(data stored in ACNUC7421 zone)

EMBL: CP000301

ID   CP000301; SV 1; circular; genomic DNA; STD; PRO; 5513844 BP.
XX
AC   CP000301; AALR01000000-AALR01000050;
XX
PR   Project:PRJNA15750;
XX
DT   22-MAR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Rhodopseudomonas palustris BisB18, complete genome.
XX
KW   .
XX
OS   Rhodopseudomonas palustris BisB18
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Rhodopseudomonas.
XX
RN   [1]
RP   1-5513844
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Pelletier D.A., Kyrpides N., Anderson I., Oda Y., Harwood C.S.,
RA   Richardson P.;
RT   "Complete sequence of Rhodopseudomonas palustris BisB18";
RL   Unpublished.
XX
RN   [2]
RP   1-5513844
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Pelletier D.A., Kyrpides N., Anderson I., Oda Y., Harwood C.S.,
RA   Richardson P.;
RT   ;
RL   Submitted (20-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 4fd240431bd6ddb3c4764eb1d89aa759.
DR   BioSample; SAMN02598337.
DR   EnsemblGenomes-Gn; EBG00001185428.
DR   EnsemblGenomes-Gn; EBG00001185429.
DR   EnsemblGenomes-Gn; EBG00001185430.
DR   EnsemblGenomes-Gn; EBG00001185431.
DR   EnsemblGenomes-Gn; EBG00001185432.
DR   EnsemblGenomes-Gn; EBG00001185433.
DR   EnsemblGenomes-Gn; EBG00001185434.
DR   EnsemblGenomes-Gn; EBG00001185435.
DR   EnsemblGenomes-Gn; EBG00001185436.
DR   EnsemblGenomes-Gn; EBG00001185437.
DR   EnsemblGenomes-Gn; EBG00001185438.
DR   EnsemblGenomes-Gn; EBG00001185439.
DR   EnsemblGenomes-Gn; EBG00001185440.
DR   EnsemblGenomes-Gn; EBG00001185441.
DR   EnsemblGenomes-Gn; EBG00001185442.
DR   EnsemblGenomes-Gn; EBG00001185443.
DR   EnsemblGenomes-Gn; EBG00001185444.
DR   EnsemblGenomes-Gn; EBG00001185445.
DR   EnsemblGenomes-Gn; EBG00001185446.
DR   EnsemblGenomes-Gn; EBG00001185447.
DR   EnsemblGenomes-Gn; EBG00001185448.
DR   EnsemblGenomes-Gn; EBG00001185449.
DR   EnsemblGenomes-Gn; EBG00001185450.
DR   EnsemblGenomes-Gn; EBG00001185451.
DR   EnsemblGenomes-Gn; EBG00001185452.
DR   EnsemblGenomes-Gn; EBG00001185453.
DR   EnsemblGenomes-Gn; EBG00001185454.
DR   EnsemblGenomes-Gn; EBG00001185455.
DR   EnsemblGenomes-Gn; EBG00001185456.
DR   EnsemblGenomes-Gn; EBG00001185457.
DR   EnsemblGenomes-Gn; EBG00001185458.
DR   EnsemblGenomes-Gn; EBG00001185459.
DR   EnsemblGenomes-Gn; EBG00001185460.
DR   EnsemblGenomes-Gn; EBG00001185461.
DR   EnsemblGenomes-Gn; EBG00001185462.
DR   EnsemblGenomes-Gn; EBG00001185463.
DR   EnsemblGenomes-Gn; EBG00001185464.
DR   EnsemblGenomes-Gn; EBG00001185465.
DR   EnsemblGenomes-Gn; EBG00001185466.
DR   EnsemblGenomes-Gn; EBG00001185467.
DR   EnsemblGenomes-Gn; EBG00001185468.
DR   EnsemblGenomes-Gn; EBG00001185469.
DR   EnsemblGenomes-Gn; EBG00001185470.
DR   EnsemblGenomes-Gn; EBG00001185471.
