAMQWERLLDPTRLNDKHGGSREEIGRSPFHKDHDRIVFAGSFR
FT                   RLGRKTQVHPLTDNDHIHTRLTHSLEVGCVGRSLGMIVGEQLRERLPAWITPADLGVIV
FT                   QAACLGHDIGNPPFGHAGEYAIRDWFKRAEADGSGLLADLAPAEREDLLTYEGNAQGFR
FT                   IVTQIEYNQFNGGMRLTAATLGTMLKYPWTVERASRAGKFGCYQSERELLGEVAERLGL
FT                   LPRGETAWCRHPLAYLVEAADDICYALLDLEDGLEMGILRFDEVAEILIQIAGGAPEGY
FT                   DGMRARGVSQRRRIATLRGAAMERAVNDVAAVFVAHESALLGGTLSEDLLELCHPDLGW
FT                   GVGTAKRIARERIFQNERKAKLEIGAYTTLGILLEAFIGAAHELHYSGQSSFKHQRVLA
FT                   LIGENTPKSSWSLYASYRRMLDFIGGMTDHYAVDLAQEMGGRLRGE"
FT   gene            complement(287556..288470)
FT                   /locus_tag="Csal_0253"
FT   CDS_pept        complement(287556..288470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57617"
FT                   /db_xref="GOA:Q1R0Z1"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z1"
FT                   /protein_id="ABE57617.1"
FT                   /translation="MPLRHFAVLLSGLALTSLAGCASLSPQNAAPAPAEHGQQALAQAE
FT                   DCCASLAALPFQALDADQTQRLKLDTSAPAHRFEDGKSFFQAFALPRDAGPLSFELTST
FT                   IVDGQVFAPTVLVLDEAFQPSQRIASDKFRYRGPSGFAPARLAAAFDLTPGPEAAYLVV
FT                   YSNDAARQGSTRYESAEKVYARVRGLAPPPGPDPVAEHTATGNVTLASEPHDGGGGGLL
FT                   TPILGDRATTPTPEPRTRATTDASSTAVERTRDRDFDYRRMIDAALKAGDIELAMQLAE
FT                   RAEREGQHGTRAWLAERLRAVSP"
FT   sig_peptide     complement(288381..288470)
FT                   /locus_tag="Csal_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 30"
FT   gene            complement(288580..289950)
FT                   /locus_tag="Csal_0254"
FT   CDS_pept        complement(288580..289950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0254"
FT                   /product="porin, LamB type"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57618"
FT                   /db_xref="GOA:Q1R0Z0"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Z0"
FT                   /protein_id="ABE57618.1"
FT                   /translation="MSTSRQFMRRPLLATLVGASCLMPALAHADINPNFFGYARSGIGS
FT                   TAGGGSQTCFKAAGAPAKYRLGNECETYAELGLGANLFDQRGTSFDFASRVAYVTSQAN
FT                   DDESLKDDDNNIALREMYVTGTNAIGGLPNGSTLWAGKRFYKRHDIHMNDFYYWDVSGP
FT                   GVGISDIDMGIGNLSLAWVRSTGSDGDNLPDEDQRLSDDTIDLRLTDIATNPGGSLQLG
FT                   VDYGRASLAEWQEEYYDDNGIDYDEGDKGWMGTIEHTQSNWFGGSNTVALQYATDGIIT
FT                   RDGNAVGRSTGSLGQEGDMWRVLDHGHVWLVPDKLDLLYTAIYEDKNMDDNTGRKWFSA
FT                   GVRPVYYWNDIMSTAVELGYDHIEPQSNVSSYDGDDHHVTKLTIAQQWSAGRGAMIRPT
FT                   IRLFATYAKWNGDAYGERVNGYRQANALDTGAGPNNVDFNDTDGLTFGAQMEVWWGS"
FT   sig_peptide     complement(289861..289950)
FT                   /locus_tag="Csal_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 30"
FT   gene            290655..292283
FT                   /locus_tag="Csal_0255"
FT   CDS_pept        290655..292283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0255"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57619"
FT                   /db_xref="GOA:Q1R0Y9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y9"
FT                   /protein_id="ABE57619.1"
FT                   /translation="MSEFTWLDSVVLVVYILLVALIGARFGRSQQSTQDYFLGGRRIPG
FT                   WAIGLSVMATQASAITFIGAPGWGFEGGLERLVTFLNVPLAMAVLIFLLVPVFHRAGIY
FT                   SIYELLERRFGPATRSVSAGLFLVARGLATGVVLYAPALVLSVVTGWSVNLTIVVMAVL
FT                   AVSYTVLGGISAVIWTDVIQMFVLWLGALVSMGLMVASLPGGWSDVFAFGAAQGMFDTL
FT                   DLSLDPGVTYSLWAGLFGGIFLHIAYFGTDQSQIQRVLTSPDVQQGQRSLLIGGYLLVP
FT                   QMLLFLFIGVMLATYYDQHGLAAPDNLNELFPRYVVSAFPPGLAGLVIAGVFAAAMSSL
FT                   DSALNSLSAVSVRDFYTRYVRPDASEAHYLKASRWATVFWGLYATVFAFFAGNLGPVIE
FT                   AVNRIGSWFYGALLGTFLLAMLSHRTNARGALSGLVLGMVSVWGVESLFDISWLYNNLV
FT                   GVVVSLGVGYVVGLTAPAPSAAQLRDVVIEETAPDMQALLATRAARARSITPAARLTRR
FT                   RCIGLVAWFCLLLAGLALLQGWANA"
FT   gene            292276..292788
FT                   /locus_tag="Csal_0256"
FT   CDS_pept        292276..292788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y8"
FT                   /protein_id="ABE57620.1"
FT                   /translation="MPEALPLRLPRRLDALQAETRLRRLRAETFEAATLTLWAHALGTP
FT                   DDAPAGWLLCHARARRALLWPHALPAAPEHEGAEAELRLAASLPPSADVVSRLWFWERM
FT                   VARRHWQVTLRGTPARAVALPLWLGYSPNRRGGHRLMVISGLGGDALPTLKNAVLWELR
FT                   QLAGVPA"
FT   gene            complement(292872..294386)
FT                   /locus_tag="Csal_0257"
FT   CDS_pept        complement(292872..294386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0257"
FT                   /product="porin, LamB type"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57621"
FT                   /db_xref="GOA:Q1R0Y7"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR021570"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y7"
FT                   /protein_id="ABE57621.1"
FT                   /translation="MPLSGTMMRKPLVIAITFASLGVTANAHADISDEALEARLAALES
FT                   RVAAAEQRAAAAEQRAKRARATLKALEDTGLEKRLADVEAHAEGDLGLSLDAYARSGLL
FT                   LDSHGKSAPGGPFLTPAGSTGGAVGRLGNEPDTYVETTLNYKQRFDNGARSHYRMMLAD
FT                   SVTTSNDWTAEESNLNVRQAYVQFSELPSFTGAFEDAKIWAGKRFDRDNFDIHWLDSDI
FT                   IFLAGTGAGVYDIRLNDDWTSNVSLYGRSFSDFPIVSRENPDLTGSTDNLVFTLNNHIG
FT                   DWQWMVNGLSANDNDRRDTGNDASAADTGFHTMLAYHGNSFFGLGEGSFKAAALHGQGL
FT                   GAEVKSLGADGDLLDEARTSRLAVYGTTYVAPDWRLAPAMLAQHSTDRYARGDSYDWVT
FT                   LNARLANELTDNFEMQYEASYQWMDLDPKGYQGNNAVDGDYAKLTVAPTFKPQVGGFWQ
FT                   RPEIRLFASWSDWDEALNGFTNGDALGDDSFTGSEWTFGTQMEVWF"
FT   sig_peptide     complement(294297..294386)
FT                   /locus_tag="Csal_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 30"
FT   gene            294696..295955
FT                   /locus_tag="Csal_0258"
FT   CDS_pept        294696..295955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0258"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57622"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y6"
FT                   /protein_id="ABE57622.1"
FT                   /translation="MIRRLTLLAALAGATVGQAHAADLTISCGAVGAELTLCKEGVSAW
FT                   EEQTGHSVAVVSTPNSSTERLSLYQQILSAQSGDIDIMQIDVVWPGLLANHLLDLREIG
FT                   GKDIADGNFQTIVDNNTVDGRLVAMPWFTDAGVLYYRKDLLDKYDREVPETWQQMTETA
FT                   EAIQQAERQADNEEMWGYVFQGRAYEGLTCNALEWVASHGGGSIVDEQGEITIDNPRAA
FT                   AALDQAAEWVGHISPQGVLNYTEEQARGVFQSGNAVFMRNWPYAWSLVQSENSDVRGKV
FT                   GVTTLPHGPKGSSAATLGGWNLAVSKYSKHPELAVDLVKFLTSEAEQKRRALEGSYNPT
FT                   IKSLYQDKEVLAAVPFFGKLYDTFTNAVARPSAPTGNKYGRVSNAFFNAAHDVLAGNMN
FT                   GARAVSQLQDKLERMKRRRW"
FT   sig_peptide     294696..294761
FT                   /locus_tag="Csal_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            295969..296943
FT                   /locus_tag="Csal_0259"
FT   CDS_pept        295969..296943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0259"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57623"
FT                   /db_xref="GOA:Q1R0Y5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y5"
FT                   /protein_id="ABE57623.1"
FT                   /translation="MTASNSVATHPPAVTRRGRRQGTKVRRQRVRAAWLFLVPMLVTLA
FT                   MVAGWPLLRTFYFSFTDASLADTGEANFIGFENYLGYYQGAWYGLLTDSAWWQSVWNTL
FT                   FFSVVSVSLETVFGIIVALILNAEFKGRMLVRAAVLIPWAIPTIVSAKMWAWMLNDQFG
FT                   IINHLLMLLGLIDAPLAWTADADLSMWAVIIVDVWKTIPFVALLVLAALQMLPRDCYEA
FT                   AEVDGIHPIKVFFRVTLPLITPALLVAVIFRLLDALRVFDVIYVLTSNSTSTMTMSIYA
FT                   RQQLVEFQDVGYGSAASTLLFLIIALATVIYLYLGRRQLGGDE"
FT   gene            296940..297782
FT                   /locus_tag="Csal_0260"
FT   CDS_pept        296940..297782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0260"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57624"
FT                   /db_xref="GOA:Q1R0Y4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y4"
FT                   /protein_id="ABE57624.1"
FT                   /translation="MNTRFAKSLAKRIGFWSLIAVLLIYAVFPFYYAVITSLKPSSALF
FT                   QVEYWLSSVDFSNYVTIFTQGSFVQAIINSIVVAVSVVAIALLLGITAAYALGRVRFRG
FT                   RTTVMMIVLGVSMFPQVAVLSGLFEVIRTLNLYNSPGGLILSYTIFTLPFTVWVLTTFM
FT                   RQLPQELEEAAIMDGATPWITITKVFLPLMWPAMATTGLLAFIAAWNEFLFALTFTLTN
FT                   EERTVPVAIALISGGSQHELPWGPIMAASVTVTVPLVILVMIFQRRIVSGLTAGAVKG"
FT   sig_peptide     296940..297041
FT                   /locus_tag="Csal_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.734 at
FT                   residue 34"
FT   gene            297950..299563
FT                   /locus_tag="Csal_0261"
FT   CDS_pept        297950..299563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0261"
FT                   /product="alpha amylase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57625"
FT                   /db_xref="GOA:Q1R0Y3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y3"
FT                   /protein_id="ABE57625.1"
FT                   /translation="MKDNTFWWRGGVIYQIYPRSFLDSNGDGIGDLPGIIEKLDYVASL
FT                   GVDGIWLSPFFTSPMADFGYDISDYRDVDPMFGTLDDFKSLLSHAHALGLKVIIDQVIS
FT                   HTSDQHPWFQESRRDRQNARADWYVWADPKPDGTPPNNWLSIFGGSAWTFDSRRRQYYL
FT                   HNFLIEQPDLNFHNPAVRDAQLDNMRFWLELGVDGFRLDTVNFYFHDAELRDNPAIEPG
FT                   DTKTLGAPEANPYTWQRHVHDISRPENLDFLKRLRALMDEFPGTATVGEISEDSPLERM
FT                   AEYTANGDKLHMAYTFDLLNAPRSPAYIHEVIERFQRLAGDAWPCWALSNHDVMRSATR
FT                   WGAEEDAEAYPKVTLAMLLSLRGSVCLYQGEELGLPEAEVPFERIQDPYGKVLWPDFKG
FT                   RDGCRTPMPWHDGIHGGFSRVEPWLPVDARHLQRAVSRQQASLDSMLNSVRALIAFRHD
FT                   HPALFDGDLRLLDVGDALLGFVREHAQERLVCVFNLTDQAQACCLPEPGHLLDAPGFTA
FT                   HVENDRLTLPAYQAAYLRLD"
FT   gene            299623..300729
FT                   /locus_tag="Csal_0262"
FT   CDS_pept        299623..300729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0262"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57626"
FT                   /db_xref="GOA:Q1R0Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y2"
FT                   /protein_id="ABE57626.1"
FT                   /translation="MASLTLNKLNKSFGDTHIIKDVDLTIGDGEFVVFVGPSGCGKSTL
FT                   LRLVAGLESISGGELKIGETLVNDLPPRERGVGMVFQSYALYPHMTVFENMAFGLKLAK
FT                   TTKQAVRDRVHETARILQLEELLDRKPKALSGGQRQRVAMGRAMAREPRILLFDEPLSN
FT                   LDASLRVQMRNEIARLHHRLGSTVIYVTHDQVEAMTLADQIVVLNGGRIEQVGSPQELY
FT                   QRPATRFVAGFIGSPTMNFLPAALRESHAKGCRVSVSGIGELNLPQNAADLAANATLTL
FT                   GIRPEHLCLGEARGDNAFEIVNVEYLGNEVYVYLDAGQGGELLIHRSEAPSRWDIGQYA
FT                   ALMPSLDNVHLFDGDGRALPLMRTRDAA"
FT   gene            300835..301877
FT                   /pseudo
FT                   /locus_tag="Csal_0263"
FT   gene            complement(301878..302819)
FT                   /locus_tag="Csal_0264"
FT   CDS_pept        complement(301878..302819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57627"
FT                   /db_xref="GOA:Q1R0Y1"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y1"
FT                   /protein_id="ABE57627.1"
FT                   /translation="MGVRTSPPTRMTAMAWLEYVLPLIFLAPLGATALVVLALRHLEDG
FT                   ALTSPYDGHTLREPAQSLRNRLDRAYAALFLDGALGPIVTLAPLVYGMGRMLFANRHSW
FT                   LEWALYGLLTTLLALILCFRLIRDVQRIRRLKLGLACELAVGQELERLIRPEAHPYFVF
FT                   HDVPTDSTTIDHVVVTPHGIFAVQVSARTPPLDIKGEPRTTVVVAGQRLRFPGWRERQS
FT                   LAHARLAAAWCRQWLAHRSLGNVAVQGVLVLPGWNVEIDKPPGEIMVVDGRGLATLLDD
FT                   TSLQPMDDATHQRVVQALDRRVKGVTSGDQAP"
FT   gene            302916..303815
FT                   /locus_tag="Csal_0265"
FT   CDS_pept        302916..303815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0265"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57628"
FT                   /db_xref="GOA:Q1R0Y0"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Y0"
FT                   /protein_id="ABE57628.1"
FT                   /translation="MVDTSPSPLAAFLARHPRLFVLTGAGMSTDCGIPDYRDERGDWKR
FT                   SPPMTHQAFMQSDLARRRYWARSLVGFQALSEARPGRGHYALAELERAGRLERLVTQNV
FT                   DGLHQRAGSRRVIDLHGQADVVRCMGCGATRMRHALHAELARLNPHWTTLEAQVGPDGD
FT                   ADLESRNFADFSLLSCARCGDGIFKPDVVFFGDNVPRPRVDAAFAALEQADAMLVAGSS
FT                   LMVYSGYRFAKRAAELGKPLACVNMGRTRADALFSLKLEAPVGETLEAAVREVTASRSP
FT                   QTPPHVTQGAGPISTLRP"
FT   gene            complement(303843..304253)
FT                   /locus_tag="Csal_0266"
FT   CDS_pept        complement(303843..304253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57629"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X9"
FT                   /protein_id="ABE57629.1"
FT                   /translation="MPLSRLSHRLRTALCGAFLAGLVGCASGPDFQTLDARVVFDTPPA
FT                   LSPAATLKVALKDSADDTTLAESRYPRIDTEATEVALRYDASAIDAAHRYTLQAEVRDQ
FT                   GRITYLNRDAVEVLNGDTGTTPTITLVPASRR"
FT   sig_peptide     complement(304173..304253)
FT                   /locus_tag="Csal_0266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.724 at
FT                   residue 27"
FT   gene            complement(304289..304663)
FT                   /locus_tag="Csal_0267"
FT   CDS_pept        complement(304289..304663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0267"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57630"
FT                   /db_xref="GOA:Q1R0X8"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X8"
FT                   /protein_id="ABE57630.1"
FT                   /translation="MASLQDQLRGLVYSTEHGETCPECRAPLSECRCADTAEEDRLARL
FT                   DGIVRLRRETKGRKGKGVTLVEGVPLKSEELKTLAKALKKRCGTGGALKEGIIEIQGDH
FT                   RDALKVELEARGYRVKLAGG"
FT   gene            complement(304759..305436)
FT                   /locus_tag="Csal_0268"
FT   CDS_pept        complement(304759..305436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0268"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57631"
FT                   /db_xref="GOA:Q1R0X7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X7"
FT                   /protein_id="ABE57631.1"
FT                   /translation="MSHSLCLLFDCDGTLVDSEPLLADVMADVLTRVGLPFAAPQYMAE
FT                   FRGVRFANIVAELERRYGALDDATRDMAESEMRRNMQARMSRELQPISGIREALERLGA
FT                   YPRCVASNGPEHKIRRALDSTGLRPYFEDRLYSGYTIESWKPEPGLFLHAARDMGFAPE
FT                   HCVVIDDAEVGVAAGLAAGMRTIHINRFPERETTPSGAIALHHMRDLPDVVARLAQLET
FT                   LPH"
FT   gene            complement(305617..306924)
FT                   /locus_tag="Csal_0269"
FT   CDS_pept        complement(305617..306924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0269"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57632"
FT                   /db_xref="GOA:Q1R0X6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X6"
FT                   /protein_id="ABE57632.1"
FT                   /translation="MMPMDWMFLLPWLLFAVLGILIVAGVPIAMSLVLTSFAVIMLDPR
FT                   LTPWIMFQRMYNGMDSFVLLAVPLFLLAGNLMNAARITDRLITLCLHLVGHFKGALAHV
FT                   NVMVSMLFAGVSGSSTADSAGVGTVLIPAMKREGYPAHFAVAVTAASSVMGIVIPPSIN
FT                   MIVWGALTNTSIAGLFLGGILPGVMIGIAQLLLNLGYVRRYQVPVRQRASLAQLMHSGK
FT                   DGLLAAGIPVLIIGGITLGIVTPTEAAVMAVLYALALGFLVYRELTFKSVMAASTSTVR
FT                   LCSLSLFSLVGAAIFGYLISFYQIPPSLMKGVNITDPTTLLIVMAIVMLLIGTFMDSLP
FT                   AMAILAPIFQPLAMQAGVHPVQFGVISVMALGLGLITPPYGLCLMISAKIGGIPLLKAL
FT                   GTTLLYLAVMLVVIALLIVYPQLILMIPRALVPDFV"
FT   sig_peptide     complement(306808..306924)
FT                   /locus_tag="Csal_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.407 at
FT                   residue 39"
FT   gene            complement(306921..307532)
FT                   /locus_tag="Csal_0270"
FT   CDS_pept        complement(306921..307532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0270"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57633"
FT                   /db_xref="GOA:Q1R0X5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X5"
FT                   /protein_id="ABE57633.1"
FT                   /translation="MPTLLAGLARLNRALERLLGALLLLLLAAFIVFIVYQIVSRNLPM
FT                   LPRLYWTEEFSRFAFQWMIMLGTAIGVLHADHFVLEAFPRGSRLDRATRLIRDLACLAV
FT                   GVVFVYYGKDFALSGLRRSATASRLPMIAVYVTFSVCGVLIILFAAQRLLHAALHGQSA
FT                   MEQTLDTPSELDEALADTAETPSDSLSAPEHRDGGKESSR"
FT   gene            complement(307587..308600)
FT                   /locus_tag="Csal_0271"
FT   CDS_pept        complement(307587..308600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0271"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57634"
FT                   /db_xref="GOA:Q1R0X4"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X4"
FT                   /protein_id="ABE57634.1"
FT                   /translation="MTQNWIDPNASRRPFAKRALGAVALTLGMTLAGGAQAVDLRFGHG
FT                   GTEDTAYQLGAERFKELVEDKTDGDVSVTILGNSVLGHETEMFEQQMAGALDMSIINPG
FT                   LITDFSQTANVFSIPFMYRDEAHWRHVLDGEVGRDIADRIEDDTGVKVLAFFGGGKRQI
FT                   VSTRPLESLDDLEGMKLRTNPTEPLIAAWKALGTEPTVMAWKEIYTGLQLGAIDGLLNE
FT                   AEWIHRMRFHEVAPHIGLSEHDITVRLLTLSQMTWDRLDDAQREAVMAAAQEAASYARK
FT                   VQLEQDAEALETLEEEGATLYPMDRERMKEIVAEPLQKVIDDMGLTELHDRIVNVE"
FT   sig_peptide     complement(308487..308600)
FT                   /locus_tag="Csal_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 38"
FT   gene            complement(308656..309753)
FT                   /locus_tag="Csal_0272"
FT   CDS_pept        complement(308656..309753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0272"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57635"
FT                   /db_xref="GOA:Q1R0X3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X3"
FT                   /protein_id="ABE57635.1"
FT                   /translation="MAESPETPSSPRESARHSVTLQDIAAHAGVSRSTVSLVLRGSSLV
FT                   ADTTRTRVQASIKALGYVYNRGAAALRASRTFTLGVVVYDIANPFFGAMVAGIDSVLHR
FT                   ENYVSFLANSEDSPQRQQRFLERMREQRVDGLLLCPAEGTDPALVSRLADWNLPCVQVL
FT                   RHVGEPPFDYAGTDFELGVRQAVDHLVTCGHRRIVFLGGDAEHSATQARHRGYHEAMRA
FT                   HGLDDVHRVIRGPVTRRAGFDGVQRLMQESPRPTAVICHNDLMALGAMLGLQRLGLTPG
FT                   QDCAVIGTDDIEEAALSLPALSSVATHPYAIGEEAARLAMRRIADPDGTREQVILTPRL
FT                   HVRDSCGPCTADATPPRRCTDVVDI"
FT   gene            complement(309917..310894)
FT                   /locus_tag="Csal_0273"
FT   CDS_pept        complement(309917..310894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0273"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57636"
FT                   /db_xref="GOA:Q1R0X2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X2"
FT                   /protein_id="ABE57636.1"
FT                   /translation="MTKRIVAFRRLKPHHLEQLRNHFHVDYFDTLEGPDDPAFREALRN
FT                   AHGLLGASLPITPELLDDAPHLEAISSISVGVDNYPVEELTRRNILLCHTPDVLTETTA
FT                   DTGFLLIMASARRAVELANMVKQGQWTSGIGESHFGTDVHGKTLGMVGFGRIGQAIARR
FT                   GALGFGMSVLYTHASRKPALEAELGATHCEFEALLEQADFVCVNVPLTAETTGLMDAAV
FT                   FKRMKSSAILINIARGKVVDEEALIEALSSGEIHAAGLDVFAQEPLPGDSPLTRMDNVV
FT                   TLPHIGSATHETREAMAQRAIDNVIDALEGRRPPSPYNDVTPRG"
FT   gene            complement(310933..311853)
FT                   /locus_tag="Csal_0274"
FT   CDS_pept        complement(310933..311853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0274"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57637"
FT                   /db_xref="GOA:Q1R0X1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X1"
FT                   /protein_id="ABE57637.1"
FT                   /translation="MSLFIAETPGDLAEVERFQRRIAGADTNVAIGLARLAFQVAWISR
FT                   VGDDSFGRFIRRTLEGEGLDCRHLRTDPDHPTGLVFKERAEHGEDPKVEYLRRGSAASH
FT                   LGLDDVRDLTFQGVRHLHATGLPPALSPSTRELAFHMLEQARRAGLTITFDPNLRPTLW
FT                   DSETDMRDTLNALAARADWVLPGLAEGQRLTGLDSPHDIAGHYLDQGATGVIIKLGPEG
FT                   SYVRTQQDAGTVSGVSVARVVDTVGAGDGFAVGVISALLDGLSPRHAAHRGNLIGAEQV
FT                   QVVGDMEGLPDRARLRDLEAAHPLA"
FT   gene            complement(311868..312953)
FT                   /locus_tag="Csal_0275"
FT   CDS_pept        complement(311868..312953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0275"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57638"
FT                   /db_xref="GOA:Q1R0X0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0X0"
FT                   /protein_id="ABE57638.1"
FT                   /translation="MTRSPTPTILEVAREAGVSKTSVSRYLGGERDRLSPSMQTRIATA
FT                   ITSLGYRPNWMARGLKGGQSRLLGMLVADIRNPFSTAVLHGAEQACRAHGLSLLVCNTD
FT                   NDAVLERRHLEMLAAYRVEGMIINAAGDPGPALRRFADPRTPVVLLDRQVSDLDADIVG
FT                   LDNALAIDQAFAHLHAQGYRRLLYVSEPVTEASSRQARLARVEACLARHPEWRGETLGV
FT                   ALEAPGDALATKLRRFVDSRDPAPGAILCANGQVTLAVAQWLREAGVTLGPVGLMGIDE
FT                   LDWCALVGPGITTLAQPTATLGASAVDCLVTRFSPEGRQRPPRRLDYAGTLIPRGSTRR
FT                   DSAAAPTTDFRSLSCPSLRTF"
FT   gene            complement(313170..314219)
FT                   /locus_tag="Csal_0276"
FT   CDS_pept        complement(313170..314219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0276"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57639"
FT                   /db_xref="GOA:Q1R0W9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W9"
FT                   /protein_id="ABE57639.1"
FT                   /translation="MMTTKHTLAGLALLGGITLAGTGQAQDTVTLRLHHFAAPTTPVQT
FT                   QYLEPWAERIEEQSDGAIQVEIFPAMQLGGSASSLYDQAKDGVVDIAWTLLSYTPNRFP
FT                   ESEAFDQPFLPTTGEATSMAAHEFAMDHMQDDFEGVHPIAVFAHSPGKIHTKDVSVHDI
FT                   GDIDGLAIRAPSKTMNRYFAQLGAKTVGMPMPQIPEAISRGVIDGLTLPFESASALGVL
FT                   DVAQNHTFFDGSHGLYTAMMVLAMNQSTYDDLSPELQKVIDDNAGLQEAQRIGQVMDTA
FT                   EQAAIDDIAARGEGQMIHIAEADQSAWREAAETTIQQWIDDMDGAGFDGQALYDDASRL
FT                   VEKYTQQTQ"
FT   sig_peptide     complement(314142..314219)
FT                   /locus_tag="Csal_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            complement(314299..315747)
FT                   /locus_tag="Csal_0277"
FT   CDS_pept        complement(314299..315747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0277"
FT                   /product="vanillin dehydrogenase"
FT                   /EC_number="1.2.1.67"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57640"
FT                   /db_xref="GOA:Q1R0W8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W8"
FT                   /protein_id="ABE57640.1"
FT                   /translation="MDLSLLIGGDTHAAQQDATFTRHNPLSGEAVTRAAAASAGDARAA
FT                   AEAASRAFPAWSATGPGERRAKLLAAADAMEARQADFIARMVDETGATPGWAGFNVMVA
FT                   ANMLREAASLTTQVGGDVIPSNVPDSLAMGVRVPCGVVVGIAPWNAPIILGTRAIATPL
FT                   ACGNTVILKASEQCPATHHLIGEVLVEAGLGDGIVNVVTNAPPQAAEVVEALIEHPAVR
FT                   RINFTGSTQVGRIIAEKAAHHLKPVLLELGGKAPFLVLEDADLDAAVEAAAFGAFFNQG
FT                   QICMSTERLIVVDAVADAFVEKLARKAETLRAGDPRDEGNALGTLITREAGEKLNALLD
FT                   DAQQHGARLACGGKAEGVIMQPTVVDGVTSSMRLYGEESFGPVVAMMRVKDEEDALRVA
FT                   NDSEYGLSAAVFSRDTARAMRIAQRIESGICHINAPTVHDEPQMPFGGVKSSGYGRFGG
FT                   KAGIEEFTELRWMTMQLGPRHYPI"
FT   gene            complement(315828..316658)
FT                   /locus_tag="Csal_0278"
FT   CDS_pept        complement(315828..316658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0278"
FT                   /product="vanillin synthase / trans-feruloyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57641"
FT                   /db_xref="GOA:Q1R0W7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W7"
FT                   /protein_id="ABE57641.1"
FT                   /translation="MSDYTNRWQTVKVDVEDGIAWVTLNRPEKRNAMSPTLNREMIDVL
FT                   ETIELDQDAHVLVLTGEGESFSAGMDLKEYFREIDASPEIVQVKVRRDASTWQWKLLRH
FT                   YAKPTIAMVNGWCFGGAFSPLVACDLAIAADESVFGLSEINWGIPPGNLVSKAMADTVG
FT                   HRQALYYIMTGETFTGPQAADMGLVNQSVPRAELRETTHKLAATLRDKNPVVLRAAKTG
FT                   FKMCRELTWEQNEEYLYAKLDQAQQLDPEHGREQGLKQFLDDKSIKPGLESYRR"
FT   gene            316750..317247
FT                   /locus_tag="Csal_0279"
FT   CDS_pept        316750..317247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0279"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57642"
FT                   /db_xref="GOA:Q1R0W6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W6"
FT                   /protein_id="ABE57642.1"
FT                   /translation="MTKVESQASAESRHGDADDAPEAVRVAYLIGRLDRALRRHISEAV
FT                   QPLGVTMQQYTALSVLARRSPQSNSQLAEKSLVSPQAANEMVKAMETKGLVERRPDPHH
FT                   GRIIQIRMTEAGRRTLAECDRTVMALEGRMLESLSEAQRGAFQRHLKSSLKSLGAGLVD
FT                   TD"
FT   gene            complement(317291..318355)
FT                   /locus_tag="Csal_0280"
FT   CDS_pept        complement(317291..318355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0280"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57643"
FT                   /db_xref="GOA:Q1R0W5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W5"
FT                   /protein_id="ABE57643.1"
FT                   /translation="MSHHATLSCRRFLLAAAAALPLAWGAGQAHAQEAEYTLRLHHFFP
FT                   ASAPVHQEYFLPWKEAIEKESDGRLAVELYPSMQLGGTPPSLYDQAKDGQVDIIWTVLG
FT                   YNSGRFPRAEVFDLPFLPTSGAATSQAAHEYAMTHMQDELEGVYPIAVHTHSPGALHTK
FT                   ETRIEALEDIEGLKMRGPSRLVNRYLAKLGAEPIGMPVAQALEALSRGVLDGTVIPFEA
FT                   ITAMGLADITTEHTIFSGDRALYTTMMIVAMDQDKYDALPEDLQPIIDAHAGGREAYRI
FT                   GQIMDQADHRQILAIQSGEQPGTITRLGSEETARWQAVGQEVVDEWIAEAEEKGLDGQM
FT                   LYDDATRLVERYTR"
FT   sig_peptide     complement(318260..318355)
FT                   /locus_tag="Csal_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(318421..318897)
FT                   /locus_tag="Csal_0281"
FT   CDS_pept        complement(318421..318897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57644"
FT                   /db_xref="InterPro:IPR020915"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W4"
FT                   /protein_id="ABE57644.1"
FT                   /translation="MTRDPLPSPPTSTFIARLAIHVDPPLELGEDARGKRRFIAITGGR
FT                   VSGERLDGVVLPGGGDWQTVRPDGVADLHARYFLETDSGDRIEVENVGFRHGPADVMQR
FT                   LQRGEPVAPESYYFLTTPRFFTTSPAYAWLTRTIFLGKAERTRDSVLIDLYAVS"
FT   gene            complement(318941..320263)
FT                   /locus_tag="Csal_0282"
FT   CDS_pept        complement(318941..320263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0282"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57645"
FT                   /db_xref="GOA:Q1R0W3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W3"
FT                   /protein_id="ABE57645.1"
FT                   /translation="MMSPITLGTGGFVLLLIMMAARIPIGLSMLVVGAAGSMLITGPMG
FT                   ILNGLKTLPYEHFSSHTLSIIPLFLLMGQFAARAGLSRAMFQAANDWLGHRRGGLAMST
FT                   IGACGAFGAICGSSLATAATMTQVALPEMERQGYRGSLATGALAAGGTLGILIPPSVVL
FT                   VIYAILAEQNINEMFAAALVPGLFAAFSYMLAISLYVRFFPASAPNKDKASRGERWRSL
FT                   WEVWPGAAIFIIVIGGIYTGIFTPTEAAAVGAAATGVLAITRGGLRWNGLRDCLLETAV
FT                   TSAMIFFIVLGASVFNSFLALTQLPQITAGWIVGLEISPWVVLAGILLCYLILGCFMDS
FT                   LSMILLTVPIFLPIVTGMDFGMPAADVAIWFGILALVVVEVGMITPPVGLNIFIIHSMA
FT                   PHVPLTETFKGILPFLAADVIRIVMLVAFPAITLGFVYLLY"
FT   sig_peptide     complement(320159..320263)
FT                   /locus_tag="Csal_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.692) with cleavage site probability 0.488 at
FT                   residue 35"
FT   gene            complement(320260..320844)
FT                   /locus_tag="Csal_0283"
FT   CDS_pept        complement(320260..320844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57646"
FT                   /db_xref="GOA:Q1R0W2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W2"
FT                   /protein_id="ABE57646.1"
FT                   /translation="MSSLATTSHASITCLRRSLETTCRLAAIVGGLVVAMLSLMTVASI
FT                   AGRWVSSLPLISDMAMFGWIGPVTGDYEMVEMGTAIAVFLFLPYCHLRGGHVTVDLLVM
FT                   RAPRSVQRLLAFVAEVLFLVVAGVMTWRLYHGLLDKQRYMETSMLLDIPLWWGYVGGIL
FT                   GFALLTLVCFYRACLSVSRDTQHHTPAQGDA"
FT   sig_peptide     complement(320713..320844)
FT                   /locus_tag="Csal_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.617 at
FT                   residue 44"
FT   gene            complement(320986..321489)
FT                   /locus_tag="Csal_0284"
FT   CDS_pept        complement(320986..321489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0284"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57647"
FT                   /db_xref="GOA:Q1R0W1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W1"
FT                   /protein_id="ABE57647.1"
FT                   /translation="MTTSKKPTSPERPSLEEAYPTTVEGLVLEERLGYALRRAQLKVFK
FT                   HFDEAMREHDIRPAQFSSLVVIEGYPGVTQSSLAQTLSIDPPRVVSLINSLEERGLAMR
FT                   VRCKRDRRSHGIFLTKTGEALVGRLKGLAEQSDLEATQSLSEIERRQLLTLLRKVYASE
FT                   EGGD"
FT   gene            321729..323564
FT                   /locus_tag="Csal_0285"
FT   CDS_pept        321729..323564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0285"
FT                   /product="4-coumarate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57648"
FT                   /db_xref="GOA:Q1R0W0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0W0"
FT                   /protein_id="ABE57648.1"
FT                   /translation="MSSPSGNRPDESRSVNDASPQTHWLFGGEVSEYPRCVTQRLVHWA
FT                   GETPSRTFLAEREGTHRAWRTLTFGEAMPRVARLAQALLDHGLSVERPLMVLSGNGIDH
FT                   ALLACAAMHVGIPYVPVSPSYALLSEDFAKLRHVVDLVTPGMIFVDDEARFEAALAAVC
FT                   EPGTTCVAVRPSQRALALETLAATPASGAVDDAHAGVTADSIAKLLFTSGSTGMPKAVI
FT                   NTHRMLCSNQAMLAQRLAFLSRRKPVLVDWLPWHHTFGGNTILGMTIHNGGSLYIDDGN
FT                   PTAEGVRRTVDNLREISPTFYCNVPKGFEALVEHLRDDDALRTSFFRDLEMMHFGGAVL
FT                   PVHVRDALDAFGERSLGHPVPMLTGLGSTEACLAFCTEEASDTPGLIGRPVPGMSLKLV
FT                   ATDDKWEARLKGLNVTPGYWRDEARSAEAFDDEGYYCTGDAMRFVDPDRPERGLIFDGR
FT                   LSENFKLVTGTWVNVGILRLRLIEHFAPLVQDVVVVGEGRDALAGFVVLNVPACRQRLG
FT                   DAAPSSLDALAHDDTLHQWFAQRLATHRQGQSSSMRLERLLLLDRPLSVDRGELTDKGS
FT                   VNQRLVRERYTELAECLYAEPPGDARVILPDSSVS"
FT   gene            323642..324580
FT                   /locus_tag="Csal_0286"
FT   CDS_pept        323642..324580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0286"
FT                   /product="4-carboxy-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57649"
FT                   /db_xref="GOA:Q1R0V9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V9"
FT                   /protein_id="ABE57649.1"
FT                   /translation="MKSPVRILMVGEGAIAAIHMQALGHVPAASVVAVAGGDERNTRRF
FT                   AETWGIERVFTDYAHALEASGVDAVILATPSPLHARQAEQAIDAGKHVLCEIPMSLNLA
FT                   DAERMTRRAREASTVAMVAHTRRFNAPHREMKRRLRAGEFHLQHLVSETYFLRRENLNM
FT                   QGEPRGWTDHLLWHHACHSVDLFAWLLDDDVLDAWGSQGPLHSELGIAMDMNIGLRATD
FT                   GTLATLALSFNNRGPFGGFYRYIGEENTLLAYRDELKDYEGNVVPLSTPGFHAQDTEFV
FT                   TSIIEKRAPEASFSSCLPTMRILDKLSHNMV"
FT   gene            complement(324672..325832)
FT                   /locus_tag="Csal_0287"
FT   CDS_pept        complement(324672..325832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57650"
FT                   /db_xref="GOA:Q1R0V8"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V8"
FT                   /protein_id="ABE57650.1"
FT                   /translation="MAAVTTAPAHAFDVVEAGQPVVTGEPSRVGPPWNHRSTINIPGTE
FT                   TDIAFGGYVKLDMLYDFDYDLGKATDPYAIMDPSNRTDGRSDFTAYESRLNFRTHTMTD
FT                   YGRLTTYFEGHFIPDGSFNLRHAYGELNGFLAGRTWTNFMSFVGGTRTLALGDPKGYAF
FT                   ERQAQLRYTQPVGAGSLSFAVEDPDTVVARDDAGVADGESQLPDLTVRYEYKRLFALSG
FT                   VARKLSTNNITNTVDDETTGYGVQAQFNLPFTPMTSLRGSAAYGEGIGNYMGNPGNTGH
FT                   RNAPDVYVNDDNELEAVETRAFGVSLNHNWTDDWFSSVGFSRLDQDMPENYGSQFETID
FT                   YAFANVIWDVTQRLTVGLEYQNAEVEQINGNSDDASRLQASAIFQF"
FT   gene            complement(326481..327158)
FT                   /locus_tag="Csal_0288"
FT   CDS_pept        complement(326481..327158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0288"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57651"
FT                   /db_xref="GOA:Q1R0V7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V7"
FT                   /protein_id="ABE57651.1"
FT                   /translation="MSYAIESRLDAVVFDCDGVILDSAGLKRNVFADFYRDQPPALYHA
FT                   IIAYLSRGGGQPRDVKFHHIEAHILGRPISEARIRALSTQFAERAEAQVAQAPTIAGAI
FT                   EFLDRWRGKIPLYLLSATPQEELRRVIKKRNLTDHFDDVLGAPPDKTNGLSTLMATHHY
FT                   DPSRTVMVGDSYNDYRAARSNNTNFVGIAPSKAKTPPFPEDVITQPDLRNLEEILEALQ
FT                   RPS"
FT   gene            complement(327214..328713)
FT                   /locus_tag="Csal_0289"
FT   CDS_pept        complement(327214..328713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0289"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57652"
FT                   /db_xref="GOA:Q1R0V6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V6"
FT                   /protein_id="ABE57652.1"
FT                   /translation="MADSVSYFLMAWLDPSLLMLTAIGTLAGIYVGAIPGLSVTMATSI
FT                   LISFTFSWDVNDALALIVGIYTGGVYGGSRTAILLNIPGAPSSVATSFDGYPLAQKGEA
FT                   GQAIGLSTVMSVIGGLIGVAVLASVAPYLSDMALQFAPRDYFLIAVLGLLLVGSLATES
FT                   LSRGIFAAALGAVIGLVGLDQVTATPRFTMGSMQLMGGIHYVVVMIGMFGVAEAFFQLH
FT                   QLNAQPVRQKVDKIVPSLHLVLKFFPLSIRTSVIGVIVGALPGTGGDIASLFAYDHAKR
FT                   SIKKPSRPFGTGAYEGLVAPETANNAAVGGAYVPMLTLGMPGDAVTAIIIGALVIHGLN
FT                   PGPMLMIEAPHIFWFTVGNLVLANIFLLIFGLTGIKVFAKVVELPKAILIPLILVLCVV
FT                   GSYSLNSSMTEVYWMLGFGVLGYFMKIFRFQMGPVILGVILGPLMDKTYRQAMSSVGDD
FT                   TGSFLLSLVTNPLSLVLTMAVVLLLLSNTPLKRVLLRHHQT"
FT   gene            complement(328732..329202)
FT                   /locus_tag="Csal_0290"
FT   CDS_pept        complement(328732..329202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57653"
FT                   /db_xref="GOA:Q1R0V5"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V5"
FT                   /protein_id="ABE57653.1"
FT                   /translation="MSNHPPLKAGERTFNVLLLLLSLGVLYEAYRITGFDLPNSAGAFP
FT                   LLLGVIMVASMVAIILGQRRHTGPETQGVLDEARHFFREHFPMAIIVFSAMATGYLFLL
FT                   TSLGFISATAIFLFVSQVYLRRGHLLTSSIVTAVSTGIIYALFKLLFQVYLP"
FT   gene            complement(329262..330263)
FT                   /locus_tag="Csal_0291"
FT   CDS_pept        complement(329262..330263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0291"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57654"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V4"
FT                   /protein_id="ABE57654.1"
FT                   /translation="MIKQILATLALSAGALTVASPALADYPERNIQGIIQWGAGGATDN
FT                   VARSLTPHVEKALGTSIILNNRPGGTGVIGMNQVMQQPANGYTVLYGAENPQLYPVMDL
FT                   ADFDYSDMTPINVIGQGLVVIAAPADSQFDNLTELLDYAHKHPGELRMGGTGAGGLPST
FT                   VLAMINSVDRLDVRNVTFGGDGPGITALLGDHIDFMPLSLAGAQDQIAAGRLKGLAVVT
FT                   KEKIEELPDTPPITQALPDIDSYLPWGPFWTVAVHKDTPDDIVTALSDAYQEGVANEQF
FT                   QNFLSENGGKSLNLQGEEARQFLERWQSVTAWALQKAGSAKVSPEDVGIPKP"
FT   sig_peptide     complement(330189..330263)
FT                   /locus_tag="Csal_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            330650..332497
FT                   /locus_tag="Csal_0292"
FT   CDS_pept        330650..332497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0292"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57655"
FT                   /db_xref="GOA:Q1R0V3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V3"
FT                   /protein_id="ABE57655.1"
FT                   /translation="MRAIATVCLSGDLRSKLEAIARAGYSGVEIFENDLLTFDGSPSDV
FT                   RSLCESLGLAILAFQPFRDFESMPEPQRRRNFERAERKFDLMEELGTDFLLVCSNVSPQ
FT                   AFDDLGRAAEDLRELAERAARRGLRIGFEALAWGRHISDYRDAWDVVKRADHPALGIVL
FT                   DSFHILARGHELETMADIPAEKIAFVQIADAPLLDMDVLQWSRHFRCFPGQGRLPLASF
FT                   MQALARTGYAGPLSLEIFNDAFRAAPTEATAIDGLRSLIWIEELAEGAAWSEASPPAVG
FT                   YDGVHFIEFTLDEESAAPLGEFFSALGFRHIGRHRSKNVELWHQGDIHLVLNFETDSFA
FT                   HTFRLLHGTSVCAVGVRVNDLDSAVTRAAHYKAQWFRGPVGEGEMEIPALRGIEGSLVY
FT                   LVDDAQAREMQWKTDFHLFEDGQDDDAGLINIDHISYVLPPTQLLSWLLFHRTVFGFDA
FT                   GPEHEIADPHGMVVSQTVTSPDNSVRIPLTVSSARETLPGRFLSEHQGGVQQIAFASGD
FT                   IFATIDAMLARGLPMLRIPANYYDDLAARFDLDDALLEAMRSRNILFDRNDDGDFFHAY
FT                   TETFMGRFFFEVVERRGSYSQFGAVNAPIRLAAQAGQQR"
FT   gene            332550..333416
FT                   /locus_tag="Csal_0293"
FT   CDS_pept        332550..333416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0293"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57656"
FT                   /db_xref="GOA:Q1R0V2"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V2"
FT                   /protein_id="ABE57656.1"
FT                   /translation="MRLGLIGKGIMNSSSPDLHVRLGKLTGIPASYDLFDTLVTQIDSL
FT                   ESQVREVMATGYRGVNVTYPYKEEAVRLATRVGEGARLVGAANTLVFQDDEIQAENTDF
FT                   TGFISGYRATVGDRPPGRVLLIGTGGVGKAVAFGLAKLGADEVLLMDLDLEKAERLARE
FT                   LDHAGFSAAAVAPEALEATAARCDGVVNCTPIGHEKSPGYPLPPALIRADQWIFDAVYV
FT                   PAVTEFIAAARAAGAQVVSGVSLFVFQGVDAFKFFCEDADKRSLADAQAATLFDHYKQT
FT                   LLQEKNA"
FT   gene            333413..333844
FT                   /locus_tag="Csal_0294"
FT   CDS_pept        333413..333844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0294"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57657"
FT                   /db_xref="GOA:Q1R0V1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V1"
FT                   /protein_id="ABE57657.1"
FT                   /translation="MRAHKILVLHGPNLNQLGIRQPEIYGHETLDDINSRLFEKAAVNG
FT                   WDITCLQSNHEGDLIDAIHAARTDGTGLIVINPAAYTHTSVAILDALNAYEGGVIEVHL
FT                   SNIHKRESFRHHSYVSRRADGVIAGLGSRGYLLALDTLS"
FT   gene            complement(334001..334948)
FT                   /locus_tag="Csal_0295"
FT   CDS_pept        complement(334001..334948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0295"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57658"
FT                   /db_xref="GOA:Q1R0V0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0V0"
FT                   /protein_id="ABE57658.1"
FT                   /translation="MFDILAITTPIFLIIGLGYLAVMLRLFSKEQVKGLGGFVINFALP
FT                   ALIFRALVQRPLDEIFNPVYLIAYGGGSALLFLGAWLFARQRGKPIGESSILALGLSTS
FT                   NSGFIGYPIAVMVVGSSAAVALALSMVVENLLMIPAALAIAEAGRQQGASFLTALRKTM
FT                   SQLARNPILIGISCGILVAFSGIKIPLPLFKAIDMLASASAPAALFVIGGTLYGLRIGG
FT                   MLHDVSPVVLGKLVLHPLLILVMLWWLPPIDAALATAAVVLASAPMLSVYPILGQRYGH
FT                   GESCTASLMLATLLSFVTISGLLWILEAYPAALS"
FT   gene            complement(334985..335767)
FT                   /locus_tag="Csal_0296"
FT   CDS_pept        complement(334985..335767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0296"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57659"
FT                   /db_xref="GOA:Q1R0U9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U9"
FT                   /protein_id="ABE57659.1"
FT                   /translation="MAGSLIERTLRVLETLSSEPDGIPLQRLAERLEIPKSAAHRICNE
FT                   LGRQGYVRQETRTGHYRLSTRLIALGFRYLGSTGASDVLQPILDRLADETGELVRLGVI
FT                   EGDRQTWIAKAQGTRTGLRYDPDMGREAPLRYTASGQAWLASLDDQAALALLERQGHHN
FT                   PEHFGPNAPRTDYELLDRLALARERGYTCCVDSSALGTSAFGAVIRHPMQGHTIGVISV
FT                   AGPSVRLTEDRMHELAPKLLQAVEELSQCSQASQLFSE"
FT   gene            complement(335808..336599)
FT                   /locus_tag="Csal_0297"
FT   CDS_pept        complement(335808..336599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0297"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57660"
FT                   /db_xref="GOA:Q1R0U8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U8"
FT                   /protein_id="ABE57660.1"
FT                   /translation="MNAQTNDEPLKPDDRDFVTALASGLDVILAFDHANPRMTLSEVAT
FT                   KTGMNRARARRFLLTLNALGYVRKQHRHFELAPKTLQLGYAFLSANNYRSVIQQHLEDI
FT                   TQQTGESSSLGVLDGSDVTYVCRSAAPHRLMVITLAIGTRLPAVATSMGRVLLAQLPED
FT                   ELDALLETVTLEQHTERTITDKAELRACLRQVREQGYCIVDQELDSGLRSLALPAFDAH
FT                   GRLLGAINVSTNAARIDMTMLTERFLPLLREKAQQIANQVN"
FT   gene            336726..338060
FT                   /locus_tag="Csal_0298"
FT   CDS_pept        336726..338060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0298"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57661"
FT                   /db_xref="GOA:Q1R0U7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U7"
FT                   /protein_id="ABE57661.1"
FT                   /translation="MYEKLLRHPFTSATGREKCSAQDLVVAMLDVELALAAEQERLDML
FT                   PKGTTETLGEYLTTEVFDIEALADDTAKGGNAAIPFVKQAKAALPDTLKPYFHRGATSQ
FT                   DIVDSALMLLLKPRLARCRRLLTASIDDGRSLMVAHRDTTMIGRTLMQQALPITFGAKV
FT                   GQWAWGLHQAGERLDDVLTGGLYVQFGGAVGVHSGLDDAGVAIMTGMASRLGLAEPWLP
FT                   WHTDRQPIHSLGCAIDAVAVAAEKVALDVALLTQTEIGELAEPAEAGVGESSSMPHKRN
FT                   PVGCARIRAAARQIHAALSVLTNAGAQPLERGLGEWHAEWAPMLDAALLLEGALETLQH
FT                   LLSGLEVNDQVMARNLGVTGGAIMAEPAARVLQSILSNDEARRVAREASENARRAGVDY
FT                   AEALLAHEDVAGSAIDADALRQAVRPESYIGSSRCLVERVIERLR"
FT   gene            338219..339040
FT                   /locus_tag="Csal_0299"
FT   CDS_pept        338219..339040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0299"
FT                   /product="coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57662"
FT                   /db_xref="GOA:Q1R0U6"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U6"
FT                   /protein_id="ABE57662.1"
FT                   /translation="MAEFLSLHDAVARYVEDGAIVAMEGFTHLIPFAAGHEVIRQRKRD
FT                   LTLIRMTPDLVYDQLIGAGCAKKLIFSWGGNPGVGSLHRLRDAVEKGWPHKVEIFEHSH
FT                   AAMACAFEAGAAGLPLAVLRGYVGSELPSVNDQIKFIECPFTGESLAAVPSVRPDVSLV
FT                   HAQKADRKGNVLVEGIIGVQKEAILAAGKSIVTVEEIVDDLEAGPNACVIPGWAIDAIA
FT                   VAEKGAYPSYAHGYYPRNNRFYKEWDTIARDRDTFQTWLDENVFNAGGQAQ"
FT   gene            339037..339813
FT                   /locus_tag="Csal_0300"
FT   CDS_pept        339037..339813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0300"
FT                   /product="coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57663"
FT                   /db_xref="GOA:Q1R0U5"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U5"
FT                   /protein_id="ABE57663.1"
FT                   /translation="MSIEYTSAEMMTVTAAKALENGMTCFVGIGLPSEAANLARLTHAP
FT                   DVVLIYESGTLQTKPDVLPLSIGDGELCESALTTVSVPEMFRYWLQGGKIDVGFLGTAQ
FT                   IDRYCNLNTTLIGDYQAPKVRLPGGGGAPEIATCAGEVFITLKHSKRTFVDQVDFITTL
FT                   GFGRDGKARDGVPNIGRGPTRVITDLCVMKPDPETRELVVVSLHPGVTVEQVQDATGWE
FT                   IRFAEQLDTTPMPSANELDVLRDLKARTERKHAGEA"
FT   gene            339824..341029
FT                   /locus_tag="Csal_0301"
FT   CDS_pept        339824..341029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0301"
FT                   /product="3-oxoadipyl-CoA thiolase"
FT                   /EC_number="2.3.1.174"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57664"
FT                   /db_xref="GOA:Q1R0U4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U4"
FT                   /protein_id="ABE57664.1"
FT                   /translation="MSDVWLCHPTRSAVGRFGGSLASVRPDDLAATIFRAVLAQAPDLD
FT                   PAAIDEVIMGCANQAGEDNRNVARMSALLAGLPTSVPGTTLNRLCGSGMDAVGTAFRAI
FT                   KAGEFELALAGGVESMSRAPFVMGKAETAFSRSQAIEDTTIGWRFVNPLMKNHYGVESM
FT                   PETAENVAEQFHVSREDQDAFAVRSQHKTERAQQSGRLAQEITPVEVPRRKQEPLIVDR
FT                   DEHPRAGTTLEKLAKLPTPFRDGGSVTAGNASGVNDGAAAMLVASDAAVARHGLTPMAR
FT                   ILGMATAGVEPRIMGMGPVPATRKLLERLGIGIDEVDIIELNEAFAAQGLACLRELGVA
FT                   DDDPRVNPNGGAIALGHPLGMSGARLLLTAAHELHVQNKRYALCTMCVGVGQGVATLIE
FT                   RV"
FT   gene            341040..342209
FT                   /locus_tag="Csal_0302"
FT   CDS_pept        341040..342209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0302"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57665"
FT                   /db_xref="GOA:Q1R0U3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U3"
FT                   /protein_id="ABE57665.1"
FT                   /translation="MAFLTVAERTIAYRDSGEAALPAVLLAHPLGMSQDVWEDVVAALR
FT                   GRFRCVTWDLPGHGASSGLTEAVTPRALAEDALALADALGVARFHFVGTSIGGVVGQQL
FT                   LIQCPERLADVVLTNTGAVIGTPDNWHARASRVRQEGLAAMADEIVPRWFSEAFAQGNA
FT                   ATYTGWKTQLARTDGESYARLCEMLADTDFSGQLRGVAGPVRLLGGREDLSTPPDTLKA
FT                   LASQFGDARLEVLESIAHVPSVEVPEAVAKRLRTWLGDAPVGAEGVSYAAGLETRKQVL
FT                   GEAHVERASENATTLDAPFQNMITRLAWGELWGNDDLSRTERSMITLAVLAALGRDGEL
FT                   ELHLKTAQRIGLSEAQLRQALMHVAIYAGVPAANHAFAMAKKLGWGNSL"
FT   gene            342267..343325
FT                   /locus_tag="Csal_0303"
FT   CDS_pept        342267..343325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0303"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57666"
FT                   /db_xref="GOA:Q1R0U2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U2"
FT                   /protein_id="ABE57666.1"
FT                   /translation="MASFEITRGINAMKRTLTCMLTLSLTAAAVSTAQAETTLRMSHFW
FT                   PGASAINKQIFDAWAEQVEKDSNGELKVENYPSQTLSQADETYEAVTNGIADIGITAQG
FT                   YTNGRFPLSQIVELPGVASSAPEGACVLQTLYDDGQIASEYDDTHVLFMFTTGPGYIHT
FT                   RETDVQTPSDLEGLRMRRPTAVAGNILDNMGAEPVGMPAPEIYTSMQRGVLDGLSFPWE
FT                   GMKTFRLNELAEYHTQVPFYTLIFVATMSQSTYDSLSPEQQKAIDENSGMKWADNAGEV
FT                   FASIDAAGKKEAEEAGHTIRVIDNPLEDSAWQKPLKAGIDKYLGDLESRGLDQARDVYY
FT                   AALEARKSCSAE"
FT   sig_peptide     342267..342374
FT                   /locus_tag="Csal_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 36"
FT   gene            343344..343871
FT                   /locus_tag="Csal_0304"
FT   CDS_pept        343344..343871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0304"
FT                   /product="TRAP-T family transporter, small inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57667"
FT                   /db_xref="GOA:Q1R0U1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U1"
FT                   /protein_id="ABE57667.1"
FT                   /translation="MQQGLTRLSHWLGSLCRLIAGVALLALLSVTILDVGLRYLGRLTG
FT                   GAVSLSVSGSVELVSYLLLFSLLAAMAASVEKSQVVVEALTHRMNDALKTRLHGFYLIG
FT                   FAVMGFILCTGLIDSGMSALEHGEVTQDLRISMGPIYLFAAFLSALLSLRSLLHVLLSG
FT                   VFGQEEETAHGE"
FT   gene            343861..345147
FT                   /locus_tag="Csal_0305"
FT   CDS_pept        343861..345147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0305"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57668"
FT                   /db_xref="GOA:Q1R0U0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0U0"
FT                   /protein_id="ABE57668.1"
FT                   /translation="MGSEMIGGIGLALLLVLMMLRVPVALTMLIVGVVGFSQVINMGAA
FT                   LSMVKSVPVEVLSNYSFSAVPMFILMGVLAAHSGMAGKLFNSTRVICGGWKGGLAIAAI
FT                   GSCGIFSAISGSSLATASTMTRVALPEMERYGYNRGLATGALAAGGTLGIMIPPSIALL
FT                   IYAILTEQSVGDMFMAGLIPGLMGLLFYSLAITVVMRLKPSLAVAGESTTWSEKVKSLV
FT                   GLVPFFGVFLLLILGIYFGAFTPTEGASVGAFATLLYAVAKGMRARGLWQSVQETLALS
FT                   SVVFFMLVGAETLGYFISVSRISFTISDFLFSLDLTPIVVLLCILLLYFVLGMFMDSIA
FT                   MLVITVPVVFPIIQSVGIDPVWFGIVTVLTVELGLITPPVGMNVFVIKAMAPHVGLGEI
FT                   FKGVAPFIAADFVRLALLIAFPVLSLFLI"
FT   gene            345222..346235
FT                   /locus_tag="Csal_0306"
FT   CDS_pept        345222..346235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0306"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57669"
FT                   /db_xref="GOA:Q1R0T9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T9"
FT                   /protein_id="ABE57669.1"
FT                   /translation="MKTIYYAAGLTLGLAVMPGLAQAETLRLAHVWPGGSKIDKEIFQA
FT                   WADSVEEASDGRLEVQVFPGQTLAKSDATYEAVVNGIADIGATAQGYNSGRFPLTQVVE
FT                   VPGVSNSSRQGSCVLQKLYDQGDLDQEYSDSHVLFMFTTGPGYLHAKEKLLETPSDLEG
FT                   MRLRRPTSLVGDMMADLGAQPVGMPAPDIYTALQRGVMDGLSINWEGAKTFRVNELVNY
FT                   HTEVPLYDLALIATMNKDDYASLPDDLKKVIDDHSGMEWSMKAASVYDELIEEGRQEAL
FT                   DAGDEIITIENPLENEDWGPVLKDTINRYVSDLQGKGLPGAQTYDNVMTLKASCDA"
FT   sig_peptide     345222..345293
FT                   /locus_tag="Csal_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            complement(346273..347199)
FT                   /locus_tag="Csal_0307"
FT   CDS_pept        complement(346273..347199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0307"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57670"
FT                   /db_xref="GOA:Q1R0T8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T8"
FT                   /protein_id="ABE57670.1"
FT                   /translation="MRPIDLNLVRTFVTLYESGSVTLAAHKLNVTQPSVSYSLSRLREL
FT                   FDDPLFSRTRDGMAPTFCAMRLYTSFRQALTQIEQTLSDAQHFDPEQSQRRFRLALTDL
FT                   GETTLLAPILRHMRDLAPGVELEVVPLEIDKVVSWFDNKSVDAVICSRDIQAPSLGRRP
FT                   IIEERYVGLLGRRHPRIGQTLSMEAFSREDHVQVSPTTGHGLVEDVLKERDITRKVSVV
FT                   VPHFSALPRLLESTSLLAILPEQIAGLFTQQADLKQVELPFDIPPVEVALYWSRQVDDS
FT                   AAQEWFRRTLIEATSRHHDETVPPETP"
FT   gene            347297..348883
FT                   /locus_tag="Csal_0308"
FT   CDS_pept        347297..348883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0308"
FT                   /product="thiamine pyrophosphate enzyme-like TPP binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57671"
FT                   /db_xref="GOA:Q1R0T7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T7"
FT                   /protein_id="ABE57671.1"
FT                   /translation="MPTVHSATYDLLRRQGMTTIFGNPGSNELPFLKNFPADFRYILGL
FT                   HEGVVVGMADGFALASGAPALVNLHAAAGSGNAMGALTNAWYSHSPLVLTAGQQARSMI
FT                   GVESMLANVDAPQLPRPLVKWSYEPACPEDVPRALSQAIHTACLPARGPVYVSIPHDDW
FT                   GHAVDDDAALLSARQVASAAQPAETQVEALVERLNAARNPVLVLGPDVDAYGANALAVT
FT                   LAERLNAPAWVAPSASRCPFPTRHACFRGVLPAAIQGISDRLDGHDLIVVIGAPVFRYH
FT                   QYAPGRYLPDGAELVHLTCDMQEAARAPMGDALVGDIHAMLDLLVPRVRQSGRARPEPQ
FT                   AAPEPQVDPEGMLTPETVFDVMNAMAPEDAIYVKESTSTVTAFWERVEMRHPGSYFFPA
FT                   AGGLGFGLPAAVGVQLACPERRVIGVIGDGSANYAITALWSAAQYRIPVVFVILKNGTY
FT                   GALRWFSRLLDAEDSPGLDVPGLDFCALAEGYGVEAEQAASREAFEAALKAALADDRPR
FT                   VIEVPTTTIEP"
FT   gene            348947..349966
FT                   /locus_tag="Csal_0309"
FT   CDS_pept        348947..349966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0309"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57672"
FT                   /db_xref="GOA:Q1R0T6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T6"
FT                   /protein_id="ABE57672.1"
FT                   /translation="MKHAISYCLLGLGLTAATGVHADTTLRLGHLWPAQSAVNQDLIKA
FT                   WADQVTQDANGALEVEIYPSQTLSKASSAYEGVVNGVADITVTLQGYTAGRFPLTEIVQ
FT                   LPGVSASAPQGACILQSLYDDGALGDEYADSHLLFLFTTGPAPLHTRDTEVQTPADLEG
FT                   LRIRTPSEVSSDMLESMGADPVGMPAPDIYTSLQRGVIDGLSLPWEAMKVFQVNELASY
FT                   HLDIPYYTGALMATMNRDAYEALSPEAREAIDANTGMGWAEKAGEVFYRLDSEGKAQAR
FT                   EQGDTIHHVEDPLNDPQWSGPLKRGTERYLERLEERGIDNARAVYEQALSLRDGACAR"
FT   sig_peptide     348947..349015
FT                   /locus_tag="Csal_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            350102..351034
FT                   /locus_tag="Csal_0310"
FT   CDS_pept        350102..351034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0310"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57673"
FT                   /db_xref="GOA:Q1R0T5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T5"
FT                   /protein_id="ABE57673.1"
FT                   /translation="MLSARVKLRHLMAFQEVARLQSLAKAAQALSITQPAMSKTIRELE
FT                   EMLDATLFERSPQGATLTAAGQTLLRHAGPALRSLGEGFQAVRDAAQHDTVVRMGALST
FT                   VEEGLLPLALHRLHRRAPALRVHVVTGPSAYLLSRLRAGELDAVAGRMSEAREIRGLQF
FT                   EHLYYEPLVLAVRVDHPLLASKARVDEELGAYPWIVPPTSTTLRDQVERFWVERGGTPP
FT                   RIALETLSLPLSRRYAMRSDAVWVAPLDAVRDDMHEGRLRRLPVRLESRGGSVGLCTNI
FT                   ALPPNAGVEILRECLHASVAERADSPEGT"
FT   gene            351206..351946
FT                   /locus_tag="Csal_0311"
FT   CDS_pept        351206..351946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0311"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57674"
FT                   /db_xref="GOA:Q1R0T4"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T4"
FT                   /protein_id="ABE57674.1"
FT                   /translation="MPLNDNKRFVERDRNWHPPAYAPGYKTTVARSPSQAYVSLQTPSV
FT                   SELAGPDFTRLRMGPHDNDLLLNFRADDEARAGLPIGERILLFGRVVDQFGKPVPNTLV
FT                   EMWQANAGGRYRHKKDGYLAPLDPNFGGVGRCLSDDEGWYRFRTIKPGPYPWPNDINSW
FT                   RPAHIHVSVMGPSISTRLITQMYFEGDPLIPLCPIVQTLRDPEAVETMVGRLDMARSRS
FT                   MDCLAYRFDLVVRGELQTYFENQG"
FT   gene            351950..352582
FT                   /locus_tag="Csal_0312"
FT   CDS_pept        351950..352582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0312"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57675"
FT                   /db_xref="GOA:Q1R0T3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T3"
FT                   /protein_id="ABE57675.1"
FT                   /translation="MQQPNSQPSAALMLRETASQTAGPYVHIGLALDIAGLPPREEEIW
FT                   NRLASPQAEGQPIELVGRVIDGNGDLVRDALLEAWQADAQGHYQCEFDLQAPFNSFGRT
FT                   ATTVENDGEWCFHTIKPGQVARRDGRMMAPHVTLAVFARGINMQLHTRLYFEDEAEANA
FT                   ACPVLNAVESPTRRQTLIAKREESEGKVRYRFDIRLQGEGETVFFDF"
FT   gene            complement(352834..353229)
FT                   /locus_tag="Csal_0313"
FT   CDS_pept        complement(352834..353229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57676"
FT                   /db_xref="GOA:Q1R0T2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T2"
FT                   /protein_id="ABE57676.1"
FT                   /translation="MSSYSWETIFALGFALFGGLTFLLGLACIILAPLLINKADDHFSC
FT                   FTQQDEILFKSYPVSFARMGRYGLMLMSRAFPHASARNFDDRPDRRRAIEQSPRWLRMV
FT                   LMWIYGGFGVVAIFAVLFGCAMSFTGR"
FT   gene            complement(353245..353646)
FT                   /locus_tag="Csal_0314"
FT   CDS_pept        complement(353245..353646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57677"
FT                   /db_xref="GOA:Q1R0T1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T1"
FT                   /protein_id="ABE57677.1"
FT                   /translation="MSQHDIYVTLLFITAGLGVLAFLLVIVGMILAPLIIEKVDRALGP
FT                   LASDKELFFKGLPLSAHRMSGYGLKVLSRNTQWGQHRIYRDRPDRVHAVERAPAWILNV
FT                   VTWIYASFVIVAPIAFLLAFIVIRLHDSG"
FT   gene            complement(353668..354063)
FT                   /locus_tag="Csal_0315"
FT   CDS_pept        complement(353668..354063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57678"
FT                   /db_xref="GOA:Q1R0T0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0T0"
FT                   /protein_id="ABE57678.1"
FT                   /translation="MNDSLLWGGFLITFVGIVTISALLVVVGVILAPMIIHKADKALSI
FT                   LLPDNELLFQGLPLSYTRLGTYGRMLLLKDTGWYQSRVFDQRPDRERAIAEMPVNLRRT
FT                   VTWLYGAGSLICFFTVLLMIIFLLLDR"
FT   gene            complement(354060..355421)
FT                   /locus_tag="Csal_0316"
FT   CDS_pept        complement(354060..355421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57679"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S9"
FT                   /protein_id="ABE57679.1"
FT                   /translation="MIRLGDATSHGGKVITGQSTYIVHGKPVAVVGDKVTCPVDGHGGV
FT                   CTIVEGNPTLRINGKQAAFHGCHTSCGATLVSSMNGRHMIGTEEAKSPPVPKPIFSLTA
FT                   AAAGKVMSDETTEKESQATIAPGFHVVREAGYRDQIKRDLLPTLSSDVDAMFERPNTHL
FT                   PDYVLPGSLIVLSDPENKMCTAEEQTLQDQARLAQQTVQQLKPEQADVMMVNWGAVMDL
FT                   SDAMGSASTAAGTSAGTLQALKSTMDETWHDLAQAWESGSRRGEQILERATAPIVGWMD
FT                   RKFGLEDKHRTLKAKLGVLQDKAVHTVEQAMAGFAEFHVPTVAEGIQKAGKFARTLDVT
FT                   NYVAIGLDIMSTRLAVERACNDINATKSCRQVELEEYIGLGTGIVGGSAGASAAVSNVG
FT                   RVCLAIGYHPMGRLACTVVLVSGGAYGGSTAGKEVGRRAGSAIYEYFHEEGGTK"
FT   gene            355634..356502
FT                   /pseudo
FT                   /locus_tag="Csal_0317"
FT   gene            356584..358389
FT                   /locus_tag="Csal_0318"
FT   CDS_pept        356584..358389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0318"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57680"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S8"
FT                   /protein_id="ABE57680.1"
FT                   /translation="MVDGGRVSSKGIFTSEEKEKLKGMYESRLSRLGPSHALDCLTQLA
FT                   SSVIGVPTSLVTLLGPDVQWIKSRYNFGLDVTPLESSFCRRTVQRKDLTIIEDALDDDE
FT                   FKCNDLVNSAPYVRFYAGAPLFDSEGAAIGGVCVIDYEPRKLSDKEAEMLRAFSVIASN
FT                   LLESSNNVGFVDSVTFLPNQQRLMRDLDALHARQDEDHVLPKTVIVLEVVSTSGYHELA
FT                   KSYGVEAVEEVSKNIADLLRVCLSERHLLYAVSLSRFSVLVPQSERGAVIDIVAALNFR
FT                   IGAGGNTALPVNLQVCAGYYDFDPLAIAPRDTFRRALSALYEALAYREPVMAYQVNFDN
FT                   AQQRKVKLINSLPEALEDRQLYLMVQPKINMRSGEVVGLEALLRWRHPEFGELSPMEFV
FT                   PLVAQTYMVNDLTHWVVREALGIISRFHEKGCYLTISVNVTTTNLFDDSFFNCVESMLG
FT                   EFGVDPKYLEIECLETEELLEDYRIASVLQALRDIGVRIALDDFGSGYSNLNYLRRIPV
FT                   DVVKIDRSIIKDMEVDAGSRAIVFRLVQILKHFDYGIVAEGIENQATADQLLQFGCVVG
FT                   QGYYFYRPMIWEKALESFAQCLPSS"
FT   gene            358489..359040
FT                   /locus_tag="Csal_0319"
FT   CDS_pept        358489..359040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0319"
FT                   /product="Appr-1-p processing"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57681"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S7"
FT                   /protein_id="ABE57681.1"
FT                   /translation="MSLTLWAGRVDVVSGDITRLDVDAIVNAANHSLMGGGGVDGAIYR
FT                   AAGPALKRACRALRETHWPDGLPDGEVALTEGFELPARYVIHTVGPVYAKTRDKSHLLA
FT                   NCYRNAVALAAETGCRRIAFPAISTGVYGYPFDDAAHIVIDTLHDALAIHDLRVTLCFF
FT                   SERDYQAFAEIAMRRGVADA"
FT   gene            complement(359068..360006)
FT                   /locus_tag="Csal_0320"
FT   CDS_pept        complement(359068..360006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0320"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57682"
FT                   /db_xref="GOA:Q1R0S6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S6"
FT                   /protein_id="ABE57682.1"
FT                   /translation="MSDVQHARERIAEALAPTPLLLDQTLSERLGRRVWLKVESFQHTG
FT                   SFKARGALNWLRTASDEELAGGLGAVSAGNHALALAWAARRTGVPVTIVMPENASPFKV
FT                   EGSRALGAEVILHGDINAAWALMHRLVEERGLTLVHPYDDPRIIAGQGTLGLESLEQAP
FT                   DAQAILCPVGGGGLIGGIGVASSAWRPELSLIGVEPRGAASMAHAWSQGGPARLDGIAS
FT                   CAKSLAAAIVGEHTYPLSRRHVTELVAVDEDAIHRAMRHLLYQAKLVVEPGAAVGVAAL
FT                   LEGGATLPSHGDVVVVVTGGNLGGEELAEFL"
FT   gene            complement(360003..360551)
FT                   /locus_tag="Csal_0321"
FT   CDS_pept        complement(360003..360551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57683"
FT                   /db_xref="GOA:Q1R0S5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S5"
FT                   /protein_id="ABE57683.1"
FT                   /translation="MSLTPSNMIALGSPLPAFRLPDAEGREVDSADFAGRPVLVAFICN
FT                   HCPFVKHIADAFADFAREYQAKGLAVVAINSNDFHAHPDDSPARMREEIDARGYTFHYL
FT                   VDESQDVARTFEAACTPDFFLFDHEHRLAYRGQFDASRPSKETPVTGEDLRAAADAVLA
FT                   DRAPATQQTPSMGCNIKWK"
FT   gene            complement(360660..361832)
FT                   /locus_tag="Csal_0322"
FT   CDS_pept        complement(360660..361832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0322"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57684"
FT                   /db_xref="GOA:Q1R0S4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S4"
FT                   /protein_id="ABE57684.1"
FT                   /translation="MVHKKAIAYSVSFAAFLGPFTQTVYVPILPELQDTLATSQLLINA
FT                   SISVFTFIIAFMQILYGPLTDTWGRKKVLLPGIALYVGASIGCFYADHIASLLFFRVFQ
FT                   AVGIATGSVVAVTVIGDLFRDEERLKAMGTFQTMVALGPVIGPVAGGFIADQLDYHYVF
FT                   LALAVAGTLIGILNLALLRETKPAGPARRIDMAEYVRIARDRQGLTIGILGFVQFYIYY
FT                   NFLVYLPVILDQGYTLSVAQKGLMFLPLSVALMLGSFLSSRVQKRLSTESLLVITALLC
FT                   AVDVMAFLATSMHSLASLITTTCLFGFLLGLSLPAQTALLTRVFVTHRATAVGLYNFFR
FT                   FMGMASGPFLGALLFDLGGLTLLFSIAALLFLLIAMLAHRNLMPVRRARA"
FT   gene            complement(361873..363159)
FT                   /locus_tag="Csal_0323"
FT   CDS_pept        complement(361873..363159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0323"
FT                   /product="protocatechuate 4,5-dioxygenase alpha subunit /
FT                   protocatechuate 4,5-dioxygenase beta subunit"
FT                   /EC_number="1.13.11.8"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57685"
FT                   /db_xref="GOA:Q1R0S3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR034939"
FT                   /db_xref="InterPro:IPR034940"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S3"
FT                   /protein_id="ABE57685.1"
FT                   /translation="MARIIGGLAVSHTPTIGFAVDHEKQQEAAWAPIFESFAPMTQWLQ
FT                   DKRPDVLFYIFNDHVTSFFFDHYSAFALGVDDHYAVADEGGGPRDLPAIGGHAALSRHI
FT                   GESLMADEFDMAFFQDKPLDHGLFSPMSALLPFEEGWPVEVVPLQVGVLQFPIPSAARC
FT                   YKLGQALRRAIESYPEDLDVAIVATGGVSHQVHGERAGFNNPEWDAQFLDLLVDDPQQL
FT                   TQMTQAEFATLGGLEGSEVITYLIMRGALSHTVIKRHQDYYLPSMTGIATLILENQARP
FT                   NPVDLSERYRQHSRHQQEGIEALEGTYPFTLERSRKGYRINRFLHRLIEPDWRERFLAD
FT                   PEALFDEAALSEEERRLIRERDWRGMIHYGVIFFLLEKLGAVIGTSNLHIYAAMRGESL
FT                   EEFQKTRNQQVTYSVARRQGSGDASSAET"
FT   gene            complement(363188..364033)
FT                   /locus_tag="Csal_0324"
FT   CDS_pept        complement(363188..364033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0324"
FT                   /product="protocatechuate 4,5-dioxygenase beta subunit"
FT                   /EC_number="1.13.11.8"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57686"
FT                   /db_xref="GOA:Q1R0S2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S2"
FT                   /protein_id="ABE57686.1"
FT                   /translation="MGKIVAGIGSSHVPSIGRAYDQKKQADPAWQPLFDGYEPVKRWLA
FT                   EEVKADVVILVYNDHGTEFFLDRYPTFALGVADSYEVADEGYGKRPLPDFPGDAAFSEH
FT                   LANHLVADEFDLTLCQEMALDHGFLTAMPLLWDHDDTAWPVKVVPLLVNVIQHPLPTGQ
FT                   RCFKLGEAIRRAVEAYPEDTRVVVVGTGGLSHQLNGERFGHINEEWDKQWLQRIQDEPR
FT                   ELAALSHKEVMTAAGAEGGEVIMWFVMRGAMTERVEEVHRFYYAPMTTGIGLLALNNSD
FT                   "
FT   gene            complement(364033..364389)
FT                   /locus_tag="Csal_0325"
FT   CDS_pept        complement(364033..364389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0325"
FT                   /product="protocatechuate 4,5-dioxygenase alpha subunit"
FT                   /EC_number="1.13.11.8"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57687"
FT                   /db_xref="GOA:Q1R0S1"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S1"
FT                   /protein_id="ABE57687.1"
FT                   /translation="MSDAQERWGIPGTYVFDLALSRQGYAINKMCNSLKFDENREAFKA
FT                   DEEAYMERYGLSEEQKQAVRERDWLRLTQLGGNLFFFLKLGATLGYGLYTIGAQMRGES
FT                   YEQFMSTRNVPGAT"
FT   gene            complement(364442..364897)
FT                   /locus_tag="Csal_0326"
FT   CDS_pept        complement(364442..364897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57688"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0S0"
FT                   /protein_id="ABE57688.1"
FT                   /translation="MTALSHEARAAIEQACTHLVLDAAAATDRQDYAGLVALFTPDGQL
FT                   FRPTAPEEPLAGRDAILASYQARPAQRITRHFCSNIRVQVESAERARISTYVQVFAADT
FT                   QHAPDGHFGWPLAGRTMIGEFDDLCVLDQGAWRFAERHARFVMHRDG"
FT   gene            complement(364894..365607)
FT                   /locus_tag="Csal_0327"
FT   CDS_pept        complement(364894..365607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0327"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57689"
FT                   /db_xref="GOA:Q1R0R9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R9"
FT                   /protein_id="ABE57689.1"
FT                   /translation="MTSVPLLPLPGLLCDDAVWTEVREHLVAPTLPTPDYGMADSIGAM
FT                   ADIALQDAPERFIAVGHSMGGRVALEIQRRAPQRLAGLALLDTGFRGRAAGEAGQRERE
FT                   NRHALLAKARQDGMRAMGGTWLQGMVHPERLDDETLVEAILAMIERKDPDTFAAQIDAL
FT                   LARPDATEQLAGIACPTLLLCGRQDAWSPLERHEEMAGLIPGSRLEVIEEAGHMSPMER
FT                   PAAVARALDHWRNHA"
FT   gene            complement(365604..366716)
FT                   /locus_tag="Csal_0328"
FT   CDS_pept        complement(365604..366716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0328"
FT                   /product="methylitaconate delta2-delta3-isomerase"
FT                   /EC_number="5.3.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57690"
FT                   /db_xref="GOA:Q1R0R8"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R8"
FT                   /protein_id="ABE57690.1"
FT                   /translation="MSQTRIPCLQMRGGTSKGLYFLAEDLPRDTARRDAVLLAAMGSPD
FT                   ARQIDGLGGATSLTSKVAIVDRPTRDDVDVDYLFAQVVVDAPRVDYGQNCGNILAGVGP
FT                   FAIERGWVTACDGTTPVRVHMVNTGQVAIIHVPTPGGSVAYAGDAQISGVPGSAAPLIV
FT                   EFQDTAGSSCGALLPTGHPRDTVEGIDVTCLDNGMPVVLLRAEDLGVSGHESCADLEAN
FT                   TALRERLERIRLAVGPRMNLGDVSERTVPKMTLIAAPRHGGSLATRSFIPHRCHEAIGV
FT                   LGAVSVASGCLVPGTVADGLAVLNEGPTQRLSIEHPTGEFTVELTRDADGEIVRAGLLR
FT                   TARLLFEGHLHVPRAVWNGDTAAHSNGAAS"
FT   gene            complement(366713..367447)
FT                   /locus_tag="Csal_0329"
FT   CDS_pept        complement(366713..367447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0329"
FT                   /product="4-carboxy-4-hydroxy-2-oxoadipate aldolase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57691"
FT                   /db_xref="GOA:Q1R0R7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R7"
FT                   /protein_id="ABE57691.1"
FT                   /translation="MTTSLETPGIVVRDIPRAKREHIDALGEEGVATVHEAQGRKGLLD
FT                   PAIRPIQQDRGISGSAVTVLVSPGDNWMFHVAVEQCQPGDILVVATRSPCVDGYFGDLL
FT                   ATSLQARGVRGLVLDGGVRDTRILREMGFAVWSRAVHAQGTVKETLGSVNIPVVCAGQW
FT                   VNPGDIIVADDDGVVVVRRDEADGVVAASRKRAAAEEDKRVRLANGELGLDIYDMRQRL
FT                   SDKGLTYYDDPQALARAMESSS"
FT   gene            complement(367444..368184)
FT                   /locus_tag="Csal_0330"
FT   CDS_pept        complement(367444..368184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0330"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57692"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R6"
FT                   /protein_id="ABE57692.1"
FT                   /translation="MTVASSSPAGLVVSAHSADFVWRAGGAIALHARQGYAMHIVCLSF
FT                   GERGESAKLWRQGNMSEEKVKAARREEAEAAAAALGASVEFFDIGDYPMRADKETLFRL
FT                   VEVYRRVQPEFVLTHSLKDPYNYDHPLATDLAQEARIIAQAEGHNPGETIVGAPPVYCF
FT                   EPHQPEQCQWRPDVLLDITEVWDDKYRAIQCMAGQEHLWEYYTRVALQRGVQAKRNIGI
FT                   TANKNIQYAEGYQSIFPRVTENLA"
FT   sig_peptide     complement(368131..368184)
FT                   /locus_tag="Csal_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.832 at
FT                   residue 18"
FT   gene            368389..369642
FT                   /locus_tag="Csal_0331"
FT   CDS_pept        368389..369642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0331"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57693"
FT                   /db_xref="GOA:Q1R0R5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R5"
FT                   /protein_id="ABE57693.1"
FT                   /translation="MTELHREAFDYAPNMRRLRAVIAVAEAGSVMRAAEALHLSQPAVT
FT                   RAVRDLEKELGLALFERHRSGMLCTTAGKIVLHRFRRALQQLIEAETALARLHPEGNFE
FT                   RLPQRLSHRQLTVLVAVADLHNEPLAAKRLGLTQPAVSGNLRDLERLLGIALFLRTQRG
FT                   MLATDGGAVLIRHAKMALRELSLVSDDLSAWQGEVRGRVVIGTLPLSSSLLVPHAVDAL
FT                   LRELPGLNVTIIEGTYDALFESLRHGEIDILIGALRQAGTSEDTHQQRLFHDRLAVAAR
FT                   QGHPLMKHAALQLSDLLDAQWIAPRQGTPARVSFEQEFRSAGLQPPSVVVESGNLSTIR
FT                   TLLLDSDRVTLVSPHQVFFEVQSGQLALLPIKLTGTLRPIGITTRADDSPTQALKVLKD
FT                   ILLTLGERMADPSSATRA"
FT   gene            369803..370798
FT                   /locus_tag="Csal_0332"
FT   CDS_pept        369803..370798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0332"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57694"
FT                   /db_xref="GOA:Q1R0R4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R4"
FT                   /protein_id="ABE57694.1"
FT                   /translation="MKTLKSRALLTLTAGVALAANAGVSAAETLKLAHFVSPAHVVNSA
FT                   VVYPLKEGVEKQTNGELEIKVYPGGELGSGPTEQYPRVLQGVADIVWGLPGYTSSQFKK
FT                   SMVVEMPGAIPDDMHGYDMLWNAYEDQLKSEFPGTKPLALWVSEPNIFIMKDEEIRTPE
FT                   DLEGLKIRVSGEMTAALIDAYGGTPVQMPAGEIYNSLQTGLIDGLVTGASAVNDFKLDE
FT                   VANVYSVGAPLGHIMFYLAMNQNKYDSLSAEFQQAIDDNSGEKLSRSGEQGWNARANET
FT                   LKAIREDADNEVIELDPEEIAAFERIADDFREQRLAEKGTNDVLDAMRGE"
FT   sig_peptide     369803..369883
FT                   /locus_tag="Csal_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 27"
FT   gene            370806..371333
FT                   /locus_tag="Csal_0333"
FT   CDS_pept        370806..371333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57695"
FT                   /db_xref="GOA:Q1R0R3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R3"
FT                   /protein_id="ABE57695.1"
FT                   /translation="MSRFRTRVTRTLDGLVNLSSILGTLALIFAVSVTLIDVTGRLFGA
FT                   PLPGGQDLSQMTMVIIVFGGMALCDRQGGNIAVDIFEDKFPARMNRWLDMAGWVLGCAI
FT                   FTAIGYTMLGAAEMSKLLNLSTNIIAIPKAPFQYIVAFFAFLTALSMLARIVSTSLTSS
FT                   HRHASLQKEEDL"
FT   sig_peptide     370806..370913
FT                   /locus_tag="Csal_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.725) with cleavage site probability 0.349 at
FT                   residue 36"
FT   gene            371330..372634
FT                   /locus_tag="Csal_0334"
FT   CDS_pept        371330..372634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0334"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57696"
FT                   /db_xref="GOA:Q1R0R2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R2"
FT                   /protein_id="ABE57696.1"
FT                   /translation="MSTELVGALGILALLALLVLRIPVAFAIFVVGFGGITVLDSLNSA
FT                   LSLLASETFTIASNAELIVIPLFILMGNIATEAGMSRKLYDAAYALIGSVRGGLASATV
FT                   VGCAGFAALCGSSVASALTMGRVSLSEMERFNYSAKLSTGSVAAGGTLGILIPPSTGFV
FT                   IYAILTQQSIGRLFLAGVLPGIMLCLLFVLLIMLLATIKPVLAPSGPKTSWREKQQGLL
FT                   GAMPILIIILLTIGGIYSGIFSPVEAAAVGAGLTILFGAAMRKLTLASFWRAAQSSITT
FT                   TATVMLILIAAHMLNPFLALSHIPQALGDFLMALDIGPYGVLLLILACYLVLGCFLEGF
FT                   AMLVLTMPIFFPVITQLGFDPIWFGVLVVLTLEMGLISPPVGVNVFIVKSVAPNVPLRD
FT                   IFKGVMPFWLVMIAAIGLLIVFPDIVLFLPDTMMD"
FT   sig_peptide     371330..371413
FT                   /locus_tag="Csal_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.594 at
FT                   residue 28"
FT   gene            372718..373905
FT                   /locus_tag="Csal_0335"
FT   CDS_pept        372718..373905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0335"
FT                   /product="glutathione-independent formaldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57697"
FT                   /db_xref="GOA:Q1R0R1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R1"
FT                   /protein_id="ABE57697.1"
FT                   /translation="MANNRGVVYTGPGKVEVQDIAYPKMQAPSGKAIEHGVILKVVSTN
FT                   ICGSDQHMVRGRTTAPAGMVLGHEITGEVIEKGKDVEFLDIGDLVSVPFNVACGRCRTC
FT                   KEGHTGLCLHVNDERAGGAYGYVDMGGWVGGQAHYVMVPYADFNLLKFPDRDQAMDRIR
FT                   DLTMLSDILPTGFHGALNAKVGAGSTVYVAGAGPVGLAAAASAHLLGAAVVMIGDFNQQ
FT                   RLEHARKMGFEPIDLSRHDRLGEMIAAVVGEPKVDSAIDAVGFEAVGHGGKEQPAVVLN
FT                   QMMEVTREAGSIGIPGLYVTEDPGAAEKAAQSGNLSLRFGLGWAKGHSFHTGQTPVVQY
FT                   NRQLMQAILHGRLNIAEIVNAQVISLEDAPQGYQQFDSGVASKFVLDPHGLLGAA"
FT   gene            complement(374018..375130)
FT                   /locus_tag="Csal_0336"
FT   CDS_pept        complement(374018..375130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0336"
FT                   /product="Rieske (2Fe-2S) protein"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57698"
FT                   /db_xref="GOA:Q1R0R0"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0R0"
FT                   /protein_id="ABE57698.1"
FT                   /translation="MSHANQAIPLDEEAIFDAMPMEEEGQFANHATPLIRNCWYVCARR
FT                   DEVGRTPISRRLLDTDVVMYRTRDGRPVAMHNRCPHRAFPLAKGHVEGDRLVCGYHGMQ
FT                   FEPDGLCAHLPAISHVPANACVQTYPIADRGPLTWIWMGDANLADEALIPELPWLASSE
FT                   WGSVTGDFHIKADYVSMHENLIDQTHFPFLHPGTVGTPEYARASMNATTEGDQVLIHRR
FT                   LDNAPPPGIYGKPADIMHKNVDRTSEARFVSPAVHMAHARIFDPQPEPGKPSVYGYYIT
FT                   HCFTPESNHSIHYWWFNSRDYGIDDTDIDAFMYEASMQAYYEDVEALEWIMDVVLTDNE
FT                   AQQFELSFAPDKPGLMARRIMHRLAMSERG"
FT   gene            complement(375162..376133)
FT                   /locus_tag="Csal_0337"
FT   CDS_pept        complement(375162..376133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0337"
FT                   /product="vanillate demethylase subunit B"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57699"
FT                   /db_xref="GOA:Q1R0Q9"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q9"
FT                   /protein_id="ABE57699.1"
FT                   /translation="MHGQHQAAVVLERRPLTERICEITLGKADGTALPAPRAGAHVELR
FT                   FGGKDGRFLRHYSLLGPLDLTSSHEPFWRIAVQRENRRRGSDYIHRHVTPGTSVLISPA
FT                   LSPFRLTADDGPVLLIAGGIGITAILPMLRACVMRRREVRMLYIGRSRAAMAYVEDVEA
FT                   LGGDAVTVHDATSSRGRPDLEALLARQPADTTAYVCGPPALIEGTRQAAQRLGWPAERV
FT                   RHEVFNPAHKEEDQAVTVHTRGASVHVSPGHTLLEALEAAGVETFSDCRRGECGLCITP
FT                   VSSVEGDIDHRDRFLTADQKRGNRQIALCCSRPRSTSIELDL"
FT   gene            376271..377503
FT                   /locus_tag="Csal_0338"
FT   CDS_pept        376271..377503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0338"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57700"
FT                   /db_xref="GOA:Q1R0Q8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q8"
FT                   /protein_id="ABE57700.1"
FT                   /translation="MSHDTVSPGLSLREIRAILAVAEQRGFSSAARRLNISQSSLSRTI
FT                   HRAESVLAIRLFQRGWGGAEPTPEGEIVRQHCTQVMAELLHERDALMAAGLTRLPLPLD
FT                   LRWRDLACVAAVVHTGKTTTAAKWLRTSQSSVSRTLGAISVRLGSPLFQRSGEGLRAEP
FT                   LAERLVALRDRMCARMQPLQERLGHLAGEVTGRLAVGMTPFCEQERVAQAFGDLLVAYP
FT                   QLRLSAVTGSYVMLTDALRCGEIDLVVGLLRELGEDDELAELPLAEEAITVLARSDHPC
FT                   AVRSVSMEDLARQTWIVAPAGTPIRAYFERLFLGMGKTPPVQTCEIVTFHLAESMVRES
FT                   QSLALLLYSPRKVRELPPGLVRVPVTLPDNRRHIGVTYRRDAGLSFTQRQFIDGLAKRF
FT                   ASDDDAEGNAP"
FT   gene            complement(377616..379220)
FT                   /locus_tag="Csal_0339"
FT   CDS_pept        complement(377616..379220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0339"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57701"
FT                   /db_xref="GOA:Q1R0Q7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q7"
FT                   /protein_id="ABE57701.1"
FT                   /translation="MKNQQDADVIISGGGPVGMGLAIELGQRGIDVLVIEKHPSPQRVP
FT                   KGQNLTQRTMEHFRAWGAESELRAARTVPAGFGIGGLTSYGTLLGDYHYDWMKRELVHA
FT                   YYGADNERLPQYATEDVLRARAASLDSVTLLTRREVRDVHEDAEGVSVTVHDRTDGTEA
FT                   TFRAAYAVGADGSRSVVRESAGLTQTVFDHDRLMVLLVFQSDTLHRALLDKHPGKSFFN
FT                   VLHPDLQGYWLFFGRVDLEGEFFFHAPVPDGEDPETFDFQGYVERAVGQSIDMHIRHRG
FT                   FWDCRVAIADSYGSGRTFIAGDAAHNHPPYGGYGINTGFEDARNLGWKLTARLQGWGGP
FT                   ELLPSYDAERRPVFWSTAKDFIEKSIETDREFLASHDPATDPAAFEAVWSARARGAVNE
FT                   VGDFQPNYRGSRIVAGPRDGAASAKGAHSFTARPGYHLAPRALPEGGTTHDRLGPGFSL
FT                   IALGQASAAARLAEDAARLHIPLTVIESAAPGKEDETADYGASLILVRPDQFVAWAGDR
FT                   LPDDLDTAGILKLAVGA"
FT   gene            complement(379217..380035)
FT                   /locus_tag="Csal_0340"
FT   CDS_pept        complement(379217..380035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0340"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57702"
FT                   /db_xref="GOA:Q1R0Q6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q6"
FT                   /protein_id="ABE57702.1"
FT                   /translation="MAEGSSSSSLTRLMSILDIFTETRPEWSSDDMMTELGYPRPTLYR
FT                   YLKVLTDAGMLASNGHGIYTLGPKVVEMDHLLRLSDRLVAIGRPVVAQLTEQYACTAFL
FT                   VRWYRNRLLCMHSETSLEAPLSSYPRGRVMPMNRGAIARTILAHLQSRKARKIIESFAP
FT                   EGPEDARKAYIAEQAAALRSVRRNGYAIAFGEVTPGVVGVASPIFDEAAEPAGALCMTM
FT                   RQEDCPHELRTLITQAVPAAANSITVTLRQSRHTGTDHTHLPLQEEVKDR"
FT   gene            complement(380039..381958)
FT                   /locus_tag="Csal_0341"
FT   CDS_pept        complement(380039..381958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0341"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57703"
FT                   /db_xref="GOA:Q1R0Q5"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q5"
FT                   /protein_id="ABE57703.1"
FT                   /translation="MTAMPLSSPGTPRQPAPYGLLTVTLATIMTLCAILQALDIPQRLG
FT                   LSLYTEQYLAAILAFALGMTFLVAPRFTGRLRLLDPALALAGFCAAGYIALSYPTIVNE
FT                   LVYRPVDGLIVSLIIGLLTIEAVRRLTGPGLTIIVALFLAYGLVGYLLPFGMTRQILWD
FT                   RLAIYVVMDTNGLIGLPLMVTASMVFSFIFLGQLLVSSGGSAFFNDLALALVGRSRGGA
FT                   AKIAVVSSFLFGSVSGSAVANVAASGGVTLPLMRRAGYKPHMAAAIEALASTGGQLAPP
FT                   IMGAAAFLMAEFLQISFATVILAAVIPSLLYYLAIFFYIDAHAAANGMSLPEDVEIRPL
FT                   RRVLADGWQFVAPFVILIFGLFGLNWRPELAALAAALTLVVLALVLPYRGKRSHLGDLL
FT                   RAFPDAGKGMIEIVVIAAAAGMVIGVLNISGLAFSLTLNLVAMAAGSLLPLLIIAALVS
FT                   VVLGMGMPTVGVYVLLASLIGPALVQAGIDPIAAHMFLLYFGMLSMITPPVALASFTAA
FT                   TMAGAEAMKTGWQAFRMGWVAYLIPFVMVFEPGLVMQAAPIDIAWQLLGALVGVWFATG
FT                   AIYGYLTRSLGIVERVLLGMIALAGILPFSLGWGGHLVNLLAICAGVILIFRTRLIPSL
FT                   SGRS"
FT   gene            complement(382058..383002)
FT                   /locus_tag="Csal_0342"
FT   CDS_pept        complement(382058..383002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0342"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57704"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q4"
FT                   /protein_id="ABE57704.1"
FT                   /translation="MSHLTTKTVAFAALLLFASATQAQQLGIGTMGQGTSGYSMGAAIA
FT                   RVLSDNGMDALVQPSAGTSAYLPLIDMGELDLGIANAIEVSDAVSGHGYFEGHALENIA
FT                   PAARLYPFRVGVFVRDDSDMQTVADLAGHAVTYGFTSQATMNRVLDAILAAGGIGPSDI
FT                   EQVMVPNIIRGAEAFVAGRADGAFFAAGSGKVTEVDASTGGVRFLPLPGDDEAEARLQE
FT                   VVPQAYVETLEPREGLTGIDAPMPVMAYDYMLVVGAHVPDETVARIVTTLRDNKQALVD
FT                   SFSAFRSMDPAAMHVDIGVPYHPGALSVLNDND"
FT   sig_peptide     complement(382931..383002)
FT                   /locus_tag="Csal_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            complement(383346..384314)
FT                   /locus_tag="Csal_0343"
FT   CDS_pept        complement(383346..384314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0343"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57705"
FT                   /db_xref="GOA:Q1R0Q3"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q3"
FT                   /protein_id="ABE57705.1"
FT                   /translation="MNDSTLSLFVRVTQKRQEAEGIVSYELSDPHGRPLPAFSAGAHID
FT                   VRVKEGVIRQYSLCGHPEERDRYFIAVLREPSSRGGSVAMHDEIEEGDLLQISAPKNHF
FT                   PLEPAKRSVLFAGGIGVTPILCMAERLSHTQAQFEMHYCARSRERMAFVDRLAQSAYAD
FT                   RVHFYYDDAPEAGKLDVAAVAGEPNDETHIYVCGPSGYIDHVMSTCKAQGWPSSQLHTE
FT                   YFSGVETTSEDDESFEVKIASSGATFSVPKDKSVYEVLSENGIDIMVSCEQGVCGTCLT
FT                   RVLEGEPDHRDLYLDDDERAANDQFTPCCSRAKSKTLVLDL"
FT   gene            complement(384391..385452)
FT                   /locus_tag="Csal_0344"
FT   CDS_pept        complement(384391..385452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0344"
FT                   /product="Rieske (2Fe-2S) protein"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57706"
FT                   /db_xref="GOA:Q1R0Q2"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q2"
FT                   /protein_id="ABE57706.1"
FT                   /translation="MFPKNTWYVACTPDEIEEKPLGRTICNEQIVFFRAEGGQVAAVED
FT                   FCPHRGAPLSLGFVRDGQLVCGYHGLEMGCDGKCSSMPGQRVRGFPSIHAYPVVERHGF
FT                   IWVWPGDAEQADPDQIPELHWANDPEWAYGGGLYHINCDYRLMIDNLMDLTHETYVHAS
FT                   SIGQPEIEEAAPETKVNGDEVLTIRHMENIPAPPFWQSALRGNNLADDVPVDRWQICRF
FT                   TPPSHILIEVGVAHAGKGGYDAPADAKASSIVVDFITPETETSIWYFWGMARNFNPQDE
FT                   ALTEQIREGQGKIFAEDLEMLESQQRNLLRYPDRRLLMLNIDGGGVQARRVIDRILKAE
FT                   AENAQPQQAATAS"
FT   gene            385579..386295
FT                   /locus_tag="Csal_0345"
FT   CDS_pept        385579..386295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0345"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57707"
FT                   /db_xref="GOA:Q1R0Q1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q1"
FT                   /protein_id="ABE57707.1"
FT                   /translation="MPEKSEKNGRLNVIASLRKLISEGVYAPGERLKELHVAERLQVSR
FT                   MPVRLAFRTLEQEGLLQKTGTRGYVVRQFSEEDVLCAVEVRGALEGLAARRLAEQGVPQ
FT                   EVEAQLRDCLSRGEALLEKGYLVKADIELWATLNQEFHRAIVGATGSRVIHDAIARNDH
FT                   LPFASADSIIIDDAALDREYGKLRMAHAQHQLVFQALSRGEGARAEMLMREHAYIGLRY
FT                   GTLFGLGGVGQAPNAT"
FT   gene            complement(386339..387226)
FT                   /locus_tag="Csal_0346"
FT   CDS_pept        complement(386339..387226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0346"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57708"
FT                   /db_xref="GOA:Q1R0Q0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0Q0"
FT                   /protein_id="ABE57708.1"
FT                   /translation="MSASSNRTIPVFQLYGETHQWPTPDLLHCESIAERSRLHDWHIRP
FT                   HRHADLVHVLHIAHGDVNLTFEEGAQRLTGPLLIVVPAMTVHAFRFSRDVDGHIVTLAM
FT                   PLARHIADTLHPQGQILARAAFYPLADQPERAPIATLVDQLDAEYRHPADGRDALLEAL
FT                   LNSLLVLASRRATRRQARPASRQHERGEAHLARFQQLIEAHYHQQPSIPEFAERLGISS
FT                   AHLSAVCQRLAGRSAQQLLHERVLLEAKRHLTYTNMTIGQVAERLGFKEPAYFTRFFKR
FT                   HVACSPKEFRQRQA"
FT   gene            387394..388581
FT                   /locus_tag="Csal_0347"
FT   CDS_pept        387394..388581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0347"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57709"
FT                   /db_xref="GOA:Q1R0P9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P9"
FT                   /protein_id="ABE57709.1"
FT                   /translation="MKTQVAIIGAGPSGLLLGQLLQRAGINNVILERRSGEYVLSRIRA
FT                   GVLEQGMVDLLREAGVDRRMDAEGLPHDGVELAFDNRRVRIDLAALTGGKQVMVYGQTE
FT                   VTRDLMEARAAEGGQTLYEVDKVQPHDLETDAPYITFEHNGETQRLDCDYVAGCDGYHG
FT                   VSRQSIPADRLKTFERVYPFGWLGLLSDTPPVSDELIYARHERGFALCSMRSQTRSRYY
FT                   VQVPLDEKVEDWSDARFWEELKRRLPEDVAANLVTGPSLEKSIAPLRSFVAEPMQHGRL
FT                   FLVGDAAHIVPPTGAKGLNLAASDVNTLYRLMVKVYHEGRTDLVPRYSQTCLKRVWKAE
FT                   RFSWWMTSILHKFSEDEDFGARMQQAELDYVTGSEAGLTTIAENYVGLPYEPLES"
FT   gene            388717..390189
FT                   /locus_tag="Csal_0348"
FT   CDS_pept        388717..390189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0348"
FT                   /product="4-hydroxybenzaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57710"
FT                   /db_xref="GOA:Q1R0P8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P8"
FT                   /protein_id="ABE57710.1"
FT                   /translation="MTQAPLFADQDAQPIAGRWRQGSAERRLTVTNPYSGETLLDLAMA
FT                   DWHDLDDAYRHAQAAQAEWAALGPNARGDVMRRAVAIFDERRDEIIDWIIRESGSTRIK
FT                   AQIEWNAARAITQEAASMPTRAHGRILPSDIPGKESRVYRAPLGVVGVISPWNFPLNLS
FT                   ARSVSPALALGNAVVVKPASDTPVTGGLLLARIFEEAGLPPGVLSVVVGAGSEIGDAFV
FT                   EHPVPSLITFTGSTPVGLNIGRLASGGKHLKHVALELGGNSPFVVLADADVEQAVDAAV
FT                   AGKFLHQGQICMAINRIIVEEPLRDAFTARFVERVKALRLGDPADPETAVGPIINAKQL
FT                   EGLQTKIAKAHAEGATLLTGGDTEGNVLPPHVFGDVTADMELADEEIFGPLVGIQSARD
FT                   EAHALELANRTEFGLSSAVFTGNLERGVRFAQGIKAGMTHVNDIPVNDEPHAPFGGEKN
FT                   SGLGRFNGDWAIDEFTTEHWITLQHEPRQYPF"
FT   gene            390264..391355
FT                   /locus_tag="Csal_0349"
FT   CDS_pept        390264..391355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0349"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57711"
FT                   /db_xref="GOA:Q1R0P7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P7"
FT                   /protein_id="ABE57711.1"
FT                   /translation="MQIKAAVTRDKGGPFSVETLTLTEPGASELRLRIVATGVCHTDAV
FT                   ARDLELTPFPVVLGHEGAGVVEAVGSEVTAFAPGDHVVLSFAHCGACEHCLTGHPTVCM
FT                   RMNELNFGGRAENGTCYLHRGDEAVSTFFGQSSFGSHAVVHERNAVKVDPDLDLGLLAP
FT                   LGCGVQTGSGTVLNRLKPASGSSLVVYGCGAVGLSAVMAARIAGCARIIAVDVHDNRLS
FT                   LAKELGATHVFNGRQVDVVEEIRAVTGAGAHYAVETTGVPQVVRQGLHALRPLGQLAIV
FT                   GVTPEVTLDVHNDLMAEGKTMLGVIEGDSVPKVFIPQLIDYYRQGQFPFDKLVTFYEFD