DR   EnsemblGenomes-Gn; EBG00001185472.
DR   EnsemblGenomes-Gn; EBG00001185473.
DR   EnsemblGenomes-Gn; EBG00001185474.
DR   EnsemblGenomes-Gn; EBG00001185475.
DR   EnsemblGenomes-Gn; EBG00001185476.
DR   EnsemblGenomes-Gn; EBG00001185477.
DR   EnsemblGenomes-Gn; EBG00001185478.
DR   EnsemblGenomes-Gn; EBG00001185479.
DR   EnsemblGenomes-Gn; EBG00001185480.
DR   EnsemblGenomes-Gn; EBG00001185481.
DR   EnsemblGenomes-Gn; EBG00001185482.
DR   EnsemblGenomes-Gn; EBG00001185483.
DR   EnsemblGenomes-Gn; EBG00001185484.
DR   EnsemblGenomes-Gn; EBG00001185485.
DR   EnsemblGenomes-Gn; EBG00001185486.
DR   EnsemblGenomes-Gn; EBG00001185487.
DR   EnsemblGenomes-Gn; EBG00001185488.
DR   EnsemblGenomes-Gn; EBG00001185489.
DR   EnsemblGenomes-Gn; EBG00001185490.
DR   EnsemblGenomes-Gn; EBG00001185491.
DR   EnsemblGenomes-Gn; EBG00001185492.
DR   EnsemblGenomes-Gn; EBG00001185493.
DR   EnsemblGenomes-Gn; EBG00001185494.
DR   EnsemblGenomes-Gn; EBG00001185495.
DR   EnsemblGenomes-Gn; EBG00001185496.
DR   EnsemblGenomes-Gn; EBG00001185497.
DR   EnsemblGenomes-Gn; EBG00001185498.
DR   EnsemblGenomes-Gn; EBG00001185499.
DR   EnsemblGenomes-Gn; RPC_R0001.
DR   EnsemblGenomes-Gn; RPC_R0002.
DR   EnsemblGenomes-Gn; RPC_R0003.
DR   EnsemblGenomes-Gn; RPC_R0004.
DR   EnsemblGenomes-Gn; RPC_R0005.
DR   EnsemblGenomes-Gn; RPC_R0007.
DR   EnsemblGenomes-Gn; RPC_R0008.
DR   EnsemblGenomes-Gn; RPC_R0009.
DR   EnsemblGenomes-Gn; RPC_R0010.
DR   EnsemblGenomes-Gn; RPC_R0013.
DR   EnsemblGenomes-Gn; RPC_R0014.
DR   EnsemblGenomes-Gn; RPC_R0015.
DR   EnsemblGenomes-Gn; RPC_R0016.
DR   EnsemblGenomes-Gn; RPC_R0018.
DR   EnsemblGenomes-Gn; RPC_R0019.
DR   EnsemblGenomes-Gn; RPC_R0020.
DR   EnsemblGenomes-Gn; RPC_R0021.
DR   EnsemblGenomes-Gn; RPC_R0022.
DR   EnsemblGenomes-Gn; RPC_R0027.
DR   EnsemblGenomes-Gn; RPC_R0029.
DR   EnsemblGenomes-Gn; RPC_R0030.
DR   EnsemblGenomes-Gn; RPC_R0031.
DR   EnsemblGenomes-Gn; RPC_R0032.
DR   EnsemblGenomes-Gn; RPC_R0033.
DR   EnsemblGenomes-Gn; RPC_R0034.
DR   EnsemblGenomes-Gn; RPC_R0035.
DR   EnsemblGenomes-Gn; RPC_R0036.
DR   EnsemblGenomes-Gn; RPC_R0037.
DR   EnsemblGenomes-Gn; RPC_R0038.
DR   EnsemblGenomes-Gn; RPC_R0039.
DR   EnsemblGenomes-Gn; RPC_R0040.
DR   EnsemblGenomes-Gn; RPC_R0042.
DR   EnsemblGenomes-Gn; RPC_R0044.
DR   EnsemblGenomes-Gn; RPC_R0045.
DR   EnsemblGenomes-Gn; RPC_R0046.
DR   EnsemblGenomes-Gn; RPC_R0047.
DR   EnsemblGenomes-Gn; RPC_R0048.
DR   EnsemblGenomes-Gn; RPC_R0051.
DR   EnsemblGenomes-Gn; RPC_R0052.
DR   EnsemblGenomes-Gn; RPC_R0053.
DR   EnsemblGenomes-Gn; RPC_R0054.
DR   EnsemblGenomes-Gn; RPC_R0056.
DR   EnsemblGenomes-Gn; RPC_R0057.
DR   EnsemblGenomes-Gn; RPC_R0058.
DR   EnsemblGenomes-Gn; RPC_R0059.
DR   EnsemblGenomes-Gn; RPC_R0060.
DR   EnsemblGenomes-Gn; RPC_R0061.
DR   EnsemblGenomes-Gn; RPC_R0062.
DR   EnsemblGenomes-Gn; RPC_R0063.
DR   EnsemblGenomes-Gn; RPC_R0064.
DR   EnsemblGenomes-Gn; RPC_R0065.
DR   EnsemblGenomes-Gn; RPC_R0066.
DR   EnsemblGenomes-Gn; RPC_R0067.
DR   EnsemblGenomes-Gn; RPC_R0068.
DR   EnsemblGenomes-Gn; RPC_R0069.
DR   EnsemblGenomes-Gn; RPC_R0070.
DR   EnsemblGenomes-Gn; RPC_R0073.
DR   EnsemblGenomes-Tr; EBT00001764082.
DR   EnsemblGenomes-Tr; EBT00001764083.
DR   EnsemblGenomes-Tr; EBT00001764084.
DR   EnsemblGenomes-Tr; EBT00001764085.
DR   EnsemblGenomes-Tr; EBT00001764086.
DR   EnsemblGenomes-Tr; EBT00001764087.
DR   EnsemblGenomes-Tr; EBT00001764088.
DR   EnsemblGenomes-Tr; EBT00001764089.
DR   EnsemblGenomes-Tr; EBT00001764090.
DR   EnsemblGenomes-Tr; EBT00001764091.
DR   EnsemblGenomes-Tr; EBT00001764092.
DR   EnsemblGenomes-Tr; EBT00001764093.
DR   EnsemblGenomes-Tr; EBT00001764094.
DR   EnsemblGenomes-Tr; EBT00001764095.
DR   EnsemblGenomes-Tr; EBT00001764096.
DR   EnsemblGenomes-Tr; EBT00001764097.
DR   EnsemblGenomes-Tr; EBT00001764098.
DR   EnsemblGenomes-Tr; EBT00001764099.
DR   EnsemblGenomes-Tr; EBT00001764100.
DR   EnsemblGenomes-Tr; EBT00001764101.
DR   EnsemblGenomes-Tr; EBT00001764102.
DR   EnsemblGenomes-Tr; EBT00001764103.
DR   EnsemblGenomes-Tr; EBT00001764104.
DR   EnsemblGenomes-Tr; EBT00001764105.
DR   EnsemblGenomes-Tr; EBT00001764106.
DR   EnsemblGenomes-Tr; EBT00001764107.
DR   EnsemblGenomes-Tr; EBT00001764108.
DR   EnsemblGenomes-Tr; EBT00001764109.
DR   EnsemblGenomes-Tr; EBT00001764110.
DR   EnsemblGenomes-Tr; EBT00001764111.
DR   EnsemblGenomes-Tr; EBT00001764112.
DR   EnsemblGenomes-Tr; EBT00001764113.
DR   EnsemblGenomes-Tr; EBT00001764114.
DR   EnsemblGenomes-Tr; EBT00001764115.
DR   EnsemblGenomes-Tr; EBT00001764116.
DR   EnsemblGenomes-Tr; EBT00001764117.