FT                   ALEEAFADSKSGKTIKPVVRMNS"
FT   gene            complement(391406..392146)
FT                   /locus_tag="Csal_0350"
FT   CDS_pept        complement(391406..392146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0350"
FT                   /product="protein of unknown function UPF0126"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57712"
FT                   /db_xref="GOA:Q1R0P6"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P6"
FT                   /protein_id="ABE57712.1"
FT                   /translation="MAGWIYWLDLAGVIVFALSGVIIACRSRMDPFGMLVLAAMTGIGG
FT                   GTLRDLLLGIRPVFWVTDPTYLWVIIITVVSSIIGFHYIHRLSRIVLPVLDAFGLAIFT
FT                   IIGAHKALALGHGGTVAVLMGLLTGVAGGMLRDVLARRVPMVLRQEIYATASIAGATAY
FT                   VTLYTHPIHPYVTIALPILVILALRLSAIYWRLSLPVFAWITSPAEPSSRSTTHNAAPS
FT                   PSEIEKTPRSRARVRMLSPKRRRR"
FT   gene            392384..393154
FT                   /locus_tag="Csal_0351"
FT   CDS_pept        392384..393154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0351"
FT                   /product="MltA-interacting MipA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57713"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P5"
FT                   /protein_id="ABE57713.1"
FT                   /translation="MQAGYRYAALAVALPMLVVATPSQAQDSGWQGSLGAGAIHAPDYL
FT                   GSDDYETSLWPSVDLTYGDSLYINARDGVGWNVINRDGWRVSPFLGYTFGRDNDDDLHR
FT                   LDEVDGGVTAGLRAEYTEGHWQYSAAVETPLSGDVDGYHVSAKAHWRSRLTQRLSVSLG
FT                   PNVAYGSDAWTEDMFGISARESRRSGLDAYSPSEGYFRFGADASASYYLTRTWSVTGLV
FT                   GVSRLTGDAKDSPIVDEIGDATQAYVGGFINYNF"
FT   sig_peptide     392384..392461
FT                   /locus_tag="Csal_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(393546..394925)
FT                   /locus_tag="Csal_0352"
FT   CDS_pept        complement(393546..394925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0352"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57714"
FT                   /db_xref="GOA:Q1R0P4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P4"
FT                   /protein_id="ABE57714.1"
FT                   /translation="MSRKTLTAVNPANDQVLGEHEMLDDAGLAEKMNQAREGYAEFRHL
FT                   PVADRQRRLTALADLIDQHQREMAEIIAHEMGKPFHQGIAETQISSAIVRFYADNLESL
FT                   LKPQPRQVEGAQKAEIVHDPMGAVLGVMPWNYPLYQVVRFAAPNLAGGNVCLLKHASNV
FT                   PGCAKFITKLFHDAGFKEGTFTWLPIGSDKVEGIIHDPLVCGVTLTGSEDAGRAVAKIA
FT                   GEAIKPSVLELGGIDPLIVLDDADVDKAVELAVNGRFDNTGQSCAASKRLIVERPMLER
FT                   FTEKLIDRVQKMRIGDPMDGDTEIGPMSRKDLRDDLHDQVQRAIKHGAQLETGGEVLDR
FT                   PGAWYAPTVLTNVAPGNPAFDEELFGPVASVIVADDAEHAIELANNCRYGLGGTVVGQD
FT                   VKRAEQVARRLEVGMSFVNRPTTPFAELPFGGVKESGYGREQSEYGFGAFLNVRTVYIA
FT                   E"
FT   gene            complement(395125..397116)
FT                   /locus_tag="Csal_0353"
FT   CDS_pept        complement(395125..397116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0353"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57715"
FT                   /db_xref="GOA:Q1R0P3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P3"
FT                   /protein_id="ABE57715.1"
FT                   /translation="MPSRFTLANAIRALSMDAVQAANSGHPGAPMGMADIAQVLWCDHL
FT                   KHNPDNPTWPDRDRFVLSNGHGSMLLYSLLHLSGYDLAIEDLKAFRQLHSRTPGHPELG
FT                   YTPGVETTTGPLGQGLANAVGMALAERTLAAQYNRPGHDIVDHRTWCFVGDGCLMEGIS
FT                   HEACSLAGTQGLGKLTVFYDDNGISIDGEVAGWFSDDTAKRFEAYGWQVIADVDGHDPA
FT                   AIEDAIIAARRDTQRPTLIICKTVIGFGAPSKQGTEACHGAALGEEEVAAARQHLGWPH
FT                   PPFHVPEEVYAGWNAAEAGRGAEAQWRQRFAQYAEAYPELAEALERRWRGELPGDLGGS
FT                   ALIENAQHACDTLASRKASLGVLNHLGPRLPELLGGSADLAPSNLTIWDGARAISAQAP
FT                   DGNYLHYGVREFAMGAIMNGISMHGGFIPYGATFLTFMEYMHNAVRMAALARRQVIFVY
FT                   THDSIGLGEDGPTHQPIEQLNALRITPNLATWRPCDATETAVAWLAALKRQTGPTALVF
FT                   SRQSLPGQQRDVAQLAHVERGGYVLYDCEGTPELILIATGSEVGLAMEAAAELGGQGRR
FT                   VRVVSMPCTSEFDAQSADYQETVLPAAVTRRLAIEASHPDYWRKYVGPQGRIIGMSGYG
FT                   ESGKAEDLFRHFGFTVENVVDTALALLD"
FT   gene            complement(397140..398096)
FT                   /locus_tag="Csal_0354"
FT   CDS_pept        complement(397140..398096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0354"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57716"
FT                   /db_xref="GOA:Q1R0P2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P2"
FT                   /protein_id="ABE57716.1"
FT                   /translation="MVSQLDSLKAQSLVVADTGDPAAIERYRPVDATTNPSLILKAFEL
FT                   PDYQPLIDEVLDEARREGRHDADQLERIVDRLSVGIGSEIAQRIPGRVSTEVAAKYSFD
FT                   TQASIRKAHELVERYDALGVGRDRVLIKLASTWEGIRAAEVLEGEGIQCNLTLLFSEAQ
FT                   AQACFDAGVFLVSPFVGRVTDWYQKETGQTFGPDDDPGVQFVRQVCERADRGGYDTVVM
FT                   GASFRTPEQVLALAGCPRLTISPALLETLDAREGGIDAQVRFRRPPARPAPALDESTFR
FT                   WRHNQDPMAIDKLAEGIRRFADDQACLEDLIADRLTG"
FT   gene            complement(398197..398850)
FT                   /locus_tag="Csal_0355"
FT   CDS_pept        complement(398197..398850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0355"
FT                   /product="dihydroxyacetone kinase DhaL subunit"
FT                   /EC_number="2.7.1.121"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57717"
FT                   /db_xref="GOA:Q1R0P1"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P1"
FT                   /protein_id="ABE57717.1"
FT                   /translation="MQFLDATHGKEILEELVEVIVENRNYLSEVDGAIGDGDHGINMAK
FT                   GFRLCGESIAGQSLSLSKALGTLATTLMGSIGGSMGPLYGSLFMGMAKAVKDKDAIDAK
FT                   DFGDMLAEGRQSLEQISDASVGDKCLLDTLVPAIDGYRHALDAGEDFPQALQALRHGAQ
FT                   RGCDSTLELEAKIGRAARLGERSRGHLDAGAVSCCLLLTRLADSTERRLEKAAA"
FT   gene            complement(398872..399864)
FT                   /locus_tag="Csal_0356"
FT   CDS_pept        complement(398872..399864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0356"
FT                   /product="dihydroxyacetone kinase DhaK subunit"
FT                   /EC_number="2.7.1.121"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57718"
FT                   /db_xref="GOA:Q1R0P0"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0P0"
FT                   /protein_id="ABE57718.1"
FT                   /translation="MQRIINDPDNVVDDALKGYLRASPTLLAPTDHPRVLKYAGHTGDK
FT                   VGVVTGGGSGHEPAFLGYVGDGLCDAVAVGEIFSSPTADAFLEAFRVANRGQGVACLYG
FT                   NYAGDNMNVKMARQMAELEDIDVKTVIARDDVASAPATQRDKRRGVAGEVMMWKIGGAA
FT                   AARGDSLDEVIRLAQKAVDACSSIGVGLSSCTIPANGKPNFSIEPGHMELGIGHHGEPG
FT                   IEVAPLTSADAIASAMCDPVLADQDFAGSEVAVLVSGLGATPVMELNLLYAHVADRLEA
FT                   AGVKVYRTDIGNYFTSLEMMGATLTLMKLDDELKPLLDAPARSLAITQR"
FT   gene            400279..400779
FT                   /locus_tag="Csal_0357"
FT   CDS_pept        400279..400779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0357"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57719"
FT                   /db_xref="GOA:Q1R0N9"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N9"
FT                   /protein_id="ABE57719.1"
FT                   /translation="MSDSRTASHTAPMRVALGGDEAAYELKALLIEHVRALGHEAVDFG
FT                   TYDAEPVLYPDVAVKVARAIEAGEVERGVLVCGTGIGVAISANKVRGIRAAQAHDTYSA
FT                   AKARSSNDAQIVTLGARVVGPELAKTIVTTFLATEFAGGGSREKVARILAYERETFRDP
FT                   PRV"
FT   gene            400851..401831
FT                   /locus_tag="Csal_0358"
FT   CDS_pept        400851..401831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0358"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57720"
FT                   /db_xref="GOA:Q1R0N8"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N8"
FT                   /protein_id="ABE57720.1"
FT                   /translation="MSERAESADVALMTEIATLYYVEGETQEAIANRLGISRVKAGRLL
FT                   KRAHAEGIVDVRVRQHPAVSAELEQALIRRFGIKRALIALDHADPDTQRSGVASLVADH
FT                   LSRSLHDGSIVAVGMGRNVGAVADNVFEQGERKCSFVCAIGGSLRAGEYMNPDHICRRL
FT                   AMKYGGESETLYAPALVQNPALRDSMYENPTVRQTLDRARRADVALIGVGDLSEDSNMV
FT                   RMGWFTPQEIAEARLSGTVGDMMGYDFIDMHGRPSETPMQGRVIGLTITDLARIPDVVA
FT                   IASENTKAAGILGALRTGVIDTLATSVTNAHTILRLDEATTSQAS"
FT   gene            402108..403208
FT                   /locus_tag="Csal_0359"
FT   CDS_pept        402108..403208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0359"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57721"
FT                   /db_xref="GOA:Q1R0N7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N7"
FT                   /protein_id="ABE57721.1"
FT                   /translation="MNDTLTPSPDIPQTMRAIVAYAPEDYRLEEVAVPEIGEKEILIKV
FT                   EACGICAGDLKAYEGAPSFWGDETQPPYIKAPMIPGHEFVGHVVKLGPGVKGFDIGDRV
FT                   ISEQIVPCWDCRFCHRGQYWMCEKHDVYGFQNNVNGGMAEYMKFPREAINHKLPENVPV
FT                   ENIVLTEPFSCSMHAVERAQIQLGDVVVLSGAGTLGLGMIGPAKKSGPAKLVVLDLHGE
FT                   RLELARKFGADVVLNPSEEDVVQIVKDMTDGYGCDIYIEATGAPKSVEQGLAMLRKLGR
FT                   FVEFSVFKDPVTVDWSIISDRKELDVLGAHLGPYCYPHVIEGIESGDFPTDGVVTHKLP
FT                   LEDFHKGIELMRHDSSALKVILVPGA"
FT   gene            403280..403930
FT                   /locus_tag="Csal_0360"
FT   CDS_pept        403280..403930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57722"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N6"
FT                   /protein_id="ABE57722.1"
FT                   /translation="MNTRTAAMSAKPSRKGRGSILMAGAVVVLLAVMAWDTKVMPIEAD
FT                   AEGEGSKLAQFAEETFPEIRDDVEARAVGVGELASALDEDRSAAGERYGVPAGIGPIIP
FT                   VTVSGVVGEGSSGTYVIETDAAPGDLTIRVQTGPAINGTVLRDATGEIEFGQFKNQIEY
FT                   QNAGAALNDAMKAQVLAGLDREALEGKNVTVTGVFQLINPANWLITPVAFDVQ"
FT   sig_peptide     403280..403384
FT                   /locus_tag="Csal_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.994 at
FT                   residue 35"
FT   gene            403944..405491
FT                   /locus_tag="Csal_0361"
FT   CDS_pept        403944..405491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0361"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57723"
FT                   /db_xref="GOA:Q1R0N5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N5"
FT                   /protein_id="ABE57723.1"
FT                   /translation="MNERAASQDERVGRVILSARNVAKSFGNVQALKHVDFDIHYGQVT
FT                   TLFGENGAGKSTLMKILSGVIRPSSGDILLEGEPVSFSSTTDAQRLGVSIIHQELSLAP
FT                   NLSVRDNIFMGRELRGATGIDYAEEERQARRLMEELDEPIDPLTLVEDLRLGQQQIVEI
FT                   ARALSVNSRILIMDEPTSALSASEVEVLFRVIRDLKSRGVSIVYISHHLEEALLITDHA
FT                   VVLRDGAMTAYARREDIDLEWIVRNMVGENFDLGSPPGGYAMGEVMLSLEGVSVPDATV
FT                   PGRHVVDDLSLAVRAGEIVCIYGLMGAGRTELLESVAGRGEMSAGRVCLHGEDISRLSI
FT                   AERIAKGLVLVPEDRQRDGLVQTMSVGENLSLASIGAFTKGLVTSRRRERHVVEASIEN
FT                   VHIKADGAEAAIGSLSGGNQQKVVIGKMLATRPQVVLLDEPSRGIDIGAKAEVFKLLSE
FT                   GAAREGLAVVFSTSEVGECLSIAHRIVVMSRGRIAAEFGADASKEDIMAASGEAVVA"
FT   gene            405519..406670
FT                   /locus_tag="Csal_0362"
FT   CDS_pept        405519..406670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0362"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57724"
FT                   /db_xref="GOA:Q1R0N4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N4"
FT                   /protein_id="ABE57724.1"
FT                   /translation="MSNMNQTASSSRSQGGGRRFDVARMLLEGRAFFALIAIIVIFSLL
FT                   SPVYFSTSNFLTMSSHVAIFGLLSLGMLLVILTGGIDLSVGSTLGLAGVFAGFLMQGVS
FT                   FEAFGVVVYPPVWVVVVLTCGLGALVGAINGVLIAYFKVPAFVATLGLLYVARGVALLM
FT                   TDGLTYNNLGGSEALGNTGFDWLGFNRLFGIPVGVLILAAVAIACLLLLSRTPFGRWVY
FT                   STGGNARAAELSGVPVKRVQVSVYVLSGICAAIAGLVLSSQLTSAGPTAGTTYELTAIA
FT                   GVVIGGAALTGGRGNVRGTLLGAFVIGFLSDGLVIIGVSSYWQTVFTGAVIILAVLLNS
FT                   IQYSGRKNSKPASDGKPTSPQPEGASERSPATGSTTGKAGAQS"
FT   gene            406689..407645
FT                   /locus_tag="Csal_0363"
FT   CDS_pept        406689..407645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0363"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57725"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N3"
FT                   /protein_id="ABE57725.1"
FT                   /translation="MFMKGKRLLIAALAVGVPLLASGASAQDKGLMSIIVNDTSNPYWF
FT                   TEGKIAEETAEKLGYEADVSSHKGDTNTESRQIDTAITNQAEAIILDPANADGSIGAVR
FT                   KAVEAGIPVFIINAEINQQGLAEAQLVSNNAQGAALGAQQWIKSVGDSARYVELKGAPS
FT                   DNNAATRSNGYETVLSQYPGLEKVGSDVANWDRTQGFNKTQSMLQANPDIDGVISGNDE
FT                   MALGAISALKEAGKLDDVVVGGFDGSPDAVEAVKAGEMDYTVLQPVAIFSEMAVRMADK
FT                   YVTTGETGVDGEKQLFDCFLITSDNVDDYTDPFVLEQ"
FT   sig_peptide     406689..406769
FT                   /locus_tag="Csal_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            408294..409640
FT                   /locus_tag="Csal_0364"
FT   CDS_pept        408294..409640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0364"
FT                   /product="L-fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57726"
FT                   /db_xref="GOA:Q1R0N2"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N2"
FT                   /protein_id="ABE57726.1"
FT                   /translation="MDVSSSALAREESVPEKSSFLYRGMRLPFLLIVICFAAWGLAGNL
FT                   TDPLVSVFGSVFSMSALQASLVQFAYYGAYFALAVPAAWINSHLGYKGGVLIGLLLAAT
FT                   GGILFLPASQMMTYSMFLVALFTLAAGLSILETSANPYVMAMGPRHNATRRLNFAQSFN
FT                   PVGSNLGVLLAAIFILPNVNPATAEQRASLTQEALAEMQSAELQAVMGPYLTLALVYVV
FT                   IAIAIAMVRVPRYEPLLADRKRDGNMQPGSRLGRLVRNRRYAFGVVAQFFNVAAQTCTW
FT                   TFTIHYVIQTLGVSDSVAGYWLQASLLVFLVSRFVMVGVMGRVDPRKLMTWMCVIGVVL
FT                   SLVAVLSGNLLGAVAVVSLSACISLLFPTIYGISLEGLGQDTKYGAAGLVMAIVGGALM
FT                   PLVQGWVIDITSARISYVVVALCFAVIAAFGVYVQKHPRVGEASDGDLA"
FT   gene            complement(409637..410368)
FT                   /locus_tag="Csal_0365"
FT   CDS_pept        complement(409637..410368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0365"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57727"
FT                   /db_xref="GOA:Q1R0N1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N1"
FT                   /protein_id="ABE57727.1"
FT                   /translation="MPPLSPSDSDQRRPSQHEVVIQGIQEMIVSGEISSGDRLPVESIL
FT                   ATRFGVSRSSLREGVRALVAMGILETRQGSGTTVTSLDPGLLLKPLEFWAGIQAGKSSR
FT                   DLHGVRQALEVEAAAVAAMRRTDEDIERLQAILDDAEPAIRALDHESAMAADLTFHLTL
FT                   ARISRNSVLIALLEALSRPTLRMRLWQSIHRSGRLAITHQEHQAILNAVIAGDPRDAHA
FT                   AMQSHLSQVAVVLRDASGNAS"
FT   gene            410461..411783
FT                   /locus_tag="Csal_0366"
FT   CDS_pept        410461..411783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0366"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57728"
FT                   /db_xref="GOA:Q1R0N0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0N0"
FT                   /protein_id="ABE57728.1"
FT                   /translation="MPVITTIELVDLRFPTSESNAGSDAVNKDADYSAAYLRLATDDST
FT                   LYGCGFTFTIGRGNEICLQAMEVLAAKLVGRDVAQVCRAPGTVYRELAEDSQLRWLGPD
FT                   KGVVHLARAAVMNAVWDLAARHAEVPLWRLICEMDPEVLVEQLDLSYLGDVLSAGEAVA
FT                   MLEEQRPFHQARIAELSEQGFPCYTTSPGWLGYSDDKLARLCREAMDEGYQHIKLKVGG
FT                   DPADDERRLGIARSVIGPDKMLMIDANQIWEVPEAIERVEALAHHGLLWIEEPTSPDDV
FT                   LGHRRIADSVRQRGIGVATGEHGMNRVLFKQLLQADAVDFVQIDSCRLASINEIIPVLL
FT                   MAKKSGKPVCPHAGGVGLCELVSHLVMIDHIAVSGPVAGRVAEFVDHLHEHFVDPCHVS
FT                   QGAYVLPTRPGYAAEIKAETLAAWAWPDGTEWVKRRQVMTA"
FT   gene            411780..412214
FT                   /locus_tag="Csal_0367"
FT   CDS_pept        411780..412214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0367"
FT                   /product="RbsD or FucU transport"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57729"
FT                   /db_xref="GOA:Q1R0M9"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M9"
FT                   /protein_id="ABE57729.1"
FT                   /translation="MINGPLLHPPLLHALAAAGHGAKILVADALYPHSTGAPATASRVY
FT                   LNLCEGMVPAQAVMDAVSQSVAVEAITFMATAEGKASETVVDCQQRLAGHRHGNGQTIA
FT                   WSGLERWAFYDACRAPDVCLLIATGERRPYSNFLLTIGVP"
FT   gene            412214..412996
FT                   /locus_tag="Csal_0368"
FT   CDS_pept        412214..412996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0368"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57730"
FT                   /db_xref="GOA:Q1R0M8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M8"
FT                   /protein_id="ABE57730.1"
FT                   /translation="MIDTHLHVWDTAAVRIPWLNDAGLPAKAVIPDRQDRRFVLVEADA
FT                   TDPAEEADWLIGVADATPSVHGVVVSVPLEKPLVSEWLERVADIPQVVGVRRLLQDRDL
FT                   FDSIAFLDGLKRLAACGLPFDACVRDYELPRLLTLIEQVPELTVVLDHMGKPDVRDAAA
FT                   RDRWARNLARLAERDAVYCKLSGLPAECRDADELECCAADILDVAIGTFGVERCLIGSD
FT                   HPVSQDPSDWCDRVLARLPAAQHSAVAVNNAMNVYQRR"
FT   gene            413003..414001
FT                   /locus_tag="Csal_0369"
FT   CDS_pept        413003..414001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0369"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57731"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M7"
FT                   /protein_id="ABE57731.1"
FT                   /translation="MTASTLSRHLPAKLQRAFAGLGVGTAQFGNMGRVTPERDCLDAVD
FT                   TAWELGLRFFDTAPHYGLGVSEQRLGKALRGRSPEDYVISTKVGRLLAPNPSPQGSDEV
FT                   NGFHVADELMRVRDYTAEGVRQSLTASLERLGMTSVDILWIHDPEEPSDRFEEALAGAV
FT                   PELDRLREQGVISAWGVGSKDAAMLKRFVDQASLDLIMLAGRYTLLEQEQVGLMSTCLE
FT                   RNVGVVAVGVFNSGLLARDEPPADAWYEYGQAPQSVIARARELAAVAHAHAVSLPAAAL
FT                   AFPWRHPAVVNVMAGMRSPEQVTRNHALASSNIPDAFWGELKARGLLEETS"
FT   gene            complement(414123..415187)
FT                   /locus_tag="Csal_0370"
FT   CDS_pept        complement(414123..415187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0370"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57732"
FT                   /db_xref="GOA:Q1R0M6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M6"
FT                   /protein_id="ABE57732.1"
FT                   /translation="MALISLRQLLDHAAEHAYGVPAFNVNNLEQMRAIMEAADRTDSPV
FT                   IVQASAGARKYAGAPFLRHLIQAAVEEFPHIPVVMHQDHGTSPGVCQRSIQLGFSSVMM
FT                   DGSLKEDGKTPADYAYNVDVTRRAVEMAHACGVSVEGELGCLGSLETGQAGEEDGVGAE
FT                   GTLDHSQLLTDPEEAAQFVAATQVDALAIAIGTSHGAYKFTRPPTGDILSIQRIKEIHA
FT                   RIPDTHLVMHGSSSVPQEWLEVINAHGGEIPETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAVRRFLAENPSEFDPRKFLKASVAAMRDVCIARFEAFGTAGQASKIAPIDLERM
FT                   FERYASGELAPKVN"
FT   gene            complement(415265..416428)
FT                   /locus_tag="Csal_0371"
FT   CDS_pept        complement(415265..416428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0371"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57733"
FT                   /db_xref="GOA:Q1R0M5"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M5"
FT                   /protein_id="ABE57733.1"
FT                   /translation="MNVRKMTDLDLAGKRVLIREDLNVPIKGDQVTSDARLRACLPTIQ
FT                   AALDAGARVMLMSHLGRPTEGDSADEFSLAPVAARLGQLLGREVRLEKDYLDGHVDIAD
FT                   GDVVLLENVRYNKGEKKDDEALSKAYAALCDVYVMDAFGTAHRAQASTHGVARYAPTAC
FT                   AGPLLAGELDALEKALATPARPMLAIVGGSKVSTKLDVLTALAEKCDQLIVGGGIANTF
FT                   IAAAGYNVGKSLHESDLIDQAKALMAKVDIPLPTDVVVATEFSEQAEATVKPVDQVGDD
FT                   EMILDIGPDTAGRLAALLENAGTILWNGPVGVFEIDQFGKGTETLSRAIAASAAFSIAG
FT                   GGDTLAAIDKYGVADDVSYISTGGGAFLEYVEGKQLPAVAALEAASR"
FT   gene            complement(416440..417630)
FT                   /locus_tag="Csal_0372"
FT   CDS_pept        complement(416440..417630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0372"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57734"
FT                   /db_xref="GOA:Q1R0M4"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M4"
FT                   /protein_id="ABE57734.1"
FT                   /translation="MPLGRHAALGKRGVTALISALYRRTGFPERLSMSYRIAINGYGRI
FT                   GQSVLRALIERQETALEIVAINELSDLDTIAYLTRYDTTHGRFPGQVDARDGQLYIDGH
FT                   AIRVLCEPDPARLPWDELGIDLVLECSGSFKDRATAEQHLAAGAQRLLFSQPAEADVDA
FT                   TIVHGINDAELRADMRIVSAASCTTNCLVPLLTVIDEALGLEHGVTTTIHSAMNDQPVI
FT                   DAYHKTDLRLTRSAMQSIIPVDTGLARGIERLMPHLAGRFECLHVRVPTINVSAMDMAL
FT                   SVRRATTAADVNALLQAASHERLGGLLGHTQEPVASVDFNHDPRSGIVDATQTRVAGGH
FT                   LIKMLCWFDNEWGFANRMLDVSLRWLALAGADTSSAASTHAPSRVSPLPSDTPSFK"
FT   gene            complement(417696..418424)
FT                   /locus_tag="Csal_0373"
FT   CDS_pept        complement(417696..418424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0373"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57735"
FT                   /db_xref="GOA:Q1R0M3"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M3"
FT                   /protein_id="ABE57735.1"
FT                   /translation="MSELLLRLESLAGELPQRTETAIVLTLAAYFAGLRLFAWLRSPAW
FT                   CPPILLASCLLALWLALLPLDYAGYRQGVEWLTWLLGPATVALGVPLYQQVHHIRALWK
FT                   PIALTLPPAAMLAAGYAVGIAWLLDAPPRILASLAPKSVTAPIAMGITQELGGSVSLLM
FT                   GALLITGVMATLGITFMARGWRLEDERVIGFALGVNGHAIGTVRAFEIGPTAGAFASLG
FT                   MSLTGVFTALWLPLMWHLMA"
FT   gene            complement(418417..418782)
FT                   /locus_tag="Csal_0374"
FT   CDS_pept        complement(418417..418782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0374"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57736"
FT                   /db_xref="GOA:Q1R0M2"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M2"
FT                   /protein_id="ABE57736.1"
FT                   /translation="MLSILRGFLGLAAFLLLGDIVVRTFALPLSSGVAGMLLLTSWLLL
FT                   CRRPGHGLTAASQPLIGMLALLIMPGVVGIFFQAGEFAGQWSTIFIALIAGTLLSSWTT
FT                   LWLMRRLVPDTRDNAHE"
FT   gene            418979..420031
FT                   /locus_tag="Csal_0375"
FT   CDS_pept        418979..420031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0375"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57737"
FT                   /db_xref="GOA:Q1R0M1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M1"
FT                   /protein_id="ABE57737.1"
FT                   /translation="MTDIAGLLGAEAETLLEHRCQTFRKEDLYLPGPDFIDRVMAESDR
FT                   SPHVLRNMQTLFNHGRLAGTGYVSILPVDQGIEHSAGASFAPNPLYFDPKNIVELAIEG
FT                   GCNCVASTLGVLSSVARRYAHKIPFMLKLNHNETLTYPAIYDQTLFAQVEQAHDMGCVA
FT                   VGATIYFGSPESRRQIQEISEAFERAHELGMVTVLWSYLRNPAFKHEGTDYHVASDLTG
FT                   QAIHMAATLKADIVKQKLPENNGGYRAVGFGHTHDKVYDELTSDNPVDLARYQVANCFM
FT                   GRAGLINSGGGSKGHSDLGEAVRTAVINKRAGGMGLISGRKAFQKPMKEGAELLNAIQD
FT                   VYLSPEVTIA"
FT   gene            420193..421428
FT                   /locus_tag="Csal_0376"
FT   CDS_pept        420193..421428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0376"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57738"
FT                   /db_xref="GOA:Q1R0M0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0M0"
FT                   /protein_id="ABE57738.1"
FT                   /translation="MPQPAGGIAIKDVVDQDVVAENVATRDVAIVGAGPVGLCLALELA
FT                   ALGLTVTVIDRAPWKALASPDDDGREIALTHASRRQLAAAGIAIPEDRMAPIREARLYN
FT                   GDPPHGMTLASARGEAQDGIGQLVANHLIRRAAFEAVRDVDRIELITGHGVQALNGGAD
FT                   WRSVRLDDQRDIPARLVVAADGRLSVTRRLAGLSAQIHDTGQRLLVRRMAHERSHRQTT
FT                   WSWFHGERGLALLPLAGDTASLVMTLPPEDAERLEAMSPTAFAAEATRLYRGCVGEMTC
FT                   LDALHDYPLTVSHADRLVADRVALVGDAALGLHPVTAHGFNVGLASVRRLVEALASHAG
FT                   TTADVGAAAGLASYARHHQRAIVPLWHASRALVALYGDTRPPARLARHLALGAARRIAP
FT                   LQWLMEGYLARH"
FT   gene            421642..421866
FT                   /locus_tag="Csal_0377"
FT   CDS_pept        421642..421866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0377"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   glutaredoxin subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57739"
FT                   /db_xref="GOA:Q1R0L9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L9"
FT                   /protein_id="ABE57739.1"
FT                   /translation="MSIKIYSKPDCMQCHATYRALDKQGLDYTVVDISADPEAVRTVES
FT                   LGYRQLPVVVTPDEQHWSGFRPELIRQLA"
FT   gene            421884..422288
FT                   /locus_tag="Csal_0378"
FT   CDS_pept        421884..422288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0378"
FT                   /product="nrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57740"
FT                   /db_xref="GOA:Q1R0L8"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0L8"
FT                   /protein_id="ABE57740.1"
FT                   /translation="MCDVVYFSTQSGNTRRFVEKLDVPAQRIPRSRNDAPLRVTRPYVL
FT                   ILPTYGDGDPRTAVPGPVIRFLNDPRNRALIQGVVAGGNTNFGAAFGLAGRVVAHKCEV
FT                   PLLHRFELMGTPEDVAKVRACLAMEMTDVG"
FT   gene            422281..424452
FT                   /locus_tag="Csal_0379"
FT   CDS_pept        422281..424452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0379"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57741"
FT                   /db_xref="GOA:Q1R0L7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L7"
FT                   /protein_id="ABE57741.1"
FT                   /translation="MDDTVELTEKTPAVEASRATQTLDYHALNAMLNLYDDQGRLQLDA
FT                   DREASRQYFLQHVNQNTVFFHTLAEKLEYLVAENYYEQEVLDQYDFPFIKSLFERAYAV
FT                   KFRFQSFLGAFKYYTSYTLKTFDGRRYLERFEDRVCMVALTLAQGDEALARQLVDEIIH
FT                   GRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSN
FT                   IREAGAPIKHIENQSSGIIPIMKMLEDAFSYANQLGARQGAGAVYLNAHHPDILRFLDT
FT                   KRENADEKIRIKTLSLGVVIPDITFELAKRNEPMYLFSPYDVENVYGKPFGDISVTEKY
FT                   YEMVDDARIRKTKINARELFQTLAEVQFESGYPYVMFEDTVNRANPIAGRINMSNLCSE
FT                   ILQVNTPSDYEADLGYERIGEDISCNLGSLNIAKTMDSSDFGATVETAIRGLTAVSEMS
FT                   DIRSVPSIAEANKQSHAIGLGQMNLHGYLAREHIHYGSEEGLDFTNLYFYTVTYHALRA
FT                   SNRLAIERGRAFAGFEASDYASGVYFDKYTEQAWGPRTARVRELFDKAGIHVPTQEDWR
FT                   ELKASVMAHGLFNRNLQAVPPTGSISYINHSTSSIHPVVSKIEIRKEGKLGRVYYPAPY
FT                   LNDDNQDYYQDAYEIGPEKIIDTYAEATQHVDQGLSLTLFFRDTATTRDINRAQIYAWR
FT                   KGIKTLYYVRLRQAALEGTEVEGCVSCTL"
FT   gene            424550..425530
FT                   /locus_tag="Csal_0380"
FT   CDS_pept        424550..425530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0380"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57742"
FT                   /db_xref="GOA:Q1R0L6"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L6"
FT                   /protein_id="ABE57742.1"
FT                   /translation="MTATATPRHLTRVDAINWNRLQDEKDLEVWNRLTANFWLPEKVPL
FT                   SNDVSAWNTLTEQEQTLTIRVFTGLTLLDTIQGTIGAPTLIEDAVTPHEEAVFTNISFM
FT                   ESVHARSYSSIFSTLCATRDVDDAYRWSEENPHLQNKAELILNRYRMDDPLMRKVASVF
FT                   LESFLFYSGFYLPMYWASRGKLTNTADLIRLIIRDEAVHGYYIGYKFQQALARESAERQ
FT                   QEIKDATFDLLLELYDNEVHYTESLYDDVGLTEEVKAFLHYNANKALMNLGYEPLFPGA
FT                   TEAVNPAILAALSPGAEENHDFFSGSGSSYVIGRSERTEDEDWAF"
FT   gene            complement(425479..426462)
FT                   /locus_tag="Csal_0381"
FT   CDS_pept        complement(425479..426462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0381"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57743"
FT                   /db_xref="GOA:Q1R0L5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L5"
FT                   /protein_id="ABE57743.1"
FT                   /translation="MARTLPPLGALHCFEMAAHHGSFARAAKALTLTPAAVSQQIRQLE
FT                   SRLGTTLFLRHPRSVELTPAGREYATAIGLALDQIAVATERVVGHHAPHRLTIATTPAF
FT                   AAKWLVSRLIDFQGRYPDLEVRLVTSNSLADMARQDIDVAIRYGQGRWPGLEATPLMHT
FT                   DLFPVCSPALLARGPSLIRLSDLREHVLLRLMHDEWPTWLRHMGILEGEELETGEWRPG
FT                   PRYADAGLMIQAALAGQGVALGQRVLVADDLAAKRLVRPFEATLPSAQSYWLVMQPGNA
FT                   GLPKVRAFQAWLDEAVSTWRLSITADDGAAQNAQSSSSVRSERPMT"
FT   gene            426599..427597
FT                   /locus_tag="Csal_0382"
FT   CDS_pept        426599..427597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0382"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57744"
FT                   /db_xref="GOA:Q1R0L4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L4"
FT                   /protein_id="ABE57744.1"
FT                   /translation="MESITIPGTDLTPSRVGLGTWAIGGWKWGGADDANAVRTIHAALD
FT                   RGITLIDTAPAYGFGHSEEVVGRALAEYGQRDKVVLATKTALEWQEGSDGVVRNASAAR
FT                   IEKEVEDSLRRLRTEAIDLYQIHWPDPRVPMEETASAMQRLYRDGKIRAIGVSNFSAEQ
FT                   CDAFRRVAPLHSVQPPLNLFERDAERDIIPYARREGLVFLAYGALCRGLLTGKMHADSA
FT                   FTGDDLRQSDPKFQSPRFTQYLAAVEALTQLARERHDKPVLALAVRWVLDSHPNAIALW
FT                   GARRPDQVTPLDALDGWSLTASDLRDIDAIIDEHVTDPVGPEFMAPPARED"
FT   gene            427673..428728
FT                   /locus_tag="Csal_0383"
FT   CDS_pept        427673..428728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0383"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57745"
FT                   /db_xref="GOA:Q1R0L3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L3"
FT                   /protein_id="ABE57745.1"
FT                   /translation="MEYRHLGQSGLRVSSLTLGTMTFGGVGKMASVGETDLAGAKRQVD
FT                   MATERGVNFFDTANMYSEGRSEEILGEVLADRRESVLVASKVRFPMGDGPNDEGLSRHH
FT                   ILRQCEASLRRLRTDWLDLYLMHQWDGSTPLEETLATMDQLVRDGKIRYYGVSNWSAWH
FT                   VMKALQVCERHDFIKPICQQIHYTAQARDAEYELMPAAVDQGLGTMVWSPLAGGLLSGK
FT                   YRRDQRHLDGTRFSQGWTEPPIHDEDRLFDLIDVLVEVADGHGVSAAQVALAWTLTRPG
FT                   VSTAVIGARKDEQLKDNLASAELTLGPDEIAAIEKVSRPALLYPYWHQHNTASSRLGHA
FT                   DRVLHAAYLDD"
FT   gene            complement(428849..430840)
FT                   /locus_tag="Csal_0384"
FT   CDS_pept        complement(428849..430840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0384"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57746"
FT                   /db_xref="GOA:Q1R0L2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L2"
FT                   /protein_id="ABE57746.1"
FT                   /translation="MPSRFEMANAIRALSMDAVQKANSGHPGAPMGMADIAQVLWHDYL
FT                   AHNPANPHWANRDRFVLSNGHGSMLLYSLLHLTGYDISLEDLQNFRQLHSKTAGHPELG
FT                   YAPGIETTTGPLGQGLANAVGMAIAERTLAAQFNRPGHDIVDHHTYVFVGDGCLMEGIS
FT                   HEVASLAGTQGLGKLIAFYDANGISIDGEVEGWFTDDTAKRFESYGWHVVPNVDGHDPE
FT                   AVKAAIELARTNDDKPSMIICKTIIGFGAPNKQGKEESHGAALGEDEVAAAREQLGWSH
FT                   PPFHVPEDIYQAWDATQRGREAEADWDARFARYQAAYPEEARELERRLKGELPAALTSE
FT                   KLIEEAQEKGESLASRKASLACLNELGPQLPELLGGSADLAPSNLTFWKGAKAITQSEA
FT                   SGNYLHYGVREFGMAAIMNGIALHGGFVPYGATFLIFMEYMRNAVRMAALMGQRVIHVF
FT                   THDSIGLGEDGPTHQPIEQLTTLRSTPNLATWRPCDAVETAVAWDAALKRQAGPSALVL
FT                   SRQGLPHQARSKQQLADIARGGYILKDSQGTPALILIATGSEVGLAMDAAAELENAGTP
FT                   VRVVSMPSTDTFDAQDADYREAVLPRAVTARLAIEAGHRDFWFKYVGLDGRIVGMTTFG
FT                   ESAPAGDLFKHFGFTVDNVVAEAKALLS"
FT   gene            431204..432424
FT                   /locus_tag="Csal_0385"
FT   CDS_pept        431204..432424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0385"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57747"
FT                   /db_xref="GOA:Q1R0L1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0L1"
FT                   /protein_id="ABE57747.1"
FT                   /translation="MNEYSLFTSESVSEGHPDKIADQISDAVLDAIIARDKQARVACET
FT                   MVKTGVAIVAGEITTSAWVDLEDLVRRVINDIGYTSSDVGFDGNTCGVLNLIGKQSVDI
FT                   AQGVDRSKPEDQGAGDQGLMFGYATNETDSYMPAPIHYSHRLVERQAELRKHGLLPWLR
FT                   PDAKSQLTFRYDAQGKPCAVDAVVLSTQHDPDIDQDELREMVKREIIEEVIPAEWLTET
FT                   TKYHINPTGNFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAG
FT                   RYVAKNVVAAGLAERCEIQVSYAIGVAEPTSVSVDTFGTGKISDAKIVELVREHFDLRP
FT                   NAITRMLDLLHPMYQLTAAYGHFGREPFETSYTWTDVGGKQHVETFTAFPWEKTDRADA
FT                   LRQAAGL"
FT   gene            432681..433808
FT                   /locus_tag="Csal_0386"
FT   CDS_pept        432681..433808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0386"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57748"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0L0"
FT                   /protein_id="ABE57748.1"
FT                   /translation="MATRTLMLAAALGLSGALLAGCGDDSGDADETTQNGETTSQEQAS
FT                   EGNGGNGESGEDGTQTASADAVSLIFGTGGTGGTYYPIGGALKSVFEASDLIDDVQVVS
FT                   TGASVQNINNITDGLNQVAIVMSDVAYDAVNGENQFDGQPADIQALAGLYPNVVQVVAT
FT                   EDSGIESISDLAGKRVGVGKVGSGVEQSAAKVIESAGLSYDDLAQVSHTGYADSVTGMS
FT                   NGNLDAAFFTSGVPNSSITGLMQSTDITFVPVTGEVADKLLEAYPYYETYTLPAGAPER
FT                   YDLDAEVDTVAIRNMLIVGSDMRDDVAEELTARFYDYLNSENVSVGALKQFDPETMNQN
FT                   LVAPVHPGAQAFYDTLSEDDASSDGEDADSAGTGS"
FT   sig_peptide     432681..432743
FT                   /locus_tag="Csal_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 21"
FT   gene            433861..434358
FT                   /locus_tag="Csal_0387"
FT   CDS_pept        433861..434358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57749"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K9"
FT                   /protein_id="ABE57749.1"
FT                   /translation="MRRKTGWIALAVATVMVATLAYPLPWLVVRDGAQWRYAFPGWEGT
FT                   RFTLRWMHSVEKEDWEEWFEVTDDGAIEITGTRFKTFGAGVPASAGKETHLEDGWVVMT
FT                   GIDRVVDPLAVQAAAAERYRMRYAGHTFALAHDEPPPILTFSILRAPLWQALPALVRPW
FT                   LS"
FT   sig_peptide     433861..433926
FT                   /locus_tag="Csal_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            434388..436562
FT                   /locus_tag="Csal_0388"
FT   CDS_pept        434388..436562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0388"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57750"
FT                   /db_xref="GOA:Q1R0K8"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K8"
FT                   /protein_id="ABE57750.1"
FT                   /translation="MSDEKYAQAAEGDDKAVKEALEKFDRESLVRDALPGFVLKFVTVV
FT                   AVVLAVFHLYTSFSGPLVDVAQRSIHLYTLLGLTFILYPLTRKGARDRVPWGDAILAVL
FT                   AFGVGVYMLVVSERVIASAGRINDIDMLVGFLAILLVLDATRRATGWGLTLLATIFLVY
FT                   GFYAKLSFYPQLNETIIMATGRQVMSHLVFITEGLLGTAIGVSASYIILFILFGAFLGK
FT                   SGLGQLFNDLALAVAGHTRGGPAKVAVIASGFLGSINGSAIANVVTTGAFTIPLMKRTG
FT                   YKPNFAGAVEASASVGGQILPPIMGAAAFIMAEVLSVPYTQVILAGIIPALLFYLGVLF
FT                   QVHLRALRNGLEGIPRSELTPLKAVMLKRGHLLVPMVVLLWLLFDGRAPFFAAFWSIAA
FT                   TVLICGTRRVTLGVSAILALLIFEPQWRALLEGYAQPDMTASRWALFVIIAVPVAINAL
FT                   RAKLGLVAEKMDIADCRDAMHDGVRNAIPVAVACGAVGIIVGIATLTGIALEAADAVVA
FT                   LGQQIPIPMLQLLVTLFLTMIASIVLGMGLPSIPTYIITSTMAAPILLNLPLFRELAGS
FT                   NETAIFVAHMFVFYFGLFANLTPPVALAAYAGAGISGGSPNATGFQAMKLAIAGFVVPY
FT                   MFVFAHSMLMIDATLANILWVVVTGVVGVLLLAVAVEGYLRRPLNPFWRLLAAAGALTL
FT                   IYPGLISDVIGAVIALGLFLLAKQETPKVA"
FT   gene            436653..437189
FT                   /locus_tag="Csal_0389"
FT   CDS_pept        436653..437189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0389"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57751"
FT                   /db_xref="GOA:Q1R0K7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K7"
FT                   /protein_id="ABE57751.1"
FT                   /translation="MPSPTPVIVANLRRLREARGYSLSALAERAAISKSTLSQLEAGHG
FT                   NPTIETLWTLANTLGVTFSELLAEKTGGVTVGEPGGGQVQVVARGRQSPRVEVYLMQLA
FT                   SGEIKHSRGHPRGVRERVMVVEGTLRVGTPRALAVCRAGEQHEFDADLDHRYEALLGAT
FT                   QAMVTILYPQQWEDA"
FT   gene            437186..437914
FT                   /locus_tag="Csal_0390"
FT   CDS_pept        437186..437914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0390"
FT                   /product="AzlC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57752"
FT                   /db_xref="GOA:Q1R0K6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K6"
FT                   /protein_id="ABE57752.1"
FT                   /translation="MSDDAVAVSAWRSGRRGLRDSVSLAVGYAPIAFSFGVISVQAGLS
FT                   PWQAVAISLLVFAGASQFVMVAMMAAGSGGLTVLSAVVMMNLRHLFYGPALATRLTSMP
FT                   RRLAPWLAFGLTDEVFATAMAKGASRPLSPAWCLGLAAGAYLAWVGGTALGAGVGAGWA
FT                   SDGGYVAQALDFVLPALFLALLAQAWRRARWPVVAVAAGATLLGMVWWPGHVAMLVGML
FT                   AGAAVGSRRPRPACSEEATT"
FT   gene            437911..438237
FT                   /locus_tag="Csal_0391"
FT   CDS_pept        437911..438237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0391"
FT                   /product="branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57753"
FT                   /db_xref="GOA:Q1R0K5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K5"
FT                   /protein_id="ABE57753.1"
FT                   /translation="MTWWSIVVAAGLGTFLIRYLPLLSGTRLARGEGWLSRFLGALGLA
FT                   AIAALIVLSMSDLWWQAPHWRGGVRLALGAAAVLLVQRLTPNVGLATLVGAGAYGAAGG
FT                   FLAE"
FT   gene            438265..438969
FT                   /locus_tag="Csal_0392"
FT   CDS_pept        438265..438969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0392"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57754"
FT                   /db_xref="GOA:Q1R0K4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K4"
FT                   /protein_id="ABE57754.1"
FT                   /translation="MPRVEVREYPDRVLTDRHGFHQWLIGLEGVVELEAGGEGAHVEPG
FT                   QWVAIPSGSEHHYLAPGRNRTLVLDLPVAWCEAAGLADIAPRRLPPAALGGGEMLLEAR
FT                   PDQLAARLHALLAQGRTRHASPRLRLLHLLPAVEADLAYPWRIRDWAARCHMTEAAFAR
FT                   RFRHLTGVAPHAWLTARRLQRACELMRDPRLTLTEIAQACGFHDSAHFAHAFRAHHACS
FT                   PRQWRQRQPSSV"
FT   gene            complement(438966..439895)
FT                   /locus_tag="Csal_0393"
FT   CDS_pept        complement(438966..439895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0393"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57755"
FT                   /db_xref="GOA:Q1R0K3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K3"
FT                   /protein_id="ABE57755.1"
FT                   /translation="MSHVDLSQPLWMLLIFVALGWLCTRRLAIDPRPIATLLIYLIAPL
FT                   TFFRGLYLGEPSPALLGLTAGMFVLASLLCLVTHAVARRGFAPQEAALLAFSAGTGNTG
FT                   YFGLPLAMVLLPPEGVAAYLFCLLGITLFEFTVGFYISARGRFSVRQSLGKIVRLPLVY
FT                   AFLAALGAHHLPWSVPGAVIEGLDYFRASYTVLGMMIIGMTLGGVSLREFDARFLAASI
FT                   AARYVMWPLVMLGLVLGLQATTGLSTTMTGVLLLLGVVPMAANVVVIAMELDMRPAKGA
FT                   IAVLVTTVAAPLVIPPYLDMLWRLAGLD"
FT   gene            440196..441092
FT                   /locus_tag="Csal_0394"
FT   CDS_pept        440196..441092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0394"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57756"
FT                   /db_xref="GOA:Q1R0K2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K2"
FT                   /protein_id="ABE57756.1"
FT                   /translation="MSLEESASRRATWIGATTVLNWALLAALTQLAGPVPPFLLTALAF
FT                   GLAFLCFVVWLRVRGESLRAPLRQPPRVWALGVGGLFGYHALYFVAQQNAPPANAGLIS
FT                   YLWPLLIVLFVALLPGEHLRVRHIVGALLGFVGAALLVGGDVSASGSTLGYVAAFACAF
FT                   LWSGYSVLSRATRAVPTAAVGGFCLVTAVLAGLCHWWFEPTRWPQGIGWLGVIGLGLGP
FT                   VGSAFFTWDVGVKHGDLRLLGLLAYFTPLLSTLVLIAAGYATATLWLVLAAGLITLGML
FT                   IGSGWLRAPRRITVSDD"
FT   gene            441151..442134
FT                   /locus_tag="Csal_0395"
FT   CDS_pept        441151..442134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0395"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57757"
FT                   /db_xref="GOA:Q1R0K1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K1"
FT                   /protein_id="ABE57757.1"
FT                   /translation="MGHSSSGHDHAPHDHDHDHGHGHDHHHEHAPTVTADSAKRVKLAM
FT                   YLTAGFMLAEAIGGWISGSLALLADAGHMFSDSFSLGLALFAFYMGDKAPDKRRTFGYQ
FT                   RFQVLAAFINGLTLLGIAVWILIAAVQRFFQPVEVMAAPMLAIAVLGLLVNVVVFRILH
FT                   GGDHENLNLRGALLHVMGDLLGSVAAIVASLVIMATGWMPIDPLLSMLAAALILRGAWK
FT                   IVRRSGHTLLEGTPEGIDVDGIRAALEDIEGVVSVHDLHVWGLTPQDPLLSLHLVVRDD
FT                   MSHAVMLKAAYARLHERFGISHATLQVEGEACLTGGDCQVTSTTHP"
FT   gene            442287..443135
FT                   /locus_tag="Csal_0396"
FT   CDS_pept        442287..443135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0396"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57758"
FT                   /db_xref="GOA:Q1R0K0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0K0"
FT                   /protein_id="ABE57758.1"
FT                   /translation="MSTREHPLGVSFEFFPPSTEAGREKLKGVRDTLAERRPRFFSVTY
FT                   GAGGSTQARTFETVQTVRQSGIDTAPHLSCIGSDKGELRERLASFREAGIDSLVALRGD
FT                   LPSGMGGMGELRYANELVEFIREETGDHFQIAVAAYPEAHPQAPSYEHDLQNFVRKMQA
FT                   GADLAITQYFFSADAYFHFVERARALGVEAPIVPGIMPITNYTKLARFSDACGADIPRW
FT                   IRKQLEAYGDDSESIQAFGSEVVTRLCQRLLDGGAPGLHFYTLNQATPALRVLDNLRCD
FT                   T"
FT   gene            443208..443738
FT                   /locus_tag="Csal_0397"
FT   CDS_pept        443208..443738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0397"
FT                   /product="superoxide dismutase, copper/zinc binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57759"
FT                   /db_xref="GOA:Q1R0J9"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J9"
FT                   /protein_id="ABE57759.1"
FT                   /translation="MLRISQMALGLGGALLMLGSAQAAQHDIELHQVNAQGTGDSVGSV
FT                   TLEDTDYGLLLTPDLSGLEPGMHGFHVHMNPSCQPSEQDGETVPGGAAGGHYDPEDTGT
FT                   HQGPYGDGHLGDLPVLMVDDDGNATTPVLAPRLEASDLQGRALMVHVGGDNYSDEPKLG
FT                   GGGKRVACGTWSQ"
FT   sig_peptide     443208..443279
FT                   /locus_tag="Csal_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 24"
FT   gene            complement(443822..444082)
FT                   /locus_tag="Csal_0398"
FT   CDS_pept        complement(443822..444082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57760"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J8"
FT                   /protein_id="ABE57760.1"
FT                   /translation="MTATPKRFIAGAICPRCAAMDRIRAWEQNGIRYRECVSCDYLEQL
FT                   AIDENGFATDLPTRVNQPREEDTSDDIQTVRLIDPSDGKTH"
FT   gene            complement(444149..446233)
FT                   /locus_tag="Csal_0399"
FT   CDS_pept        complement(444149..446233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0399"
FT                   /product="oligopeptidase A, Metallo peptidase, MEROPS
FT                   family M03A"
FT                   /EC_number="3.4.24.70"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57761"