DR   EnsemblGenomes-Tr; EBT00001764118.
DR   EnsemblGenomes-Tr; EBT00001764119.
DR   EnsemblGenomes-Tr; EBT00001764120.
DR   EnsemblGenomes-Tr; EBT00001764121.
DR   EnsemblGenomes-Tr; EBT00001764122.
DR   EnsemblGenomes-Tr; EBT00001764123.
DR   EnsemblGenomes-Tr; EBT00001764124.
DR   EnsemblGenomes-Tr; EBT00001764125.
DR   EnsemblGenomes-Tr; EBT00001764126.
DR   EnsemblGenomes-Tr; EBT00001764127.
DR   EnsemblGenomes-Tr; EBT00001764128.
DR   EnsemblGenomes-Tr; EBT00001764129.
DR   EnsemblGenomes-Tr; EBT00001764130.
DR   EnsemblGenomes-Tr; EBT00001764131.
DR   EnsemblGenomes-Tr; EBT00001764132.
DR   EnsemblGenomes-Tr; EBT00001764133.
DR   EnsemblGenomes-Tr; EBT00001764134.
DR   EnsemblGenomes-Tr; EBT00001764135.
DR   EnsemblGenomes-Tr; EBT00001764136.
DR   EnsemblGenomes-Tr; EBT00001764137.
DR   EnsemblGenomes-Tr; EBT00001764138.
DR   EnsemblGenomes-Tr; EBT00001764139.
DR   EnsemblGenomes-Tr; EBT00001764140.
DR   EnsemblGenomes-Tr; EBT00001764141.
DR   EnsemblGenomes-Tr; EBT00001764142.
DR   EnsemblGenomes-Tr; EBT00001764143.
DR   EnsemblGenomes-Tr; EBT00001764144.
DR   EnsemblGenomes-Tr; EBT00001764145.
DR   EnsemblGenomes-Tr; EBT00001764146.
DR   EnsemblGenomes-Tr; EBT00001764147.
DR   EnsemblGenomes-Tr; EBT00001764148.
DR   EnsemblGenomes-Tr; EBT00001764149.
DR   EnsemblGenomes-Tr; EBT00001764150.
DR   EnsemblGenomes-Tr; EBT00001764151.
DR   EnsemblGenomes-Tr; EBT00001764152.
DR   EnsemblGenomes-Tr; EBT00001764153.
DR   EnsemblGenomes-Tr; RPC_R0001-1.
DR   EnsemblGenomes-Tr; RPC_R0002-1.
DR   EnsemblGenomes-Tr; RPC_R0003-1.
DR   EnsemblGenomes-Tr; RPC_R0004-1.
DR   EnsemblGenomes-Tr; RPC_R0005-1.
DR   EnsemblGenomes-Tr; RPC_R0007-1.
DR   EnsemblGenomes-Tr; RPC_R0008-1.
DR   EnsemblGenomes-Tr; RPC_R0009-1.
DR   EnsemblGenomes-Tr; RPC_R0010-1.
DR   EnsemblGenomes-Tr; RPC_R0013-1.
DR   EnsemblGenomes-Tr; RPC_R0014-1.
DR   EnsemblGenomes-Tr; RPC_R0015-1.
DR   EnsemblGenomes-Tr; RPC_R0016-1.
DR   EnsemblGenomes-Tr; RPC_R0018-1.
DR   EnsemblGenomes-Tr; RPC_R0019-1.
DR   EnsemblGenomes-Tr; RPC_R0020-1.
DR   EnsemblGenomes-Tr; RPC_R0021-1.
DR   EnsemblGenomes-Tr; RPC_R0022-1.
DR   EnsemblGenomes-Tr; RPC_R0027-1.
DR   EnsemblGenomes-Tr; RPC_R0029-1.
DR   EnsemblGenomes-Tr; RPC_R0030-1.
DR   EnsemblGenomes-Tr; RPC_R0031-1.
DR   EnsemblGenomes-Tr; RPC_R0032-1.
DR   EnsemblGenomes-Tr; RPC_R0033-1.
DR   EnsemblGenomes-Tr; RPC_R0034-1.
DR   EnsemblGenomes-Tr; RPC_R0035-1.
DR   EnsemblGenomes-Tr; RPC_R0036-1.
DR   EnsemblGenomes-Tr; RPC_R0037-1.
DR   EnsemblGenomes-Tr; RPC_R0038-1.
DR   EnsemblGenomes-Tr; RPC_R0039-1.
DR   EnsemblGenomes-Tr; RPC_R0040-1.
DR   EnsemblGenomes-Tr; RPC_R0042-1.
DR   EnsemblGenomes-Tr; RPC_R0044-1.
DR   EnsemblGenomes-Tr; RPC_R0045-1.
DR   EnsemblGenomes-Tr; RPC_R0046-1.
DR   EnsemblGenomes-Tr; RPC_R0047-1.
DR   EnsemblGenomes-Tr; RPC_R0048-1.
DR   EnsemblGenomes-Tr; RPC_R0051-1.
DR   EnsemblGenomes-Tr; RPC_R0052-1.
DR   EnsemblGenomes-Tr; RPC_R0053-1.
DR   EnsemblGenomes-Tr; RPC_R0054-1.
DR   EnsemblGenomes-Tr; RPC_R0056-1.
DR   EnsemblGenomes-Tr; RPC_R0057-1.
DR   EnsemblGenomes-Tr; RPC_R0058-1.
DR   EnsemblGenomes-Tr; RPC_R0059-1.
DR   EnsemblGenomes-Tr; RPC_R0060-1.
DR   EnsemblGenomes-Tr; RPC_R0061-1.
DR   EnsemblGenomes-Tr; RPC_R0062-1.
DR   EnsemblGenomes-Tr; RPC_R0063-1.
DR   EnsemblGenomes-Tr; RPC_R0064-1.
DR   EnsemblGenomes-Tr; RPC_R0065-1.
DR   EnsemblGenomes-Tr; RPC_R0066-1.
DR   EnsemblGenomes-Tr; RPC_R0067-1.
DR   EnsemblGenomes-Tr; RPC_R0068-1.
DR   EnsemblGenomes-Tr; RPC_R0069-1.
DR   EnsemblGenomes-Tr; RPC_R0070-1.
DR   EnsemblGenomes-Tr; RPC_R0073-1.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC2587559; 19020098.
DR   EuropePMC; PMC2620714; 19011059.
DR   EuropePMC; PMC2786518; 19801478.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00485; K_chan_RES.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000301.
DR   SILVA-SSU; CP000301.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000203
CC   Source DNA and bacteria available from Caroline S. Harwood
CC   (csh5@u.washington.edu)
CC   Contacts: Caroline S. Harwood (csh5@u.washington.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5513844
FT                   /organism="Rhodopseudomonas palustris BisB18"
FT                   /strain="BisB18"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:316056"
FT   gene            758..2179
FT                   /locus_tag="RPC_0001"
FT   CDS_pept        758..2179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85580"
FT                   /db_xref="GOA:Q21DF6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21DF6"
FT                   /protein_id="ABD85580.1"
FT                   /translation="MTNIEQDRWSRVKGRLRSSVGEDVYSSWFARMDLESVQPESVHLS
FT                   VPTRFLKSWIQTHYSDRVLSCWQAEMPQVHRVDLTVRTAMRCAAPAKDAPAHAEPRRDD
FT                   GRPAPELRATAIAPVSATHEALGGSPLDPRLTFGSFVIGRSNTLAHAAARQVAEGRRGD
FT                   PVMFNPLYIHSGVGLGKTHLLQAVTWAGNSGTERKVLYLTAEKFMYGFVAALKSQTALA
FT                   FKEALRGIDVLVIDDLQFLQGKTTQAEFCHTLNALIDAGRQVVIAADRPPSDLESLDER
FT                   VRSRLAGGLVVEMASLGEDLRLGILKSRVTAARAHHASFDVPLPVLEYLARTITHNGRD
FT                   LEGAINRLLAHSKLNAQPVTLEMAEREIRDLVRPQEPKRIKIEDIQRVVARQYNVSRSD
FT                   LLSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEGLVAKDT
FT                   ALSDEVELLKRQLQE"
FT   gene            2475..3593
FT                   /locus_tag="RPC_0002"
FT   CDS_pept        2475..3593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85581"