FT                   /db_xref="GOA:Q1R0J7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J7"
FT                   /protein_id="ABE57761.1"
FT                   /translation="MLHSHVHIEVPMSRNPLLESHVLPPFDDIQPEHVVPAIEQLLAEN
FT                   RRDIEALAQQSQISWESLAAPLEALNDRLSQAWSPVSHLNSTMNNEALREAYQACLAML
FT                   SDYSTWLGQHQGLFEAFTRLKESDEYARLEEGQQRSIDNTLRDFRLAGVDLPEDRKRRY
FT                   GEIQARLSELANTFSNHVLDATQAWHLDLTDDTRLGGLPDSALATLKANAEAKGVDGYR
FT                   ITLDFPSFYPVLSFADDRALREEVYTAFVTRASDKGPHAGRFDNAPIIEETLRLRRELA
FT                   ELLGFDTYADYSLATKMADSPQQVLGFLGDLADRAHPQAQREFNELEAFARESLGLETL
FT                   KPWDIGYVSEKLREARYAISQEQLRPYFPAPRVIEGLFQVTGTLYGIDFAERDDVPRYH
FT                   PDVRYFEILDGDTPIAGFYLDLYAREGKRGGAWMDECRVRRTREDGSLQLPVAYLTCNF
FT                   TRPVGGKPALLTHDEVLTLFHEFGHGLHHMLTRQTVADVSGINGVAWDAVELPSQFMEN
FT                   FCWEREGLDMIAAHVDTGEKLPDALLDKLQAARNFQSAMGMMRQLELSLFDFRLHHESQ
FT                   APSADEVQALLDDVRDKTSVTPRVDFNRFQNGFGHIFAGGYAAGYYSYKWAEVLSADAY
FT                   SAFEEAGIFDTATGQRFRQEILERGGSRDAAALFEAFRGRAPSIEPLLRHSGIESAEAA
FT                   "
FT   gene            446355..447695
FT                   /locus_tag="Csal_0400"
FT   CDS_pept        446355..447695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0400"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57762"
FT                   /db_xref="GOA:Q1R0J6"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J6"
FT                   /protein_id="ABE57762.1"
FT                   /translation="MSETLERWGSRRAFILAVTGAAVGLGNIWRFPYMTGENGGAAFLL
FT                   LYVAFVMVLGLPIMMAEILVGRAGRRGPMQSLAHLARHAGVSPHWRWLGLFGAITVFFI
FT                   LSFYSVVSGWSIEYLIESVNGNFSGRTPAEIGASFEAFLADPLRMTFNHTLFMLLTMSV
FT                   VAAGISGGLERLNNLLMPLLYILLVVLAGYAVTTDGFGTAMTWLFAPDLDAITLSVVLN
FT                   AMGHAFFTLAVGACALMAYGAYMPDHQSLPRAVMAVAVLDITVALLAGIAIFSVVFSQG
FT                   MDPGEGPGLMFVTLPIAFSDLPGGSLWLGVFFLLLLLATWTSSINLAEPMVAIFTDAGL
FT                   KRGKATALIGTLVWMVGLLSVFSFSTLSEVTWVAGMNFFELVTTVPPEIFLPIGGLLIA
FT                   IFAAWVMPASEAMRALDAGPGGFRLWRGVVRYVSIPLLVIVLLSALW"
FT   gene            447757..448296
FT                   /locus_tag="Csal_0401"
FT   CDS_pept        447757..448296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0401"
FT                   /product="anhydrase, family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57763"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J5"
FT                   /protein_id="ABE57763.1"
FT                   /translation="MTLRTFQGMTPRLGARVYLDPACVVLGDVTLGDDCSVWPMTVIRG
FT                   DMHRIRIGARCSIQDGSVLHITHASDYNPEGYPLTLGDDVTVGHKALLHGCTIGSRVLV
FT                   GMGATVMDGVVVEDEVIIAAGAVVTPGKRLESGHVYAGNPAKPLRALKEGERAFFTYTA
FT                   GNYVKLKDDYLAQPSV"
FT   gene            448417..449094
FT                   /locus_tag="Csal_0402"
FT   CDS_pept        448417..449094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57764"
FT                   /db_xref="GOA:Q1R0J4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J4"
FT                   /protein_id="ABE57764.1"
FT                   /translation="MANFRTHFGVALGGGALAAYAGWQASLWSLNEGWPLAVLTAFGGI
FT                   LPDIDSDHSHAIRLIFTLLAVLAVIAGALWLQSRLAPGPLVMACGGLYVGVRYLAGAIF
FT                   KRFTVHRGVWHSLLASLLCGMGTAAMSFHLLAQPAPMAWAQGMALSLGAVIHLLLDELY
FT                   SVDLVGSRLKRSFGTAFKLFDYREPGNAVLMLLLGVALAPWLPPWTTLWELVGRGVALW
FT                   PSP"
FT   sig_peptide     448417..448482
FT                   /locus_tag="Csal_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            complement(449116..449901)
FT                   /locus_tag="Csal_0403"
FT   CDS_pept        complement(449116..449901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0403"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57765"
FT                   /db_xref="GOA:Q1R0J3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J3"
FT                   /protein_id="ABE57765.1"
FT                   /translation="MAYQRVRQPRLADVITERLEAMLLEGSLKPGEKLPPERELAEHFG
FT                   VSRPSLREAIQKLAARGLLTSRQGGGTFVSEQLNNSYSDPLLEMLARHGEFNLDLLEFR
FT                   DALEGIAAYYAALRATPADKAMLKTRFEALEESYRHPDRASDPMREARADAAFHLAIAE
FT                   AGHNVLLLHTMRGLFHLLEKSIVANLAHLFEKPDSRDRLMDQHRALYDSIIAGHADEAR
FT                   TRAHEHLIFVEEGLLELERAETRAQRAQRRSQGLPEPRT"
FT   gene            450240..451418
FT                   /locus_tag="Csal_0404"
FT   CDS_pept        450240..451418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0404"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57766"
FT                   /db_xref="GOA:Q1R0J2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0J2"
FT                   /protein_id="ABE57766.1"
FT                   /translation="MIISASTDYRHAAKRRLPPFLFHYADGGAYAEHTLRRNVEDLAGI
FT                   ALRQRVLKDMSHLSLETELFGEPLAMPVALAPVGLAGMYARRGEVQAARAAASKGIPFT
FT                   LSTVSVCPIAEVASAIERPLWFQLYVLRDRGFMKHVLERAKAAGVKTLVFTVDMPVPGA
FT                   RYRDAHSGMSGKHGGLRRMLQAVTHPSWAWDVGLHGRPHDLGNVSDYRGQPTELEDYIA
FT                   WLGNNFDPSISWKDLEWIREFWDGPMIIKGILDPEDARDAVRFGADGIVVSNHGGRQLD
FT                   GVPSTARALPAIADAVKGDLAILADSGVRNGLDVVRMIAMGADTILLGRAYIYALATAG
FT                   EAGVAHLLELFEKEMRVAMTLTGARSIAELGSDSLVTGSAAASIERTLSPSL"
FT   gene            451536..454421
FT                   /locus_tag="Csal_0405"
FT   CDS_pept        451536..454421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0405"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57767"
FT                   /db_xref="GOA:Q1R0J1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J1"
FT                   /protein_id="ABE57767.1"
FT                   /translation="MKKPYEELHEALRGILPAERLIDDPLRLLAYGTDASFYRLIPQLV
FT                   VRPDSEEELMGVLAECRRRRLPVTFRTAGTSLSGQAVTDSVLVQLNQGWRDYRILDAGR
FT                   AIRLQPGIIGARANQLLAPYGRKIGPDPASINSCMIGGIAANNASGMCCGTAQNSYRTL
FT                   RDIRVILADGTLLDTADADSRAAFRDSHAALLEALERLGRETRENAPLAERIRHKYRLK
FT                   NTTGYALNSLVDFEDGFDILAHLMIGSEGTLGFISAITYDTVADAPLKTAALAFFPDMA
FT                   TACRATLALKSAPVSAVELMDRAALRSVEGSPGMPERLKTLPAAATALLIDVRAEDEAT
FT                   LTQQMAAVHAALEGIKTLEPLGFTRDPEEYARYWKVRKGLFPAVGAVRDVGTTVIIEDV
FT                   AFPIECLEAGVAALTEAFRRHGYEGAILFGHALEGNLHFVFPQGFETPAEIQRYAALME
FT                   DVATLVADEYGGSLKAEHGTGRNMAPYVEREWGAEAYALMWRIKALFDADNVLNPDVVL
FT                   SRDPEQHIHNLKPLPAADPIVDKCIECGFCEPVCPSRELTLTPRQRIVIQREMARLEAS
FT                   GGQEDASRLATLRDAYQYQGIDTCAADGLCATQCPVGINTGDLVREWRHRQVAEHGDAA
FT                   HLIGRHFSGTTRLGRGGLRVLDLTHGVLGTRLMGALSKGARHLSGARLPQWSPSLPGPA
FT                   PVRILERRAGKPPVGRGDKVVYLPACATRVFGTSRQDAHARAVTRTTLALLEKAGFEVV
FT                   MPAMIGHLCCGMAFQSRGQFAEADHKARELNRELLLASQNGRYPVLCDTSPCTQRMRER
FT                   LDKRLQIQEPVAFAHDHLLPRLSITPKRARIALHITCSSTCMGLDDKFLALAKRCADDV
FT                   VVPPDITCCGFAGDKGFTVPELNASALRGLADAVRGCEAGYSNSRTCEMGLSQHAGIPY
FT                   RSILDLLHDVSRPLEAKSPQAQVDVGRVTSE"
FT   gene            454940..456413
FT                   /locus_tag="Csal_R0001"
FT   rRNA            454940..456413
FT                   /locus_tag="Csal_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            456548..456624
FT                   /locus_tag="Csal_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            456548..456624
FT                   /locus_tag="Csal_R0002"
FT                   /product="tRNA-Ile"
FT   gene            456732..456807
FT                   /locus_tag="Csal_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            456732..456807
FT                   /locus_tag="Csal_R0003"
FT                   /product="tRNA-Ala"
FT   gene            456987..459883
FT                   /locus_tag="Csal_R0004"
FT   rRNA            456987..459883
FT                   /locus_tag="Csal_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            459986..460101
FT                   /locus_tag="Csal_R0005"
FT   rRNA            459986..460101
FT                   /locus_tag="Csal_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            460283..461263
FT                   /locus_tag="Csal_0406"
FT   CDS_pept        460283..461263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0406"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57768"
FT                   /db_xref="GOA:Q1R0J0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0J0"
FT                   /protein_id="ABE57768.1"
FT                   /translation="MTIGDLIRLLSDGEYHSGEQLGEKLGVSRTAVWKQLKKLESMGLQ
FT                   LEAVKGLGYRLTAPLDLLSGPAIIERLPAEPRHHLTRLFVEDELVSTNSFLRERFQQGA
FT                   GHAEVCLAESQTAGRGRRGRDWLSPWGRGLVFSLGWRFDEGASALEGLSLAVGVVLAEV
FT                   LEQLSASVALKWPNDVLLCREQGPAKLAGILLEVSGDVAGPCEVVIGIGLNVELPDSLR
FT                   ESVDQPIAALRDVVPSVSRNALAASLIEALLGMLPRFETHGFEPWRDAWNRRNAYAGQE
FT                   IDVHQGTQAYVAVAEGVDDTGNLRVNVDGQARLLAGGEISLRLRS"
FT   gene            461260..462099
FT                   /locus_tag="Csal_0407"
FT   CDS_pept        461260..462099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0407"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57769"
FT                   /db_xref="GOA:Q1R0I9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I9"
FT                   /protein_id="ABE57769.1"
FT                   /translation="MILDLDIGNTLSKWRLKDVASSEIRSRGAVWTREEWRPGADIPDL
FT                   DVVEAVRISSVARASVLRDTVALLRRQVGAVHVARSTPEALGVSCGYEEPARLGVDRWM
FT                   GVLAGYQLTGGCCSVDCGSAITMDFVLPGGRHLGGYIIPGLRLMKESLKLGTRNVAIDP
FT                   DSEADELLAPGRNTVEAVNHGIYMSAVSAVNRIYSEVCDREGVALPLLLTGGDARVVSR
FT                   GLRVPHAIWPDMVYAGLETCFPMTAAERAGRLSGAPPPPPAPPLEKVRASLAFSMLL"
FT   gene            462206..462289
FT                   /locus_tag="Csal_R0006"
FT                   /note="tRNA-Tyr1"
FT   tRNA            462206..462289
FT                   /locus_tag="Csal_R0006"
FT                   /product="tRNA-Tyr"
FT   gene            462339..462412
FT                   /locus_tag="Csal_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            462339..462412
FT                   /locus_tag="Csal_R0007"
FT                   /product="tRNA-Gly"
FT   gene            462421..462495
FT                   /locus_tag="Csal_R0008"
FT                   /note="tRNA-Thr1"
FT   tRNA            462421..462495
FT                   /locus_tag="Csal_R0008"
FT                   /product="tRNA-Thr"
FT   gene            462617..462692
FT                   /locus_tag="Csal_R0009"
FT                   /note="tRNA-Trp1"
FT   tRNA            462617..462692
FT                   /locus_tag="Csal_R0009"
FT                   /product="tRNA-Trp"
FT   gene            462764..463132
FT                   /locus_tag="Csal_0408"
FT   CDS_pept        462764..463132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0408"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57770"
FT                   /db_xref="GOA:Q1R0I8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0I8"
FT                   /protein_id="ABE57770.1"
FT                   /translation="MKQSAEVQGSRYDVAKWALVVILVVLAVAGNAYFADQALLYRVLG
FT                   VVALGVAAAAVALTTTKGRALAELARGSRKEIRRVVWPTRPETIQTTAIVLVAVLLVGI
FT                   MLWLIDTLLGWIMSGIIG"
FT   gene            463141..463674
FT                   /locus_tag="Csal_0409"
FT   CDS_pept        463141..463674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0409"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57771"
FT                   /db_xref="GOA:Q1R0I7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0I7"
FT                   /protein_id="ABE57771.1"
FT                   /translation="MSKRWYVVHAYSGFEKHVMRSLMERVKMYGMEDQFGEILVPTEEV
FT                   VEMRDGKRRKSERKFYPGYVLVEMEMTDASWHLVNETPRVMGFIGGTPEKPAPITQKEA
FT                   DGILRRVQDGTDKPRPKTLFDPGETVRVVDGPFADFNGVVEEVNYEKSRLQVSVLIFGR
FT                   STPVELEFAQVEKD"
FT   gene            463777..464208
FT                   /locus_tag="Csal_0410"
FT   CDS_pept        463777..464208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0410"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57772"
FT                   /db_xref="GOA:Q1R0I6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I6"
FT                   /protein_id="ABE57772.1"
FT                   /translation="MAKKVQAYIKLQVAAGKANPSPPVGPALGQHGVNIMEFCKAFNAE
FT                   TQDIEPGLPTPVVITVYSDRSFTFITKTPPAAVLLKKAAGIKSGSGVPNKTKVGTVTRE
FT                   QLEEIAKTKEPDLTASDLDAAVRTIAGSARSMGLNVEGL"
FT   gene            464211..464903
FT                   /locus_tag="Csal_0411"
FT   CDS_pept        464211..464903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0411"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57773"
FT                   /db_xref="GOA:Q1R0I5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I5"
FT                   /protein_id="ABE57773.1"
FT                   /translation="MAKLTKRAQMLREKVDTSKVYNLEDAVALLSEVSTVKFKESVEVS
FT                   INLGVDPRKSDQVVRGATVMPNGTGKDARVAVFAQGAAADAAKEAGADVVGMEDLAEEV
FT                   KKGNLDFDVVVAAPDAMRVVGQLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVRF
FT                   RTDKNGIIHAAIGKVDFDASAIKGNLDALVGDLKRLKPSTSKGVYFKKITLSTTMGPGL
FT                   TVDHSAYV"
FT   gene            465167..465670
FT                   /locus_tag="Csal_0412"
FT   CDS_pept        465167..465670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0412"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57774"
FT                   /db_xref="GOA:Q1R0I4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I4"
FT                   /protein_id="ABE57774.1"
FT                   /translation="MPLALEGKKAIVAEVSEAAQDALSVVVADSRGVAVSAMTELRKQA
FT                   RENGVQVRVVRNTLARRALEGTPWECLNETFSGPTLLAFSYEHPGAAARLFKEFAKNEK
FT                   DFEVKALAYEGEFIPASELDRLATLPTRDEAIAKLMSVMKEASAGKLVRTLAALRDQKQ
FT                   EEAA"
FT   gene            465757..466131
FT                   /locus_tag="Csal_0413"
FT   CDS_pept        465757..466131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0413"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57775"
FT                   /db_xref="GOA:Q1R0I3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I3"
FT                   /protein_id="ABE57775.1"
FT                   /translation="MALTQEDIINAVAEMSVMEVAELISAMEEKFGVSAAAAVVAGPGA
FT                   GGEGEAAEEQTEFDLVLTGAGDKKVNVIKVVREITGLGLKEAKGAVDGVPATLKEGMSK
FT                   EDAEAAKTKLEEAGASVELK"
FT   gene            466359..470435
FT                   /locus_tag="Csal_0414"
FT   CDS_pept        466359..470435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0414"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57776"
FT                   /db_xref="GOA:Q1R0I2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I2"
FT                   /protein_id="ABE57776.1"
FT                   /translation="MAYSYTEKKRIRKDFGKLPQVMDVPYLLAIQLDSYFDFLQQDRAI
FT                   EERLDVGLHAAFKSVFPIESFSGNAALEYVSYRFGTPAFDVKECQLRGVTYSAPLRVKV
FT                   RLIIYDKDSSTKAIKDIKEQEVYMGEIPLMTENGTFVVNGTERVIVSQLHRSPGVFFDH
FT                   DKGKSHSSGKLLYSARIIPYRGSWLDFEFDPKDNVYVRIDRRRKLPATVLLRALGMSAE
FT                   EILETFFDTSTFHIEKSGFSVELVPSRLRGETATFDIKDGEGNLIVEEGRRITQKHIRQ
FT                   MEKAGLERLDVPMEYLFGKTLAKDQVDPNTGELVCECNTEITPELLEKIGQAGITTLET
FT                   LYTNDLDTGPFVSDTLKIDTTHSQLEALVEIYRMMRPGEPPTKEAAETLFHNLFFTEDR
FT                   YDLSGVGRMKFNRRLRREGDTGSGVLDNQDILDVMRELINIRNGFGEVDDIDHLGNRRI
FT                   RCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAVKEFFGSSQLS
FT                   QFMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHATHYGRLCPIETLEGPNIGL
FT                   INSLATYSHTNSYGFLETPYRKVVDRQVTDEVVHLSAIEEGDFIIAQASATVDESNKLT
FT                   DDLVQVRHKGETTFMAPDKVTLMDVSPRQVVSVAAALIPFLEHDDANRALMGSNMQRQA
FT                   VPTLKAEKPLVGTGMERFVARDSGVCAVARRGGVIDSVDAKRIVVRINEDEIIGGEAGV
FT                   DIYNLTKYVRSNQNTCMNQRPIVRPGDVVARGDILADGPSVDMGDLALGQNMRMAFMPW
FT                   NGYNFEDSILISERVVEEDRFTSIHIQELTCVSRDTKLGAEEISSDIPNVGEAALGKLD
FT                   DAGIVYIGAEVGAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRAPTGMK
FT                   GTVIDVQVFTRDGVEKDSRALSIEQSQLDEVRKDLQETYRIAEEATFERLKRALIGQPV
FT                   NGGPKLKKGDTLDEAYLDELPRSQWFKLRMQDESLNELLAQADEQLENRRKEMDERFED
FT                   KKRKLTQGDDLAPGVLKIVKVYLAVKRRIQSGDKMAGRHGNKGVISSIMPIEDMPFDDN
FT                   GEPVDVVLNPLGVPSRMNVGQILETHLGMAANGLGVKIDRMLRDARQQQVAEIRDFLGQ
FT                   VYNTAETRQEDIDSLSDDEIITLAKNLRSGVPVATPVFDGAKEHEIKHLLTLADLPDSG
FT                   QMTLYDGRTGDAFDRQVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGG
FT                   QRFGEMEVWALEAYGAAYTLQEMLTVKSDDVEGRTKMYKNIVDGDHSMQAGMPESFNVL
FT                   VKEIRSLGIDIELEG"
FT   gene            470513..474730
FT                   /locus_tag="Csal_0415"
FT   CDS_pept        470513..474730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0415"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57777"
FT                   /db_xref="GOA:Q1R0I1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I1"
FT                   /protein_id="ABE57777.1"
FT                   /translation="MKDLVKVLKSQAQSEEFDAIKITLASPDMIRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPVKDYECLCGKYKRMKHRGIICEKCGVEVTKAAVRRERMGH
FT                   IELAAPVAHIWFLKSLPSRIGMFLDMTLRDIERVLYFESFMVIDPGMTTLERGQLLNDE
FT                   QYFEALEEFGDDFDARMGAEAVQALLNDVDLDEEIERLREEIPQTNSETKIKKLSKRLK
FT                   LLEAFQKSGNDPAWMIMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLNAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYSKLQAGGQASTIKAAKK
FT                   MVERELPEVWDILADVIREHPVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLESRTLMMATNNVLSPANGEPIIVPSQDVVLGLYYMTREK
FT                   IGAPGEGMVFSNLDEVERAFGTQSVSLHARVKVRLTEYDRDEDGGEWTSSTKIHDTTVG
FT                   RALLYRILPKGMPFELVDQPMKKKAISGLINAVYRRSGLKDTVIFADQLMYTGFRLATW
FT                   SGASIGVNDFVIPDSKKEIVDGAEEEVKEIENQFSSGLVTAGEKYNKVIDIWSKANDKV
FT                   AKAMMAGISKETAIDREGNEVEQDSFNSVFIMADSGARGSAAQIRQLAGMRGLMAKPDG
FT                   SIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVSQDLVITE
FT                   EDCGTEDGLTLHPVIEGGDVIVSLAQRVLGRVVAQDVVDPATDDVLIARGTLLDEAWCA
FT                   RLDTMGVDEIVVRSAITCETAHGVCSACYGRDLARGHQVNVGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRASAVDSVQVKHGGTVRLHNIKHVERSDGKLVVVSRSSALAVADEH
FT                   GREREYYKLPYGAELSVRDGDMVEAGTPVAKWDPHTHPVVAEVEGKVQFSDMEEGLTIH
FT                   RSVDEMTGLSNIEVIESASRPASGRDKRPMIMLLDENGGHVTLPGSNTPVQYMLPGKAI
FT                   ISVENGGQVGVGEVIARIPVEASGNKDITGGLPRVADLFEARKPKEPAILAEVTGTISF
FT                   GKETKGKRRLTITPEEGDPLEMLIPKWRQIGVFEGETVEKGEVISDGPSNPHDILRLLG
FT                   VAELAKYITAEIQDVYRLQGVVIDDKHIEVIVRQMLRKVEITDSGDSSFITGDQVEFVR
FT                   VLEENQRLAQEDKFPAKYDRLLLGITKASLATESFISAASFQETTRVLTEAAVTGKRDY
FT                   LRGLKENVVVGRLVPAGTGLAHHAERRRRREDPESTANPSAFDVEQELGAQLTALDAED
FT                   DDL"
FT   gene            474880..475254
FT                   /locus_tag="Csal_0416"
FT   CDS_pept        474880..475254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0416"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57778"
FT                   /db_xref="GOA:Q1R0I0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0I0"
FT                   /protein_id="ABE57778.1"
FT                   /translation="MATINQLVRKPRKRPVAKSDVPALQSCPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDT
FT                   SGVQNRRQGRSKYGTKRPKS"
FT   gene            475365..475835
FT                   /locus_tag="Csal_0417"
FT   CDS_pept        475365..475835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0417"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57779"
FT                   /db_xref="GOA:Q1R0H9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H9"
FT                   /protein_id="ABE57779.1"
FT                   /translation="MPRRKVVAKREILPDPKFGSERLAKFMNHLMVSGKKSVAERIVYG
FT                   ALDKVAERSKDEPLEIFDKALETIQPMVEVKSRRVGGATYQVPVEVRPSRRQALAMRWL
FT                   VDAARSRGEKTMVQRLAGEMLDAAEGKGAAVKKREDVHRMADANKAFSHYRF"
FT   gene            475854..477974
FT                   /locus_tag="Csal_0418"
FT   CDS_pept        475854..477974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0418"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57780"
FT                   /db_xref="GOA:Q1R0H8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H8"
FT                   /protein_id="ABE57780.1"
FT                   /translation="MARKTPLKRYRNIGIVAHVDAGKTTTTERVLFYTGLSHKVGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWQGMNKQFDEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVLCGSSGVQPQTETVWRQANKYEVPRMVFVNKMDRAGADYFMVLDQLKQKLG
FT                   ANTVPIQINWGAEDDFKGVIDLIQMKGILWDEANHGMNYELVEIPDELKESAAKYREQM
FT                   VEAAAEASEELMDKYLEEGDLSEADIKAGLRRRTLDNEIVLVTCGSAFKNKGVQAVLDG
FT                   VIEYMPSPTEVKAIEGELDDKDGTIATREADDSAPFAALAFKIATDPFVGTLTFIRVYS
FT                   GVLKSGDSIFNSVKSKKERVGRIVQMHSNSREEIKEVYAGDIAACIGLKDVTTGDTLCD
FT                   LNDKIILERMEFPDPVISVAVEPKSKPDQEKMGTALGKLAQEDPSFRVKTDEETGQTII
FT                   SGMGELHLDIIVDRLRREFKVDANIGKPQVAYRETIRASVEQEGKFVRQSGGRGQYGHV
FT                   LLRIEPLTAEDKGEDEDMTFKFASEIVGGVVPKEYVPAVEKGAYEQLQNGVIAGYPMID
FT                   VKVTLFDGSYHDVDSNETAFKVASSMAIKEGAPKAKAVLLEPVMKVEVVTPEEFMGDVM
FT                   GDLNRRRGLVQGMDDSPSGKIIRATVPLAEMFGYATDLRSQTQGRASYTMEFADYEEAP
FT                   SSVVEAVINQNG"
FT   gene            478004..479197
FT                   /locus_tag="Csal_0419"
FT   CDS_pept        478004..479197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0419"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57781"
FT                   /db_xref="GOA:Q1R0H7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H7"
FT                   /protein_id="ABE57781.1"
FT                   /translation="MAKEKFERNKAHINVGTIGHVDHGKTTLTAALTRVSAEVFGGDWR
FT                   EFDTIDNAPEERERGITIATAHVEYQSEERHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPTIVVFLNKADMVDDEELLELVEMEVRELLNEYDF
FT                   PGDDCPIITGSALMALEGKDDNGMGTTAVANLIKALDAYIPEPERAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRVERGIVKSGEEVEIVGLKDTAKTTVTGVEMFRKLLDEGRAGENIGAL
FT                   LRGTKRDDVERGQVLAKPGTITPHTVFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGTCELPEGVEMVMPGDNVKMTVTLIAPIAMEDGLRFAVREGGRTVGAGVVAKIVQ"
FT   gene            479351..479662
FT                   /locus_tag="Csal_0420"
FT   CDS_pept        479351..479662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0420"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57782"
FT                   /db_xref="GOA:Q1R0H6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H6"
FT                   /protein_id="ABE57782.1"
FT                   /translation="MQNQKIRIRLKAFDHRLIDQSAQEIVDTAKRTGAQVRGPIPLPTN
FT                   RERYTVLISPHVNKDARDQYEIRTHKRVLDIVEPTEKTVDALMKLDLAAGVDVQIKLD"
FT   gene            479790..480428
FT                   /locus_tag="Csal_0421"
FT   CDS_pept        479790..480428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0421"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57783"
FT                   /db_xref="GOA:Q1R0H5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H5"
FT                   /protein_id="ABE57783.1"
FT                   /translation="MTIGLVGKKSGMTRIFTENGASVPVTVIEVEPNRVTRVKTVESDG
FT                   YSAVQVTSGSRKAKHLTKAAAGQYAKSGVEAGRSLMEFRLAEGEEAPEVGGNITVSLFE
FT                   AGQKVDVTGTSKGKGFQGAVKRWNFRTQDNGHGNSLAHRAPGSIGQCQTPGRVFKGKKM
FT                   AGQLGNERVTVQSLEIVRVDAERNLLLVKGAVPGATDCEVIVRSAVKAR"
FT   gene            480443..481051
FT                   /locus_tag="Csal_0422"
FT   CDS_pept        480443..481051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0422"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57784"
FT                   /db_xref="GOA:Q1R0H4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H4"
FT                   /protein_id="ABE57784.1"
FT                   /translation="MNLNLAGADAGTVEVSDATFGKEFNESLVHQVVTAYFAAGRQGTR
FT                   AQKTRSEVRGGGKKPWRQKGTGRARAGTIRSPLWRSGGVTFAARPQDYTQKVNRKMYRA
FT                   AMRSILSELVRQERLVVVDSFEVDAPKTKQLVAKLKDLDLEKALIVTEDIDEKLFLAAR
FT                   NIPYVDVVDVAAADPVSLVAFDKVLVTVSALRKFEEKLG"
FT   gene            481048..481344
FT                   /locus_tag="Csal_0423"
FT   CDS_pept        481048..481344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0423"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57785"
FT                   /db_xref="GOA:Q1R0H3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H3"
FT                   /protein_id="ABE57785.1"
FT                   /translation="MNQERVFKVLLGPHMTEKAAFAAENNQYVFKVAQDATKPEIKKAV
FT                   EALFEKKVAGVQVLNVKGKTKRTQHGLGLRKGYRKAYVTLAAGETLEDFSGAE"
FT   gene            481361..482188
FT                   /locus_tag="Csal_0424"
FT   CDS_pept        481361..482188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0424"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57786"
FT                   /db_xref="GOA:Q1R0H2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H2"
FT                   /protein_id="ABE57786.1"
FT                   /translation="MAVVKTKPTSAGRRHVVKVVSDELHKGRPYDGLLEKKSKSGGRNN
FT                   NGRITTRHVGGGHRQHYRVVDFKRNKDGIAATVERLEYDPNRSANIALLKYLDGERRYI
FT                   IAPRGVKVGDSLESGVNAAIKRGNALPLRNIPVGSTVHCIELKPGKGAQIARSAGASAQ
FT                   LVAREGNYATVRLRSGEMRKILAECRATLGEVGNSEHSLRQLGKAGAKRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGIPTKGHKTRKNKRTDKLIVRRRKAK"
FT   gene            482211..482486
FT                   /locus_tag="Csal_0425"
FT   CDS_pept        482211..482486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0425"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57787"
FT                   /db_xref="GOA:Q1R0H1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H1"
FT                   /protein_id="ABE57787.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVETAVEKSDRKPIKTWSRRSMILPNMV
FT                   GLTIAVHNGRQHVPVHVSEEMVGHKLGEFAATRTYRGHAADKKAKR"
FT   gene            482505..482837
FT                   /locus_tag="Csal_0426"
FT   CDS_pept        482505..482837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0426"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57788"
FT                   /db_xref="GOA:Q1R0H0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0H0"
FT                   /protein_id="ABE57788.1"
FT                   /translation="MEVTAKLRGARLSAQKARLVADLVRGKPVAEALDVLAYSPKKAAK
FT                   VVKKVLQSAIANAEENNGMDIDELRVSTICVDEGMTLKRIQPRAKGRADRILKRTCHIT
FT                   VKVAEK"
FT   gene            482849..483547
FT                   /locus_tag="Csal_0427"
FT   CDS_pept        482849..483547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0427"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57789"
FT                   /db_xref="GOA:Q1R0G9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G9"
FT                   /protein_id="ABE57789.1"
FT                   /translation="MGQKVNPTGIRLGIVKDHRSVWYAERGAYADKLNNDLEVRRFLEQ
FT                   RLKNASVSDITIERPANNARITIHTARPGIVIGKKGEDVDRLRRDVSEMMGVPVHVNIE
FT                   EVRKPELDAQLVAQNVCGQLERRVMFRRAMKRAVQNAMRLGAGGIKIQLSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATYEAHTTYGVIGVKVWVFKGEILGGIEEVRAKQKQAQ
FT                   APAPKKKGSR"
FT   gene            483562..483975
FT                   /locus_tag="Csal_0428"
FT   CDS_pept        483562..483975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0428"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57790"
FT                   /db_xref="GOA:Q1R0G8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G8"
FT                   /protein_id="ABE57790.1"
FT                   /translation="MLQPKRTKFRKVQKGRNRGLAHRGSKVSFGEYGLKATGRGRITAR
FT                   QIEAGRRAITRHVKRGGKIWIRVFPDKPITEKPLEVRMGKGKGSVEYWVAQIQPGKVLY
FT                   EIEGVSEELAREAFDLAAQKFPVSTTFVKRTVM"
FT   gene            483975..484166
FT                   /locus_tag="Csal_0429"
FT   CDS_pept        483975..484166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0429"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57791"
FT                   /db_xref="GOA:Q1R0G7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G7"
FT                   /protein_id="ABE57791.1"
FT                   /translation="MKAQEIREKSVEALQQQLLELLREQFNLRMQKATGQLSQTHLLKQ
FT                   VRRDIARVKTVLNEKAGD"
FT   gene            484168..484428
FT                   /locus_tag="Csal_0430"
FT   CDS_pept        484168..484428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0430"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57792"
FT                   /db_xref="GOA:Q1R0G6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G6"
FT                   /protein_id="ABE57792.1"
FT                   /translation="MAEENNARTLTGKVVSDKMDKSVVVQIERRVRHPIYDKYVKRSTK
FT                   LHAHDEANQARVGDTVSIEECRPISKLKAWTLVEVVEQAKG"
FT   gene            484480..484851
FT                   /locus_tag="Csal_0431"
FT   CDS_pept        484480..484851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0431"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57793"
FT                   /db_xref="GOA:Q1R0G5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G5"
FT                   /protein_id="ABE57793.1"
FT                   /translation="MIQTQTMLDVADNSGARRVQCIKVLGGSHRRYARVGDVIKVTVKE
FT                   AIPRGKVKKGQVLKAVVVRTKSGVRRTDGSLIRFDGNAAVLLHNANEQPIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   gene            484866..485183
FT                   /locus_tag="Csal_0432"
FT   CDS_pept        484866..485183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0432"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57794"
FT                   /db_xref="GOA:Q1R0G4"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G4"
FT                   /protein_id="ABE57794.1"
FT                   /translation="MRKIKRDDEVIVIAGKDKGKRGTIKRVLQDGCYVVSGVNMIKRHT
FT                   KPNPMQGKQGGIVEREAPIHASNVAIFNQETGKADRVGFQIQEDGTKVRIYKSTQKQID
FT                   A"
FT   gene            485202..485741
FT                   /locus_tag="Csal_0433"
FT   CDS_pept        485202..485741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0433"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57795"
FT                   /db_xref="GOA:Q1R0G3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G3"
FT                   /protein_id="ABE57795.1"
FT                   /translation="MANLKERYQNEVAAQLQEQFSYANVMQIPRITKVTLNMGIGDATS
FT                   DKKLIDNAMGDLEKLSGQRPVITKARKSIAGFKVREGWPIGIKVTLRSERMWDFLDRLV
FT                   NIAIPRVRDFRGLNPKSFDGRGNYSMGVREQIIFPELEYDKIDRIRGLDVTITTTANTD
FT                   EEGRALLSALNFPFKK"
FT   gene            485752..486057
FT                   /locus_tag="Csal_0434"
FT   CDS_pept        485752..486057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0434"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57796"
FT                   /db_xref="GOA:Q1R0G2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G2"
FT                   /protein_id="ABE57796.1"
FT                   /translation="MAKKSMIERELKRAKLVDKYAAKRAELKAIIYDVNASDEERFDAQ
FT                   LKLQQLPRDSSPVRQRNRCRVTGRPHGFYNKFGLGRNKLREAAMRGDVPGLKKSSW"
FT   gene            486086..486478
FT                   /locus_tag="Csal_0435"
FT   CDS_pept        486086..486478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0435"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57797"
FT                   /db_xref="GOA:Q1R0G1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G1"
FT                   /protein_id="ABE57797.1"
FT                   /translation="MSMQDTLADMFTRIRNAQMATKETVTMPSSNLKTEVARVLKQEGY
FT                   INDFTVTEGAKPQLAVTLKYFEGKPVIEHIQRFSKPSLRSYKGKDALPKVADGLGIAIV
FT                   TTSQGVMTDRAARQAGVGGEVICTVF"
FT   gene            486488..487018
FT                   /locus_tag="Csal_0436"
FT   CDS_pept        486488..487018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0436"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57798"
FT                   /db_xref="GOA:Q1R0G0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0G0"
FT                   /protein_id="ABE57798.1"
FT                   /translation="MSRVAKYPVKLPSGVEVKLEANKLTVKGGQGTLSMTVHSDVTIGQ
FT                   EEGQLTFNPSESAKSWAMVGTTRALVQNIVTGVSEGFTKSLEINGVGYRAQASGNTLNL
FT                   TLGFSHPVEYKLPEGVTAETPKNTTIVLKSADKQQLGQVAAEIRAFRPPEPYKGKGIRY
FT                   GDEEVRRKEAKKK"
FT   gene            487028..487378
FT                   /locus_tag="Csal_0437"
FT   CDS_pept        487028..487378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0437"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57799"
FT                   /db_xref="GOA:Q1R0F9"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F9"
FT                   /protein_id="ABE57799.1"
FT                   /translation="MNAKKEARLRRARRARAKIREQGVSRLSVNRTPRHIYAQIISPDG
FT                   GQVLASASTLDKSLREGSTGNSDAAAKVGALIAERAKEAGITEVAFDRAGFKYHGRVKA
FT                   LADAAREGGLEF"
FT   gene            487390..487890
FT                   /locus_tag="Csal_0438"
FT   CDS_pept        487390..487890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0438"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57800"
FT                   /db_xref="GOA:Q1R0F8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F8"
FT                   /protein_id="ABE57800.1"
FT                   /translation="MANNEQKGGDLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGSGR
FT                   VGFGRGKAREVPVAIQKAMDQARRNMVKVSLSGATLQYPVKARHGASKVFMQPASEGTG
FT                   IIAGGAMRSVLELAGVHDVLAKCYGSTNPVNVVRATIKGLASMQSPEDIAAKRGMSVEE
FT                   IAG"
FT   gene            487897..488082
FT                   /locus_tag="Csal_0439"
FT   CDS_pept        487897..488082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0439"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57801"
FT                   /db_xref="GOA:Q1R0F7"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F7"
FT                   /protein_id="ABE57801.1"
FT                   /translation="MASATIKVTQTRSTIGILEKHKATMRGLGLRRIGHTVELEDTPAV
FT                   RGMVNKVNYLVRVEGE"
FT   gene            488086..488520
FT                   /locus_tag="Csal_0440"
FT   CDS_pept        488086..488520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0440"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57802"
FT                   /db_xref="GOA:Q1R0F6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F6"
FT                   /protein_id="ABE57802.1"
FT                   /translation="MKLNNLSPAPGSKHAEKRVGRGIGSGLGKTGGRGHKGQKSRSGGS
FT                   VKPGFEGGQMPLQRRLPKYGFTSAKSLVSEEVRLAELAKVDGEIVDLESLKKANVLKDN
FT                   TQYAKVILSGELNKAVTVRGLKVTKGARDAIAAAGGKVED"
FT   gene            488520..489851
FT                   /locus_tag="Csal_0441"
FT   CDS_pept        488520..489851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0441"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57803"
FT                   /db_xref="GOA:Q1R0F5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0F5"
FT                   /protein_id="ABE57803.1"
FT                   /translation="MAKSGNMPASGSGLSELWARLRFVFIAIVVYRIGAHIPVPGINPD
FT                   QLAALFRENQGTILGMFNMFSGGALSRMSIFALGIMPYISASIIMQLLTAVSPQLEQLK
FT                   KEGEAGRRKINQYTRYGTVVLALIQATGMAVGLVGQGVAYSGDLSFYFTAIVTFVAGAV
FT                   FLMWLGEQITEKGIGNGISLIIFAGIVAGLPSAIGQSFTLARNDGAWNILPLLALAVLG
FT                   IATVAFVVFIERGQRRITVNYPRRQVGNKMYAGQSSYLPLKVNMAGVIPPIFASSILLF
FT                   PASIGQWVGEGQNMAWLQTVSQAMGPGQPLYILLFAAAVLFFCFFYTALVFNPKDVADN
FT                   LKKSGAFLPGIRPGEQTARYVDKVMTRLTLFGALYITAVSLMPQFLVVAWQVPFYFGGT
FT                   SLLIVVVVVMDFMAQVQSHLMSNQYESVMKKSNLKGYGSGGILR"
FT   gene            489871..489996
FT                   /locus_tag="Csal_0442"
FT   CDS_pept        489871..489996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0442"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57804"
FT                   /db_xref="GOA:Q1R0F4"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F4"
FT                   /protein_id="ABE57804.1"
FT                   /translation="MERTMKVRASVKKMCRNCKIIRRNGAIRVICTEPRHKQRQG"
FT   gene            490120..490476
FT                   /locus_tag="Csal_0443"
FT   CDS_pept        490120..490476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0443"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57805"
FT                   /db_xref="GOA:Q1R0F3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F3"
FT                   /protein_id="ABE57805.1"
FT                   /translation="MARIAGVNIPDNKHAAISLTYIFGIGRTRAQEICAATGIAPTAKV
FT                   QDLSAEEVDTLRNEVGKYTVEGDLRRDTTLNIKRLMDLGCYRGLRHRRGLPLRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   gene            490516..490902
FT                   /locus_tag="Csal_0444"
FT   CDS_pept        490516..490902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0444"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57806"
FT                   /db_xref="GOA:Q1R0F2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F2"
FT                   /protein_id="ABE57806.1"
FT                   /translation="MANPRSNRKKVKKQVVDAVAHIHASFNNTIVTITDRQGNALSWAT
FT                   AGGSGFRGSRKSTPFAAQVASERAATAAAEYGVKNVDVLVKGPGPGRESAVRALNAAGF
FT                   RVQSITDATPVPHNGCRPPKKRRV"
FT   gene            490915..491535
FT                   /locus_tag="Csal_0445"
FT   CDS_pept        490915..491535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0445"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57807"
FT                   /db_xref="GOA:Q1R0F1"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F1"
FT                   /protein_id="ABE57807.1"
FT                   /translation="MARYIGPKCKLSRREGTDLFLKSGVTPFEKKCKSEQIPGVHGQRR
FT                   QRLSDYGLQLREKQKVRRMYGVLEKQFRNYYKEAARLKGATGELLLQLLESRLDNVVYR
FT                   MGFGSTRSEARQLVSHKAIAVNGRTVNVASYQVKPGDVVSVREKAKNQARIQNALGIAA
FT                   NRGDVAWIDVDSKKMEGTFKAVPERGDLSADINENLIVELYSK"
FT   gene            491627..492628
FT                   /locus_tag="Csal_0446"
FT   CDS_pept        491627..492628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0446"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57808"
FT                   /db_xref="GOA:Q1R0F0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0F0"
FT                   /protein_id="ABE57808.1"
FT                   /translation="MQRSVTEFLRPRDIKVEEINANHAKIVLEPFERGFGHTLGNALRR
FT                   ILLSSMPGCAVVEAEIEGVLHEYSAIEGVQEDVIEILLNLKDVAVKMHGNRDEVVLALS
FT                   KQGPSVVTAGDIAVDHDVEIVNPDHVIAHLNDSGELKMQLKVVRGRGYEPADTRASEED
FT                   ESRAIGRLQLDATFSPVRRVSYSVEAARVEQRTDLDKLIIDLETDGTLDPEEAIRRSAT
FT                   ILQEQLAAFVDLEADKEQEVEEEEDQIDPILLRPVDDLELTVRSANCLKAENIYYIGDL
FT                   IQRTEVELLKTPNLGKKSLNEIKDVLAARGLSLGMRLENWPPASLKDDKASA"
FT   gene            492668..493051
FT                   /locus_tag="Csal_0447"
FT   CDS_pept        492668..493051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0447"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57809"
FT                   /db_xref="GOA:Q1R0E9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0E9"
FT                   /protein_id="ABE57809.1"
FT                   /translation="MRHRKSGRHLNRTSSHRHAMFKNMCVSLVEHEVIKTTLPKAKELR
FT                   RHIEPLITLAKQDSVANRRLAFNRTRSKEAVGKLFNELGPRYVERPGGYVRILKCGFRA
FT                   GDNAPMAYVELVDRPVVEEAAEE"
FT   gene            complement(493135..496008)
FT                   /locus_tag="Csal_0448"
FT   CDS_pept        complement(493135..496008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0448"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57810"
FT                   /db_xref="GOA:Q1R0E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E8"
FT                   /protein_id="ABE57810.1"
FT                   /translation="MDRILVRGARTHNLQNIDVELPRNKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSTYARQFLSMMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARAGTPRCPEHGIDLEAQTVSQMVDQVLALPEGSKLMLLAPVVSGRKGEHQ
FT                   QLLTELRAQGYVRAMVDGQAVELDELGPLEKNKKHDISVVVDRVKVRDGLAQRLAESFE
FT                   TALGLADGIAVVHDMDGERDDIVFSARFACPVCGYSIAELEPRLFSFNNPAGACPTCDG
FT                   LGVRQYFDPDKLISHPELSLAEGAIKGWDRRSVYYFNQLQAVAEHYRFKLETPWQDLAR
FT                   HEREVVLRGSGHDQITFSYVNDRGRKVTREHAFEGVLPNMERRYRETESSMVREDLAKY
FT                   LAVQPCPSCEGTRLRKEARHVYVDGRPLPEVAHLPIGEAWQYFATLELSGRKGEIAVKI
FT                   VHEIHSRLEFLVNVGLDYLTLERSADTLSGGEAQRIRLASQIGAGLVGVMYILDEPSIG
FT                   LHQRDNDRLLKTLERLRDLGNTVIVVEHDEDAIRAADHVLDIGPGAGVHGGRIVAQGTP
FT                   QQIEQSEESLTGQYLSDQRRIEIPPHRIPGNPEKMLRLTGANGNNLQNVTLELPLGLFV
FT                   CVTGVSGSGKSTLINSTLMPVATRELNRATSLTPAPYRHIEGLDLLDKVIDIDQSPIGR
FT                   TPRSNPATYTGIFTPIRELFAGTQEARSRGYKPGRFSFNVKGGRCEACQGEGMIKVEMH
FT                   FLPDIYVPCDVCQGKRYNRETLEIHYKGKNIHEVLEMTIEEALEFFSPVPAIARRLQTL
FT                   MDVGLSYVRLGQSATTLSGGEAQRVKLARELAKRDTGKTLYILDEPTTGLHFEDIRQLL
FT                   GVLHRLRDHGNTVVVIEHNLDVIKTADWLIDLGPEGGSGGGRIIAEGTPEQVAKLEQSH
FT                   TGRFLKPLLDKRTAPANKARTPSTLET"
FT   gene            496253..497635
FT                   /locus_tag="Csal_0449"
FT   CDS_pept        496253..497635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0449"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57811"
FT                   /db_xref="GOA:Q1R0E7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E7"
FT                   /protein_id="ABE57811.1"
FT                   /translation="MSSSLLRTERRAIFGLASLYATRMLGLFMVLPVLAVYAEDLDGAT
FT                   PLLVGMALGGYGLTQAILQIPFGLMSDRFGRKLIISVGLLLFLLGSVIAAQATSIGWVI
FT                   AGRCLQGSGAVAGAIMALLADQTREEVRTAAMATIGLSIGIAFGVAMVVGPLVADPFGL
FT                   AGVFWFTAVLAVVGLLVLWRLVPRAPRLMAHRDVGLDRTQLRAMLARHDLLRLDFSIFA
FT                   LHAILTACFVAVPFRLEALGIAPAHHGWVYLPIMALAFVGMVPLVIVAEKYRKMKPIFL
FT                   GAVAWLTLCLAGLVEFSDGRWSLFALLWGFFVAFNLLEATLPSMISKLAPAGAKGTAMG
FT                   VYSTSQFLGAFLGGTAGGFLSQHYGLSAVFLGAALLGAVWLAIVWKMPAPRHLSSEIVA
FT                   LDERSLGTVDTLMDRFAAVAGVEDVMVVPDERVAYLKVDRQRLDAEALARVLGTEPDHK
FT                   RA"
FT   sig_peptide     496253..496369
FT                   /locus_tag="Csal_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.890 at
FT                   residue 39"
FT   gene            497669..498235
FT                   /locus_tag="Csal_0450"
FT   CDS_pept        497669..498235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0450"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57812"
FT                   /db_xref="GOA:Q1R0E6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E6"
FT                   /protein_id="ABE57812.1"
FT                   /translation="MARGVNKVILIGNLGQDPEVRFLPSGNPVCNLRIATTDSWTDRQS
FT                   GQRQERTEWHTVVMFNKLAEIAQQYVKKGSRIYIEGRLQTRKWQGQDGQDRYSTEIVAN
FT                   DMQMLDSRSGQGGDYAQPSQGAPQQGMGQPGGAPQQGGGYGQPQGGPPPQQRPQQQPPQ
FT                   QGGQQDNYGAPNPGNFDDFDDEIPF"
FT   gene            complement(498245..499813)
FT                   /locus_tag="Csal_0451"
FT   CDS_pept        complement(498245..499813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0451"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57813"
FT                   /db_xref="GOA:Q1R0E5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E5"
FT                   /protein_id="ABE57813.1"
FT                   /translation="MTAFLHTLRDLLADLSAGHSRDPLPERWARLLAALVGSYPADAST
FT                   LMVAHDDGLQPVAVLGLDDEVRGRRFALDAHPRLAAIAAHPGVCRFPLDSTLPDPFDGL
FT                   LDDASSHVHDCMGVALRDGDRLLGMLTLDALTPGCLAAIDDDELLAAAGLMATCLRLAQ
FT                   QLSDTRSRLNQALDQTFDHDAPRHSEPAWHSPAMRQLDESLALVAPTDMSVLLHGETGV
FT                   GKERLARRVHALSSRRKGPLVRVNCAALPEALIESELFGHRRGAFSGAVRDHRGHFAMA
FT                   HEGTLMLDEIGELPLTMQPKLLRVLQEGEIQPLGSETPQRVNVRVIAVTNRALDQEVAA
FT                   GRFRKDLYHRLSVFPLRVPPLCERRDDVLLLAGGFLEDNRIRLGVANLRLEPEAERALL
FT                   AWHWPGNIRELEHTLGRAALRAFGERPRDTRHARRDAVVRIATHHLELPSSEAPIPRPA
FT                   DANVVTSTEAAPSMPLREAVEAFQRQHIARALDTHDGNWAATARALRTDSGNLHRLAKR
FT                   LGLKH"
FT   gene            500065..501246
FT                   /locus_tag="Csal_0452"
FT   CDS_pept        500065..501246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0452"
FT                   /product="Oxidoreductase FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57814"
FT                   /db_xref="GOA:Q1R0E4"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E4"
FT                   /protein_id="ABE57814.1"
FT                   /translation="MLTSAQESVIAATTPVVAEHIEAIAQRFYPLMFARYPEVKTLFNA
FT                   THQHTGGQPRALAGAVVGYVQLRHTPQRLDEVLGIIVDKHVSLGIRPEHYPIVGECLMA
FT                   AIGEVLGDAVTDEVADAWGALYEELAGLLIEKEARRYRDFAAQPGGWEGTRTFRIAAKR
FT                   PESAVITSFVLAPVDGGPVAAHRPGQYIGFKLTIDGEIVHRHYSLSASPDGKTYRVSIK
FT                   REEGGKVSRHFHDRLAEGDTLELLPPAGHLTLDEGTSPVMLISAGVGQTPMVPLARQAL
FT                   AAGRRVAYLHAARDGAVHAFADELARLEADYPALLEVITVYSQPRAEDAPTHGGHVDAN
FT                   LLSRYLPRDAQCYLVGPAGFMRNMEAALSALGVAASRRHHEFFGPAEPLDSAA"
FT   gene            complement(501308..502177)
FT                   /locus_tag="Csal_0453"
FT   CDS_pept        complement(501308..502177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0453"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57815"
FT                   /db_xref="GOA:Q1R0E3"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E3"
FT                   /protein_id="ABE57815.1"
FT                   /translation="MTLAVRQAWNGRAQLGEGPLWSSELQALVFVDILGARLMAYMPDD
FT                   DTTHCWSLEEACCWLAPHHDGGFVAGLRSRLVRLQLDEGGPHVLETLAHPVADRPGQRL
FT                   NDGKADPEGRLWFGTMDDAERHASGALWRFDAGGLQTLDTPYTVTNGPAISPDGQTLYH
FT                   TDSPARTVYAFTRHTDGTLSDKRVHLRFGEADGYPDGMTCDTEGGLWIAHWDGGRVTRF
FT                   RPDGTRDRHIEVPASRVTCCTFGGDDLSRLYVTTAAVGRDNEPKAGSLFVTEPGLRGMP
FT                   PCAYRPAP"
FT   gene            502241..503203
FT                   /locus_tag="Csal_0454"
FT   CDS_pept        502241..503203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0454"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57816"
FT                   /db_xref="GOA:Q1R0E2"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E2"
FT                   /protein_id="ABE57816.1"
FT                   /translation="MTDNATMGEYVPLPTALPANRNDKHARGETVKLLLADAGHCLSLA
FT                   LAREANRRRDTELVIVEGTQVTARILAEAKPDALIVPPLAAPARLAPAEVMAHADAVEA
FT                   NLELCREYGVPLVWCVSDELYEDGGDGTLDEHVTPAPRDESLKRLIVAGDSVRQRLPRH
FT                   LIVRLGPLFALEGAHAWLPGLIDTLLAGETVRAAEDVILCPTSADAVAMALIGMLQQQG
FT                   CGAEAWGAYHLAGTEPVSPYTFASVVRTQLATHLERQGRDLTLGTLQALHHHHDHPLRR
FT                   VLNCRRVLDAFGIHQKPWRLELSRMLDDWCRLHDKEAAT"
FT   gene            503200..503955
FT                   /locus_tag="Csal_0455"
FT   CDS_pept        503200..503955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0455"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57817"
FT                   /db_xref="GOA:Q1R0E1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E1"
FT                   /protein_id="ABE57817.1"
FT                   /translation="MNVLRSVLFYAGYFLALLVSGLCLLPIAPLVPLFSRFRLLNLHNR
FT                   FILRWFAIACGVRYHVRGRENVPEGPCVVLANHQSEWETLFLQLLKVPICTVLKRELLN
FT                   LPVFGWGLRLIKPIALDRSRPSRAMRMVLEQGMQRLSEGLSVLIFPEGTRVAPGQRKRY
FT                   NKSGVVIACRAGVPVLPVAHNAGEHWPGKHWVKKPGHLNVVVGAPIETQGRSAEDVLAE
FT                   VEHWIEAQLTEISAVPRPAAEGEAAKVPA"
FT   gene            complement(504059..505276)
FT                   /locus_tag="Csal_0456"
FT   CDS_pept        complement(504059..505276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0456"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57818"
FT                   /db_xref="GOA:Q1R0E0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0E0"
FT                   /protein_id="ABE57818.1"
FT                   /translation="MRRVVVTGLGIVSCLGNDQQQVLDALRNGRSGIRFKDEYAERGFR
FT                   SHVAGVVDIDLDTLIDRKLRRFMGDAAAFAYVSMDQAIRDAGLEESDISSERTGLIAGS
FT                   GGASSANQVEAADVLREKGLRRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACAT
FT                   SAHCIGSAVEQIQLGKQDVVFAGGGEEEHWTLSCLFDAMGALSTSYNDSPETASRPYDA
FT                   SRDGFVIAGGGGMLVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAARCMRQ
FT                   AMATVDGPIDYINTHGTSTPVGDIAELKAIREVFGDTTPAMSSTKSLTGHSLGATGVQE
FT                   TIYSLLMMEHAFIAASANIDELDDAAQGFDIVKTRRDDAAIERVLSNSFGFGGTNACLV
FT                   LQRYRD"
FT   gene            complement(505290..505886)
FT                   /locus_tag="Csal_0457"
FT   CDS_pept        complement(505290..505886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0457"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57819"
FT                   /db_xref="GOA:Q1R0D9"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0D9"
FT                   /protein_id="ABE57819.1"
FT                   /translation="MHSSGTASRLGRPCSATHHNFDSRNDSVTKQHSFEREELLQCSQG
FT                   ELFGPGNAQLPAPNMLMLDRVVRICEEGGHYGKGELIAELDIHPDLWFFDCHFPGDPVM
FT                   PGCLGLDAMWQLVGFHLGWLGHPGRGRALGCGEVKFSGQILPDANKVTYHIHMKRVITR
FT                   RLILGIADGTVSVDGREIYQANDLRVGLFTSTANF"
FT   gene            506019..507854
FT                   /locus_tag="Csal_0458"
FT   CDS_pept        506019..507854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0458"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57820"
FT                   /db_xref="GOA:Q1R0D8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D8"
FT                   /protein_id="ABE57820.1"
FT                   /translation="MWSVFTLNRPLVWTGIAAMASMSLLPTLMLRMAALVVVLVGGWDA
FT                   WRQIRLEATRRRLTETALTLSPDGVLISNAQNRIQAVNPAFTQITGYSVDEIRGLDPSV
FT                   LSSGRHDKAFYERYWQTLNATGQWEGEVWNQRKHGDEFPEWLRVHAVTDAKGRVTHYVG
FT                   LFTDISRHKAREQDLQRIGFEDPLTGLPNRRRLHDLLASRLQRLRAGEELDIALIDIDG
FT                   FKAVNDAMGVDKGDRLLSRFGQRLAAFVAGGVVGRLGGDEFMAIRTTTFDDHEQWVEEL
FT                   RGHLSEPFEIGETPLRLGLTIGSCRSPDDGRDAGVLFQRLESALYAAKRHGRNHSRRFR
FT                   PSLEVEGDPQLELLNELRQALAHGTQLELFYQTQHYLDDGRLAGMEALLRWYHPTQGMI
FT                   SPASFIPLAERHGLMSALGDWVIERACAQVAAWRQQGVSFVPVWINISAVQLIQGDLEA
FT                   KLSASLAKYHVPAAMLGLELTESVLLDERAGDISARLVALRDKGHPIAIDDFGTGYSSM
FT                   AYLKQLPVDKLKLDRAFVRALPEDSADAAITSAVLAMARGLELDVVAEGVETEEQRDFL
FT                   LAQGCAMVQGFLYARPERVADVEARLRRDAEVSLP"
FT   sig_peptide     506019..506120
FT                   /locus_tag="Csal_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.725 at
FT                   residue 34"
FT   gene            complement(507823..508305)
FT                   /locus_tag="Csal_0459"
FT   CDS_pept        complement(507823..508305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0459"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57821"
FT                   /db_xref="GOA:Q1R0D7"
FT                   /db_xref="InterPro:IPR021306"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D7"
FT                   /protein_id="ABE57821.1"
FT                   /translation="MLGKVINALAFQVGWLACVLGGTSWAIPAVGVIVTLHLAWLGRPG
FT                   EWRWLMGFALLGALVDGALTYAGGMRFTGSAGLPLWLWLLWPLFATTIHHSLAWLWSHP
FT                   WLAVLGGVLGGPSSYLGGARLAEVTLAPWAVAVQALVWGSLCGWLAFRAATLRRRA"
FT   sig_peptide     complement(508225..508305)
FT                   /locus_tag="Csal_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.651) with cleavage site probability 0.600 at
FT                   residue 27"
FT   gene            complement(508309..509574)
FT                   /locus_tag="Csal_0460"
FT   CDS_pept        complement(508309..509574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0460"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57822"
FT                   /db_xref="GOA:Q1R0D6"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D6"
FT                   /protein_id="ABE57822.1"
FT                   /translation="MTMTHSDTSPGRSLDACLTRWLKPRLLQQLATLDGGVLIVEEDGC
FT                   THRLGRGGPLTARLRIHDPRAWRRVALGGSVGAGEAYMDGLWTCDDLVTLIRLLARNLE
FT                   HVNGGLEKGPARLAQSALSALNALRRNTTARARRHIAAHYDLGNDLFETFLDREHWLYS
FT                   SAIFPHADASLEDASTYKLDVILGKLDIGPEHHVLEIGTGWGGLALYAARTRGCHVTTT
FT                   TISEAQYAHTARRIREAGLEDRITLLKQDYRALEGRYDRLVSVEMIEAVGHQYLDTYLA
FT                   TVDRLLKDDGLALIQAITIRDQRYAAAKRDVDFIKRYIFPGGFLPSHQAMLDSMTRRTQ
FT                   LNVLDLDEIGAHYARTLREWRQRFEASLERIGELGYDERFMRMWRYYLCYCEGGFLERT
FT                   IGTSQWLLAKPGNRRAPLTGAL"
FT   gene            complement(509571..510356)
FT                   /locus_tag="Csal_0461"
FT   CDS_pept        complement(509571..510356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0461"
FT                   /product="protein of unknown function DUF1365"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57823"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D5"
FT                   /protein_id="ABE57823.1"
FT                   /translation="MSQEAHVRHPVTHSRVAWGTLRHRRFTPRPHAFTYRMWMAWLDLD
FT                   ELPALFDALPGFSARRMALARFRREDYLGPARLPLKTAVRQRLHAELGELPDGPIRMLT
FT                   QLRLCGVGFNPITLYYAYDREERLCAILGEVTNTPWRERQVYASRVTPTRHVHAAHFDK
FT                   ALHVSPFNPMDMRYRWRFNTPGAHLSMHMDVWRDATRHFDATLTLTFAPAGRRAWVAAL
FT                   ARAPWMSLKTLAAIHFEAVRLWCKRVPLFSHPRREEKSP"
FT   gene            complement(510353..511678)
FT                   /locus_tag="Csal_0462"
FT   CDS_pept        complement(510353..511678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0462"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57824"
FT                   /db_xref="GOA:Q1R0D4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D4"
FT                   /protein_id="ABE57824.1"
FT                   /translation="MSTPRSRIAVVGGGISGMACAHYLAKRHAVTLFEANERLGGHTAT
FT                   VDVEVNGHQHAIDTGFIVFNDRTYPHFQRLLAQLGVPMQPTEMSFSVHAVNEDFEYNGH
FT                   TLNTLFAQRRNLLRPRFYAMLRDILRFNRQAVRDLERDALPSTLTLGEYLTRGGYGLDF
FT                   QRRYLLPMGAAIWSASEHDMAHFPLASFVRFFHHHGLLSVNNRPQWYTLPGGSRQYIAP
FT                   LTSSYAANIRLASPVWHIVRDARGVTLTTPRGQERFDQVVLACHSDQALAMLAAPSAAE
FT                   REILEALPYQDNQVVLHTDTRLLPRRQRARASWNYRIDGRADDARVSVTYDMNRLQRLT
FT                   SETPFCVTLNDSEVIDPDCMLRRFTYRHPRFTVAGAAAQRRHAEISGTHRRTHFCGAYW
FT                   RHGFHEDGVWSALRVARALGCDEPGAPATTSVPYTEQTEEPA"
FT   sig_peptide     complement(511613..511678)
FT                   /locus_tag="Csal_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.812 at
FT                   residue 22"
FT   gene            complement(511675..512469)
FT                   /locus_tag="Csal_0463"
FT   CDS_pept        complement(511675..512469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0463"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57825"
FT                   /db_xref="GOA:Q1R0D3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D3"
FT                   /protein_id="ABE57825.1"
FT                   /translation="MATPLAAPQRIWLTGATSGIGEALAKRLLQDGHRVALTARRRDAL
FT                   EALAAPFDNALVVPADLTDRASVREAGERIAAVFGGLELALLNAGTCEYLDARHFDIDL
FT                   VERVLTTNLHGTLYAVDAALPLLRRARDAHRRPQLAAVSSASAYFPLPRAEAYGASKAA
FT                   ISYFLASLRLDLAAEGIDVSLIHPGFVRTPLTERNDFPMPMRVEVDEAVEAILRGLEKR
FT                   SLDIHFPRRFTWLVKLAGILPPVLRHRLGLRLTRNADTEGRS"
FT   gene            complement(512511..512957)
FT                   /locus_tag="Csal_0464"
FT   CDS_pept        complement(512511..512957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57826"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D2"
FT                   /protein_id="ABE57826.1"
FT                   /translation="MSQDTALATFCRVFEKLDKRCTRSLENLYTEDVEFTDPLHHIEGR
FT                   APLMRYYEDMLANVQTCRFEVTQRFREGDDALLVWTLHLAHPRLARGRTVCISGCSQLT
FT                   FRGDRICRHRDHFDAGAMLYEHVPLLGTMIRWLKRRVDPARHSR"
FT   gene            complement(513003..514424)
FT                   /locus_tag="Csal_0465"
FT   CDS_pept        complement(513003..514424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0465"
FT                   /product="deoxyribodipyrimidine photo-lyase type I"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57827"
FT                   /db_xref="GOA:Q1R0D1"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D1"
FT                   /protein_id="ABE57827.1"
FT                   /translation="MSDLQMVWFRSDLRTLDNRALSAAAERGPVIAVFLTSIPQWQRHD
FT                   HGANKIDFWLRGVAALREHLSGLNIPLLQRRIETYDEAPDALLKLAHQHGATALHFNRE
FT                   YPLNERRRDAAVERAFHDAGIAVTGHTDAVAYAPGELLTGKGEPYSVFTPFAKAWHRQL
FT                   EGHRLALTHAPAPQTRLAIEADPAPSRELPDACDTPLDASRWPAGQEEAGDRLERFLRF
FT                   RGRHYRRQRDFPALPGTSELSPYLALGMLSHRQCLQAVMSDNDGHLADGDAGLTAWANE
FT                   LIWREFYLHIAASFPDISRHRPFQPHTRDLAWRDDDAGFRAWCEGRTGYPLVDAAMRQL
FT                   VQCGWMHNRLRMVTAMFLSKHLLIDWRRGEAFFMRHLVDGDFASNNGGWQWAASTGTDA
FT                   APYFRIFNPTTQAERFDPEGRFIAHWLPELAPLAVKSRFFPSEAQRRDTGYTLPIVDHK
FT                   AARQRALDAFKSLSS"
FT   gene            complement(514453..515370)
FT                   /locus_tag="Csal_0466"
FT   CDS_pept        complement(514453..515370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0466"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57828"
FT                   /db_xref="GOA:Q1R0D0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0D0"
FT                   /protein_id="ABE57828.1"
FT                   /translation="MSEQAMDPASAPLYPIREVSRLTGVNSVTLRAWERRYGLIRPQRT
FT                   PKGHRLYAREDIQRVERILQWLNRGVPVSQVRDLLEQSEPAANDAPPPDISDWESQRQQ
FT                   LLQAVDTLDGELLETLFNRSMALYPTSVCIAELWQPVVDRLEERWSDQFGAELQRRQLE
FT                   SFLRTRIGMRLYHANHVTGGARLLLVRLPEERDLLRTLLLALAASASGFRVEWLETDLP
FT                   INELALAAERFKVDALVMTSGHAERSDLIRRQLPRLGEQLDVPLCLVGPVTRIRGAELE
FT                   NTQVASLGDDLPAALSRLHGLLGR"
FT   gene            complement(515600..515968)
FT                   /locus_tag="Csal_0467"
FT   CDS_pept        complement(515600..515968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0467"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57829"
FT                   /db_xref="GOA:Q1R0C9"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0C9"
FT                   /protein_id="ABE57829.1"
FT                   /translation="MSHALILLAHGSSDARWRAPFEALESDLQARLETPAVVAYMELSE
FT                   PSLETRVAECHAQGHRRIDILPLFFAAGRHLRQDVPAQLDALRTQYPDATLTLLDPVGQ
FT                   HPAFVEALAGIVTARAGA"
FT   gene            516143..517039
FT                   /locus_tag="Csal_0468"
FT   CDS_pept        516143..517039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57830"
FT                   /db_xref="GOA:Q1R0C8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0C8"
FT                   /protein_id="ABE57830.1"
FT                   /translation="MRILITGGSGFVGRPLCRRLHDAGHELLVVSRSPSRAKALLPDGT
FT                   EVRDSVLAFVDRAPEAIINLAGEPIADKRWSAAQKRRLIDSRLTVTRDLVTLCERLDTP
FT                   PRVMISGSAMGYYGDQGDRDVTEQTPPQEEFAHRLCAEWESAALAAEPLGVRVVLLRTG
FT                   LVLDAGGGTLAKLLLPFRLGLGGRLGSGRQYMPWIHREDWVSIALFLLERDDLAGPFNA
FT                   SAPHPVTNADFTRALARHLHRPAVMAVPAGVLRLALGEMSRLLLTGARMRPARLEAAGF
FT                   GFQYPTLDSALKAILGR"
FT   gene            complement(517061..520003)
FT                   /locus_tag="Csal_0469"
FT   CDS_pept        complement(517061..520003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0469"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57831"
FT                   /db_xref="GOA:Q1R0C7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0C7"
FT                   /protein_id="ABE57831.1"
FT                   /translation="MSEFIPGQRWVSDGEAELGLGTILSCDFRSVTVLFAASQETRTYS
FT                   VRQAPLTRVVFGAGDRIEAADGRTLTVDDTKEAKGLLIYVVETADGEYEEFPESRLADS
FT                   MRFQQARDRLLTGQVDRNDWFELRYRTLHHYHRIAQHPANGLAGPRVDLIPHQLYIADE
FT                   VSRRHAPRVLLADEVGLGKTIEAGLILHRLLITGRAERALILVPDSLTHQWLVEMLRRF
FT                   SLHFTLLDEQQSQHSTGNPFESAQLVLASQQWLFANPHRQTQAQACDWDLLIVDEAHHL
FT                   DWSPEASGPGYACVEQLAHAIDGVLLLTATPEQMGLASHFARLRLLDPERYTSLAAFEA
FT                   EETGYARVAEAVDALERLPGDAADRDSVGAVIDDADSQALLDTLIDPESDDTQRDSARR
FT                   QLREQLLDRHGTGRVMFRNSRRHVAGFPERHLHVTRLAPPSSYRRELRKLDRDMDYLDD
FT                   LLITTGLDHPEVLLYPDAMYRAQCDASPGDTALNAEPWWQIDPRVTWLLERLTEVGRDK
FT                   MLVIAHDRETASDLSEALRVLGGVQAPVFHEGLTLIERDRAAAAFADEEDGCQVLVCSE
FT                   IGSEGRNFQFCRHLVMFDLPAHPDQLEQRIGRLDRIGQQHAIEIHVPVFEDSPGERLLR
FT                   WYDEGMRAFDAPHGIGSELYDAFGDSVADALLDDDALAEVIADTRRFFESRLAAHEAGR
FT                   DRLLEWNACRPARAQAITEAIRELDDDPALPRYVDKALDVFGVESRDLGGDIQHLLAGP
FT                   HMLDGLPGLVKGEEGFSATFDRQRALARDDVQRLSWEHPLVREMMERILDGTLGNTALA
FT                   LLQHPAIPGGRLMAELVFRTHCPAPRHLNVGRFLPPTAVRLLLDESGANLTQKVSFGGL
FT                   AKNLQKVKKAVARDLIKSRHAQLRDLLTRAEDEAENELPSIIEAAQTHMRDTLDTELAR
FT                   LKALARHNPAVRDAEIEALAHERRELDTAIDATRLRLDAVRVVVTVDPPE"
FT   gene            complement(520122..520922)
FT                   /locus_tag="Csal_0470"
FT   CDS_pept        complement(520122..520922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0470"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57832"
FT                   /db_xref="GOA:Q1R0C6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0C6"
FT                   /protein_id="ABE57832.1"
FT                   /translation="MTAFTLGPLSLPPAHLYAVSAAVALLALGHLVRLPPPRRRLWLTG
FT                   ALLGALLGARLADIALHGEAYREAPLEAVMRWQSGYHPLGALLGAGAWTLGCLRRLPPR
FT                   YLTRASGVLATCAVLWWGLNAWHPLAGEPPPSHLPPLSLNALDGDAVSLETLSTSSPLI
FT                   VVLWRSDCHACRQALARVNAVADQVRVITVNEGQSLLQAARFLDAQDMGFAHNLQDPEQ
FT                   RLQAYFGMPDLPLTVYLDAHGRLRNIRSGPLATATLEAWLAALP"
FT   gene            521112..521360
FT                   /locus_tag="Csal_0471"
FT   CDS_pept        521112..521360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57833"
FT                   /db_xref="GOA:Q1R0C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0C5"
FT                   /protein_id="ABE57833.1"
FT                   /translation="MVNSRHGVDGLRAVAIASQAVGFILIIALETWLGDAARVWQGVTL
FT                   AAMLVAASGVALVRRYRRNRQRRAMDERLRRAEESDP"
FT   gene            complement(521371..521787)
FT                   /locus_tag="Csal_0472"
FT   CDS_pept        complement(521371..521787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57834"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0C4"
FT                   /protein_id="ABE57834.1"
FT                   /translation="MQRLSPEPATLHVAQLAPMLEALQRHLGLTILLHTAHGACLELRH
FT                   ERHDSQVLWLEATPGALPGTLRLEADNAEFERLAPTLMAQGARCLEASRDRPSASRGCA
FT                   WRVLIMPLPGGWQLMLLALDPRRCQPLGLQGLVV"
FT   gene            complement(522085..522161)
FT                   /locus_tag="Csal_R0010"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(522085..522161)
FT                   /locus_tag="Csal_R0010"
FT                   /product="tRNA-Pro"
FT   gene            complement(522244..523257)
FT                   /locus_tag="Csal_0473"
FT   CDS_pept        complement(522244..523257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0473"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57835"
FT                   /db_xref="GOA:Q1R0C3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0C3"
FT                   /protein_id="ABE57835.1"
FT                   /translation="MRRPNPLIATSRPMQPNASPLHAAVADDFAAVDRTILAQLASRVP
FT                   LVETIGRYIIESGGKRLRPLLVLLAARSLNYPGDRHVTLATLIEFMHTSTLLHDDVVDE
FT                   SHLRRGKATANDAWGNAPSVLVGDFLYSRSFQMMVEVGSMRVMEILSGATCVIAEGEVL
FT                   QLTNIGNPDIDEAAYFDTIQGKTAMLFEAASHSGAVLAEATPAQEEALKLYGRYLGLAF
FT                   QLVDDLLDYQGDADAMGKNVGDDLAEGKPTLPLIHAMANGNAEQVSVVRQAIRQGGLDH
FT                   LDEVLAIVHDTGALDYTRRRAEEMADRALAQLELLPESRYRDSMAALAHLAVERQT"
FT   gene            523481..523792
FT                   /locus_tag="Csal_0474"
FT   CDS_pept        523481..523792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0474"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57836"
FT                   /db_xref="GOA:Q1R0C2"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0C2"
FT                   /protein_id="ABE57836.1"
FT                   /translation="MYAVIKSGGKQYRVQEGQTLKLEKLEVATGETLELDQVLLVADDD
FT                   DVKVGAPLVEGAKVTAEVVSHGRGEKVKIIKFRRRKHQMRRQGHRQWFTEVKITGISA"
FT   gene            523825..524082
FT                   /locus_tag="Csal_0475"
FT   CDS_pept        523825..524082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0475"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57837"
FT                   /db_xref="GOA:Q1R0C1"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0C1"
FT                   /protein_id="ABE57837.1"
FT                   /translation="MAHKKAAGSSRNGRDSESKRLGVKLFGGQAATAGNIIVRQRGTKF
FT                   HAGSGVGIGKDHTLFALNDGVIKFETKGPKNRKFVSVVSA"
FT   gene            524167..525354
FT                   /locus_tag="Csal_0476"
FT   CDS_pept        524167..525354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0476"
FT                   /product="GTP1/OBG subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57838"
FT                   /db_xref="GOA:Q1R0C0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0C0"
FT                   /protein_id="ABE57838.1"
FT                   /translation="MQFVDEASIIVEAGKGGNGCLSFRREKYVPKGGPDGGDGGHGGSV
FT                   YLIGDESLNTLIDFKYQRFYKAPNGQPGQGRQMSGRNGEDLHVKVPVGTTVIDEDTLEV
FT                   IADVTEAGQVVLVAQAGRRGLGNIHFKSSTNRAPRKTTPGTEGERRNLRFEMKVMADVG
FT                   LLGVPNAGKSTLIRAVSAAKPKVANYPFTTLVPNLGVVKLGTHEHFVMADVPGLIEGAS
FT                   DGAGLGLRFLKHLTRTRLLLHVVDVAPFDESDPVDSARAIAHELEQFSATLAERPRWLV
FT                   LNKLDLLPEEERPSTVDDIVERLAWSGPVYKISAISGDGTQALVQAAHRWLTEQRQLEA
FT                   EDETAFEHEREMRRRMEDEAVARAEARMSRKRKPAEDDDDDFDEDDYDVEVEYAP"
FT   gene            525380..526516
FT                   /locus_tag="Csal_0477"
FT   CDS_pept        525380..526516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0477"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57839"
FT                   /db_xref="GOA:Q1R0B9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0B9"
FT                   /protein_id="ABE57839.1"
FT                   /translation="MSESQSASRDALRRARRVVVKIGSALLTNDGRGLDADAIGEWVDQ
FT                   IAALHARGIEVVLVSSGAVAEGMARLGWVTRPSAVHELQAAAAVGQSGLSQCYEEHFAR
FT                   HGLRSAQVLLTHDDLSNRKRYLNARSALRSLVALRVVPVINENDTVVTDEIRFGDNDTL
FT                   GALVANLLEADALVLLTDQEGLFDADPRHDPEARLIAEGRADDPALAAVAGDGGALGRG
FT                   GMATKVRAARLAARSGALTAIASGRQPEVLTRLMQGETLGTLLMPDHAPLAARKRWLAG
FT                   QLQVRGTLVLDAGAVKVLREHGSSLLPVGVRRVEGEFKRGDMLVCVDEQGQRIAKGLVN
FT                   YGSDEARRIMGQPSRRIEELLGYMESPELIHRDNLVIV"
FT   gene            526729..526995
FT                   /locus_tag="Csal_0478"
FT   CDS_pept        526729..526995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0478"
FT                   /product="SSU ribosomal protein S20P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57840"
FT                   /db_xref="GOA:Q1R0B8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0B8"
FT                   /protein_id="ABE57840.1"
FT                   /translation="MANTKQAQKRARQAEQRRQHNASQRSMVRTYIKRVIKAIQGGDHA
FT                   QAMTEFKAAQPVIDRIADKDAISKKKAARIKSRLNKRIKALAA"
FT   gene            527096..528688
FT                   /locus_tag="Csal_0479"
FT   CDS_pept        527096..528688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0479"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57841"
FT                   /db_xref="GOA:Q1R0B7"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0B7"
FT                   /protein_id="ABE57841.1"
FT                   /translation="MTARQSQATPEDGESAGPASGGLLRSGLVVSTMTMLSRVLGLARD
FT                   VVIATLFGAGSGADAFFVAFKIPNFMRRLFAEGAFNQAFIPVLSEYATQRTREEVRELL
FT                   DAVAGSLGVVLALISAVAMLIAPWLVWLFAPGFSADPGKLALTADMLRLTFPYLWLISL
FT                   TAFAGSVLNTWNRFAVPAFTPVLLNLSLIGAALGLTPWMQDPSMALAWGVLIAGVVQLG
FT                   FQVPFLARLGLMPRPWPNFRHPGVRRILTLMAPALFAVSVSQINLLLDTVLASLLASGS
FT                   VSWLYYSDRLVELPLGVFGVALGTVILPALSKRHAEQSPEHFAKMLDWALRAVLLIGLP
FT                   AGLALILLAEPLLVSLFHYGAMTDHDIVMAARSLRAYALGLLPFMLIKVLAPGYFARQD
FT                   TKTPVKIGVFAMLANMVFNLLLIWPLAHAGLALATALSACFNAGLLGWGLKRRGVLQFQ
FT                   SGWGRYALTLGGGCMVMGGGLWWLAPEWHVWLDWGVWQRAATLLGLTLGGAVVYFGWLA
FT                   LCGVRLRHFRLRG"
FT   gene            528765..529832
FT                   /locus_tag="Csal_0480"
FT   CDS_pept        528765..529832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0480"
FT                   /product="FMN adenylyltransferase"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57842"
FT                   /db_xref="GOA:Q1R0B6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0B6"
FT                   /protein_id="ABE57842.1"
FT                   /translation="MELIRGLHNLREAGPCVATIGNFDGVHRGHQAILDQLKSRARALG
FT                   LPVAVVVFEPQPREYFAGQQAPPRLSRLRDKVELLAAHGADRILCLPFNAALRRLTADE
FT                   FIERVLIQGLGVKHLVVGDDFRFGCDRAGDFALLQRVGERRGFGVEHTRTFVLDDERVS
FT                   STRVRTLLASGNFAQAARMLGRPYQLTGRVVADRQLGRTIGVPTANLPLAARPLALRGI
FT                   YACVTRLPDGRELTGAANIGWRPTVGSTRPVLEVHLFDFDGDLYGQRLTVVPCARLRGE
FT                   VNFAGLDALTRQIHADLAQARHYFRTATPLDAAALGLPCHSTGWTLPLASAPLAPEPST
FT                   SDSSAGAGPAAQDDG"
FT   gene            529842..532682
FT                   /locus_tag="Csal_0481"
FT   CDS_pept        529842..532682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0481"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57843"
FT                   /db_xref="GOA:Q1R0B5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0B5"
FT                   /protein_id="ABE57843.1"
FT                   /translation="MSDYKHTLNLPETDFPMRGMLPKREPGRVSQWQDMNLYQRLRDAR
FT                   AGREVFVLHDGPPYANGSIHIGHAVNKILKDIVVKSKSLAGYDAPYVPGWDCHGLPIEH
FT                   KVETTHGKHLEADEARGLCREYAGAQIEGQKTDFVRLGVVGDWENPYRTMDFANEAGEI
FT                   RALAKMVEGGYVFKGLKPVNWCFDCGSALAEAEVEYADKKSDAIDVAFAAAEPEALASA
FT                   FGLASLDKPAAIVIWTTTPWTIPANQALNVHPDFTYALVDTGELLLVLAEELVESCLTR
FT                   YGLEGDVVATAAGASLEFITFRHPFYERVAPVYLADYVTVEEGSTGIVHSAPSYGLDDF
FT                   MTCREHGMSFDDMLNPVQGNGVYRDDLPLFGGQMIWKANPHIVDTLREVNALMAHTPIT
FT                   HSYMHCWRHKTPVIYRATAQWFVGMDREDDQGRTLRQRALDGVEATQFIPAWGKARLHS
FT                   MIANRPDWCISRQRNWGVPIPFFMHKQTGEWHPRTVELMEDVARRVEAEGIDAWFRLDA
FT                   RELLGDEADQYDKVTDTLDVWFDSGTTHRHVMRGSHPMGHDQGPRADLYLEGSDQHRGW
FT                   FHSSLLTGCAIDGHAPYKALLTHGFTVDEKGRKMSKSMGNVIAPQQVMDKLGADILRLW
FT                   VASTDYSGEMAVSDEILKRTADVYRRIRNTSRFLLANLNGFAPERDAVAFEDMLALDQW
FT                   VVDRAAQLQARIQGAYAEYRFRDVYQQVHDFCAHELGGFYLDVIKDRQYTTQADSRSRR
FT                   SCQTALYHVVEALVRWVAPILSFTAEEIYEVIPGTRGDSVLLEEYYPHLATLEANAAMG
FT                   REFWSRVLTVKQAVNKCLEDARNAKVVRNSLAAEVTLYADDSLRETLTQLGEELRFVLL
FT                   TSEVHLASLEDAGSAQAEASELEGLKVAVVSSPHAKCERCWHHRADVGTHAADPNLCGR
FT                   CLSNLPEGPGETRRYA"
FT   gene            532800..533345
FT                   /locus_tag="Csal_0482"
FT   CDS_pept        532800..533345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0482"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57844"
FT                   /db_xref="GOA:Q1R0B4"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0B4"
FT                   /protein_id="ABE57844.1"
FT                   /translation="MNDASTSEKIAAAPAMRRPLRWLWLALLVVVLDLGSKFVASAYLV
FT                   YGQPVEVLPVFNLTLLHNTGAAFSFLAEHAGWQRWLFAAIAIGVSIGLTVWLTRLKAHE
FT                   RLSAIAIVLVIGGALGNLYDRLVHGYVVDFLSFHWQDYYFPAFNLADTAITLGAMGLIL
FT                   ASLRDDRRNTTQKETPHE"
FT   gene            533338..533781
FT                   /locus_tag="Csal_0483"
FT   CDS_pept        533338..533781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0483"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57845"
FT                   /db_xref="GOA:Q1R0B3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0B3"
FT                   /protein_id="ABE57845.1"
FT                   /translation="MSDYRIDDGMEVTLHFTVKLEDDTVIDSTREKEAATFQVGDGNLP
FT                   PGFEAPLKGMTGGESGRFTITPEHGFGQHNPQNVQRLPRDQFEDELEVGTVMSFTDPGG
FT                   GELPGVIADIDERHVDVDFNHPLAGRTLIFEVEVIDVRPATTH"
FT   gene            533843..534796
FT                   /locus_tag="Csal_0484"
FT   CDS_pept        533843..534796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0484"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57846"
FT                   /db_xref="GOA:Q1R0B2"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R0B2"
FT                   /protein_id="ABE57846.1"
FT                   /translation="MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHEVVHNRFV
FT                   VDSLRERGAVFVEELHEVPDDVIVIFSAHGVSRAVQQEAERRGLRIFDATCPLVTKVHM
FT                   EVLRYAKRGQECVLIGHAGHPEVEGTMGRYDTSFGGQIYLVEDEADVENLEVNGPERLA
FT                   FVTQTTLSMDDTSRVIDALRAKFPQIDGPRKDDICYATQNRQDAVRGLASESDLVLVVG
FT                   SPNSSNSNRLRELAERTGTPAYLIDTAEQIRPEWLTDVSAIGITAGASAPEVLVQAVIE
FT                   RLQSLGAEAPDELAGQAENITFSMPQELRERVIASE"
FT   gene            534943..535479
FT                   /locus_tag="Csal_0485"
FT   CDS_pept        534943..535479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0485"
FT                   /product="methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57847"
FT                   /db_xref="GOA:Q1R0B1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0B1"
FT                   /protein_id="ABE57847.1"
FT                   /translation="MPHLACRIRRVPNVRGFSLLELLIVLVIFAILASMALPSFQRLQY
FT                   RQQLVSASNELVAALRLARGEAIMREADVTLCASADGASCGGKGWTQGWLLQAASDDDK
FT                   KDTIVVHQALSPRLDIADNPSPPASVSFDELGYPGGGTEWRLSHAALPDGTSRQVCLEV
FT                   TGRAYVAEPGAGCGS"
FT   gene            535479..535898
FT                   /locus_tag="Csal_0486"
FT   CDS_pept        535479..535898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0486"
FT                   /product="methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57848"
FT                   /db_xref="GOA:Q1R0B0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0B0"
FT                   /protein_id="ABE57848.1"
FT                   /translation="MAPPLQSSPHAQRGFGLIEVLVALTILSIGMLGLAAMQLTSLQAA
FT                   RESLDTTIATIMVRDMNERAWAQQDEACKTLLSQWQKDVAQVGGLPSPDGSGEETGNNG
FT                   LYDLKVTWQGREEPNSEEDASPHVHLVAFLPCKGG"
FT   gene            535900..536469
FT                   /locus_tag="Csal_0487"
FT   CDS_pept        535900..536469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0487"
FT                   /product="methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57849"
FT                   /db_xref="GOA:Q1R0A9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A9"
FT                   /protein_id="ABE57849.1"
FT                   /translation="MNHQHRQRGFTLIEMMISMFLGLIILVGTVSAYQAISGLREQRDT
FT                   INTLQNDLLFVHQSMSRAVAMARDIEVTEEGAALTVTPFALPASATPAGCRKSGDSNWT
FT                   WSVDSSQGVTSLDCNGSQILTLATPGVTSVAFDTSGICSAATTPCVRVTLNYAPCRDLQ
FT                   NCTVRTLRYHLSSRYAGQSEGGADAS"
FT   sig_peptide     535900..535998
FT                   /locus_tag="Csal_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.736 at
FT                   residue 33"
FT   gene            536459..538246
FT                   /locus_tag="Csal_0488"
FT   CDS_pept        536459..538246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57850"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A8"
FT                   /protein_id="ABE57850.1"
FT                   /translation="MHPRENGFVLVIGLALLTIATGMVVAGMSLGRYQERQAGHYLRTS
FT                   DAQLGADEAFLHLLRGDMQWARDIRQYVNDQLMPNAENGTTWKPGVDDMSTTPWRDRSA
FT                   LSPSQYTRPMVESVEKLDEDTVRVTFSGSNWVDGNDQNVGFSSFQAEFNVGGGDEAGGA
FT                   YREVLLGCEGVSLSGSGRIDSYDSRKGRYGANLGGGEYNRDGTQGLVSTNADENGNVTL
FT                   SGSSPIYGQVRATGNVTASGSASIHGDIQANGDVVISGGGSSILGNVASRQAVRLTSSG
FT                   RIQGDVAANTEIVTGNWSSRIEGSATAPVVRTTSNRDVTEQVGGSIERASPGVGTVATS
FT                   SCDAFTTREGATIGELADALSPYASSGRLAIGGGNQTYTLTPNGLQVPSDRNNNSVPNP
FT                   ERYRVTRDVTVAGVFPEPTNVLVLDSFSLGGSANFIVDGGDMTLYVKGGIDIGGGASFS
FT                   VAEGSSLKIITSGRFNLPSGLDVASDSPTDDEGNPVLSIYSTYDDGGASGWNAGVNISG
FT                   SSTFKGTIFAPYSTVNVGGSGALFGAVKGRRVEVSGSGDIHYDEALMESSVGTGGGGTD
FT                   GGVGGGDWTLEGLSYGADD"
FT   sig_peptide     536459..536539
FT                   /locus_tag="Csal_0488"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.918 at
FT                   residue 27"
FT   gene            complement(538248..538775)
FT                   /locus_tag="Csal_0489"
FT   CDS_pept        complement(538248..538775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0489"
FT                   /product="methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57851"
FT                   /db_xref="GOA:Q1R0A7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A7"
FT                   /protein_id="ABE57851.1"
FT                   /translation="MNGMQRGMTLLELLVLIVILGLLATQGMPAMGQLLREQRLQAASH
FT                   ALYQTLYYTRSEAIRQGVPVMLVSEENGWEQGWRVFADRDDDGRQGPSEPTLRAGGGLA
FT                   NGLRLRANQPLRRYVRYAPNGYSLRASGSFQIGSFYLCTATATTPARRIVLSRGGRVRI
FT                   ERLPEGDAACAR"
FT   sig_peptide     complement(538677..538775)
FT                   /locus_tag="Csal_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.745 at
FT                   residue 33"
FT   gene            538846..539304
FT                   /locus_tag="Csal_0490"
FT   CDS_pept        538846..539304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0490"
FT                   /product="methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57852"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A6"
FT                   /protein_id="ABE57852.1"
FT                   /translation="MARTHRARRLPRAWHGFSLIEVLVTLFILSFGMLGLAATQAQALQ
FT                   AQRRADNESQAVQRAAAMLERLRIDRRGAVAGKYELPCSDTPATAASQQVRNWLTGLRL
FT                   VLPQAQGCIAVAGDEEVATATVRIMWHAHRDTWEQDDDTREYRLQTRL"
FT   sig_peptide     538846..538977
FT                   /locus_tag="Csal_0490"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.858 at
FT                   residue 44"
FT   gene            539342..540022
FT                   /locus_tag="Csal_0491"
FT   CDS_pept        539342..540022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0491"
FT                   /product="Tfp pilus assembly protein PilW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57853"
FT                   /db_xref="GOA:Q1R0A5"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A5"
FT                   /protein_id="ABE57853.1"
FT                   /translation="MSLVELMVSLAIGMLVLVGVVDLFLAYQHQYRMQTQLAQMQESGR
FT                   FVTDVLTRELRKAGYAPRGLTEAFPATAHFAAKASVTGSNDSIQVRYYGSADGTMQDCL
FT                   GARLGRGDASRARFALREDGGLTCAVDDTPPQPLDALVVDLALRYFVADGWRRAAQVND
FT                   WTKVTGVSAELLVASPQDGLVDTASSYVFDGERVTAPDHRLYRVYTTAVALRNALHPHE
FT                   EGAS"
FT   gene            540019..540645
FT                   /locus_tag="Csal_0492"
FT   CDS_pept        540019..540645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0492"
FT                   /product="Tfp pilus assembly protein PilX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57854"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A4"
FT                   /protein_id="ABE57854.1"
FT                   /translation="MSTVVPLSQRGMTLVIALVLLMAMTALAVSGLQGAVLQERMARNL
FT                   MDRQVAFQAAEAALEEGEWRLRHAAVTLPDAAGECTARDCLAERTQRAVQWSAERWRRD
FT                   GLAYGDSGAPLPAGVSEPPRVTLAVLESRCPESGPSCRVVFGVTAFAWGQRAVTHAVLT
FT                   RRVTLDVARKTAQALAQADAQDADNDATQVVRPAASRAAWRAIMR"
FT   sig_peptide     540019..540105
FT                   /locus_tag="Csal_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 29"
FT   gene            540680..541075
FT                   /locus_tag="Csal_0493"
FT   CDS_pept        540680..541075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0493"
FT                   /product="methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57855"
FT                   /db_xref="GOA:Q1R0A3"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A3"
FT                   /protein_id="ABE57855.1"
FT                   /translation="MRRTRGFTLIELMIVMVIIGILAAIAIPAYTEHVRKAQRADAQAT
FT                   LMQLAYWMERQYTQNSIYDTDATLPESMTGAKDPERVYKFESLPNPDKNKGDGFLLKAT
FT                   RINSQSGDQCGVLKLYDTGQKQPEKCW"
FT   sig_peptide     540680..540760
FT                   /locus_tag="Csal_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.469 at
FT                   residue 27"
FT   gene            541123..542250
FT                   /locus_tag="Csal_0494"
FT   CDS_pept        541123..542250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0494"
FT                   /product="Glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57856"
FT                   /db_xref="GOA:Q1R0A2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A2"
FT                   /protein_id="ABE57856.1"
FT                   /translation="MIDCGFRQPRTSVPVSEFLIVGGGVIGMMTALQLADAGRRVTLLE
FT                   RGECGREASWAGGGIVSPLYPWRYSAPISTLSRYSEGAYPELSLRLLEETGIDPEYRQR
FT                   GLLYLRVDDEERALDWARQEGKPLQRVGPETIYAKEPNAAPGVESALWMPTLGSIRNPR
FT                   LCRALRARLQAMPNVALREHVDVEELVASAGRIQGVRTSAGHETAECVVVCGGAWASQL
FT                   LASVDVALPVRPVRGQMILFKAPPGLVERVVLKDGRYVIPRGDGRVVAGSTLEEVGFDK
FT                   RTTEAAKGSLYDSALSIVPGLADCPVEHHWAGLRPGSPDGVPRIGAVPGVEGLWVNAGH
FT                   YRNGLVLAPASTRLLADQLLQRTPVVDPAPYRLDT"
FT   gene            542359..543990
FT                   /locus_tag="Csal_0495"
FT   CDS_pept        542359..543990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0495"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57857"
FT                   /db_xref="GOA:Q1R0A1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A1"
FT                   /protein_id="ABE57857.1"
FT                   /translation="MQDLTLVMAQLDPLVGDIPGNTAQAIEAVREARIEHRADVVVFPE
FT                   LFLTGYPPEDLLFRESMESRLEQAREQMARKVARDVMVIIGYPGKRDGRLHNLAGVLYD
FT                   GEWLGEYAKQALPNYQVFDEQRYFAPGASPLVIEHRGARLGVLICEDLWDGGPVARSVD
FT                   AGADIVVTLNASPYHRDKPLERERLFAERARAVTRPVVYLNQVGGQDELVFDGGSLVLD
FT                   ASGQVAVRAPFWEVGLMPVRFTDASGGWQPEAGECEPLLSSEESLYCALVTGLRDYVNK
FT                   NRFQGVVLGLSGGIDSALSLAIAVDALGPERVQAVMMPYHYTADISKADAAAQAELLGV
FT                   HYEVMPIAPMVEAFTDTLRESFAGTERDTTEENLQSRCRGVLLMALSNKKGLMVLSTGN
FT                   KSEMAVGYATLYGDMVGGYNALKDVYKTWVYRLAKWRNAQAPAIPERVITRPPSAELAP
FT                   DQADSDSLPAYDELDAILERYIEGDMSAEAIIDAGFASEDVYKVVKLVDRSEYKRRQAP
FT                   VGVRVTVRGFGRDRRYPIVNGWAPGE"
FT   gene            complement(544103..544909)
FT                   /locus_tag="Csal_0496"
FT   CDS_pept        complement(544103..544909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0496"
FT                   /product="competence lipoprotein ComL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57858"
FT                   /db_xref="GOA:Q1R0A0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R0A0"
FT                   /protein_id="ABE57858.1"
FT                   /translation="MRLPSLGTFGALLLSGALLAGCASNEPAPDLQEQELYQQAQSALD
FT                   AGRYSTAVTRLEALDTRYPFGRYAEQAQLELIYAYYQTEDWEQARAAASRFIRLHPDHA
FT                   QVDYAYYMRGLAAYQAGRFSLEGLELIDISKRDLGATRDANVDFGELVRRFPDSPYAAD
FT                   ARQRIVYLRNVLSRHELQVADFYLRKGAYLAAINRGEWVLQHYPQTPATRDALAVMVEG
FT                   YLGLDMRDRARTVLQTLIKNDPDNARLDGNTFEPEHVDAEPLTLND"
FT   sig_peptide     complement(544832..544909)
FT                   /locus_tag="Csal_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.705 at
FT                   residue 26"
FT   gene            544997..545974
FT                   /locus_tag="Csal_0497"
FT   CDS_pept        544997..545974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0497"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57859"
FT                   /db_xref="GOA:Q1R099"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R099"
FT                   /protein_id="ABE57859.1"
FT                   /translation="MEPSIAMADTVQREERVPDTMIGLRLDQAAAELFADFSRERLKAW
FT                   IKSGALTRDGAPARPKDKLFGGERLTLEATLEEDTRFAPQAMALSIVHEDDDVLVIDKP
FT                   AGLVVHPAAGNPDGTLLNALLHHAPGQMQLPRAGIVHRLDKDTTGLMVVAKTLAAHASL
FT                   VEQLQARTVSREYDAVVTGRMTAGGSVDAPIGRHPKDRKRQAVTPSGKPAVTHYRVVER
FT                   FPAHTHVRCRLETGRTHQIRVHMAHRRFPLIGDPVYAGRLKMPAGATDALKDVLRHFPR
FT                   QALHARKLAFVHPGTGETLTFRAPLPDDMLMLLDFLRDAADTPT"
FT   gene            545986..546741
FT                   /locus_tag="Csal_0498"
FT   CDS_pept        545986..546741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0498"
FT                   /product="protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57860"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R098"
FT                   /protein_id="ABE57860.1"
FT                   /translation="MSERPTLILPDWPAPSTVGAFVTTRESGPSQGAFASFNPADHVGD
FT                   DPVTVEACRRRLSAELDDERPLLWLEQVHGANVQQEYRADFAEHAPRADASVAFDTGHA
FT                   CVVLTADCLPVFFCDRQGTRVGVAHAGWRSLAGGVLEASVAALGVAPDDLMAWLGPAIS
FT                   KAQFEVGAEVFDTFVAVQPEAESAFEPSPYRLGHYMADLYRLARLRLERLGVGHIGGGH
FT                   FCTACEPRFYSHRRDDGNTGRMASVIWLR"
FT   gene            546883..549465
FT                   /locus_tag="Csal_0499"
FT   CDS_pept        546883..549465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0499"
FT                   /product="ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57861"
FT                   /db_xref="GOA:Q1R097"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R097"
FT                   /protein_id="ABE57861.1"
FT                   /translation="MRIDRMTSKLQNALAEAQSLAVGRSHNQLDPGHVLMALVEAQESG
FT                   IKGLVQKAGGDTARLRDGLSQYLDGLPSVGQFDGNVTMGQELARLFNFADREAQKRGDQ
FT                   YIASELVVLAALEMKSAISKVLQQAGLDVQSVRSAIDSLRGGSKVDDASAEESREALDK
FT                   YTTDLTQRAGEGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKDKRVLALDMGSLLAGAKYRGEFEERLKAVLGELAKEEGRVILFVDELH
FT                   TMVGAGKAEGAMDAGNMLKPALARGELHCVGATTLDEYRQHIEKDAALERRFQKVLVDE
FT                   PNEEDTVAILRGLKERYEVHHGVDITDGAIIAAAKLSTRYITDRQLPDKAIDLIDEAAS
FT                   RIRMELDSMPEEMDRLDRRLIQLKMEREALKKETDEATKKRLDSLEAQIESLEREYADL
FT                   EEVWKAEKASIQGAAQFKAELEQARIDLEAARRQGDLGRMSELQYGVIPKLEKQIAEAS
FT                   EQETDTAKHQLLRSNVTEEEIAEVVSRWTGIPVSKMLEGERDKLLRMEEALHERVIGQD
FT                   EAVTAVANAVRRSRAGLADPGRPNGSFLFLGPTGVGKTELCKSLASFLFDTEEAMVRID
FT                   MSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVLLLDEVEKAHADVFNILLQ
FT                   VLEDGRLTDGQGRTVDFRNTVIVMTSNLGSDIIQRMGGDDADYGAMRDAVMGVVGDHFR
FT                   PELINRIDEVVVFHALGQEQIQSIAGIQLERLKARLAEREIRLEVSDDALAQLAVVGFD
FT                   PVFGARPLKRAIQSRIENPLAQELLAGNFAAGDTIKVTAEDGHLAFAK"
FT   gene            complement(549562..550899)
FT                   /locus_tag="Csal_0500"
FT   CDS_pept        complement(549562..550899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0500"
FT                   /product="Sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57862"
FT                   /db_xref="GOA:Q1R096"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R096"
FT                   /protein_id="ABE57862.1"
FT                   /translation="MSNILKWSLFVAMAGFLFGFDTAVISGADKPIQTLWGLSDLQHGL
FT                   FIMSMALWGTVIGALFGNWPTDRLGRRPTLLIIGVLYLVSAIGSALATDPLWFSAFRLI
FT                   GGFGVGMSTVAAPAYISEIAPADRRGQLVALYQFNVVFGIFMAYVSNATLGALLDADAW
FT                   RWMVGIEALPALVYTLLVFLVPRSPRWLVLNRNDDVAAAHVLRQIDPEVDTDRQIAEIR
FT                   SADERDQQARSRFFSKRYRLPILLAFLMAFFNQFTGINFVLYYAPRILESAELGSNAAL
FT                   LSTAGIGLIMVLFTMLGIALIDRLGRRTLMYIGSAGYLVSLSIISHAFFTDDLGGALIP
FT                   LQLCVFVAAHGISQGTVIWVFISEIFPNRERARGQSLGSFTHWFFAAAITLVTPWVLGA
FT                   FSGGPVFAFFAVMMVLQVLFVALLMPETKGVSLEDIQKRLTAGTAS"
FT   sig_peptide     complement(550828..550899)
FT                   /locus_tag="Csal_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.368 at
FT                   residue 24"
FT   gene            551389..553146
FT                   /locus_tag="Csal_0501"
FT   CDS_pept        551389..553146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0501"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57863"
FT                   /db_xref="GOA:Q1R095"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R095"
FT                   /protein_id="ABE57863.1"
FT                   /translation="MALAISRGELPVELLSGADMIARFLQDEGVERIYGYPGGAALHIY
FT                   DALFRQDKVKHILVRHEQAATHAADGYARASGKPGTVLVTSGPGATNAVTGIATAYMDS
FT                   IPMVVLCGQVASHLIGEDAFQETDIVGVTRPIVKHSFAIKHPSEIPEVLKKAYYLASTG
FT                   RPGPVVVDIPKDMTAPTERYEYVYPKKVKIRSYNPVTRGHSGQIKKAVDMMLKARRPVF
FT                   YTGGGIVTSGASENLTALVRRLGFPITTTLMGIGAYPQTDAQSLSWLGMHGSYEANMAM
FT                   HHADLIIAIGARFDDRVTNNTSKFCPTAKIVHVDIDPSSISKTVRADVPIVGPADSVIN
FT                   EMISLLQGREMANAEALPEWWATIDGWRAEREGKLYEPSQPGERLKPQEVVEAVYHITR
FT                   GEAFVTTDVGQHQMFAAQYYKFDKPNRWITSGGLGTMGFGFPAAMGIKQNFPDDIVVCF
FT                   TGEGSFQMMMQELSTCKQFGTGVKIINLNNGSLGMVRQWQDLNYKSRHAHSYMESLPDF
FT                   HKLIEAYGFTALKVERHDQLDAALERMFADNDELVFLDVDVDPREHVYPMQVPLGAMRD
FT                   MLLSKTERT"
FT   gene            553146..553637
FT                   /locus_tag="Csal_0502"
FT   CDS_pept        553146..553637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0502"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57864"
FT                   /db_xref="GOA:Q1R094"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R094"
FT                   /protein_id="ABE57864.1"
FT                   /translation="MRHIISILLENEPGALSRVVGLFSQRNFNIETLNVAPTEDPTLSR
FT                   LTVTTVGDDRVIEQITKHLNKLIDVVKLVDLTEGNHIERELMLVKVKALGASRDEVKRT
FT                   VDIFRAQIVDVTPSVYTVQITGDAGKLDAFVQAMAPIGILEVARTGVSGISRGDKVLSL
FT                   "
FT   gene            complement(553711..554592)
FT                   /locus_tag="Csal_0503"
FT   CDS_pept        complement(553711..554592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0503"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57865"
FT                   /db_xref="GOA:Q1R093"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R093"
FT                   /protein_id="ABE57865.1"
FT                   /translation="MDTRPYQQFLSLAETLHFGRSSEACHVSPSTLSRTIRQLETQLGV
FT                   TLFERDNRSVRLTHEGRLFQRYARDALEQWDVLRHSLMAESRQLAGEISIYCSVTASYS
FT                   FLYELLSEFRLRHPRIELKLHTGDPASAVSRVLSGEEDMSITARPETLPAHLAFKPIAT
FT                   SPLLFIAPRDMPQWLATLTATTEAESWGSIPMILSESGLARDRTDAWFRQLGIKPHIYA
FT                   QVAGNEAIVSMVGLGFGVGVVPQIVVDNSPLAERIQVLDVEPGLTPYEVGLCVTEKKLR
FT                   NPLVKALWSQIQ"
FT   gene            554760..555776
FT                   /locus_tag="Csal_0504"
FT   CDS_pept        554760..555776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0504"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57866"
FT                   /db_xref="GOA:Q1R092"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R092"
FT                   /protein_id="ABE57866.1"
FT                   /translation="MRVYYDKDCDLSLIQAKNVTIVGYGSQGHAHAHNLKESGVDVTVA
FT                   LRPGSSSVAKAEAAGFKVASVPDACKTADVLMLLAPDENQKAIYEQDIAPNLKQGATLA
FT                   FAHGFNIHYNQVTPRADLDVIMIAPKAPGHTVRSEFVRGAGVPDLIAVQQDATGQAKEL
FT                   ALSYAAGVGGGRSGIIETTFKDETETDLFGEQAVLCGGAVELVKAGFETLTEAGYEPEM
FT                   AYFECLHELKLIVDLMYEGGIANMNYSISNNAEYGEYVTGPEVINEQSREAMRNALKRI
FT                   QNGEYAKMFISEGNSNYPSMHARRRLNAEHPVEQVGEKLRGMMPWIAANQLVDKSKN"
FT   gene            555932..556756
FT                   /locus_tag="Csal_0505"
FT   CDS_pept        555932..556756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0505"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57867"
FT                   /db_xref="GOA:Q1R091"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R091"
FT                   /protein_id="ABE57867.1"
FT                   /translation="MTQEPRTPESSKDADAENVSAESSELHDEDEIIEETIENGKRVRR
FT                   RGIYLLPNLFTLSALFSGFFSIIAAMNGNFSGAAIAIFVAMVLDGLDGRVARMTNTQSA
FT                   FGAEFDSLADMVSFGVAPALVAFSWILQDVGKIGWIAAFIFVSGAALRLARFNVQIGST
FT                   DKKWFVGLPSPSAAALVAGCVWTLHKFDADALGFKLFIAFVVAAAGVLMVSNVRYHSFK
FT                   EVDFKGPVPFVVLLAIVLAFVVISLEPSLMLLILFGCYVVSGPLFALMRKMR"
FT   gene            557343..558816
FT                   /locus_tag="Csal_R0011"
FT   rRNA            557343..558816
FT                   /locus_tag="Csal_R0011"
FT                   /product="16S ribosomal RNA"
FT   gene            558957..559033
FT                   /locus_tag="Csal_R0012"
FT                   /note="tRNA-Ile2"
FT   tRNA            558957..559033
FT                   /locus_tag="Csal_R0012"
FT                   /product="tRNA-Ile"
FT   gene            559251..559326
FT                   /locus_tag="Csal_R0013"
FT                   /note="tRNA-Ala2"
FT   tRNA            559251..559326
FT                   /locus_tag="Csal_R0013"
FT                   /product="tRNA-Ala"
FT   gene            559506..562402
FT                   /locus_tag="Csal_R0014"
FT   rRNA            559506..562402
FT                   /locus_tag="Csal_R0014"
FT                   /product="23S ribosomal RNA"
FT   gene            562505..562620
FT                   /locus_tag="Csal_R0015"
FT   rRNA            562505..562620
FT                   /locus_tag="Csal_R0015"
FT                   /product="5S ribosomal RNA"
FT   gene            562851..564176
FT                   /locus_tag="Csal_0506"
FT   CDS_pept        562851..564176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0506"
FT                   /product="flagellar hook-associated 2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57868"
FT                   /db_xref="GOA:Q1R090"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R090"
FT                   /protein_id="ABE57868.1"
FT                   /translation="MASIASLGVGSGLDLNGLLDQLQEAEQQKLVPIRQQQADQDAKIS
FT                   AYGQLQGALSKVQSSASNLNDPELFNSVTSDVEGDSVSAAATPDAPPGRYDVDVTQLAT
FT                   ASSIATQGVDEEAVLNAGAEASLDVTLNDGTAQNITVEADSTLSDVRDAINASDSGVSA
FT                   SIVFDGSQSRLAIASESTGAEAGINSVTFNGLDGLALDTATEIQGQDAKLDVNGIAITS
FT                   DSNQVEEAIQGTTLSLSETGQSTVTVERDDGAIRDAITGFVDSYNSMKSTADDLTSFDA
FT                   ESGDAGELLGDGTTRMAETQLRSTLASSVEGDGLNTLSDIGISMNVDGELEVDDEKLDD
FT                   VMANQPGELQALFTGTGDTVGIAGRAEEELDTMLGDNGMVENAVTGAEEQMARLDERYS
FT                   SMQDSISSTVDRYRTQFQELDSMVAEMNQTSSYLTQQLSALG"
FT   gene            complement(564283..565338)
FT                   /locus_tag="Csal_0507"
FT   CDS_pept        complement(564283..565338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0507"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57869"
FT                   /db_xref="GOA:Q1R089"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R089"
FT                   /protein_id="ABE57869.1"
FT                   /translation="MSKFWSPAVRELTPYVPGEQPRERLIKLNTNENPYPPAPGVEQVL
FT                   REFPVDHLRLYPDPSATALREALAETYDVATEQVFVGNGSDEVLALAFQAFFRQSRPLL
FT                   MPAISYSFYPVYCKLYDVAYRSVALDDQWRVPLTAFDTDNGGIVFANPNAPTGHGHSRD
FT                   AIAALLERNTESVVLVDEAYVDFGGESAVPLVERFPNLLVTGTFSKSRSLAGLRLGYAI
FT                   GSRELIEGLERVKDSFNSFPIDRITIDAGIAALHDRAYFEACRERVITTRERTRQRLES
FT                   LGFEVMPSQSNFLFVRHETYEGRAIFGELRERGILVRHFDKEALSDFLRISIGTEDEMD
FT                   SLIEALEAVCR"
FT   gene            565522..566619
FT                   /locus_tag="Csal_0508"
FT   CDS_pept        565522..566619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0508"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57870"
FT                   /db_xref="GOA:Q1R088"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R088"
FT                   /protein_id="ABE57870.1"
FT                   /translation="MAYDRLLSPLTMGKLELPNRVLMAPLTRARTPDMVPKALQATYYA
FT                   QRANAGLIISEATNISPTARGYVYTPGIYTDEQEAGWRGVVDSVHRAGGRIALQLWHVG
FT                   RISHHKIQPGGQPPVAPSALRAEGANCFLEFEDGSSGQHPTSTPRALETEEIPALIDDY
FT                   RQAAKRARRAGFDMVEVHAANAYLLQQFMATGSNKRTDRYGGNLVNRARLVLEVVDAVC
FT                   EVMGADRVGIRISPFIEIFGLSDDESEAMAFYLAEQLTRRGIAYLHVNEPDWTGEGPQL
FT                   TDTFRRELRQRFPGTLIYCGHYTAERAEALIRNGLGDGAAFGRPYIANPDLVERFRRDS
FT                   ALNEPDPATFYGGGAEGYTDYPTLS"
FT   gene            566721..567179
FT                   /locus_tag="Csal_0509"
FT   CDS_pept        566721..567179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57871"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R087"
FT                   /protein_id="ABE57871.1"
FT                   /translation="MQIRTLLAGSAMLAVLAGCATGTTQQETPDASAQAEQATVYNGTL
FT                   PCRSCDGIDLEVQLMGDEQAPASERTFDLRAEYRNHPENPPAEEYEGQWEVIDGAAEDP
FT                   NATVYELTPDGEGQIYYFQKLDANTLELIDPQLRRFQNGETLRLQRQS"
FT   sig_peptide     566721..566789
FT                   /locus_tag="Csal_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.531 at
FT                   residue 23"
FT   gene            567306..568682
FT                   /locus_tag="Csal_0510"
FT   CDS_pept        567306..568682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0510"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57872"
FT                   /db_xref="GOA:Q1R086"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R086"
FT                   /protein_id="ABE57872.1"
FT                   /translation="MAKAKSAFVCTECGAEYSKWQGQCSSCREWNTLSEVRLGSARPHA
FT                   PSPSTTGRSGYAGLVSREVVDLGEVDLTEVPRFSSTFGEFDRVLGGGLVPGSAVLLGGN
FT                   PGAGKSTLLLQTACKLAQSHKVLYVTGEESLSQVAMRAHRLQLPVKGLNMLAETSIETV
FT                   LAVAEREKPAVLIIDSIQTMHLEDISSAPGGVAQVRESSAALTRFAKQSNTVLMLVGHV
FT                   TKDGTLAGPKVLEHMIDASLLLEGGADSRFRTLRGQKNRFGAVNELGVFAMLEHGLKEV
FT                   KNPSAIFLSRAEEQAPGSLVMVVWEGTRPILVEVQALLDESALGNPRRVAVGLDQNRLA
FT                   MLLAVLHKHGGLFTGDQDVFLNVVGGVKVLETSADLAVLLAVVSSLQNRHLPRELVAFG
FT                   EVGLSGEIRPVPSGQERIVEAAKHGFKRAIVPRANAPKQAPEGMEVIAVDKLADALDAL
FT                   "
FT   gene            568737..569774
FT                   /locus_tag="Csal_0511"
FT   CDS_pept        568737..569774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0511"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57873"
FT                   /db_xref="GOA:Q1R085"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R085"
FT                   /protein_id="ABE57873.1"
FT                   /translation="MSAIRLTQYSHGAGCGCKIAPDVLDSILAKAGPGASDKRLIVGNQ
FT                   GREDAAVYDLGDGRGLISTTDFFMPIVDDPFDFGRIAAINAISDVYAMGGTPIMALGIL
FT                   GWPIDTLAAEIAGDVVGGAQSICRELGLALAGGHSIDAPEPIFGLSVNGLVDLEHLKLN
FT                   SHAKPGDLLYLTKPLGVGLLTTAEKRGWLAPGHQELARKTMLKANRIGIELAKVQGVHA
FT                   MTDVTGFGLAGHLSEVCQASGLKARINFAKLPRLAEAEAYRRRGAVPGGTHRNRQALGT
FT                   ALPDMDAAHWQWLCDPQTSGGLLLSVDPAWADDVERIGRQHGLALEAFGEMRPADGASL
FT                   IEVRG"
FT   gene            569771..570856
FT                   /locus_tag="Csal_0512"
FT   CDS_pept        569771..570856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0512"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57874"
FT                   /db_xref="GOA:Q1R084"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R084"
FT                   /protein_id="ABE57874.1"
FT                   /translation="MSLPHLAPEMALLERPLIDVRAPVEFARGALPGAVNLPLMDDAER
FT                   HAVGIRYKEAGQGAAIALGERLVDGDLKARRVAAWRAFAERHPDAVIYCFRGGLRSRIA
FT                   QQWLQEAGITLPRIQGGWKAMRQCVNAEIEAAAARPVLVVAGLTGCAKTELVQSLDVGI
FT                   DLEGHARHKGSAFGRHPLQGPSQIDFEHALGAALSHATHGCVVEDESRMIGQLDIPLSF
FT                   WQTMETAPRIRVEMPLDWRLEQIRKDYIDTLWRTYRDHYGEWLGWSLMRKQLSSALKRV
FT                   RKRLGSARFQRLQRLQALAFREHQRGNTQAHEAWLAPLMLEYYDPMYRYQLEQSPYEAL
FT                   HVGDWESCLAFARDWSAALPR"
FT   gene            complement(570866..571570)
FT                   /locus_tag="Csal_0513"
FT   CDS_pept        complement(570866..571570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0513"
FT                   /product="glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57875"
FT                   /db_xref="GOA:Q1R083"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R083"
FT                   /protein_id="ABE57875.1"
FT                   /translation="MHIYFLQHADFLGPARFADWLTGMGHSHNTCHLYADEAPPGFDNF
FT                   DALIVLDAPFGLHEAPPDWLKRERKLIARVLKSGKPLLGVGVGAQLIAEALGAIVSPGT
FT                   YAERGWQRITLADDSPFDLPEQFEAFLWHRDIFGLPEDALPLGASAASPLQGFAWDGGR
FT                   VLALQCHLEATADAVEARYAHADTLDDPRSTARDTYLQSREAVLENPRRFDRLAPLLDR
FT                   VMVDWMRHARTP"
FT   gene            571635..571931
FT                   /locus_tag="Csal_0514"
FT   CDS_pept        571635..571931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0514"
FT                   /product="O(6)-alkylguanine repair protein YbaZ"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57876"
FT                   /db_xref="GOA:Q1R082"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R082"
FT                   /protein_id="ABE57876.1"
FT                   /translation="MPRAEVLEQIYTIVAQIPEGRVTTYGRVAGMTDAATARMVGSAMR
FT                   HLPSGHGLPWHRVINASRRVTEHTGAVRQHEKLRAEGIVFDARGRVPEDLLWP"
FT   gene            571955..572554
FT                   /locus_tag="Csal_0515"
FT   CDS_pept        571955..572554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0515"
FT                   /product="protein of unknown function DUF416"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57877"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R081"
FT                   /protein_id="ABE57877.1"
FT                   /translation="MTSSAGGFHARLEALPSRGRLAFMAALIERMWPNYALYAEMSGVG
FT                   DPKVLRNVLDLAWEALAVKDAAIDFDKQAEKLAAQEPPESDGSFGARRAVEVVMAMAAL
FT                   LDALRGEAPEAPRDVSRLSRDGVHAYIEMTDGAEDDDAERLAARVREHPLMDDEHGFQE
FT                   AVLECVEAPLTRDALKALRRLGRNEGVSNLGLSADA"
FT   gene            complement(572599..573372)
FT                   /locus_tag="Csal_0516"
FT   CDS_pept        complement(572599..573372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0516"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57878"
FT                   /db_xref="GOA:Q1R080"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R080"
FT                   /protein_id="ABE57878.1"
FT                   /translation="MALAKRIIPCLDVDAGRVVKGVNFVGIRDAGDPVEVAKRYNQQGA
FT                   DEITFLDITASVEDRGTTVEMVERIAGEVFIPLTVGGGIRTCDDIRTMLNAGADKVSIN
FT                   TAAVTHPEFVHEAAERFGSQCIVVAIDAKRVSAEGETPRWEIFTHGGRTPTGLDAVEWA
FT                   RKMVDLGAGELLLTSMDRDGTKAGFDIGVTRAIADAVSVPVIASGGVGDLDHLVAGVKE
FT                   GGADAVLAASIFHFGEYTIPDAKRYMAEHGIEMRL"
FT   gene            complement(573375..574124)
FT                   /locus_tag="Csal_0517"
FT   CDS_pept        complement(573375..574124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0517"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57879"
FT                   /db_xref="GOA:Q1R079"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R079"
FT                   /protein_id="ABE57879.1"
FT                   /translation="MLVIPAIDLKDGQCVRLKQGRMDDSTTYGDDPVAMAARWVETGAR
FT                   RLHLVDLNGAFEGKPVNAEAVTAIARAYPDLPIQIGGGIRTAETIEAYLEAGVSYVIIG
FT                   TQAVKEPAFVGEMCRRFPGHVIVGLDARDGYVATDGWAEVSTLKAVDLAKRFADDGVSS
FT                   IVYTDIARDGMMQGVNIAATAELAREGGLPVIASGGVTHLGDIEALLEVADAGILGAIT
FT                   GRAIYEGKLDVAEAQRLCDAQLATRRS"
FT   gene            complement(574184..574825)
FT                   /locus_tag="Csal_0518"
FT   CDS_pept        complement(574184..574825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0518"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57880"
FT                   /db_xref="GOA:Q1R078"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R078"
FT                   /protein_id="ABE57880.1"
FT                   /translation="MTIAVIDYGMGNLHSVAKALEHVTHENVVITDDSRSIRGASRLVL
FT                   PGQGAIRDCMSELQRNDLQGLVQEILRAQGKPLLGICVGQQMLMEESEENGGVPCLGYL
FT                   PGRVRHFGRDLHDIDGQRLKVPHMGWNRVTQRHAHPLWAGIDDGARFYFVHSYYVEAQE
FT                   DGDVFGTTDYAGLTPHVATGRGPVFAVQFHPEKSAHDGLRLLENFVNWAP"
FT   gene            complement(574852..575445)
FT                   /locus_tag="Csal_0519"
FT   CDS_pept        complement(574852..575445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0519"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57881"
FT                   /db_xref="GOA:Q1R077"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R077"
FT                   /protein_id="ABE57881.1"
FT                   /translation="MAERVATVSRDTHETQIQVHVNLDGQGHFQCETGVAFLDHMLDQV
FT                   ARHGLIDLDIHAKGDLHIDDHHTVEDLGITLGQAVAQAIGDKRGIRRYGHAYVPLDEAL
FT                   SRVVVDFSGRPGLSMDVEFTRASIGRFDTQLFWEFFQGFVNHAQVTLHIDNLKGFNAHH
FT                   QAETIFKAFGRALRMAVEPDPRMAGRMPSTKGSL"
FT   gene            575650..576105
FT                   /locus_tag="Csal_0520"
FT   CDS_pept        575650..576105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57882"
FT                   /db_xref="GOA:Q1R076"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R076"
FT                   /protein_id="ABE57882.1"
FT                   /translation="MPVTLQEIDRAQWETDSQVAQDLARIYRDAPAERLPAPVDRFIEA
FT                   HFAQGGTFCCALFNARRLGAVAVQREKGVWWVSHFCVRAETRHRGVGSRLLMLIAERAR
FT                   DEACTPRVPSTVLMMGDQLLLTRLGYHPAADGAYYEFHSLASEGGRR"
FT   gene            576102..578471
FT                   /locus_tag="Csal_0521"
FT   CDS_pept        576102..578471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0521"
FT                   /product="AsmA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57883"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R075"
FT                   /protein_id="ABE57883.1"
FT                   /translation="MRALLRALLAVVGVLALIVVGAVVYITTFFDPNDLKPRLVEAVRE
FT                   QSGLDLNLEGQLAWSFYPRLGFSVEQAEAWLPEQPHEEAPFAAFERAEVSVAFAPLLSG
FT                   EVAVEGLTLDGMRLNLERDAQGRGNWQVLLDRLENGGDQAERALAPASAGPGLDQNADS
FT                   LPVALDIASVQVRDSLVHYRDAQRGLDLTLSGLSLDGSNVSPDAAFPLQMAFELERQAP
FT                   ALTSDVNFKSRVRLGLSDGRYELNKVTLETSTQWPALSEQAQGLNLQIGHLLAETQRQH
FT                   YRIDDARLNTRLHHPAVDGKPLGLSLGFDGEADLDAQTAQLRDIALSGDDDLDLTGTLS
FT                   FTDLLGAPEYTGQLKLSPLSLRDWLTRFEALPETGDDKALSEVAFTSPVHGDLERINFS
FT                   NLSLLLDGETFTGELGAGFDGQWLSFDLQGERLDLDAYLPPAAASRNEDDAADAEDTAA
FT                   LLETLGVAPAYAAAEGAELLPVEWLSGLTLDGQLALDTMMLKGMTLTDVALRAAGSDGR
FT                   QRLESLTAKLYEGTLDAQGSLDLRQSPLRMAFTESLSNVQIAPLYADATGETSPLRGRL
FT                   NLESDVTSRTNRLESLKRHLNGTASLRIDDGAMLDVNVSKQLCTAAALLDGERSDREWS
FT                   EDTPFDTLSATLDITDGVARNDDLTIRIPGIEMTGAGTFNIPTERFDYDVKARFIDTAD
FT                   QQACRVTSRLQQVSLPVHCEGRLGEAPEEWCRFDREAFQDTLEALAEDKAKREVGEEVD
FT                   EALDKHLDSETARKIDETLGEGASKELGDKLRGLFK"
FT   sig_peptide     576102..576167
FT                   /locus_tag="Csal_0521"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.697 at
FT                   residue 22"
FT   gene            578600..579661
FT                   /locus_tag="Csal_0522"
FT   CDS_pept        578600..579661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0522"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57884"
FT                   /db_xref="GOA:Q1R074"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R074"
FT                   /protein_id="ABE57884.1"
FT                   /translation="MQDIPLTAEAFRQRLFAWFDEHGRKTLPWQFDKTPYRVWVSEIML
FT                   QQTQVATVIPYYQRFMDRFPDVFALAEAPQDEVLHLWTGLGYYARARNLHKAARVVVEE
FT                   HGGEFPVDSVEALSTLPGIGRSTAGAIISISTGRRAPILDGNVKRVLTRLHGVEGWPGR
FT                   PAVERELWVLAERYTPEERLPDYTQAMMDVGATLCTRGKPACLLCPFNDVCVAHARGEE
FT                   TRFPESKPRKTLPERTTRMLVLRDPEGRVFLQQRPASGLWGGLWSLPQFDDEAALRAWL
FT                   DQRFPRAQREADGAAFTHTFSHFRLVITPSPARLHEPFSSVGETGELWYDVQAPASVGL
FT                   AAPVKTLLDQAVT"
FT   gene            579703..579975
FT                   /locus_tag="Csal_0523"
FT   CDS_pept        579703..579975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0523"
FT                   /product="Fe(II) trafficking protein YggX"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57885"
FT                   /db_xref="GOA:Q1R073"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R073"
FT                   /protein_id="ABE57885.1"
FT                   /translation="MSDTVFCRKYQKELDALPFPPLPGAKGQEIQQTVSKQAWDEWQAL
FT                   QTRLINEKHLSLLDPDARAYLMEQMERFLDNRETDQAEGYVPPSQ"
FT   gene            580057..580132
FT                   /locus_tag="Csal_R0016"
FT                   /note="tRNA-Phe1"
FT   tRNA            580057..580132
FT                   /locus_tag="Csal_R0016"
FT                   /product="tRNA-Phe"
FT   gene            580139..580213
FT                   /locus_tag="Csal_R0017"
FT                   /note="tRNA-Gln1"
FT   tRNA            580139..580213
FT                   /locus_tag="Csal_R0017"
FT                   /product="tRNA-Gln"
FT   gene            580235..580310
FT                   /locus_tag="Csal_R0018"
FT                   /note="tRNA-Thr2"
FT   tRNA            580235..580310
FT                   /locus_tag="Csal_R0018"
FT                   /product="tRNA-Thr"
FT   gene            complement(580418..580972)
FT                   /locus_tag="Csal_0524"
FT   CDS_pept        complement(580418..580972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57886"
FT                   /db_xref="GOA:Q1R072"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R072"
FT                   /protein_id="ABE57886.1"
FT                   /translation="MTPRKTNFPLDQCRCHLETGPIVLVGSQWQAERNLIVIGWHMMLG
FT                   FTPAHFGCLITAANHSHRLVRGSRECTINIPTLELIDAVVGVGNSDGDALDKFDAFGLT
FT                   PTPGKIVSAPLVEECYASFECRLVDDSQIDRHELFIWEIVKAHVDTSFDLARTLHYRGH
FT                   GRFMVAGDEVDRSADFRVQNL"
FT   gene            complement(581601..583835)
FT                   /locus_tag="Csal_0525"
FT   CDS_pept        complement(581601..583835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0525"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57887"
FT                   /db_xref="GOA:Q1R071"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R071"
FT                   /protein_id="ABE57887.1"
FT                   /translation="MSNTPKIIYTLTDEAPALATHSLLPIIAAYTSTAGVSVETRDISL
FT                   AGRILAQFPDLLSDEQRVSDDLSELGELAKTPEANIIKLPNISASGPQLKAAIKELQSQ
FT                   GYPLPDYPDEPSSDEEKAIKAAYDKAKGSAVNPVLREGNSDRRAPQSVKNYARKYPHRM
FT                   GEWSADSQSHVAHMSEGDFYGSEQSAVIAQAGKLKIELQQKDGTRTVLKENLAVQEGEV
FT                   VDAARMSSRRLRNFIDSEIKDAKKRGVLFSLHLKATMMKVSDPIMFGMVVEEFYKDVLE
FT                   KHADALKLAGFSPNSGIGDLYSAIQSLPSEQQDAITSDIDALYKERPPMAMVNSHKGIT
FT                   NLHVPSDVIIDASMPAMIRDSGKMWGADDALHDAKAVIPDRCYAGIYQVVIDDCKQNGA
FT                   FDPTTMGSVPNVGLMAQKAEEYGSHDKTFQIPADGTVVVTDENGQQLFSHDVEAGDIWR
FT                   MCQTKDAPIQDWVKLAVTRARDSGSPAVFWLDPQRAHDAQLIKKVESYLEDHDTSGLDI
FT                   RIMAPEDAMRFSLERIRKGEDTISVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMEGG
FT                   GLFETGAGGSAPKHVQQLLEENHLRWDSLGEFLALAASLEHLGKTYGNTKAKVLGKTLD
FT                   QATGKFLDADKSPKRKVGELDNRGSHFYLSLYWSQALAAQDEDAELKEQFTELAKSLEA
FT                   DEAKIVNELNEVQGKPVDIHGYYHPDHELASKAMRPSATLNAALDALMQR"
FT   gene            583983..584387
FT                   /locus_tag="Csal_0526"
FT   CDS_pept        583983..584387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57888"
FT                   /db_xref="GOA:Q1R070"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R070"
FT                   /protein_id="ABE57888.1"
FT                   /translation="MQKMNSVARHGAGDPAVESDYTSAAFVAHMHCRQSFAAAAMGLPV
FT                   AAAVARLSARFRIPNIACEMRHEMTVLIGIGIPLAVLVAVWWCARLALKHLTARDKATR
FT                   ERMAWAIAAVVASLIAVYLWLLLTMPVMPS"
FT   gene            584792..584867
FT                   /locus_tag="Csal_R0019"
FT                   /note="tRNA-Thr3"
FT   tRNA            584792..584867
FT                   /locus_tag="Csal_R0019"
FT                   /product="tRNA-Thr"
FT   gene            585161..585844
FT                   /locus_tag="Csal_0527"
FT   CDS_pept        585161..585844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0527"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57889"
FT                   /db_xref="GOA:Q1R069"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R069"
FT                   /protein_id="ABE57889.1"
FT                   /translation="MDDREHLEAEVSYYDPTRQPASPSRRHFLKTAGASGLAVAAAPAL
FT                   SSVSYAGSPDDPDTQTDAPPAEGARRITLTVNGRRHQLDVAPNVILLDALRHGLQLTGT
FT                   KKGCDHGQCGACTILVNGTSINSCLSLAVTHDGDEITTVEGLEKGGQQHPLQQAFLEHD
FT                   AYQCGYCTAGQMMSALAVLQDDDIGTSDADVREAMSGNICRCGAYKNIVAAIQSARGAV
FT                   QGGKA"
FT   gene            585841..586827
FT                   /locus_tag="Csal_0528"
FT   CDS_pept        585841..586827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0528"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57890"
FT                   /db_xref="GOA:Q1R068"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R068"
FT                   /protein_id="ABE57890.1"
FT                   /translation="MRHFDYARAESPQQAVAAHGSDRDAAFLAGGTTLLDLVKLDVMQP
FT                   QKVVDINGVDLTTIERLDDGRLRIGAMVTNTALARDERVVEDYAVLSQALLAGASTQLR
FT                   NKATTGGNIMQRVRCPYFRDGVSACNKREPGSGCAAIGGVNRTVHAVLGTSDACIATHP
FT                   SDMCVAMAAIGATVEVQGPEGSREIDFGDFHLLPGDTPAREHALEPGELITHVVLEAPI
FT                   HGSRSAYLKLRDRQSYQFALASSAVIVRMDGDIIREARVAMGGVGTKPWRAPEVEAALK
FT                   GRTASEALFADAARLAFEKATAYSQNGYKIPLGQQAIVRNLSDLTAA"
FT   gene            586850..589078
FT                   /locus_tag="Csal_0529"
FT   CDS_pept        586850..589078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0529"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57891"
FT                   /db_xref="GOA:Q1R067"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R067"
FT                   /protein_id="ABE57891.1"
FT                   /translation="MSDKQHSIIGAGVPRIDGPDKLAGRANYAADNLPADMAYGYGVFS
FT                   TIAKGKVARIKVDEAKRMPGVIDIFHHGHFPSLYRTPSSFAQGNKVEETRLPFEDERVY
FT                   YEGQFVALVVADSFENARAAARHVEVEYASESAVANLAQGLDDNGTQAGSGNHSRGDAS
FT                   GAFEDAAASIDVTYHTPVETHNPMEMHASVAYWDAQGNLTIYDASQGVVVERNALSKIF
FT                   AIAPERITVHAPYIGSGFGSKLWTWPHAVATAAVAREVGRPVQLVVPRQQMFTTTGHRP
FT                   ETRQRMRLATDANGRLVSLRHESINTTSFTDQYVETCGSVTKSLYSCPNLTVSHATTQV
FT                   NRGTPTSMRAPGAAPGLFALESAIDEMALAAGVDPVQFRLDNYAERDESQDLDFSSNHI
FT                   VEATNRAAETFGWADRNPRIGSMREGREIIGYGMAACNWEALKRPCDARVSLRADGTAF
FT                   ASCATQDIGTGTYTIVAQAVSDVTGIPIDRITVKLGDSSYPDGPISGGSWATATTLPAI
FT                   AGAARNALDEMKRYATGDNGVFAGASSDELDVVDGGLRNAGGKQASFAEVLDAARYGSA
FT                   DGEAHTEAADSQYSYRSFGAHFVEVRWDPGISHLRVSRVVSAIDVGRVINETTARNQVE
FT                   GAVVMGIGMGLFEATEYDERNGRPVNNDYAEYVVPVHADQPEIDVILLDYPDLAFNEYG
FT                   ARGIGEIGITGLAAAIGNAVHHATGKRIRELPITLDKLMDDVPQAQSA"
FT   gene            complement(589095..589718)
FT                   /locus_tag="Csal_0530"
FT   CDS_pept        complement(589095..589718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57892"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R066"
FT                   /protein_id="ABE57892.1"
FT                   /translation="MPCKRVVAVIMAAGSSRRFGEQDKRRALLAGGETLLNASFARAVE
FT                   AFTHCRVVLRDTETPAHLGLAEHASVIGVAHADRGLGTSLAEAFATLAGDPSLADVQAA
FT                   AILLGDMPAIRADTLRRVQHMADTAHIIRPRHAGRPGHPVLFGRDFWPALTHLDGDSGA
FT                   RRLIHQHPERCRTIDVEDPGILLDVDTPSDLQHLATPAGGGARH"
FT   sig_peptide     complement(589656..589718)
FT                   /locus_tag="Csal_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.737 at
FT                   residue 21"
FT   gene            complement(589708..590679)
FT                   /locus_tag="Csal_0531"
FT   CDS_pept        complement(589708..590679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0531"
FT                   /product="protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57893"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R065"
FT                   /protein_id="ABE57893.1"
FT                   /translation="MQHLDLQVIEKALAWTRAGETVWLCTVLATFGSSPREPGSLFVAR
FT                   GDGRHAGSLSGGCIEEDFLERLRRGDFEAPITTLRYGDGHADGPSVTLPCDGILDVLIE
FT                   RLPATPASLAHLEAVQDVLGGRHPAVRDIDLATGAATLVEDDGNGPRVTCDAHHARVRL
FT                   GPVARLIVAGVSPVAIACAEFACAMGFEVIVCDPREEAWEDVALPGVRTRRELPSTFIA
FT                   SGASHAATAIVALTHDPRLDDLTMIEAVRTPAFYIGVMGSQRTSTARAERLARIGGLSE
FT                   EEIARLHMPIGLALGSRTPAEIALAVMADIVRVRRGKARDAL"
FT   gene            complement(590810..591541)
FT                   /locus_tag="Csal_0532"
FT   CDS_pept        complement(590810..591541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0532"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57894"
FT                   /db_xref="GOA:Q1R064"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R064"
FT                   /protein_id="ABE57894.1"
FT                   /translation="MDFSWLTDPFYQKALWTGFVNTLWLVAVSAVCGFALAVVFAVTRL
FT                   RGPRPLAMLVTGVTTVVRGTPLLVQLFFFYDGVGRLLPEIPGVRESLIWPLLRDPFFYG
FT                   ALTFTLSVGAYTGEVLRGALLSVPEGELAAGRAFGLNRWQILYRLWLPRAIQMCLPTLT
FT                   GELILLLKSVPLVSTIALMDLLKAANMVRDETFLVYEPLLLIAGIYLALTLVLTSVMRL
FT                   IEQRFPGARPAAPRRRRLLPG"
FT   gene            complement(591580..592284)
FT                   /locus_tag="Csal_0533"
FT   CDS_pept        complement(591580..592284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0533"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57895"
FT                   /db_xref="GOA:Q1R063"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R063"
FT                   /protein_id="ABE57895.1"
FT                   /translation="MPSDPTDGLLEWLGPILQGALVTLEIALLAYAIGLGLGLVGATAR
FT                   LSPWRPLRALGTAYSTLVRAIPELLLIILLYYAGSQALNALLAELGGDMHIEISGFVTA
FT                   VGVLAFVQGAYMTEVFRGAIQAIPRGQLEAADAYGFSRPTRFHRIVLPAMLPNALPGMS
FT                   NLWLILVKDTALISVIGFEELFFTAQQAAASTRDYALFYAFAGALYLVMTLGSNALFAR
FT                   AERYVRRGQPST"
FT   gene            complement(592351..593136)
FT                   /locus_tag="Csal_0534"
FT   CDS_pept        complement(592351..593136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0534"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57896"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R062"
FT                   /protein_id="ABE57896.1"
FT                   /translation="MIKQLKATLMQATGIVLLALSATSAMADEPLKIGISAEPYPPFTY
FT                   KDADGSWTGFEVELGQAICAQMDAACEITPTGWSGIFPALNSGKIDMIMNSLSITEKRK
FT                   RVIAFSDPYYFTPSAYVTAKANDMQIPEDLDGKILGVQGSTTNATFARRSLADTGVELK
FT                   VYDQQEQANRDLLAGRVDAILADEIAMTEFVERDSAQDFEIRAIAPRDDAFGNGVGIGL
FT                   RQEDDALRDKLNAAIASVLDNGRCAELSQQYFGTDICGG"
FT   sig_peptide     complement(593053..593136)
FT                   /locus_tag="Csal_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(593216..593983)
FT                   /locus_tag="Csal_0535"
FT   CDS_pept        complement(593216..593983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0535"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57897"
FT                   /db_xref="GOA:Q1R061"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R061"
FT                   /protein_id="ABE57897.1"
FT                   /translation="MANHNNLAIEARHLVKRYAELEVIKDVSLDVREGHVASIIGSSGS
FT                   GKSTLLRCMNLLETPDSGDLTIAGESLAFSPARHHRPDRRQLQRLRTQVSMVFQQFNLW
FT                   PHLSVLGNVIEAPMRVRGLSRRDATSLAEHYLARVGMADKRDQYPAYLSGGQQQRVAIA
FT                   RALAMEPRVLLFDEPTSALDPELVGDVLAVIQSLAEEGRTMLLVTHEMGFARDVSHQVA
FT                   FLHQGCVEEIGTPHDVFENATSERCRQFVSSVA"
FT   gene            complement(594046..595236)
FT                   /locus_tag="Csal_0536"
FT   CDS_pept        complement(594046..595236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0536"
FT                   /product="L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57898"
FT                   /db_xref="GOA:Q1R060"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R060"
FT                   /protein_id="ABE57898.1"
FT                   /translation="MQYSRLTQRIAGEGAAAWDIHYRALARQAEGDDVIILSVGDPDFA
FT                   TPTPIVDSAVDSLRAGATHYADVQGKARLRELIARRHRQTGGAPETRADNVAVMAGAQC
FT                   GLYAVAQCVLDPGDEVIVPEPMYVTYEAALQAAGATLVRVPLRAANDFQPDPAEFAAAV
FT                   TPRTRALLLNSPHNPTGQVLSRDHWEALAALCREHDLWLLSDEVYAELIHDGEHLSPDS
FT                   LAGMRERTAIVNSLSKSHAMTGWRLGWVIGPGPLIQHLTHLALCMLYGSPDFIQDAACE
FT                   ALAHPPAALDEMRRTYRTRRDSVLEALADDDTVEALRPAAGMFMMVDIRRTGLSAQAFA
FT                   DRLLDTHGVSVLAGDAFGPSASGFVRLSLTVDADRLREACQRLARCAAECRTTAEA"
FT   gene            complement(595266..596204)
FT                   /locus_tag="Csal_0537"
FT   CDS_pept        complement(595266..596204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0537"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57899"
FT                   /db_xref="GOA:Q1R059"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R059"
FT                   /protein_id="ABE57899.1"
FT                   /translation="MRRTTTRLMAALALLPLAAHAHATDEATQVSFVAPPWPGVTVKTE
FT                   IMAQILAPLGYTNERQELSSTVGYKTLQTGDSDVFLAGWLPAQQDSYDAAMDDGTIVDL
FT                   GNNVTGARMGFAVPGYVFDAGVTSAEQLDDPENRERFEGRYYSIESGSTVSDFINDAKR
FT                   NDTYGLGDWELLESSTPGMLSAVRSAYDEKRWVAFYGWTPHWMVPEFDMHILDDPEGIY
FT                   GENQGRSDVRTIVAKSFSEANPNLMRLLDQFVLTAEQQSDFIREYGLEERELETVAREW
FT                   LQAHPDELADFLEGVTTRDGEPGLAAVKASL"
FT   sig_peptide     complement(596139..596204)
FT                   /locus_tag="Csal_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.602 at
FT                   residue 22"
FT   gene            complement(596231..597823)
FT                   /locus_tag="Csal_0538"
FT   CDS_pept        complement(596231..597823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0538"
FT                   /product="thiamine pyrophosphate enzyme-like TPP binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57900"
FT                   /db_xref="GOA:Q1R058"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R058"
FT                   /protein_id="ABE57900.1"
FT                   /translation="MTQCAHRLLELLVAHGIETVFGIPGVHTVELYRGLPDSGLRHVTP
FT                   RHEQGAGFMADGYARATGKPAACFIISGPGMTNIATAMGQALADSVPMLVISSVNRRDT
FT                   LGRGQGRLHELPDQQHTLSGVSVFSHTLQTPEALPEVLGRAFAVFKSARPGPVHIEIPL
FT                   DVMALPAPETRPRIAEVFPPTAPDAALAWAADWLADAERPLVLLGGGCVAAGDAVRTLV
FT                   ERLDAPAMTTINAKGVLGCDHPLDLGACASLPAGRELARHADVVLALGTELGETDYDLT
FT                   FDGGFRLDGRLIRVDIDAQQLARNHATDLALLADVGEVALGLLERLPHQASREGAARVA
FT                   DTRAALALRDADDVAPYADFLDTLREALPDATIVGDSTGPVYAGNFIAEMPAPRRWFNA
FT                   ATGYGTLGYGLPAALGAALGVPERPVIALVGDGGLMFTLAEIATAREAGVPLAIVIWNN
FT                   AGYGEIRRYMDAQDVPRLGVDLAAPDFVTLARSMDCHGVRVSTRTALHQALQASRQAPG
FT                   PTLIDVEADRWSA"
FT   gene            complement(597820..598398)
FT                   /locus_tag="Csal_0539"
FT   CDS_pept        complement(597820..598398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0539"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57901"
FT                   /db_xref="GOA:Q1R057"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R057"
FT                   /protein_id="ABE57901.1"
FT                   /translation="MNQATFTRFDESTRADWALIDAHFQHYQNDASRRVLEHLLRLKGD
FT                   THGYPVDRYEHCLQTATRALEAGADEETVICALLHDIGDDLAPANHAEIAAAILEPFID
FT                   PLNVWMIRHHELFQGYHYRAFYGMDPHAREAYRDHPAYARTVRFCDEWDQCAFDPDYPT
FT                   RPLEDFIPMVERVMSRPPFGETTSVEDPA"
FT   gene            complement(598395..599618)
FT                   /locus_tag="Csal_0540"
FT   CDS_pept        complement(598395..599618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0540"
FT                   /product="Gamma-butyrobetaine,2-oxoglutarate dioxygenase"
FT                   /EC_number="1.14.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57902"
FT                   /db_xref="GOA:Q1R056"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R056"
FT                   /protein_id="ABE57902.1"
FT                   /translation="MSWPASQAVTNPCQQWRAPFMFISADVELKDEGRRLILHAAGQRR
FT                   EFAALWLRERAPDDTTLDTRTGQRLIEAAQLPLTLCAETASCEADSLHVRFSDGHATAY
FT                   ALNDLLLDTDADHAEVEPGLRLWDAGLDALPQATFASALEDDGALLAMLEDLHRYGFVK
FT                   VSGVPCEADGMQPLIDRIGPLRRTNWGGIADVKSVANAFDLTMTQRGLEPHTDNPYRDP
FT                   IPGYIWLHCLSNAADGGDSTLTDGFMAAQRLKAEAPEDFACLTRLSPRFRYTDATTDLE
FT                   SEGPLIELDSRGRLARVRYSNRTERIAAHDAALLERYYAARQRFYRLITDEALTVHLKL
FT                   GPGDMLIMDNYRLLHGRTAYQLEGGVRHLRQGYVDRDSTASRRRVLGAQLAGNARPGAS
FT                   HTAQGVNP"
FT   gene            599676..600701
FT                   /locus_tag="Csal_0541"
FT   CDS_pept        599676..600701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0541"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57903"
FT                   /db_xref="GOA:Q1R055"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R055"
FT                   /protein_id="ABE57903.1"
FT                   /translation="MIFAMSELSTTDWPYPRPEQPPVPRPGEAAHTVDVWVVPNFSMLT
FT                   LFCLLEPLRVANRFGRTLFAWRLLSADGEAVVASNGVRIEVDGPLDAHCHGELLMVISS
FT                   YQPEVSVTSAERAVLRHVAAHGGRVGGLDTAPFILARAGLLDHHRVALHWESVPAFRAE
FT                   FPHIAVSEARFEFAGQRLTGSGGAAGIDMMLQWIEHDYGPALANAVGRQLVHQRVSEEE
FT                   AWKAGAARTLEDLPRSVVRALAVMEAHLDQVLPMPEICRLAGQSQRQLTRLFVAHFGET
FT                   PKQCYLGMRLDYARRLLADSRCRVTEAALSSGFVHLAHFSRAYQARFGERPSVTAERGT
FT                   V"
FT   gene            600907..601851
FT                   /locus_tag="Csal_0542"
FT   CDS_pept        600907..601851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0542"
FT                   /product="Ectoine hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57904"
FT                   /db_xref="GOA:Q1R054"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR012774"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R054"
FT                   /protein_id="ABE57904.1"
FT                   /translation="MSVQSAFRHEDVTFGNAFDAYPTRLSDATGSLWQDRKDAVVKGRA
FT                   EDGPLSRDQLARFERDGFLFEPHFLADDEVGELRRELAALLERDDFRGRDFSITEPDSQ
FT                   EIRSLFAVHFLSERFRRLAEDPRLTGRARQIVGGDVYVHQSRINYKPGFHGKGFNWHSD
FT                   FETWHAEDGMPEMHAVSASIVLTDNHHYNGPLMLIPGSHKVFVHCLGETPEDHHKQSLK
FT                   SQEFGVPSHEALRRLIGANGIEAPTGAAGGLLLFDCNTLHGSNANMSPDPRSNAFFVYN
FT                   RRDNACHAPYGAKRPRPSFLAHAPDEVWTPDTH"
FT   gene            601970..602647
FT                   /locus_tag="Csal_0543"
FT   CDS_pept        601970..602647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0543"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57905"
FT                   /db_xref="GOA:Q1R053"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R053"
FT                   /protein_id="ABE57905.1"
FT                   /translation="MSIPAQPFVTRLADGGVFPHMLGKIVCVGRNYAEHARELDNPVPS
FT                   APLLFIKPATSAVPMAHDIAEPFTRGEVHFETELALLIGKRLSGASAEAAQQAVAGLGL
FT                   ALDLTLRDVQSQLKEKGHPWEIAKAFDGACPLSPFVALHEVPDWAALRFTLDIDGERRQ
FT                   TGETRDMLFAIPELLAEMSRHFTLQPGDVVLTGTPAGVGPLPRNARLSLQASFGLEVST
FT                   RTR"
FT   gene            complement(602656..604557)
FT                   /locus_tag="Csal_0544"
FT   CDS_pept        complement(602656..604557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0544"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57906"
FT                   /db_xref="GOA:Q1R052"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R052"
FT                   /protein_id="ABE57906.1"
FT                   /translation="MTSPAVQARRTYNIDQWGSGYFDVDDAGHAVVCPRGDERGGPALP
FT                   LNALVEELRRAGLRLPVLVRFTDILHDRVERLCGAFDSAMHDEAYHGGYTAVYPIKVNQ
FT                   QRRVVEEILATQARGHGRVGLEAGSKPELLAVLALSGDGPSLIVCNGYKDREYVRLALM
FT                   GEKLGHRVYLVVEKHSELTLILEEARRLDVTPRIGLRARLSSVGKGKWQNTGGEKSKFG
FT                   LTASQILDVVERLDAAGALASLQLVHFHLGSQIANIRDIQRGLRECARFYQSLRALGAP
FT                   VDTVDVGGGLGVDYEGTRSRSFCSINYSMHEYASNVVWAFRQICDAENLPHPHLISESG
FT                   RALTAHHAVLITNVIGEERLSDTPPERRLEGDAELDELWRVYAKLDTAQEPRGLAEAYH
FT                   DVVQAIGELQDRFVLGLASLEARAEGEAVYVAACQRLRRRLDPRNRAHREIADELAEKL
FT                   ADKLFVNFSLFQSVPDVWGIDQVFPVLPLTGLDRPPTRRGVIQDITCDSDGRIDCYVDG
FT                   QGLEATLPLPEWQDDEDKLLGLFLVGAYQEILGDLHNLFGDTDAVDATLDADGHWRLSH
FT                   RQHGDTVADVLGYVNFDADELRQRLSRQLQDSALSDTQRDEFMHDLAAGLEGYTYLE"
FT   gene            complement(604651..604986)
FT                   /locus_tag="Csal_0545"
FT   CDS_pept        complement(604651..604986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57907"
FT                   /db_xref="GOA:Q1R051"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R051"
FT                   /protein_id="ABE57907.1"
FT                   /translation="MSTFIRRLTAVSPARNGMSSLLHGMRRAGASLALAFASLALMSQG
FT                   PVIALLVIFALGTGLLGRACRPGDGETLPASESCGGRPWADALNGETLATLGMASAATL
FT                   VVLFLLH"
FT   sig_peptide     complement(604855..604986)
FT                   /locus_tag="Csal_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.856 at
FT                   residue 44"
FT   gene            complement(605080..606045)
FT                   /locus_tag="Csal_0546"
FT   CDS_pept        complement(605080..606045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0546"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57908"
FT                   /db_xref="GOA:Q1R050"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R050"
FT                   /protein_id="ABE57908.1"
FT                   /translation="MAVFTPLTETQVASFLERFDVGALRALEGVPSGTENSTFFVTTDR
FT                   DRFVLTLFEQGESDELPFFVALLDYLAEHRLPVPGPVHDRDGVALQQLAERPALLFPRL
FT                   PGRHPEAPTLAQCHALGDALGRMHKVSQRFEGQRPNPRDLHWLASAQHKVMSYLAADDQ
FT                   RLMGDEIDAYQVAFGDASPLPQGAIHGDLFRDNTLFDGDRLGGIIDFYNGCTGDLLFDL
FT                   AIVVNDWASDADGHLDRERYTALLAAYQARRPLTATERELWPMMLRMTALRYWLSRLLV
FT                   VYVDPPAHDLTPKDPGEYRRLLLTRLAHGAPPLPAPVSST"
FT   gene            complement(606145..606417)
FT                   /locus_tag="Csal_0547"
FT   CDS_pept        complement(606145..606417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57909"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R049"
FT                   /protein_id="ABE57909.1"
FT                   /translation="MQRSRILPPLILGLCLGVIAPPVVAQQPEITVRQDDARTIKEYRV
FT                   NGKLYAIEIMPRDGSDYYLVDDDGDGNFEHSDSADLEVPDWVTGD"
FT   sig_peptide     complement(606340..606417)
FT                   /locus_tag="Csal_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            606583..609369
FT                   /locus_tag="Csal_0548"
FT   CDS_pept        606583..609369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0548"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57910"
FT                   /db_xref="GOA:Q1R048"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R048"
FT                   /protein_id="ABE57910.1"
FT                   /translation="MDADVMANTPPIVLVDGSSYLYRAFHALPPLTTSKGNPTGAVKGV
FT                   LNMLKSLIKQYPQSPMAVVFDAKGKTFRDDIYAEYKAHRPPMPDDLRPQVEPLHDCIRA
FT                   LGLPLLCIEGVEADDVIGTLARQATEAGRDAVISTGDKDMAQLVNAHITLVNTMKGETL
FT                   DVAGVEEKFGIPPSLVIDFLALMGDKVDNIPGVPGVGEKTALGLLQGMQGGLDTIYADL
FT                   ERVTTLSFRGAKTMPKKLEANREQAFLSYQLATIKTDCELPVGLDDLDIAHPDREALKT
FT                   LYTELEFKNWLNELLEGRDEGVDDVGSGDAVDAAQGPVASTAEATSRTDHVIVTREAFD
FT                   AWLARLGEADIFCFDLETTSLNYMEADIVGIGLSLDAGEAAYIPVAHRYLDAPEQLDRA
FT                   SVLAALKPLWEDPAKAKIGQNLKYDISVLARYDIEVAGRLEDTMLASYVLNATATRHDM
FT                   DSLALKYLGEKTISFEEIAGKGAKQLTFDQIALEQAAPYACEDVDITLRLHRELRPRVD
FT                   GEGRLAAVLDDIELPLVPVLSRMERNGVALDAERLHAQSRELEKRLRELETRAYELAGR
FT                   EFNLGSPKQLGEILFDELKIPVIKKTPKGAPSTAEAVLEELALDYPLPKVIIEHRGFAK
FT                   LKSTYTDKLPQLVNATTRRLHTSYHQAVTATGRLSSSDPNLQNIPIRTEEGRKIRQAFV
FT                   ARPGYRIVAADYSQIELRIMAHLSGDKGLLDAFAEGRDIHTATAAEVFGVALDAVSGEQ
FT                   RRSAKAINFGLIYGMSAWGLGRQLHIERNQAQTYIDRYFDRYPGVARFMERIRAQAADD
FT                   GYVETVFGRRLYLPEINAQNRTRRQAAERTAINAPMQGTAADIIKLAMIDVDRWLREGD
FT                   FDAWMVMQVHDELVFEVKEAQVDAFTDAVRQRMEGAAKLDVPLTVEANAGDNWDEAH"
FT   gene            complement(609424..610449)
FT                   /locus_tag="Csal_0549"
FT   CDS_pept        complement(609424..610449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0549"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57911"
FT                   /db_xref="GOA:Q1R047"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R047"
FT                   /protein_id="ABE57911.1"
FT                   /translation="MPQRPLALPATALLAGAIFAGDALAEEVNIYSARHYDSDQALYDA
FT                   FTEKTGIDVNILEGDSDQLIERIRREGAASPADIMLTVDAGRLWRAEQAGVFQGIESDV
FT                   LNERLPDAMRHPEGKWFGFSQRVRAIFYDPDDVDPANLKRYEDLADPRFEGDICIRSSN
FT                   NIYNQSLLASMIAHHGMDDAEAWAQGVVDNMARDPEGGDTDQIRGVASGECDIAVANHY
FT                   YYVRLLESDDASDREAAESVEILLPNQDGRGAHVNVGGAGVVADAPNRDNAIRFLEFLA
FT                   SDEAQRLFAAGNHEFPVVDGVEVDGTLATWGDFKRDALNINALGEHNPEAIRIFDRVGW
FT                   R"
FT   sig_peptide     complement(610372..610449)
FT                   /locus_tag="Csal_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.850 at
FT                   residue 26"
FT   gene            610589..611758
FT                   /locus_tag="Csal_0550"
FT   CDS_pept        610589..611758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0550"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57912"
FT                   /db_xref="GOA:Q1R046"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R046"
FT                   /protein_id="ABE57912.1"
FT                   /translation="MWLPIASSLDVPGPLTMNQPFNASRTCTAASVSPRLDVRRLHHRY
FT                   AEHVAVEEVSLEVMPGEVVCLLGPSGCGKTTVLRLVAGLERLQHGELYLGGEALSTVGG
FT                   RHVPPEKRSVGLAFQEAALFPHLSVLDNVAFGLDGLPASQRRARARHWLDQLGMAARAE
FT                   SYPHQLSGGQQQRVALARALAPSPQLMLLDEPFSSLDARLREQIRDDTLHALKQGEAGT
FT                   LLVTHDPEEAMFMADRIALMREGRVVQWGTPYQLYCQPQDPFVVTFFGAVNEWSGDVRN
FT                   GAVATPAGAVAAPTLAEGARARVMIRPEAIRVTPLAHAASAVETSAPRHARVVMAKLLG
FT                   RSSLLHLAAADGGGGEVHLHAQVPGVFLPDVGTSLALELDASQCFAFPA"
FT   gene            complement(611732..613435)
FT                   /locus_tag="Csal_0551"
FT   CDS_pept        complement(611732..613435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0551"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57913"
FT                   /db_xref="GOA:Q1R045"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R045"
FT                   /protein_id="ABE57913.1"
FT                   /translation="MPLFGSRPAFFFRSRHRRHVDPWTLVTLGVALSVALPVITVLVHV
FT                   LIPSRAIWAHLADTVLTGYLTNTLWLALGVGIGTTVIGTGTAWLIAMCRFPGRRVFEWA
FT                   LLLPLAVPTYVIAYAYTDFLQYAGPLQGELRALFGWGHGDYVFPNIRSLGGATLLITLV
FT                   LYPYVYLLTRAAFLEQSACVLDVGRTLGRGPWRLFTTVAVPLARPAIIGGVSLVLMETL
FT                   NEFGAVQYFGVDTFTTGIYRTWFGMGEPVAAAQLAACLLAFVIIVVALERLSRGRRRYF
FT                   HTTGRYRQLPEFTLRGWHAWGACLACALPIGIGFVLPGVILADLALETGDDVLGARFLD
FT                   YAGNSLMLAALAALVAVGLALVLSYGVRLHPGRTTRTATRIAAMGYAVPGSVVAVGILI
FT                   PLTWVDRHLYAWLNGQLGIETGLILSGTAFVLIYAYVVRFLAVSFNTVEASLAKVTPGM
FT                   DAASRTLGQTAGGTLRRVHTPLMRGSLWAALLLVFVDVMKELPATVILRPFDFDTLAVR
FT                   AHNLAADERLAEAASSSLAIVLVGVIPVILLSRAIRHARPGASGGKREAL"
FT   gene            613630..614682
FT                   /locus_tag="Csal_0552"
FT   CDS_pept        613630..614682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0552"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57914"
FT                   /db_xref="GOA:Q1R044"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R044"
FT                   /protein_id="ABE57914.1"
FT                   /translation="MKIKKRLYTALALVVLVVLALVWGVHWWQTGRFFEETDNAYVHAD
FT                   SVAVRAEVTGRVAEVAVADNQRVAAGDILVKLDPSDAKSQLAQAQASLAVAQANAVSAA
FT                   RQVEQQQAAIEEAQARVTSAQADVEQARLHLERSQRLAEKNYASQQEYQDDQAALQVAE
FT                   ATLAARRATLASSRKQLDVLNAERDSAEANIEAARADLDNARHQLDKTRLRAPVAGVIG
FT                   NKTVEVGTLAQPSLTLMHLVPIRSAYVVANYKETQTARMRSGQPVSLHVDAYPDIAFEG
FT                   VVDSLAPATGSRFSLLPNDNATGNFNKIVQRVPVRIRVTGPEEALGRLRDGLSVVPTVD
FT                   TRDLDPEDDA"
FT   sig_peptide     613630..613704
FT                   /locus_tag="Csal_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.440 at
FT                   residue 25"
FT   gene            614684..616234
FT                   /locus_tag="Csal_0553"
FT   CDS_pept        614684..616234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0553"
FT                   /product="Drug resistance transporter EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57915"
FT                   /db_xref="GOA:Q1R043"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R043"
FT                   /protein_id="ABE57915.1"
FT                   /translation="MAEAVTDTASGPREAPSRRTQLGFVAAVFGMFMAILDIQIVASSL
FT                   NEIQAGVSASADEISWVQTSYLIAEIIMIPLSGMLTRILSTRVAFVVSCLGFTLASLGC
FT                   AMANSIESLIVLRAIQGFMGGAMIPIAYAISFSVFPRRMMGSVQAVMGLVATLAPSVGP
FT                   TVGGYITEFASWHWLFLANAVPGVLVSLAVWRLLDIDRPDRRALRHLDLIGLALLALFL
FT                   GTLEFSLEEGPGDDWFASRTILIAAFVCALASLGFFWRTLRHRHPIVDLRAFANLNFAV
FT                   GAWLGFVVGIGLYGLVYLLPLFLGNVRGYSALQIGEVMIVTGVAMFLTAPLVGRASDKV
FT                   DLRVLLLLGMTLTGIGTIMNANLTAEAGFDAFFWPQVVRGVGLVMCLIPTSRIAFGTLP
FT                   PSEVGNASGLFNVMRNLGGAVGLALLDTIRDWREDYHWNQLIPAIDSGREVVNAAQAQY
FT                   QQLLAATGDPQTASLGMLSRTLLEQAMVMAYNDIFLWLGMLYLLVAPLILLLKRPAHA"
FT   gene            complement(616263..616499)
FT                   /locus_tag="Csal_0554"
FT   CDS_pept        complement(616263..616499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0554"
FT                   /product="SlyX"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57916"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R042"
FT                   /protein_id="ABE57916.1"
FT                   /translation="MTDEATRDRLDALETRLAYQEDWLDTLDRALTAQDRRVAHLERTN
FT                   ALLRERLRDLRQNVETLGDDSAPAPHDEIPPHY"
FT   gene            616687..617154
FT                   /locus_tag="Csal_0555"
FT   CDS_pept        616687..617154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0555"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57917"
FT                   /db_xref="GOA:Q1R041"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R041"
FT                   /protein_id="ABE57917.1"
FT                   /translation="MNRKIFLRCSLISVLLAIPSPLLIALFVTLTGSVLEFSLLLEADG
FT                   LAIAYSATALAVFALLLLGTLCTQMLAPQSTQLAHLAELENDDREIGEVKWFNVNKGYG
FT                   FITRDSGEDVFVHFRAIRGKGHRTLAEGQKVRYHVVENERGLQADDVTVIS"
FT   sig_peptide     616687..616764
FT                   /locus_tag="Csal_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.515 at
FT                   residue 26"
FT   gene            complement(617226..617615)
FT                   /locus_tag="Csal_0556"
FT   CDS_pept        complement(617226..617615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57918"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R040"
FT                   /protein_id="ABE57918.1"
FT                   /translation="MERYPDIEIYLAKTDIEAIQQWLDEHLEAPSPLVKRGKHQWRARA
FT                   RHAASEIPILLVENAADGFASLWFDSPHTPWPRDVDCARAAARTLGCEVRCSLGGWQPG
FT                   DEPDRFWQVRADGEEGAIHWPDQGQ"
FT   gene            complement(617624..618784)
FT                   /locus_tag="Csal_0557"
FT   CDS_pept        complement(617624..618784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0557"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57919"
FT                   /db_xref="GOA:Q1R039"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R039"
FT                   /protein_id="ABE57919.1"
FT                   /translation="MPTTEADTTPASATLALAFDLLRRHSVTPNDAGCQALMIERLERL
FT                   GFQVERLRIGEVDNFWATRGETGPLLVFAGHTDVVPTGPESDWQYPPFTPRIDADGMLC
FT                   GRGAADMKGSLAAMVTAVETFIEAHPDHHGRLGFLITADEEGPAVHGTRAVVEHLREKG
FT                   VAPDYCIVGEPSSSERLGDTLKNGRRGSLGGTLRVKGVQGHVAYPHLARNPVHEAAPAL
FT                   AALAEAQWDAGNAFFPATSFQISNLQAGTGASNVIPGQLEAVFNFRFSTEVTAEALKAR
FT                   TTEILDRFALDYTIDWTLNGEPFLTTEGALIDATVASVEDVLGYRPQLSTGGGTSDGRF
FT                   IATLGAQVIELGPVNATIHKVDERIRAADLETLSRLYATIMQRLFT"
FT   gene            complement(618771..619796)
FT                   /locus_tag="Csal_0558"
FT   CDS_pept        complement(618771..619796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0558"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57920"
FT                   /db_xref="GOA:Q1R038"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019876"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R038"
FT                   /protein_id="ABE57920.1"
FT                   /translation="MLSFALGIGHQNTQGEWLDVYYPTPLLNPDDALVAAAREALAAPA
FT                   GNAAVSFLPEHCQALSSALHQAGAAEQAELAEAFAAAQRPLVAVFLDEDSAPASVPEVY
FT                   LKLHLLSHRLVKPHGVKLDGMFGLLKNIAWTNEGPIDIDELAARRLKARLEGRPLTVDC
FT                   VDKFPKMADYVVPKGVRIGDTARVRLGAYLGEGTTVMHEGFCNFNAGTEGPGMVEGRIS
FT                   AGVTIGKGSDLGGGCSTMGTLSGGGNIVIKVGEGCLIGANAGIGIPLGDRCTVEAGLYV
FT                   TAGAKIAVLDDKGELVQTVSGRDLAGQSDLLLRRNSQNGRIECLTNKSAVALNEALHAH
FT                   N"
FT   gene            complement(619855..620193)
FT                   /locus_tag="Csal_0559"
FT   CDS_pept        complement(619855..620193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57921"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R037"
FT                   /protein_id="ABE57921.1"
FT                   /translation="MITLYGIKTCDSCRKARRALDTQGTAYRYHDLREDGLDAERLDAF
FT                   LARSDWKTLLNTRSTTWRGLDEADKRDLDAASARALLLAHPTLLKRPVLETPDRLLVGF
FT                   QAEAYRAL"
FT   gene            complement(620246..621445)
FT                   /locus_tag="Csal_0560"
FT   CDS_pept        complement(620246..621445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0560"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57922"
FT                   /db_xref="GOA:Q1R036"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R036"
FT                   /protein_id="ABE57922.1"
FT                   /translation="MNPDLDALKPYPFEKLAALKAGVTPSASSPIALSIGEPRHAPPAA
FT                   VLDAMRRFEGEVARYPATAGLPELRDAIARWASRRYALPPGSLDPERHVLPVNGTREAI
FT                   FAFVQAALDRTRPAKVAMPNPFYQIYEGATLLAGGEPVYLDCPPANGCLPDLDAVPADT
FT                   WRDVQLVFVCSPGNPTGAVAPLAEYRKLIALADEHDFIIASDECYSELYLDEHQPPAGL
FT                   LEACATMGRDDYRRCLVFHSLSKRSNLPGLRSGFVAGDAELIAPFKRYRTYHGCAMPLT
FT                   TQQASIVAWGDEQHVRANRDAYRDKFAAVGEILAPVMDFPTPRASFYLWPAVPGGDDEA
FT                   FARDLFAEEHVTVLPGRYMSRAGENGDPGAGRVRLALVAEVEATVEAAYRIRRFIERRA
FT                   "
FT   gene            complement(621566..624241)
FT                   /locus_tag="Csal_0561"
FT   CDS_pept        complement(621566..624241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0561"
FT                   /product="UTP-GlnB (protein PII) uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57923"
FT                   /db_xref="GOA:Q1R035"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R035"
FT                   /protein_id="ABE57923.1"
FT                   /translation="MLLHHYRFVPDETLFDASAFREALAASRTPIRVFKDALRDLQERL
FT                   DARFRAGSDIRDLVHGRAWCLDQLLRIAWERYDWPDDGIALLAVGGYGRGELHPYSDID
FT                   LLLLLERDDDTAYREGLTGFITFLWDIGLEIGHSVRSLADCEREARADLTVITNLLESR
FT                   TLAGPEHLRETMRARLASEAMWPSDAFFEAKWQEQIARHYRYNNSEYHLEPNIKSSPGG
FT                   LRDIQMIGWVAKRHFGELRYEDVVAQGFMNDAELRILSQGQAFLWQVRYALHMLNGRAE
FT                   DRLLFDHQRAIAELFGYRDTPERLAIEQFMKRYYRHVTALAGLNDMLLQHFDEVILRAH
FT                   ETPDITPLNARFEIRGGYIQVRHASVFRQRPGALLELFLLMAQHPEIEGVRAETIRLIR
FT                   DHRHLIDESFRDDLRHQSLFMELLRSGGNIPRQLRRMNRYGILGKYLPEFGQAVGLMQH
FT                   DLFHLYTVDAHTLRLLKFVQRFREPEGHEDFPVAATLVHQLPKLELLWIAGLYHDIGKG
FT                   RGGDHSELGAIDATAFCERHGLSPRDTRLVAWLVEHHLLMSKTAQKRDISDPDVIHEFA
FT                   LAMRDEVHLDYLYVLTVADITATNPSLWNGWRAALLRQLHTETKRALRRGLDHAIDREE
FT                   WARESREEARGLLSTVGIDTASADALWASFGDDYFLQYAPSEIVWQTQGILAHQPSELP
FT                   LILANAPTEDMADGGTKVFIHTRSVNDLFAATAAAMEQLGLSIHDARIATSSNDWTLNT
FT                   FIVLDDDGEPIRDPQRLEEIRHHLVEELDDPADYPRIVTRHTSRQLKHFKVPTRVVIEQ
FT                   DTANARTIVELTAPDRPGLLARVGRIFMEQDIALSAAKIATLGERVEDVFFITDKAGEP
FT                   LTDPERQARLRERLCETLDV"
FT   gene            complement(624288..625079)
FT                   /locus_tag="Csal_0562"
FT   CDS_pept        complement(624288..625079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0562"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57924"
FT                   /db_xref="GOA:Q1R034"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R034"
FT                   /protein_id="ABE57924.1"
FT                   /translation="MNIPIKTADEIEKMREAGRQAASVLEMIAPHVAAGVTTGEIDRLC
FT                   HEYIVNELGSTPAPLNYHGFPNATCTSINHVVCHGIPDMGKKLKKGDIMNLDITVKTAD
FT                   GYHGDSSVMFVIGESIQGGRLSRVTQECLYKSIAEVRPGVRLSELARTIQQHAERHGYS
FT                   VVRDFCGHGIGAGFHEDPQFLHYDGYAPEADAVLAEGMCFTIEPMLNAGDYRTKVLRDG
FT                   WTAVTKDKSLSAQWEHTLLVTANGVEVLTARQDEDFSFLAA"
FT   gene            625440..626180
FT                   /locus_tag="Csal_0563"
FT   CDS_pept        625440..626180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0563"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57925"
FT                   /db_xref="GOA:Q1R033"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R033"
FT                   /protein_id="ABE57925.1"
FT                   /translation="MAQVNMRDLLKAGAHFGHQTRYWNPKMSKYIFGARNKIHIINLEH
FT                   TLPALNDALAVIEKMVASNNKILFVGTKRAASKIVKEEARRAGQPFVNHRWLGGMLTNF
FT                   KTIRVSIKRLRELEAMHEDGTFEKLTKKEVLMATREQDKLERSVGGIKDMGGLPDALFV
FT                   VDVDHERIAINEANKLGIPVIGVVDTNSNPDGVDYVIPGNDDSIRAIQIYAQAVADVCV
FT                   RAKDNSASEFVEVTETNENEAAAE"
FT   gene            626443..627312
FT                   /locus_tag="Csal_0564"
FT   CDS_pept        626443..627312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0564"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57926"
FT                   /db_xref="GOA:Q1R032"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R032"
FT                   /protein_id="ABE57926.1"
FT                   /translation="MAAISASLVKELRERTGLGMMECKKALTEADGDIETAIENLRKNS
FT                   GLKAAKKAERTAAEGGVVTRVAEDGTYGVMLEVNSETDFVARDDNFTAFAEKVVGKVFE
FT                   AKSDDVASLMEGELEEAREQLVQKIGENISVRRAVVVEAPAGGVVGAYVHGGRIGVLTV
FT                   LKGGNAEVAKDVAMHVAAINPSVAHPEDMPQAELDSEKAIILAQPDMAGKPAEIAEKMV
FT                   QGRLKKYLAENSLTEQPFVKDPNQSVAEYVKAAGGEVVGFTRFEVGEGIEKEEVDFAQE
FT                   VMEQARRS"
FT   gene            627440..628201
FT                   /locus_tag="Csal_0565"
FT   CDS_pept        627440..628201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0565"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57927"
FT                   /db_xref="GOA:Q1R031"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R031"
FT                   /protein_id="ABE57927.1"
FT                   /translation="MSAPTDRSATPAERNEKSKYKRILLKLSGEALIGEHEFGIDPKVL
FT                   DRMALEIGQLVGIGVQVGIVIGGGNLFRGAALHAAGMERVTGDHMGMLATVMNGLAMRD
FT                   ALERSNIRSRVMSAIPMSGVVEHYDRRTAIRYLTSGDVVIFSAGTGNPFFTTDSAACLR
FT                   GIEIDANVVLKATKVDGVYDKDPVKHADAAKYERLTYDDVLDQKLGVMDLTAICLVRDH
FT                   DMPVRVFDMTKPGALLNLVVGGKEGTLVDRG"
FT   gene            628206..628763
FT                   /locus_tag="Csal_0566"
FT   CDS_pept        628206..628763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0566"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57928"
FT                   /db_xref="GOA:Q1R030"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R030"
FT                   /protein_id="ABE57928.1"
FT                   /translation="MINDIKKDADARMKKSVEALNANFHKIRTGRAHPSLLDAVTVEYY
FT                   GSEMPLNQVASVNVEDARTLAVVPWEKSMVPKVEKAIMTSDLGLNPAAAGNVIRVPLPP
FT                   LTEETRRNYIKQARGEAENARVAVRNVRRDANGDLKSLLKEKEITEDEERHAIDEIQKL
FT                   TDKYVTEIDKLLETKEHDLLQV"
FT   gene            628815..629573
FT                   /locus_tag="Csal_0567"
FT   CDS_pept        628815..629573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0567"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57929"
FT                   /db_xref="GOA:Q1R029"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R029"
FT                   /protein_id="ABE57929.1"
FT                   /translation="MTSQPFSPSRAGELPRHVAVIMDGNNRWARAHGLSGIRGHRAGVE
FT                   AVRAVIGRAAERGIGTLTLFAFSSENWKRPASEVSALMELFLWALKREVKKLHAHDIRL
FT                   TVIGDRAEFSDAIQQYIARAEALTRDNRGLHLVIAANYGGRWDIAHAARRLAERVACGE
FT                   LSPEAVDEESLGAEVSLADEAPVDLCIRTSGEQRISNFLLWQLAYAEFYFTPELWPDFG
FT                   AEAFDAALDAYGARQRRFGMTQEQIEAHGA"
FT   gene            629563..630366
FT                   /locus_tag="Csal_0568"
FT   CDS_pept        629563..630366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0568"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57930"
FT                   /db_xref="GOA:Q1R028"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R028"
FT                   /protein_id="ABE57930.1"
FT                   /translation="MVLRQRILTALVMAPLALLGLFGLSGAPFALFTGAVLLVGAWEWA
FT                   NLAGFMRQAPRLAFVGFCAAAMALLWGTGIVHQPWPLWLGMLGWLANLYWVVRYPHHNT
FT                   QWQGRTTRLAMGLWVLLPCWVGFVQLRSDGAEWLLFVLLLVWVADIGAYFAGRAFGRRK
FT                   LAVRVSPGKSWEGVYGGMLAVVLLAWGFAQWQGLAAADTLRLMALALPVVLISVLGDLF
FT                   ESMLKRQRGLKDSSHLLPGHGGVLDRIDSLTAAIPLFVLLRPWLG"
FT   sig_peptide     629563..629655
FT                   /locus_tag="Csal_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.303 at
FT                   residue 31"
FT   gene            630408..631580
FT                   /locus_tag="Csal_0569"
FT   CDS_pept        630408..631580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0569"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57931"
FT                   /db_xref="GOA:Q1R027"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R027"
FT                   /protein_id="ABE57931.1"
FT                   /translation="MTVLGATGSIGRSTLDVIGRHPERYRLHALTAHRSRETLRDQCLA
FT                   HRPDIAVLGTEDDAAWLRAALSDAGLDTEVRAGEAALAEVAGSRDSDVVMAAIMGAAGL
FT                   MPTLAAVRAGKRVLLANKEALVMSGALFMDAVDRHGAVLLPIDSEHNAIYQCLPTEHRG
FT                   GLTRHGVTQLLLTASGGPFRGWSQAQLDEVTPEQACAHPNWSMGRKISVDSATLMNKGL
FT                   ELIEACWLFDARPEQIQVVVHPQSVIHSMAAYSDGSVIAQMGNPDMRTPIAHGLAWPER
FT                   IDAGVAPLDLFAVARLDFEAPDESRFPCLRLAREAMAAGGTAPATLNAANEVAVAAFLE
FT                   GRLKFAQIPALVAVVCEACEVQSAHTLEAVLAADATARRVAERELSRFTS"
FT   gene            631621..632976
FT                   /locus_tag="Csal_0570"
FT   CDS_pept        631621..632976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0570"
FT                   /product="site-2 protease, Metallo peptidase, MEROPS family
FT                   M50B"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57932"
FT                   /db_xref="GOA:Q1R026"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R026"
FT                   /protein_id="ABE57932.1"
FT                   /translation="MGVIENLLAVIVVLGLLITFHEFGHFWVARRCGVKVLRFSVGFGK
FT                   PLWSRFDRHGTEFAVAAIPLGGYVKMLDEREGPVAPEEQAHAFNRKSVWARIAIVSAGP
FT                   LANFLLAFVAYWALFIYGTATVAPVIGDVTPDSPAAQGGLQRGQEIVAVQGEPTPSWGE
FT                   VNLKLVAAIGADGTLDVTTRTSEGATPTQHRVPVNDWLVRQNPPQPLASLGVTPWRPEL
FT                   PAVLGEVLDDGRAHQAGLQRGDRIVSVDGVAVDDWMAFVERVRANPETPLTLQVTRDGE
FT                   RREITLTPAVREQEDGSTIGYIGAGVQPSEWPERYRREIRYGPLDAVGEAVAKTGEMSL
FT                   LTLDSIRKMLVGLISPSNLSGPVTIARIAGDSARDGVESFISFLAYLSISLGVLNLLPI
FT                   PVLDGGHLVYYIIEAVRGRPVPEAVQAFGLRVGIALVGSLMLMALYFDLMRL"
FT   gene            633134..635506
FT                   /locus_tag="Csal_0571"
FT   CDS_pept        633134..635506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0571"
FT                   /product="surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57933"
FT                   /db_xref="GOA:Q1R025"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R025"
FT                   /protein_id="ABE57933.1"
FT                   /translation="MSGRTREKRIDCMKIKTIGLAALLLTAAPAALAAPFEISDIRVEG
FT                   LQRVSPASVFNAFPVSAHETVDDRELAEASQQLFDTGLFDDIELLRDGDVLIVNVVERP
FT                   TIASIELDGNSQVSDDDLRKGMTEAGLAEGQVLQRSTLDEVQRELERLYQSQGRYSASI
FT                   DTNVEELDNNRVEVDIDINEGAVAKIQKINFVGNQDFDDETLRDLFALEDKPGWFLGWF
FT                   SDDEYSRDKLSGDLETLRSFYLDRGYVNFDIRSSQVSISPDKSKIFITINVDEGQRYKL
FT                   DEIRFAGDLKIGEDKARELVTATPGEYYSQSAMTESAEALRQRLGAEGFAFAEVDSVPE
FT                   TDAQDGTVDVTFRVEPGRRAYVRRINFVGNTTTQDEVLRREMTQMEGAPASTDQISQSR
FT                   ERLERLGFFRTVDVETRPVADHPDQLDVTYNVEEQPSGSVSASLGYSQSAGVIYGAALS
FT                   QNNFLGTGNRVNVNAQKGDYFTNLNFGFTDPYWTLDGISRGYNVYYRETDYEDFDDIST
FT                   YSSDALGGSINFGYPINELSRLNFGVGVEDLSLETYRDTPAEIIQYTEDEGEDFLNYKL
FT                   TARWTRNNLNRGIMPTAGSYQRLSLEAAVPGSDTQYYKTRYEAQKLFEFRPEWSLKFST
FT                   NLGYADTVGDDAYPFYENFYSGGLGSVRGFSSNTLGPNTTPRNDGDDDTLGGNVLVEGS
FT                   AELIYPFPWVEDRRSLQTSVFFDAGNTYLTECYDVPAGSTSNCSSGVDLGELRYSVGLG
FT                   LSWLTPVGPLTFSVAKPISDEDGDDTQVFQFSLGQTF"
FT   sig_peptide     633134..633235
FT                   /locus_tag="Csal_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            635590..636093
FT                   /locus_tag="Csal_0572"
FT   CDS_pept        635590..636093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0572"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57934"
FT                   /db_xref="GOA:Q1R024"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R024"
FT                   /protein_id="ABE57934.1"
FT                   /translation="MRKLTGALCLGVMSVLSMPAMATEVGVLDWRQALLDSDAAQRSMN
FT                   ELKNQISSQQQRAESLSQELQQLQQKLQQDGAVMSESERTSAQQELRQKGSEFQQLRQQ
FT                   IQRAQQEKEQAFMQSAKPKLDRAIDQVVAQHDLDVIVDRDAVVFSEDGLDVTEEVTRIF
FT                   NSLN"
FT   sig_peptide     635590..635658
FT                   /locus_tag="Csal_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            636141..637184
FT                   /locus_tag="Csal_0573"
FT   CDS_pept        636141..637184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0573"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57935"
FT                   /db_xref="GOA:Q1R023"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R023"
FT                   /protein_id="ABE57935.1"
FT                   /translation="MKTLTPCAFTLGELAERLKARLVGDSDRRVTGLATLLDAGPNDIT
FT                   FLANKTYLKYLPDTRAAAVLVHPAHGTDAPCARLELENPYLGYAELSRLFDPLAGQAPE
FT                   GVHPSAVVAESARIGEHVSVGPQCVIEAGAVIGDGCVIGAGSIVGADSEIGADSRLHAN
FT                   VTVYHGVSVGRRAILHSGCVIGADGFGFAHDGQGWHKIAQLGGVIVGDDVEIGSCSSID
FT                   RGALGDTVIGNDVKIDSQVQIAHNVQIGDHSALAGCVGIAGSTRVGSHCMLGGGVGLSG
FT                   HLTLCDGVQVTGMSLVTNSIHEPGVYSSGTGAMPNGLWRKNAVRFKQLDELAKRLSRLE
FT                   RGASDTP"
FT   gene            637309..637752
FT                   /locus_tag="Csal_0574"
FT   CDS_pept        637309..637752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0574"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57936"
FT                   /db_xref="GOA:Q1R022"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R022"
FT                   /protein_id="ABE57936.1"
FT                   /translation="MVMDINEIREYLPHRYPFLLVDRVTEITLGETIVAYKNVSINEPF
FT                   FNGHFPHHPIMPGVLIIEAMAQACGILGFKTVNKLPADGYVYYLVGSDNVRFKRPVMPG
FT                   DQLRLEANVIRGKRGIWKFACRATVDGELACEAEIICAERKVA"
FT   gene            637749..638516
FT                   /locus_tag="Csal_0575"
FT   CDS_pept        637749..638516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0575"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57937"
FT                   /db_xref="GOA:Q1R021"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R021"
FT                   /protein_id="ABE57937.1"
FT                   /translation="MIHPTALVDPSARVSDDVDIGPFCVIGPEVEIGDGTVIGPHVVIK
FT                   GPTRLGKRNRIFQFASVGEDCQDKKYAGEATRLEMGDDNVVREGVTLHRGTVQDKAVTT
FT                   IGSRNLFMAYSHVGHDCVIGDDCILANQATLAGHVTLGNFAILGGLSAIHQFCHMGEHA
FT                   MAGGGSIITKDVPAYVIVNGNPAQTHGLNLVGLKRRGFERDALRALGDAYRIVYRQGLT
FT                   MEQAIERLENDFAVPEVETFLASLKTSQRGITR"
FT   gene            638529..639689
FT                   /locus_tag="Csal_0576"
FT   CDS_pept        638529..639689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0576"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57938"
FT                   /db_xref="GOA:Q1R020"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R020"
FT                   /protein_id="ABE57938.1"
FT                   /translation="MRIYLVAGELSGDILGAGLMQALKRRHPDAEFRGIGGPRMLAEGM
FT                   QSLYPLETLSVMGLVEVLKHLPGLIKVRRHLRRDALAWQPDVMIGIDAPDFNLGLERQL
FT                   RATGMRTVHYVSPSVWAWRQGRVKTIARSVDAMLTFLPFEAAFYARHQVPVAFVGHPLA
FT                   DELPLVNDRQAARTALGLSSTAPLLAVLPGSRGNEIRFLGPTFLDSAVWLRERVPGLQV
FT                   VIPAASPARRQELEVLLATHPAREFVHLRDGESRQAMTAADAVLLASGTAALEAMLCHR
FT                   PMVVAYKMAAATHWLAKRMVKTEWISLPNLIAQETLVPELVQEDASCEAIGEALLTWLG
FT                   DETHRQATETRFAALHATLQRGASERAAEAIDSLVVHGRLPEEPTA"
FT   gene            639686..640288
FT                   /locus_tag="Csal_0577"
FT   CDS_pept        639686..640288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0577"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57939"
FT                   /db_xref="GOA:Q1R019"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R019"
FT                   /protein_id="ABE57939.1"
FT                   /translation="MTDFPPLVIDYHGSRLAGVDEVGRGPLVGAVVAAAVILDPARPIE
FT                   GLADSKTLSEKRRLALADAIREQAAACAVAEASAEEIDALNIFHATHLAMRRAIDALPV
FT                   TAEYLLVDGNRMPGHHVPGQCVVKGDRRHAAIGAASILAKVTRDAQMVALHERHPEYGF
FT                   ARHKGYPTREHLAALERLGPLEEHRRSFAPVKQWQLL"
FT   gene            640374..643880
FT                   /locus_tag="Csal_0578"
FT   CDS_pept        640374..643880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0578"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57940"
FT                   /db_xref="GOA:Q1R018"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R018"
FT                   /protein_id="ABE57940.1"
FT                   /translation="MTTPFVHLRVHTEYSLVDGLVRLKPLIEATVEGGMPAVAVTDDSN
FT                   LFGLVKTYKAAQGAGLKPVIGADLWMENPHDEEHPYRVTLLAMDNDGYRHLTELISQGW
FT                   SEGQQRGQGILKKEWIFARSAGLIALSGARDGEIGRYLLSEHGQAARELCEGWKAAFPG
FT                   RFYLEVQRTGREHDEECLHLSVALAAETETPVVATNDVRFLTREDYWAHETRVAIGEGK
FT                   ALDDPRRERRYSEEQYLKSPQEMAELFSDLPEALENSVMIAARCNVDVPLGEIFLPEYP
FT                   VPDGMSMDGFFRKISHDGLTERLDKLFSGENPIYPGRDLAEYEPAYRERLDFELNIILE
FT                   MGFPGYFLIVMDFIQWAKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLN
FT                   PERVSMPDFDVDFCMEKRDRVIEYVASRYGRDAVSQIVTFGTMAAKAVVRDVARAQGKP
FT                   YSMGDKLSKLIPFEVGMTLAKAIEQEPALKEYLDSDEESQEIWDMALKLEGITRGTGKH
FT                   AGGVVIAPTKLTDFSPLLCDEDGSGLVVQYDKNDIEEAGLVKFDFLGLRTLTIIDWALE
FT                   MVDTVRAREGQGPLDIASIPLDDVPTFDMLKKAETTAVFQLESRGMKELIKRLQPDSLE
FT                   DMIALVALFRPGPLQSGMVDDFINRKHGRAEVAYPHPDYQHELLKPVLEPTYGIILYQE
FT                   QVMQIAQVLAGYSLGQADMLRRAMGKKKPEEMAKQRAGFMEGCAANGIDKDLAGNLFDL
FT                   VEKFAGYGFNKSHSAAYGLVSYQTAWLKAHYPAPFMAAVLSTEMDNLDKVVPLIEECRN
FT                   QGLTVTPPDVNMGSYKFTVDEQGRVVYGLGAIRGVGEGPIGAIVEAREADGAFSDLFDF
FT                   CRRVDAKRLNKRTLEALIRSGALDNLGPTRAVLMASLEAALKAAAQSTTNANLGMMDMF
FT                   GEAFSEPEAGDAYADYRGVREWTDKERLAGEKDTLGLYLTGHPIDEYESELKRFVSTRI
FT                   VDLKPQRGESQRVAGLVVAMRTMKSKRGDTMAFITLDDRTGRIEASLFGEMFEQVRGKL
FT                   GTDEVLIIEGEVSTDDYSGGLRLRGKEVTPMVDARTRYGEAVELTVDGTRLNGRFARSL
FT                   HDSLTPWCDPQGLPVRVRYRNPEASGVLELGAPWRVAPSDDLLIALREVEGQEAVTLHY
FT                   RG"
FT   gene            644054..645007
FT                   /locus_tag="Csal_0579"
FT   CDS_pept        644054..645007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0579"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57941"
FT                   /db_xref="GOA:Q1R017"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R017"
FT                   /protein_id="ABE57941.1"
FT                   /translation="MNPNYLDFEQPIAELEAKIEELRLVGNDSGISLSDEIGKLEDKNR
FT                   KLTESIFRDLSAWQVSQLSRHPQRPYMLDYVESLFSDFDELHGDRNFADDAAIVGGVAR
FT                   LDDKPVMLIGHQKGRDVKEKVRRNFGMPRPEGYRKACRLMEMAERFKMPVLTFIDTPGA
FT                   YPGIDAEERGQSEAIAYNLAVMSRLRTPIVATVVGEGGSGGALAIGVCDELQMLQYSTY
FT                   SVISPEGCASILWKSAEKASEAAQAMGITAERLKELGFVDTLIKEPLGGAHRNPQKMAG
FT                   HIKDALGASLERLESMEMDDLLSRRYERLMSYGAPQ"
FT   gene            644991..646283
FT                   /locus_tag="Csal_0580"
FT   CDS_pept        644991..646283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0580"
FT                   /product="tRNA(Ile)-lysidine synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57942"
FT                   /db_xref="GOA:Q1R016"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R016"
FT                   /protein_id="ABE57942.1"
FT                   /translation="MARPNNASSSPDALVVDALAMTSPGRCVWVALSGGLDSSLLLTLA
FT                   VAACRRHPRPLYAVHVNHGLQDAAADFEAHARWLCGRLGVPLFVERARVERGARGLEAH
FT                   ARDARLAAFARRVAPGETLLLAQHADDQAETLLLAGLRGSGLRGMAAMPERREWQGRVM
FT                   VRPWLSVTRAALAREAEARGLRWIDDPSNADERFDRNYLRRSVMPALASRWPEAATSLS
FT                   RTAEQLGESDALLEELAGETLQALGGDAACLPVADLLALSRPRQRLLVRHACRQLSLPT
FT                   PPRARLESLLEQLEARGDAQIHVDWPGGEARRWQGHLHLLAPREPVDVDWQAVWDGVTP
FT                   LETPSGPLDWQLVAESPRDVRLTLGRRRGGETLRVAGRGRRDVKRLLQEAGIPPWQRER
FT                   VWLVWEGETLVGVLGIAAAEGWRLRAMPTSG"
FT   gene            complement(646273..647772)
FT                   /locus_tag="Csal_0581"
FT   CDS_pept        complement(646273..647772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0581"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57943"
FT                   /db_xref="GOA:Q1R015"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R015"
FT                   /protein_id="ABE57943.1"
FT                   /translation="MSSRYPAPRRLAAIDLGSNSFHLLVANHYAGQLQVVAKLGEKVQL
FT                   AAGLDEDERLDDDAMQRALDCLERFAPYLSGLAASDVRIVGTNALRAARNRQALIDRAE
FT                   ALIGHPIEIIAGREEARLIYLGAAHALAEVHGRRLIVDIGGGSTELIIGERFEPLALES
FT                   LHMGCVAYTQRFFANGDISEKAFRAAELAALSELANIRRPYQELGWQDPVGSSGTIKAI
FT                   AAVQAASGDAPEGMITRQGLKNLRGRLLKCKKLDKVAMEGLKSDRARVFPAGVAILCAI
FT                   FEAFDLERMRYSDGALREGVLYDLLGRNTTEDSRAAALLTLRRRFDVDARQANNVRATA
FT                   DHLVTQVADHWSLSQEQCQFLAWGAELHEIGLAISHSQFHRHGAYLLENSDLAGFSRPE
FT                   QQALAFLVRAHRRKFPGKELDALPAAARTTYARLARLLRLAVALNHSRPEQPPRDVTLR
FT                   ADGETLYVDLDQASDQPLLSADLEQEALYQRNAGFRLELSR"
FT   gene            647882..648211
FT                   /locus_tag="Csal_0582"
FT   CDS_pept        647882..648211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0582"
FT                   /product="thioredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57944"
FT                   /db_xref="GOA:Q1R014"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R014"
FT                   /protein_id="ABE57944.1"
FT                   /translation="MSERLIEVTDDTFEERVLEPQTPVLVAFVAAWCAPCRELRSRLSA
FT                   LAAARDALQVALCDVDLNPATADKYGVRGMPTLVLFVGASMESSRVGALSTTQLEGWLD
FT                   AQLTS"
FT   gene            648257..648523
FT                   /locus_tag="Csal_0583"
FT   CDS_pept        648257..648523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57945"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R013"
FT                   /protein_id="ABE57945.1"
FT                   /translation="MRLPVGLTTIGLFACSECFLTVTRQRRRGPSSRQIAPSILVSPSL
FT                   PSGAGHGVRRREPISQCHFFAYPSRGDALMHECDEWKGFPGAL"
FT   gene            648610..649869
FT                   /locus_tag="Csal_0584"
FT   CDS_pept        648610..649869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0584"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57946"
FT                   /db_xref="GOA:Q1R012"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R012"
FT                   /protein_id="ABE57946.1"
FT                   /translation="MNLTELKQKTVPELLDIAREMGIDNLARSRKQDIIFAILKKHAKS
FT                   GEDIYGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRKGDSIAGKIRPP
FT                   KEGERYFALLKVNEINFDRPENAKHKILFENLTPLFPQERMVMEIGNGSTEDLTSRVID
FT                   LTSPIGKGQRGLIVSPPKAGKTLMLQNIATSITRNNPECHLIVLLIDERPEEVTEMSRT
FT                   VRGEVVASTFDEPPARHVQVAEMVIEKAKRLVEHKRDVVVLLDSITRLARAYNTVVPSS
FT                   GKVLTGGVDAHALEKPKRFFGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGN
FT                   MEAHLDRKLAEKRVYPALNIRRSGTRREDLIASEEEMQRMWILRKLLNPMDDVAATEFL
FT                   IDRLKDTKTNIEFFEAMKRR"
FT   gene            650129..651697
FT                   /locus_tag="Csal_0585"
FT   CDS_pept        650129..651697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0585"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57947"
FT                   /db_xref="GOA:Q1R011"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R011"
FT                   /protein_id="ABE57947.1"
FT                   /translation="MLCCPFSRSGTENHMKYRDLRDFIAALEARGELTRVTAEVDPYLE
FT                   ITEICDRTLRAGGPALLFENVKGHAMPLLGNLFGTPERVALGMGQDSTAALREVGELLA
FT                   FLKEPEPPKGFRDAWEKLPIFKQAMSMGPKTLRKAPCQEVILEGDDVDLDRLPIQHCWP
FT                   GDVAPLVTWSLVVTKGPNKTRQNLGIYRQQKLGKNRLIMRWLSHRGGALDFQEWQSAHP
FT                   GEPFPVAVALGADPATILGAVTPVPDNLSEYAFAGLLRGSRTELVKCGHADLEVPASSE
FT                   IVLEGYIYPDDTAPEGPYGDHTGYYNEVETFPVFTVERITHRRDPIYHSTYTGRPPDEP
FT                   AILGLALNEVFVPILRKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSF
FT                   LRQFMYTKFVIVLDDDVDARNWEDVIWAITTRMDPARDTVMVENTPIDYLDFASPTAGL
FT                   GSKMGLDATTKWAGETQREWGTPIVMDEAVKRRVDERWGEYGIATPPPPPRHSPPSDER
FT                   GHDDV"
FT   gene            651687..652499
FT                   /locus_tag="Csal_0586"
FT   CDS_pept        651687..652499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0586"
FT                   /product="oxidoreductase FAD/NAD(P)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57948"
FT                   /db_xref="GOA:Q1R010"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R010"
FT                   /protein_id="ABE57948.1"
FT                   /translation="MTSKTLTCQVTSVEDLTPDVFRVHLTGRREAIAHAPGQYLELKLD
FT                   EQTWVPFSIANAHADDGVIELHVQHWPERSNSARLRELLVHAARLTVRLPNGGCVLDTR
FT                   SRRPLTLIAAGTGFAQMKAIVEAALANDHPGPIRLWWAVKSPRDLYLESLALEWAATHP
FT                   HLDVHTVVEDSEPALSAPAGVTRHIGRIDEVLAECHGDISGDDVYLSGSPGMVYACIDT
FT                   LAPLGLDPERVFSDVFAYAPRVPLIPLPEEVSEKAPLSPGERRAEDDA"
FT   gene            652496..653209
FT                   /locus_tag="Csal_0587"
FT   CDS_pept        652496..653209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0587"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57949"
FT                   /db_xref="GOA:Q1R009"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R009"
FT                   /protein_id="ABE57949.1"
FT                   /translation="MSQSPILVTGGAQRLGRHCVERLLDDGQPVILSYRREREALDALR
FT                   QRGAVTLQADFSSEAGILDFIARLKAQTSSLRAIVHNASDWAPDSLGDDAGANFERLFR
FT                   VHMQAPYLINLHARELLDACQEPQRDIIHMTDYVSQKGSRKHAAYAATKAGLDNLTLSF
FT                   AAMYAPSIQVNAIAPALIMLNEGDDEAYAEKAKAKSLMAKVPGPGVIYQTLRYLLDNDF
FT                   VTGAILPVDGGRHLR"
FT   gene            653719..654789
FT                   /locus_tag="Csal_0588"
FT   CDS_pept        653719..654789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0588"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57950"
FT                   /db_xref="GOA:Q1R008"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R008"
FT                   /protein_id="ABE57950.1"
FT                   /translation="MNAPLTMPQHPDATASPSHHPLPTPGELKQRIPLAPALEARIAQQ
FT                   RDAVQAVLDGRDDRLLVVVGPCSIHDPQAALAYAEKLSELAARLDDRLLMVMRVYIEKP
FT                   RTTVGWKGLAYDPHLDGSDDMAHGLEVSRRLMRDIAALGMPVATELLHPMTAPYLEDLL
FT                   SWVAIGARTTESQVHRELASGLQAAVGFKNGTDGSVDVAIAAMQSAAHPHRHFAIDDAG
FT                   RPAMRETRGNPHTHVVLRGGHGKPNYDAASMRACRLDLQAAGITPRLMVDCSHANSRKD
FT                   HRRQTEVMLDVLEQRLAGNHDVIGVMLESYLHEGKQPLKLGALRYGVSVTDACLGWEAT
FT                   EHLLTLAAERLGGVAR"
FT   gene            654895..657045
FT                   /locus_tag="Csal_0589"
FT   CDS_pept        654895..657045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0589"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57951"
FT                   /db_xref="GOA:Q1R007"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R007"
FT                   /protein_id="ABE57951.1"
FT                   /translation="MSKEIETQRNFNPGTNEPFSSVLARHVSRRDIMRGGLSLAALGML
FT                   GGIGGLNLANAQESGSGKTPLALAFESLRGSRTDAVVVPEGYTAQVLVPWGTPLNGAAA
FT                   EWKHDMRMTAEAQAERVGMHHDGMHAFALDADNASRDFLLALNNEYIDQAALWAPQGGP
FT                   TNADSGRRPADEVRTEINAHGITLVRVRKDAEGRWTHVPDDARNRRFTSATPMELAGPV
FT                   AGSDYVRTRYSPEGTHTRGTNNNCANGYTPWGTYLTCEENWPEVFVNTGERHADDARLG
FT                   LPTERGRYGWETAAGSEGERDDEFARFDVTPRGNGPRDDYRNETRTFGYIVEIDPYDGQ
FT                   SRAVKRTALGRFRHEGCWPGKLVAGEPVVFYSGHDARNEYIYKFVSDAKWDPADANRPG
FT                   EAYDRLALGAKYMDEGTLYVARFDADGGGEWLALEPDTRVADGRTLAEALSLAEDDRAG
FT                   VIVHTCDAADLLGATPMDRPEWGTVDPSSGEVYMTLTNNSRRTEADSAPTFTNEGDAIE
FT                   AAGVGYATAPANAANPRADNEAGQVIRWRERGDDATRFDWEVFVFGAAADDADNLSGLT
FT                   ERNQFASPDGLWYDDRGDGQGILWIETDNGYDGVAEQTNDQVLAVVPAALSRESGQASV
FT                   VGAANQQQLKRFAVGPNDCEVTGIFATPDKTALFINIQHPGNWPADPDAVTQDATKVAA
FT                   GSVRPRAATVVIQKADGGQIGV"
FT   gene            complement(657146..659347)
FT                   /locus_tag="Csal_0590"
FT   CDS_pept        complement(657146..659347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0590"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57952"
FT                   /db_xref="GOA:Q1R006"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R006"
FT                   /protein_id="ABE57952.1"
FT                   /translation="MDDTRSSDVPIGTENAASQDTGEAPPLRVNRTRTGIHAKPTPSPE
FT                   ADLDDPSLYFNRELSHLQFNIRVLEQALDPSHPLLNRLMFLLIFSSNLDEFFEIRVAGL
FT                   KHQIALSREESGADGLPPRQVLAEISRITHEQVERQYHILNETLIPALEEQGLRFRRRT
FT                   QWTEAQAAWVREYFAEEIMPVISPIGLDPSHPFPRLVNKSLNFIVELEGTDAFGREGGM
FT                   AILPAPRSLPRLMRLPSELCESGYTEYVFLSSMIHAHAQEVFPGMEVRGCYQFRLTRNA
FT                   DLAVDPEDVSDLASALRGELLARRYGSGVRLEVADNCPDQLSRFLLTQFELDEADLYRV
FT                   SGPVNLTRLMSVLSDVDRPDLLYRTFTPGLPRQVKSDVSLFTQIAQSDILLHHPFQSFS
FT                   LIEDWLQEAADDPDVLAIKQTLYRTGADSPIVGALVNAARNGKEVTVVIELRARFDEAD
FT                   NLALASRLQEAGAIVIYGVMAYKTHAKMLHVVRRERGALRYYAHLGTGNYHSKTAKLYT
FT                   DYSLLTANETLCEDVHMVFQQLSGMGKPRQIDTLLHAPFVLHDRLVAMIDREARQAEKG
FT                   HKAQLIIKCNSLTEPQLIRALYRASRAGVQCDLIIRGMCCLRPGVEGVSENIRVRSIIG
FT                   RFLEHTRVFHFHNGGKPETWCSSADFMERNMFRRVETCFPLLDKKIAQRVRKDLATYLV
FT                   DNCQSWELLSDGRYQLLDAGDAEPISAQETLLYAYAAKS"
FT   gene            complement(659486..660253)
FT                   /locus_tag="Csal_0591"
FT   CDS_pept        complement(659486..660253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0591"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57953"
FT                   /db_xref="GOA:Q1R005"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R005"
FT                   /protein_id="ABE57953.1"
FT                   /translation="MSETPPREPEQQPQAPLIEHLIELRSRLVKAVVLILAIFAALYAF
FT                   SNDIYSFVADPLMALLPAGSQMIATEVASPFLAPFKLTLFAALFIAVPFVLYQAWAFVA
FT                   PGLYRHEKALAFPLLASSILLFYAGVAFAYFVVFPLLFDFFVHTGPENVAVMTDINQYL
FT                   NFVLKLFFAFGAAFEIPIATFLMIWTGATSVESLSKKRPYVIVGCFVIGMMMTPPDVVS
FT                   QSLLAIPMWLLFEVGILFGRLVRRRRHDPEADT"
FT   gene            complement(660250..660669)
FT                   /locus_tag="Csal_0592"
FT   CDS_pept        complement(660250..660669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0592"
FT                   /product="Sec-independent protein translocase TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57954"
FT                   /db_xref="GOA:Q1R004"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R004"
FT                   /protein_id="ABE57954.1"
FT                   /translation="MFDMGFLELMLIGVVALLVLGPERLPTAARTVGLWVGKIKRTVSG
FT                   MQREISAQLEAEELRQKLNEQQRKLDAGLGKVRDEVERHGDAPSSRGGQPPPSRTTPTA
FT                   ARSADDTDETPPSTAASRETPEPPAAPSAKDSNAP"
FT   gene            complement(660676..660948)
FT                   /locus_tag="Csal_0593"
FT   CDS_pept        complement(660676..660948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0593"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57955"
FT                   /db_xref="GOA:Q1R003"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R003"
FT                   /protein_id="ABE57955.1"
FT                   /translation="MLGGISIWQLLIVLGIVILIFGTKKLRNLGSDLGGAVKGFKSAVG
FT                   EEEQKKQDGEETAQHRVAHDTNEEPLDTSSKATQSSGADEKSERK"
FT   gene            complement(660986..661324)
FT                   /locus_tag="Csal_0594"
FT   CDS_pept        complement(660986..661324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0594"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57956"
FT                   /db_xref="GOA:Q1R002"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1R002"
FT                   /protein_id="ABE57956.1"
FT                   /translation="MSDTLAQLADVLAARRHADPESSYVAKLHAKGLNKILEKVGEEAT
FT                   ETLLAAKDAEHGDDATRQAVVAETADLWFHSLVMLSHLDIDHQAVLDELARRFGVSGLD
FT                   EKAARQSR"
FT   gene            complement(661396..663018)
FT                   /locus_tag="Csal_0595"
FT   CDS_pept        complement(661396..663018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0595"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57957"
FT                   /db_xref="GOA:Q1R001"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R001"
FT                   /protein_id="ABE57957.1"
FT                   /translation="MSLRLFRIAWVVARFRLDTLIPVERLPGVLRFSMKLSPLRLLPTG
FT                   PHTRGKRLRLALEALGPIFVKFGQMLSTRRDLLPPDIADELKRLQDQVPPFPGDQACAL
FT                   VEEELGVDIDVAFAEFTRDPLASASIAQVHGARLHSGEDVVVKIIRPNIDGVMRKDIGL
FT                   LYTFAHLLKRVPEARRLRPVEVVADYEATLFDELDLHKEAANTSQLKRNFRDSPLLYAP
FT                   SIHWPLTRKRVMVQERIHGIPVADLEALTAAGIDLRRLAERGVEIFFTQVFRDNFFHAD
FT                   MHPGNIFVSAENPHDPQYIAIDCGIVGSLTREDQDYLARNLLAFFRQDYYEVAVLHIES
FT                   GWVGEDTRANEFAAAIRAVCEPILEKPLKDISFGQVLLGLFQTARRFNMEVQPQLVLLQ
FT                   KTLLNIEGLGRQLYPDLDLWSTAKPYLERWMKERAGPRGFWDALTKHAPELSRQLPELP
FT                   VLAHQALARSEDSHRQHRQQTETLNALRRRLRGTGARARRLRFGALLLALALAWQPLWE
FT                   WSQSQPWPVLAAAALGLLLIAWR"
FT   gene            complement(663015..663665)
FT                   /locus_tag="Csal_0596"
FT   CDS_pept        complement(663015..663665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0596"
FT                   /product="protein of unknown function DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57958"
FT                   /db_xref="GOA:Q1R000"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q1R000"
FT                   /protein_id="ABE57958.1"
FT                   /translation="MPVMFSALLASAETLINGLLAHDPASPARLAQLAGQRLSLRLERP
FT                   SLAVLVHFDTHGVTLLAQHEPEEADSDVVVELDVETLGALLGGERVESLLFAGRLSVRG
FT                   RTHVLERASDLLSDLEIDWEGELARWLGDMPAHSLSQGLRRLNRFGLRTRDELRRDVHE
FT                   YLIEEARLLPSRTQWDIAREHLTQLELATDRVEARLARLVREIECRRQEEHAS"
FT   gene            complement(663673..664419)
FT                   /locus_tag="Csal_0597"
FT   CDS_pept        complement(663673..664419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0597"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone
FT                   methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57959"
FT                   /db_xref="GOA:Q1QZZ9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZZ9"
FT                   /protein_id="ABE57959.1"
FT                   /translation="MDKRTTHFGYQEVPVDEKADRVAQVFHSVAARYDVMNDLMSFGVH
FT                   RVWKRLTLERAGVRPGHHVLDIAGGTGDLALKFSRLVGSRGRVVLADINGSMLRVGRDK
FT                   LLDNGVGDNVEYVQANAEALPFADNSFDCITIAFGLRNVTDKDAALRSMARVLKPGGRL
FT                   LVLEFSKPSSAALSRLYDEYSFRVLPRMGEWVASDGDSYRYLAESIRMHPDQETLKAMM
FT                   ENAGLERVEYTNMTGGIVALHRGIKL"
FT   gene            complement(664520..664903)
FT                   /locus_tag="Csal_0598"
FT   CDS_pept        complement(664520..664903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0598"
FT                   /product="protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57960"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZZ8"
FT                   /protein_id="ABE57960.1"
FT                   /translation="MSAPIPTRIHYHQRARELELGYADGTSYRLPAELLRVYSPSAEVR
FT                   GHGPDTAVLQVGKKDVGLKNITQAGRYALKLHFDDGHDSGLYSWDYLYEMARHQSGWWA
FT                   DYLRRLEEAGATREPSSITIKQL"
FT   gene            complement(665082..666407)
FT                   /locus_tag="Csal_0599"
FT   CDS_pept        complement(665082..666407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0599"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57961"
FT                   /db_xref="GOA:Q1QZZ7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZZ7"
FT                   /protein_id="ABE57961.1"
FT                   /translation="MTQMTPREIVHALDQYIIGQQEAKRSVAIALRNRWRRMQLDDSLR
FT                   GEVVPKNILMIGPTGVGKTEIARRLAKLAGAPFIKVEATKFTEVGYVGRDVESIIRDLV
FT                   EMAMKMVREQAKEEVAHKAEDATEERILDALLPRPRGSEYDHARDESSTRQTFRKKLRE
FT                   GQLDDKEIDIEITPQGGGFDISAPPGMEEMTSQLQSMFSNMGKQKSETRRVTVEEARRL
FT                   LHDEEAAKLVNEEQIKHRAIEAVEQNGIVFLDEIDKVAKRGDSGSGGDVSREGVQRDLL
FT                   PLIEGSTVSTKHGMVKTDHILFIASGAFHLSKPSDLIPELQGRLPIRVELQALTPDDFK
FT                   RILTEPSAALTKQYQALLATDGLEVNFTDEGIARIAEIAWQVNDGTENIGARRLHTVME
FT                   RLLEEPSFQGGDMASPLTIDAAYVDEQLGELATDEDLSRYIL"
FT   gene            complement(666445..666963)
FT                   /locus_tag="Csal_0600"
FT   CDS_pept        complement(666445..666963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0600"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57962"
FT                   /db_xref="GOA:Q1QZZ6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZZ6"
FT                   /protein_id="ABE57962.1"
FT                   /translation="MTTIVSVRRGENVALAGDGQVSLGNTVMKGNASKVRRIHHGKVLA
FT                   GFAGGTADAFTLFERFEAQLDKYQGHLVKAAVELSKEWRTDRALRRLEAMLAVADKNAS
FT                   LILTGNGDVVEPERGIIAIGSGGHYAQASARALLENTDLDARTITEKSLEIAGDICVFT
FT                   NHHITLEEL"
FT   gene            complement(667114..667803)
FT                   /locus_tag="Csal_0601"
FT   CDS_pept        complement(667114..667803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0601"
FT                   /product="Sporulation related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57963"
FT                   /db_xref="GOA:Q1QZZ5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZZ5"
FT                   /protein_id="ABE57963.1"
FT                   /translation="MARRPAQKGQANRRPASRGATTRKRQAKPARAGLPGWLWGVVGLI
FT                   AGFALAQYFQQSAPAPVATVVPKPTNSASQSRDTGNDDAGGASGSSAPEATESRMPTFE
FT                   FYTLLPESEVIAPKVDDSTAAAGGSASTDEADDERADEVAADPSADGLKYMLQAASFRN
FT                   VADAKRLASRLQDFGLLANITKVQTSNDETWHRVQVGPYQDTRELSRAQDLMVTQGIEP
FT                   LLIKLQN"
FT   gene            complement(667804..669489)
FT                   /locus_tag="Csal_0602"
FT   CDS_pept        complement(667804..669489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0602"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57964"
FT                   /db_xref="GOA:Q1QZZ4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZZ4"
FT                   /protein_id="ABE57964.1"
FT                   /translation="MKETIIELLEAAGTQLKQQGILPADAPLTVKVEPTKDKAHGDYAS
FT                   NLALTLAKPAGRKPRDLAEALVAALPPSDAIRQVDIAGPGFINFFAATDAAAQVVPAIL
FT                   DAGDTFGRSLSGAGEKVQVEFVSANPTGPLHVGHGRGAAIGDCLCRLLEATGFEVTREF
FT                   YYNDAGAQIQNLALSVQARVQGLTPDDAAWPEDGYRGAYINDVAQAYLAGETVVADDRD
FT                   VTASAAPDDLDAIRDFAVAYLRREQDLDLKAFGVAFDVYFLESSLYDDGKVDATVKALV
FT                   EGGHTYEEDGATWLRTTDFGDDKDRVMRKKDGGYTYFLPDVAYHLDKWQRGFTTVINEQ
FT                   GADHHSTVTRVRAGLQALEAGIPQGWPDYVLHQMVLVTRSGVEVKLSKRAGSYVTLRDL
FT                   IDEVGRDATRFFLAARRSDSQLTFDIDLARSQSNDNPVYYIQYAHARVCSVMRRAQDAG
FT                   KAFDRDLAMQHLGRLDAPQEKELMNRLARYPEVVERAARMREPQQVAQYLMDLAADFHT
FT                   CYNAVKVMVEDDELRNARLALGLATRQVIRNGLDLMGVSAPEEM"
FT   gene            complement(669645..671867)
FT                   /locus_tag="Csal_0603"
FT   CDS_pept        complement(669645..671867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0603"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57965"
FT                   /db_xref="GOA:Q1QZZ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZZ3"
FT                   /protein_id="ABE57965.1"
FT                   /translation="MTSTVPAPRFLRVALPTPLRRLFDYRPCREAPACGWRPGLRVKVP
FT                   FGRRQLVGVVVECTEHSDLPAQQLKQVHACLDEAPLSADWWWLCQFTARYYQHPLGDTI
FT                   AQALPVALRQGRPLQARQQERWIARQGDDAAPGRAPRQAELLAMLRQHPRGLMTPAITA
FT                   QGYTRAQLEGLLAKRLVDRREEPVAAPAETSSTRLAEPSLPLTREQAGVLAELHEGLDR
FT                   YHPCLLHGVTGSGKTEVYLQLIEAVLARGRQALVLVPEIGLTPQTLSRFRQRFQVPVVA
FT                   LHSGLTDLERLDAWDAARTGRAPIVIGTRSAVFTPLAMPGVIVIDEEHDGSFKQQEGLR
FT                   YHARDLAIARAHRDGIPIVLGSATPSLETLAQARGGRYRHLRLTQRANRHAPARLEMVD
FT                   LRGRPRQGGLIPPAIEGIRQALNAGGQVLVFINRRGFAPTLACHACGWLAECPHCDARM
FT                   TLHRQPQELVCHHCDFHRALPDACPTCESGDLRPLGSGTERTEETLAALFPDTPVHRID
FT                   RDSTRRKQAFEEILREIRRGEPCLLVGTQMLAKGHHLPHVTLVVVVNADAGLYASDFRA
FT                   LEQSAQLLVQVAGRAGRAEHPGRVLIQTLHPDDPNLRLLADSGYEALAGQLLEERRLAG
FT                   LPPFRHLALARFEAARETHVAEVAGNAAEALREWLAAQGSTVTCLGPVPAPMERRQNRY
FT                   HMQVMLSDTRRSSLHRACAWLVQWLENHPDGRRVRASLDIDPQTLS"
FT   gene            672092..672307
FT                   /locus_tag="Csal_0604"
FT   CDS_pept        672092..672307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0604"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57966"
FT                   /db_xref="GOA:Q1QZZ2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZZ2"
FT                   /protein_id="ABE57966.1"
FT                   /translation="MKQAIHPEYKKVTATCSCGATFEFGSTAREDFYVDVCSQCHPFYT
FT                   GKQKQATTGGRVERFNKRFGAAIKRN"
FT   gene            672559..673857
FT                   /locus_tag="Csal_0605"
FT   CDS_pept        672559..673857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0605"
FT                   /product="Malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+)"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57967"
FT                   /db_xref="GOA:Q1QZZ1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZZ1"
FT                   /protein_id="ABE57967.1"
FT                   /translation="MQMTGQKLMSDEKRQAALDYHAKPIPGKLSVELTKPTETSKHLAL
FT                   AYSPGVAEPCREIAKDVENAYLYTGKGNLVAVVSDGSAILGLGNLGPLSSKPVMEGKGV
FT                   LFKRFAGINSVDIEVDAESPQAFIDTVARIADTWGGINLEDIKAPECFEIEQALIEQCN
FT                   IPVFHDDQHGTAIVTAAGLLNALDIAGKRLEDARIVCLGAGAAAIACMKLLVSCGARAE
FT                   NIFMLDRKGVVHSERDDLNQYKAMFATETSRRTLDDAIEGADVFVGLSGPNLLKPEQLQ
FT                   RMAANPVVFACSNPDPEIHPDVANETRDDVIMATGRSDYPNQVNNVLGFPFIFRGALDV
FT                   RATRINEEMKVAAVHALKDLAREPVTREVLDGYGIESLEFGRGYIIPTPLDSRLLDRVS
FT                   SAVAQAAVDTGVARKPYPAHYPLTSIKDVYGTP"
FT   gene            complement(673957..674709)
FT                   /locus_tag="Csal_0606"
FT   CDS_pept        complement(673957..674709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0606"
FT                   /product="protein of unknown function DUF481"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57968"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZZ0"
FT                   /protein_id="ABE57968.1"
FT                   /translation="MLVSHHLRWLLCALLGIAALPVHADLFYAPPAPQEDAPKMSGEAE
FT                   LGYTHLSGNSNSRTLLAKGRLTWLTGRHTHTLRGETRSVQENDETSTEQYLVAGRERYD
FT                   LQGPHYLFGFGRWEKDRFSGYDYQFTTIGGYGRQWLDGPDHTLSTEFGPGYRHDAYVDG
FT                   KEEDLGLAYAALDYRWDLSEGAYFEQAISTEAATRNTTTRSITSLTAQLNSHLALKMSY
FT                   ELKNNTDPPDDAESNTDRTTSMSLLYSW"
FT   sig_peptide     complement(674635..674709)
FT                   /locus_tag="Csal_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(674804..677323)
FT                   /locus_tag="Csal_0607"
FT   CDS_pept        complement(674804..677323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0607"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57969"
FT                   /db_xref="GOA:Q1QZY9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY9"
FT                   /protein_id="ABE57969.1"
FT                   /translation="MKLFKRLLTSILWLIVSLGLGCVLATVGAGIYFAPGLPDVRQLQG
FT                   FELQTPLRVYTQDDKLIGEFGEQRRTPVSYDDIPQSFIDALLAAEDAHFFEHPGIDPKG
FT                   LARAALELATSGNIQSGGSTITMQVARNYLLTLDQTFTRKIREILLSLQMEQVLDKQNI
FT                   LELYVNKIYLGNGAYGIGAAAESYYDKPLAELDLPQLAMMAGLPKAPSALNPLNNPERS
FT                   LIRRNWVLLRMRELGFIDPIQYQAAVKAPITAHRAQSQFEVNAPYIAEMARQYAVERFG
FT                   DDAYTDNFQIKTTIDSRLQTFARSALVNGLIEYDTRHGWRGPEETDIPSSLVEAQENTD
FT                   AQGLEEELSESPEVMKTARQAAKSSEQSIEGVDGDVSNWVKVLDRTPRHGPLEPGIVVE
FT                   AGDRQLQVLTRDDGVVTIGWDGLDWAREYHSAEWRGEVPANAAAIAERGDLIRVMRTDD
FT                   GDWRLSQVPGAQGAIVIIDPQTGAIRGLQGGFSFSASKFNRAIQAQRQAGSIFKPFIYL
FT                   AALQNGMSAATIINDAPVVMSDVGGDWRPENAEGEFRGPTRLRVGLYQSRNLVTIRVLQ
FT                   SLGLDNTLSFLENFGFAKGRLPHGLSLALGSASLTPLEMANAYAVLANGGFQVAPWYIQ
FT                   SVTRGSDNEVIEQANPVVACRECDPDQQTTVIDGETRRIAKRVADPETMYIIRDMMRDV
FT                   IEKGTGRGALELNRPDIVGKTGTTNDQRDAWFSGFNDDLVATVWVGKDDNTTTGEYGSQ
FT                   AALPIWKAFMRQALDGQPESMPSRPDDVVAVRIDPETGLRLHNDQPGGMQEIFRKDNLP
FT                   DYKPRSIQPELEDRSGSQGTGTYDAIF"
FT   sig_peptide     complement(677246..677323)
FT                   /locus_tag="Csal_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.779 at
FT                   residue 26"
FT   gene            677596..678666
FT                   /locus_tag="Csal_0608"
FT   CDS_pept        677596..678666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0608"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57970"
FT                   /db_xref="GOA:Q1QZY8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY8"
FT                   /protein_id="ABE57970.1"
FT                   /translation="MTVWRFKKSQKGLVGVDITSATVKLIELESSGAGHRIASYAVRPL
FT                   HEGAVVERRIRDLDEVANTLTRAVEHARPHSRRAVAAVPASAAITKTLTYPASLTDDEI
FT                   EARIQLESERHIPFPLNEVAFDFQRLGLNARYPDQQDILLVACRLQDVDRLADVLRRAG
FT                   LEPAAVDVETFAMERAAGELLLGQAASQPDDECVALVDIGANMNAFHVLIDGRIAYTRD
FT                   NVLGGRHLTEEIRKRYGLSLEEAGLAKKRGGLPEDYELEVLTPYIDMLIQQVGRSLQLY
FT                   YTSGKPRDIQRLVLAGGSSVIPGLRERLAAQSGLEVVMANPFSRMRVASRVDVQALASD
FT                   APAMLTACGLAMRGRR"
FT   gene            678663..679232
FT                   /locus_tag="Csal_0609"
FT   CDS_pept        678663..679232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0609"
FT                   /product="Fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57971"
FT                   /db_xref="GOA:Q1QZY7"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY7"
FT                   /protein_id="ABE57971.1"
FT                   /translation="MSIEINLLPWREAYRQRRTRRFYMALAIVAVSALLCGWGLSYWYQ
FT                   AGIDAERGRLALIERRTQALDQDIAAVKDYRELRGRMLDQIQLIRELQFSRPQTVRIFD
FT                   QLAATLVEGVHYDRLTRKGDRLDLSGVARANRRVSDQLRQLASSPVFATPELADVHAVD
FT                   GVPSLKRFNLSVETRTPRRDDDGESP"
FT   gene            679229..679879
FT                   /locus_tag="Csal_0610"
FT   CDS_pept        679229..679879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0610"
FT                   /product="Pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57972"
FT                   /db_xref="GOA:Q1QZY6"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY6"
FT                   /protein_id="ABE57972.1"
FT                   /translation="MSLRTQWRQLREVEWRDLDLKEAGSWPALLQGLCLIVLFVAVFWV
FT                   AQWFLAAPRQATLDSLQARERTLLAEYEARAYQAANLDQMRTQMAELDARMQALLEMLP
FT                   SDAEIPALLDDISDAAQDHQLVIDSIRLRAPVPQTFYIEQPFDIEVRGGYHEIAAFLGS
FT                   VAALPRIVTLHDFTLTPVNEGDTLRLSLLARTYSYREDADPKARAGNPEGGDD"
FT   gene            679872..680432
FT                   /locus_tag="Csal_0611"
FT   CDS_pept        679872..680432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0611"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57973"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY5"
FT                   /protein_id="ABE57973.1"
FT                   /translation="MIDQAKPWLRGMALVAGLAGVVAIGGCRDADLASLEAHLDALRER
FT                   PEGNIDALPPAPVYRTAHYTQAGQRSPFRATRESSGTESATGQAGRPDRERPREPLEQF
FT                   ALERLELVGTLTVAGRPSALIRAPDGHVYRVFRGHYLGTDFGRITAIGDSGVELIERVR
FT                   DAGGGWRERHRTLNFNDSSQAAE"
FT   gene            680509..682515
FT                   /locus_tag="Csal_0612"
FT   CDS_pept        680509..682515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0612"
FT                   /product="type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57974"
FT                   /db_xref="GOA:Q1QZY4"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY4"
FT                   /protein_id="ABE57974.1"
FT                   /translation="MMMRTLRGWLSGWLWLVGVIVCAQGQAATLTSLDIAQREDGGIDA
FT                   MLGFDGPAPEAHSYRGDAPAQMIVDLPDTASGLEQRTVEVGQGGLRDISVVDAAERTRL
FT                   VFGLTSPQAYSVQRQGDRLRVRLGSEAIPDGVTSIRDLDFRRGNAGGGRLVVTLDAPGV
FT                   SPETSVDGNTLTLTLPGTRLPDALDRILDVSDFATPVSRIVPNRQDDAVTLTLENREPF
FT                   QHLVTQRGDRLIVDVQPRNEQTSDARDASPTYTGEPISLNFQNIQVREVLSVLSDFSGL
FT                   NIVASDSVQGSVTLNLQQVPWDQALALILQSHGLASRRNGDVIVVAPVDELAQMERQTL
FT                   ENRAQSEQLAPLVTDYVQVRYAKATDLAAMLRGSEGFGLLSERGRVTVDERTNTLLVRD
FT                   TREQLASIRGMLERLDVPVRQVQIEARIVIARDTASRELGVNWGISQRQGVTFDDDGVG
FT                   SVVDRNPSGANRGSAGLSVDLGDSDGSGSTFSFGYLSGDVLLDLELRALESEGKSQTIS
FT                   QPKVITANQKTAVIKQGQEIPYQESTSSGATNVEFKEAVLSLEATPQITPDGSIVMDLL
FT                   INNDTVADNSYDGAPAIDTNSIETQVLVDDGATVVLGGILTSEQLRNLYKTPFLGDLPL
FT                   IGSLFRYTQESNEKVELLIFITPTIIGDGQANR"
FT   sig_peptide     680509..680592
FT                   /locus_tag="Csal_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.931 at
FT                   residue 28"
FT   gene            682515..683057
FT                   /locus_tag="Csal_0613"
FT   CDS_pept        682515..683057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0613"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57975"
FT                   /db_xref="GOA:Q1QZY3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZY3"
FT                   /protein_id="ABE57975.1"
FT                   /translation="MQGLPTIILVGPMGAGKSTIGRLLAAELQREFFDSDHEIEARCGA
FT                   NIAWIFDVEGEAGFRDRETAMLRELASLDAVVLATGGGAVMREDNRQALRERGTVVYLA
FT                   TSVEQQIRRTARDRNRPLLRQGNPEQVLRDLFAKRDPLYRATADLVVRTDRRGPRAVVN
FT                   EIIRRTKRLSDPLDLKA"
FT   gene            683060..684172
FT                   /locus_tag="Csal_0614"
FT   CDS_pept        683060..684172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0614"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57976"
FT                   /db_xref="GOA:Q1QZY2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY2"
FT                   /protein_id="ABE57976.1"
FT                   /translation="MTASTASPSQCLHVELDARRYPIHVGPGLLDDPAMLVPYLAGRQV
FT                   MIVTNETVAPRYLERLKRALSGDDRDVREIVLPDGEHTKTLASVERIWDALLAAGFNRR
FT                   CTLVALGGGVIGDMAGFAAACYQRGVAFVQVPTTLLSQVDSSVGGKTGVNHPRGKNMIG
FT                   AFWQPRAVVIDTQTLTTLPSRELSAGLAEVIKYGLIHDIEFLAWLESRMTALRALDAEA
FT                   LTEAILRSCAIKAEIVAADETEQGQRALLNLGHTFGHAIEAHQGYGNWLHGEAVGAGMA
FT                   MAAELSRRLGWLDDAEVARVEALIVHAGLPVTAPAAMSGDDFLATMRLDKKNIDARLRL
FT                   VLLSRLGEACIHDATPPDMLDALLADFPRH"
FT   gene            684635..689086
FT                   /locus_tag="Csal_0615"
FT   CDS_pept        684635..689086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0615"
FT                   /product="glutamate synthase (NADPH) large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57977"
FT                   /db_xref="GOA:Q1QZY1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY1"
FT                   /protein_id="ABE57977.1"
FT                   /translation="MMRGLHQPGEFRDNCGFGLIAHMEGQASHDLLKTAIESLTCMTHR
FT                   GGIAADGKTGDGCGLLFKMPTDFMRAVAREELAVELGERFAVGCLFLPDDDAREARARE
FT                   VLETQLRERDLRVSGWRDVPTDASVCGPMALECLPRIRQVFVEAEDARDTQAFNVDLFM
FT                   ARRYAEQALKDEDDFYICSLSSEVVSYKGLMMPADLPTFYRDLGDERLHTAICVFHQRF
FT                   STNTAPRWPLAQPFRFMAHNGEINTIEANRGWANARKENFLSPLLPEITELDEIVNTSG
FT                   SDSSSMDNMLEVLLTGGMDLYNAVRMMVPPAWQNVETMDGDLRAFYEYNSMHMEPWDGP
FT                   AGLVMTDGRHAVCMLDRNGLRPARWVITENGYITLSSEIGVYDYKPEDVVAKGRVGPGQ
FT                   ILAVDTQTGEVLHTPDVDERLRSAYPYRRWLKEHAHYLESALTELARFQPMARDELNVY
FT                   QKMFQVTFEERDQLLRPLAEGGQEAVGSMGDDTPMAVLSRHGRLLTDYFRQKFAQVTNP
FT                   AIDPLREAIVMSLETCCGAELNVFEATPEHAHRLILTTPVLSPRKFTALVTQDDPAFAS
FT                   HTLNLGYDPERDTLKQALLALCQRAEDAARDGKVILVLSDADLARGKLPVHPALAVGAI
FT                   HHHLGRKALRPRVNLVVETGYARDAHQMAVLFGVGATAVYPYLAYQVMADMHNTGELTG
FT                   NPADARENYRKGLQKGLYKILSKMGISTLASYRGSQLFEAVGLSSEVMDMCFAGMASRI
FT                   EGTGFAELQLQQELLAREAWIPRKGIRQGGLVKYVHDHEYHAYNPDVVMQLQSAVQSGD
FT                   YAKWKQFAKTVNERSVATIRDLLALKPAPEPLPLDEVEPVENLLPRFDSAGMSLGALSP
FT                   EAHEALAQAMNETGGRSNSGEGGEDPARYGTIRSSKIKQIASGRFGVTPAYLVNAEVLQ
FT                   IKVAQGAKPGEGGQLPGGKVNELIARLRYAVPGVTLISPPPHHDIYSIEDLAQLIFDLK
FT                   QVNPDAQVSVKLVSEPGIGTIATGVAKAYADLITVSGYDGGTAASPLTSIKHAGSPWEL
FT                   GLPEVHQALRINSLRDKIRLQTDGGLKTGLDVVKAAILGAESFGFGTAPMVALGCKYLR
FT                   ICHLNNCATGVATQHQHLRDEHFRGTVDMVKHYFRFIAEEVRELMALLGVRQLTDLIGR
FT                   TDLLEILEGETASQRKLDLMPLLQNDHVPEGAPQFCQVGRNEPHDPGAKNQEVLEALLP
FT                   AIEAKSGGEFSFRITNCDRSVGARASGEIAKRYGEAGLEEAPITARFTGVAGQSFGVWN
FT                   ARGLQLYLEGDANDYVGKGMNGGKVVIVPPRESRFESHKTAIIGNTCLYGATGGKLFAS
FT                   GTAGERFAVRNSGVHAVIEGAGDHCCEYMTGGLVAVLGETGINFGAGMTGGFAYVLDED
FT                   RTFVDKYNHELVEIHRINTEVMEAYRRHLREMIEEYVAETGSVRGQTILEDFSGFIRHF
FT                   WLVKPKAASLNGLLAESRRRPE"
FT   gene            689118..690536
FT                   /locus_tag="Csal_0616"
FT   CDS_pept        689118..690536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0616"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57978"
FT                   /db_xref="GOA:Q1QZY0"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZY0"
FT                   /protein_id="ABE57978.1"
FT                   /translation="MANRLNNDFQFIDVGRQDPEKKQARARAREFAEIYEPYKPSEAAS
FT                   QAHRCLHCGNPYCEWKCPVHNYIPNWLKLVSEGNILEAAEMSHRTNSLPEVCGRVCPQD
FT                   RLCEGDCTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVEWTDKRVAVIGAGPAGLG
FT                   CADILVRNGVKPVVFDKHPEIGGLLTFGIPEFKLEKHVMKRRRAVFEEMGVEFRLGVEI
FT                   GRDVTHDALLDEFDAVFMGMGTYKYMEGGFPGEDLPGVHKALDFLIANVNHCLGFETNP
FT                   DDYVSLEGKRVVVLGGGDTAMDCNRTSIRQGATSVTCAYRRDEENMPGSKREVANAREE
FT                   GVEFLFNRQPVAIVGEDKVEGVKLVRTRLGEPDANGRQRPEVVPGSEEVFAADAVIIAF
FT                   GFQPSPADWFDTVGIDLDERGRVKAPAQASFAFQTSHEKIFAGGDMVRGSDLVVTAVYE
FT                   GRQAGEGILDYLGV"
FT   gene            690739..692385
FT                   /locus_tag="Csal_0617"
FT   CDS_pept        690739..692385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0617"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57979"
FT                   /db_xref="GOA:Q1QZX9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZX9"
FT                   /protein_id="ABE57979.1"
FT                   /translation="MTRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTILKLDPYIN
FT                   VDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIRTKMTQGNNFTTGRVYEHVLRKERR
FT                   GDYLGGTVQVIPHITDEIKRRVYEGGDGFDVALVEIGGTVGDIESLPFLEATRQIRSEK
FT                   GANQAIFMHLTLVPYIKTAGETKTKPTQHSVKELRSIGIQPDILICRSEVELEESERRK
FT                   IALFTNVEERAVVPLQDADTIYRIPLMLHEHGLDDIICDKLRIEADEVDLAEWVRVLDA
FT                   KLNPLKSVNIAMVGKYMELLDAYKSLNEALIHAGIQGRVKVNIDYIDSEDIEHHGTERL
FT                   AGKDAILVPGGFGERGVEGKIATARYARENGVPYLGICLGMQVAVIEYARHVAGWADAN
FT                   STEFTHDTQHPVVGLITEWVNAEGKIELRDAASDLGGTMRLGGQVCHLKPGTRAHEAYG
FT                   LDEITERHRHRFEVNNQFVEALESAGLVISGKSADHSLVEMIELPEHPWYVACQFHPEF
FT                   TSTPRDGHPLFSGFVNAALAYKAARARAQQS"
FT   sig_peptide     690739..690816
FT                   /locus_tag="Csal_0617"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.819) with cleavage site probability 0.766 at
FT                   residue 26"
FT   gene            692396..693247
FT                   /locus_tag="Csal_0618"
FT   CDS_pept        692396..693247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0618"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57980"
FT                   /db_xref="GOA:Q1QZX8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZX8"
FT                   /protein_id="ABE57980.1"
FT                   /translation="MAETSKQIEFAGLRAGNSLPLALFGGMNVLESREMALEVAEAYVE
FT                   VTGRLGMPYVFKSSFDKANRSSIHSYRGPGLEKGLEWLAEIKERFNVPVITDVHEPWQA
FT                   KPVAEVADVIQLPAFLARQTDLVVAMAETGAAINIKKPQFIAPHEMRHIIRKCEEVGNS
FT                   RLILCERGSSFGYNNLVVDMLGFGEMKQTGYPVFFDVTHALQRPGGRADSADGRRAQVA
FT                   ELARAGVAVGLAGVFLEAHPDPDNAKCDGPCALPLNRLEGFLSQLKAIDDLVKGFAPLE
FT                   ID"
FT   gene            693366..694661
FT                   /locus_tag="Csal_0619"
FT   CDS_pept        693366..694661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0619"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57981"
FT                   /db_xref="GOA:Q1QZX7"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZX7"
FT                   /protein_id="ABE57981.1"
FT                   /translation="MAEIKDIHALEVLDSRGNPTVQADVVLASGVRGTACAPSGASTGS
FT                   REALELRDGDTSRYLGKGVLKAVEAVNGRIRDALVGKDALDQRALDAAMLELDGTDNKA
FT                   GLGANAILAVSLAAAKAAAIEKGVPLYAHIADLYGQSGQFRMPVPMMNILNGGEHADNN
FT                   VDIQEFMIQPVGAPSFREALRMGAEIFHALKKVLAARGLSTSVGDEGGFAPNLASNAEA
FT                   LAVIQQAVEKAGYVLGKDVTLALDCASSEFYQDGQYNLSGEGKSYDAAGFVDYLAALCD
FT                   QYPIVSIEDGMDESDWAGWKALTEKLGDKVQLVGDDLFVTNTRILKRGIDEHIGNSILI
FT                   KFNQIGSLSETLDAIKMAQDAGFTAVISHRSGETEDTTIADLAVGTSAGQIKTGSLCRS
FT                   DRVAKYNRLLVIEQELEGQAVYPGLAAIKGQG"
FT   gene            complement(695223..695546)
FT                   /locus_tag="Csal_0620"
FT   CDS_pept        complement(695223..695546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0620"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57982"
FT                   /db_xref="GOA:Q1QZX6"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZX6"
FT                   /protein_id="ABE57982.1"
FT                   /translation="MTFVVTENCIRCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCAL
FT                   CEPECPAEAIYSEDELPDDQKAFIELNAELSEVWPNISEKKDPLPDAEEWDGKTDKLQH
FT                   LER"
FT   gene            complement(695721..698300)
FT                   /locus_tag="Csal_0621"
FT   CDS_pept        complement(695721..698300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0621"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57983"
FT                   /db_xref="GOA:Q1QZX5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZX5"
FT                   /protein_id="ABE57983.1"
FT                   /translation="MSQASAQHTPMMAQYLKIKREHPEVLLFYRMGDFYELFYDDAKRA
FT                   ASLLDITLTQRGQSAGQPIPMAGVPYHSAESYLARLVKSGESVAICEQIGDPATAKGPV
FT                   ERKVVRIVTPGTLHDEALLDARRDNLVLAVHPQGDRWGLAWLELSSGHFSVLEVDGESD
FT                   LLSEIQRLDPAELLAAESLSLPPALAERPGFRRQSDWLFDLESATRLLCDQFGVADLRG
FT                   FGCAHLTTALTAAGVLIDYARDTQRSRLPHVTGIAVETRDEAVVIDAASRRNLEIDTNL
FT                   GGGFDNTLASVLDTTATAMGSRQLKRWLNRPLRDIAQIQSRQAAVQCLIDADRHATLRD
FT                   ALKAIGDIERILARVALYSARPRDLARLRDALNALPALEHDLAELDEGTAIDALKHHIR
FT                   PYPELAETLSRALVDNPPVVIRDGGVIGTGFDAELDEYRGLAEHAGDYLVELETRERER
FT                   TGLVGLKVGYNRVHGYYIEIPRAQAREAPAEYIRRQTLKNAERFIIPELKEFEDKALSA
FT                   KSRALAREKLLYDGLLETLNVDLQALQGTARALATLDVLACFAERALALDFVRPRLSDQ
FT                   PGLRIRGGRHPVVEHVSDHPFVPNDLMLDETRRLLVITGPNMGGKSTYMRQAALIALLA
FT                   HTGSCVPADEAEIGPVDRIFTRIGSSDDLAGGRSTFMVEMTETATILHNATEHSLVLMD
FT                   EIGRGTSTFDGLSLAWASAEHLVERRAFTLFATHYFEMTALTEPYDSVANVHLTAAEHR
FT                   DGIVFMHRVEEGPASQSYGLQVAQLAGVPPRVVARAREKLATLEQQEVHQAGTRGGLGD
FT                   SDAAAPQQADLFASAPHPVVEALEKLDLDAISPRQAMALLYEWREQC"
FT   gene            698457..698981
FT                   /locus_tag="Csal_0622"
FT   CDS_pept        698457..698981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0622"
FT                   /product="CinA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57984"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZX4"
FT                   /protein_id="ABE57984.1"
FT                   /translation="MAITLEEWRDVSVDALAERLGKACRATGASVTAAESCTGGGVASA
FT                   ITDVAGSSDYFETGYVTYANSAKQRLLGVREATLATHGAVSAETVREMVAGACRDSGAT
FT                   LGVAISGVAGPGGGSADKPVGTVWFAWGDDRAQEVERHHLPGTRGEVRRAAVRMALIGL
FT                   VARLEGESGRD"
FT   gene            699120..700178
FT                   /locus_tag="Csal_0623"
FT   CDS_pept        699120..700178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0623"
FT                   /product="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57985"
FT                   /db_xref="GOA:Q1QZX3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZX3"
FT                   /protein_id="ABE57985.1"
FT                   /translation="MAQDDNRSKALNAALSQIERQFGKGAVMRLGDTPRVATPAISTGS
FT                   LGLDIALGVGGLPMGRVVEIFGPESSGKTTMTLSVIAQGQKQGKTCAFIDAEHALDPTY
FT                   AEKLGVNLDDLLVSQPDTGEQALEICDMLVRSGGVDVIVVDSVAALTPRAEIEGEMGDS
FT                   HVGLQARLMSQALRKVTGNIKNANCMVMFVNQIRMKIGVMFGNPETTTGGNALKFYSSV
FT                   RLDIRRTGSVKQGDEAIGNETRVKVVKNKVAPPFRQAEFQILYGKGIYHAGEVVDIGVQ
FT                   QGLVDKAGAWYSYQGNKIGQGKANAAQFLEDNPAIMEEIENEIRARLLSTPKPEAESQE
FT                   KAAAAQDDDSLV"
FT   gene            700181..700639
FT                   /locus_tag="Csal_0624"
FT   CDS_pept        700181..700639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0624"
FT                   /product="regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57986"
FT                   /db_xref="GOA:Q1QZX2"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZX2"
FT                   /protein_id="ABE57986.1"
FT                   /translation="MSTQEATPRDDAIRLLARRDYSRSELMSRLAARGHAPDDIASLLD
FT                   ALADEGLQSDARFAEQFVRSRLSRGQGAMKIRAELGARGVTDEVAREALEGEAPDWHRL
FT                   ACEALAKRFDSPGRDPRERAKRERFLASRGFDFEQVRHAMAHAWENTR"
FT   gene            700857..703463
FT                   /locus_tag="Csal_0625"
FT   CDS_pept        700857..703463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0625"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57987"
FT                   /db_xref="GOA:Q1QZX1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZX1"
FT                   /protein_id="ABE57987.1"
FT                   /translation="MKSADIRQAFLTFFEEHGHTIVPSSSLVPANDPTLLFTNAGMVPF
FT                   KDVFLGRDPRPYVRATSAQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKRG
FT                   AIRFAWTFLTERLGLPADKLWVTVHVSDDEAERIWKDEIGIDPARFSKLDEDNFWQMGD
FT                   TGPCGPSSEIFFDHGPEVAGGPPGSPEEDGDRYIEIWNLVFMQFDRDSAGTLNPLPKPS
FT                   IDTGMGLERVAAVLQGVHSNYEIDLFQNLLNAASEATGYDDTSAPSLRVIADHIRSCAF
FT                   LITDDVLPSNEGRGYVLRRIIRRAIRHGHKLGAREPFFHTLVAALDAEMGAAYPELRKA
FT                   RPRIEKVLLKEEEQFARTLDHGMGLLTEALETLDGEVLPGETVFKLYDTYGFPFDLTAD
FT                   VCRERGVTLDEVGFQRELEAQRERARAASQFGADYTAALDLEGETAFTGYERLEDEARV
FT                   TALVDREGNALAALEAGQHGVVVLDRTPFYGESGGQAGDTGYLEADGMRFQVTDTQKQG
FT                   GHHLHHGVLVEGRLDVGASVTPRVDASLRAATMRNHSATHLLHEALRQVLGEHVQQKGS
FT                   LVTAERLRFDVSHFEAMTRAQLDEVERIVNAQILANAATRIEHMTLDEAKAKGAAALFE
FT                   AKYADSVRVLTIGADDFSIELCGGTHVARSGDIGCFHILSEAGVAAGVRRIEAVTGEGA
FT                   LAYFRDQEAKVARVAEQLKAKPEQVEARLEATLERNRTLEKELERLKAKLASATSGDML
FT                   ADVREVAGVKLLAKQVEGVGGKELRGLLDQLKNKLGSGVIVLGVAGDEKVSLIAGVTDD
FT                   LTARLKAGDLVKHVAEQVGGKGGGRADMAQAGGSRPQALPDALASVPSWVEARLGE"
FT   gene            703543..704787
FT                   /locus_tag="Csal_0626"
FT   CDS_pept        703543..704787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0626"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57988"
FT                   /db_xref="GOA:Q1QZX0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZX0"
FT                   /protein_id="ABE57988.1"
FT                   /translation="MALYVQKFGGTSVGSVERIKAVAEKVKRFRDEGHQVVVVVSAMSG
FT                   ETNRLIDLASQINDEPTPREMDMLVSTGEQVTISLLAMALHKLDVEATSYTGAQVGIRT
FT                   DSAHTKARIQRIETDDIQADLDDGQVVVVAGFQGVDDEGNITTLGRGGSDTTGVALAAA
FT                   LKADECQIYTDVDGVYTTDPRVCSKAQRLSAITVEEMLELASLGSKVLQIRAVEFAGKY
FT                   NVPLRVLSSFEDGPGTLIVAEEEETTMEEPLISGIAFTASEAKLTLLNTPDVPGVASKI
FT                   LGPIADANIEIDMIVQNVAPAGDYTDFTFTVAKSDYKQTKSILQDQVIPALGGGELRGD
FT                   DNIAKVSLVGVGMRSHAGVASKMFRVLADENINIRMVSTSEIKISVVIDEKQMELAVRA
FT                   LHTAFGLDKDSIQGE"
FT   gene            705009..705206
FT                   /locus_tag="Csal_0627"
FT   CDS_pept        705009..705206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0627"
FT                   /product="carbon storage regulator, CsrA / carbon storage
FT                   regulator, CsrA"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57989"
FT                   /db_xref="GOA:Q1QZW9"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QZW9"
FT                   /protein_id="ABE57989.1"
FT                   /translation="MLILTRRVGETLMIGDDITVTVLGVKGNQVRIGVNAPKDVAVHRE
FT                   EIYQRIQREKTDSEDDGSSV"
FT   gene            705419..705511
FT                   /locus_tag="Csal_R0020"
FT                   /note="tRNA-Ser1"
FT   tRNA            705419..705511
FT                   /locus_tag="Csal_R0020"
FT                   /product="tRNA-Ser"
FT   gene            705541..705617
FT                   /locus_tag="Csal_R0021"
FT                   /note="tRNA-Arg1"
FT   tRNA            705541..705617
FT                   /locus_tag="Csal_R0021"
FT                   /product="tRNA-Arg"
FT   gene            705704..705780
FT                   /locus_tag="Csal_R0022"
FT                   /note="tRNA-Arg2"
FT   tRNA            705704..705780
FT                   /locus_tag="Csal_R0022"
FT                   /product="tRNA-Arg"
FT   gene            complement(706310..706783)
FT                   /locus_tag="Csal_0628"
FT   CDS_pept        complement(706310..706783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW8"
FT                   /protein_id="ABE57990.1"
FT                   /translation="MKTMHMLMMPMVLSGGLSTAVMADDGSLSPGELESLLATAGEHGV
FT                   THYDDIAIDDGNRLEVEGWRDDGWQLDLDMLIRDGSLVHEKRRQDTTPDWSLNGEELRQ
FT                   ALDNARDAGMQRFAELDVDEQGHVDIEGYDAQNEEIDIRLERNGLTVTGVEHD"
FT   sig_peptide     complement(706712..706783)
FT                   /locus_tag="Csal_0628"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            707009..707350
FT                   /locus_tag="Csal_0629"
FT   CDS_pept        707009..707350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57991"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW7"
FT                   /protein_id="ABE57991.1"
FT                   /translation="MKRFNGCLKALMLAAVGIMACQSLVMADDDEWRSLHREVQEGRVV
FT                   ALPTVLDWLEHRYVGQVLEVELEHENEAPRYEIEMIGPQGQVVEFEFDAANGELIGIEG
FT                   VNIEGMTRP"
FT   sig_peptide     707009..707092
FT                   /locus_tag="Csal_0629"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            707347..708018
FT                   /locus_tag="Csal_0630"
FT   CDS_pept        707347..708018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0630"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57992"
FT                   /db_xref="GOA:Q1QZW6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW6"
FT                   /protein_id="ABE57992.1"
FT                   /translation="MKVLLVEDDTALAQALGEAFVEAGLLWEHAANGEAADYLVRVEAY
FT                   DAVILDLGLPDGDGTRWLAAWREDGIDLPVLVLTARERWSDKAAGFSAGADDYVTKPFE
FT                   TAEVLFRLRALVRRSHGHAHPILKLGELALDTHTGSVTLAGRPITLTAQESRLLAYLLH
FT                   AAPRIVTRTELSEHVYDRDHEPDSNVIDVQISRLRRKLGNQRIETLRGQGYRLVALEET
FT                   P"
FT   gene            708015..709394
FT                   /locus_tag="Csal_0631"
FT   CDS_pept        708015..709394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0631"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57993"
FT                   /db_xref="GOA:Q1QZW5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW5"
FT                   /protein_id="ABE57993.1"
FT                   /translation="MRRRAWQQRIARTSIRARLLIASLLLVMVALPLAGTGLAYNFRDA
FT                   VTTAFDDRLESLLNVLLAGAQLDPQSNELRMTRSLGDPRFERVYSGWYWQVAGEEQALT
FT                   SRSLWDQRLPTDDIQGLAVSEVDGPRGNRLRVMERDIRLPGHAGTLHVSVAASREELDR
FT                   EVARFEWLLGLSLLALGALLLVGLAVQIRWGLAPLRRMHANLRAVESGDAESLETRFLP
FT                   DELARLAGAMNGVLERDRRLIERGRHAAGNLAHALKTPVSVLTTLAERFPDETRDRVQG
FT                   ELGRIDDAVRHHLARASATGGGVLAGKIDVGKTLAPVLDGLTRMGERRGVRLDAELAAD
FT                   LSVRMDAQDLQELVGNLLENALRWASSQVSLRFYPQGAGVALVIEDDGPGMSEDQREAA
FT                   LARGARLDERRSGSGLGLAIVEDLMTLYGGRLQLAESTLGGLAARAWLPSSPVAPSVAE
FT                   S"
FT   sig_peptide     708015..708134
FT                   /locus_tag="Csal_0631"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.543 at
FT                   residue 40"
FT   gene            709532..710488
FT                   /locus_tag="Csal_0632"
FT   CDS_pept        709532..710488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0632"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57994"
FT                   /db_xref="GOA:Q1QZW4"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW4"
FT                   /protein_id="ABE57994.1"
FT                   /translation="MDKYELKREQAARAAWLSYVGGRTQDDIARLLGVSRPGVQRLLAL
FT                   ARQEGLVKVHVDHPISQCMAMGEAILTHFGLDFCDVVPSDPELPESSPRFLAQAGAERL
FT                   ASLLDRQAPLTLSLGTGRSVRATVEALSRLDRSQHRIVSLVGNVARDGSANRYDGVMVL
FT                   ADKTGAERFLLPAPVVAASVEEKEALLAQQLVQAVFHIAREAETGVIGIGRIDPRATLF
FT                   QDHFISEAELNELLEAGAVGELLGWPLDIQGRLIDCPITRRITSLPLSALGGQPLMGLA
FT                   GGHDKGPAILSALRGGWLKGLVTDEAAARYIVSALGA"
FT   gene            710603..711913
FT                   /locus_tag="Csal_0633"
FT   CDS_pept        710603..711913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0633"
FT                   /product="mannitol-binding protein / sorbitol-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57995"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW3"
FT                   /protein_id="ABE57995.1"
FT                   /translation="MRLTYALPLAGAATLASFAAHAETITVATVNNNDMIIMQGLTDEF
FT                   EKAHPDIDLEWVVLEENVLRQRLTTDIATDGGQFDVMTIGTYEVPIWAKQDWLVELDDL
FT                   PESYNEQDLLKPIRDGLSQDGSLYALPFYGESSMMYYRTDLFEQAGIEMPEQPTWEQVE
FT                   DWASQINDPDNGVYGICLRGKPGWGENMAFVSTLVNTFGGRWFDEEWHPEINSPEWKEA
FT                   VGFYVDLMNNYGPPGATSNGFNENQALFSSGKCGMWVDATSAAGRLYNPDESQVADKLG
FT                   FAPAPIAETPKGANWLWSWTLAIPASSDAKDAARTFITWATSQDYIELVGETEGWTSVP
FT                   PGTRESTYENPKYQEAAPFADFVLNAIQTADPTDSTLKPSPYIGVQTVNIPEFQAVGTQ
FT                   VGQMIGAALAGQQSVDAALDQAQRSVDRTMRQAGYYD"
FT   sig_peptide     710603..710671
FT                   /locus_tag="Csal_0633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            711992..712879
FT                   /locus_tag="Csal_0634"
FT   CDS_pept        711992..712879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0634"
FT                   /product="sorbitol ABC transporter membrane protein /
FT                   mannitol ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57996"
FT                   /db_xref="GOA:Q1QZW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW2"
FT                   /protein_id="ABE57996.1"
FT                   /translation="MRERTSGRTVGGFRNVFLQGPAVTLLLLWMLVPLGMTLWFSFQRY
FT                   NLINPMISGFAGWDNYTYLLTDPALWTAMGNTLLLVGWVLAISVIGGTLLAVLFQQEFF
FT                   GRGIARLLVIAPFFVMPTVGALVWKNMLMHPVNGVFAWLSGLLGLPVIDWFSSMPLASI
FT                   IIIVAWQWMPFALLILLTAIQSLDDDQVEAARMDGAGPLAIFWFITLPHLKRAISVVIM
FT                   IEMIFLLTIFAEIFVTTSGGPGLASTNLAYFIYIRALLDFDVGGASAGGVIAIILANIV
FT                   AIFLIRTVAKNLET"
FT   gene            712895..713716
FT                   /locus_tag="Csal_0635"
FT   CDS_pept        712895..713716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Csal_0635"
FT                   /product="mannitol ABC transporter membrane protein /
FT                   sorbitol ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Csal_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57997"
FT                   /db_xref="GOA:Q1QZW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QZW1"
FT                   /protein_id="