FT                   /db_xref="GOA:Q21DF5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DF5"
FT                   /protein_id="ABD85581.1"
FT                   /translation="MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLLRAEKGRLSLK
FT                   ATDLDLEVTETLPAETATGGSTTVPAHMFYDIVRKLPDGSQIVLESDGERAVLAIRAGR
FT                   SRFTLQTLPENDFPDLAAGEMTHSFTLTAADVKRLIDRTQFAISTEETRYYLNGIYLHG
FT                   AGTAAAATLRAVATDGHRLAQVDLPLPSGAAGMPGVIVPRKTVGEVQRLIEDTEAAVGI
FT                   ELSVGKIRFTLGDVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEGE
FT                   VAVLKLADPGSPTLVQDRDAKGALYVLMPMRV"
FT   gene            3768..4907
FT                   /locus_tag="RPC_0003"
FT   CDS_pept        3768..4907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85582"
FT                   /db_xref="GOA:Q21DF4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DF4"
FT                   /protein_id="ABD85582.1"
FT                   /translation="MTVSKIHRLTLTHFRNYRAASVTVRGDVVVLVGPNGAGKTNCLEA
FT                   ISLLSPGRGLRRATLDDIADNHGDGSWAVSAEVEGALGLATLGTGIDPRTEAAATTRRC
FT                   RIDRENVGSAAAFGDHLRMVWLTPAMDGLFLGAASERRRFFDRLVLAIDSQHSSRVSAL
FT                   DRSLRSRNRLLEQRSHDSHWLDAIERETAELAVAVAAMRGETVTRLAAALAQRSADSAF
FT                   PSATIALDGWMENALRSEPATAVEDRYRTSLRDNRARDAAAGRTLDGPHLTDLRVIYTP
FT                   KNMPARDASTGEQKALLIGLVLAHAYLVAEMTGITPLLLLDEVVAHLDPSRRKALFGEL
FT                   ARLGAQVWMTGADPAAFVDLGEGGELFEVDNGRIAPHGG"
FT   gene            5106..6350
FT                   /locus_tag="RPC_0004"
FT   CDS_pept        5106..6350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85583"
FT                   /db_xref="GOA:Q21DF3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DF3"
FT                   /protein_id="ABD85583.1"
FT                   /translation="MYIASSNSSAGNSSIQSQAADQPARQKAGSGASDGPANDAASSKA
FT                   AANPATRIEISSYARRLLARASAEQAVVAQLLAQINALRHGTSSVGAPSGPGDYATITT
FT                   GSGDDVIEAARYATINAGDGNNTISTYDYATISTGAGNDAIDSYGYATIDAGGGDNRVS
FT                   TYDHSTVSTGAGNDVINTYGWSTVNAGDGNNTVSTYNHSTVATGAGDDVISTYGWSTVN
FT                   AGGGNNTVSTYSHSTVATGAGDDVISTYGWSTVNAGDGNNRVSTYNHSTVATGSGNDVI
FT                   STYDHSTIDAGAGNDVISTSNHSTIDAGAGNDVITAGGFSTITGGRGDDSIQIDGWAAT
FT                   VAFGQGDGHDTIRSGRDLTLAISGYSQSDVTVTRKDGTAVISFKGSEDSIVLDLAGNGS
FT                   AKLSFADHSTLNVSA"
FT   sig_peptide     5106..5165
FT                   /locus_tag="RPC_0004"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.816) with cleavage site probability 0.814 at
FT                   residue 20"
FT   gene            6602..9043
FT                   /locus_tag="RPC_0005"
FT   CDS_pept        6602..9043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85584"
FT                   /db_xref="GOA:Q21DF2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DF2"
FT                   /protein_id="ABD85584.1"
FT                   /translation="MTEPARQPIAEPEASAPVEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGHATAVEVVLNADGSVTVRDDGRGIPVGIHKGEGIS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLQLRVWRDGKEHFIEFAHG
FT                   DAVAPLVVVGDSNGKRGTEVTFLASPETFTHIEYDFATLEHRLRELAFLNSGVTIVLSD
FT                   LRHPVEKREEMMYRGGVEEFVKYLDRNKKAMVPAPIMIAAELNGIGVEAALWWNDSYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRGALTRQVNGYADVIAKKEKIALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVLNEALAAWFEEHPAEAKIIVGKVIEAGAAREA
FT                   ARKARELTRRKGALDIASLPGKLADCQERDPAKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERARFDKMLGSEQIGTLITALGTGIGRDDFDISKLRYHKIILMTDADVD
FT                   GAHIRTLLLTFFFRQMPSLIEGGFLYIAQPPLYKVTRGKSEQYLKDERALEDYLIETGL
FT                   DDCVFKLASGEDRSSRDLLALVEDARQIRGTLHNLHSRYNRSVVEQAAIAGVLNPRVTA
FT                   DLATANEAAAYIARRLDALADEVERGWVGRFVEGEGFSFERTVRGVKDVAMIDAALLSS
FT                   ADARKLDEYAVNLQEAYPRPGILRRKDTETPIHGPVSLFEAVTDAGRKGVALQRYKGLG
FT                   EMNPEQLWHTTLDTNARSLLQVKVREVDEADDIFTKLMGDVVEPRREFIQDNSLSANVD
FT                   V"
FT   gene            complement(9075..9695)
FT                   /locus_tag="RPC_0006"
FT   CDS_pept        complement(9075..9695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0006"
FT                   /product="protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85585"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DF1"
FT                   /protein_id="ABD85585.1"
FT                   /translation="MRPSHIPKIAPEAFFAWIAGQEGRYELVDGEVVMMAGAGRRHDHI
FT                   VVNLITALNLQTRGGRCQTFTGDTYVATSPATRRMPDLGVDCGTADDASLVADQPSLVV
FT                   EVLSPTTGGIDVTIKLAEYQSLPTLDYILLVDTASPKVHFHYRAQDRIWTAIVVEGLDA
FT                   AIRLDRLEVRLELRDIYAGLEFRPKPKLVEPASEAYEPGGSDP"
FT   gene            complement(9960..10469)
FT                   /locus_tag="RPC_0007"
FT   CDS_pept        complement(9960..10469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0007"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85586"
FT                   /db_xref="GOA:Q21DF0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DF0"
FT                   /protein_id="ABD85586.1"
FT                   /translation="MAELALPPVESHRRIDAIDRKILTVLQQDASLSVAEIGDRVGLSS
FT                   TPCWKRIQRLESDGVIMRRVALVDQNKIGLGLSVFVSIESGDHSDAWLKKFADAVSAMP
FT                   EVIEFYRMAGDVDYMLRVVVADMRAYDVFYKKLISAVALKNVTSRFAMEKIKSVTALPV
FT                   PALEVA"
FT   gene            complement(11386..11565)
FT                   /locus_tag="RPC_0008"
FT   CDS_pept        complement(11386..11565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0008"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85587"
FT                   /db_xref="GOA:Q21DE9"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE9"
FT                   /protein_id="ABD85587.1"
FT                   /translation="MEVMVFLVPLALCLGLVGLIGFLWSLRSGQYEDLDGAAWRAIFDD
FT                   EPPQPPAPVVPHKE"
FT   gene            complement(11556..13763)
FT                   /locus_tag="RPC_0009"
FT   CDS_pept        complement(11556..13763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0009"
FT                   /product="Copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85588"
FT                   /db_xref="GOA:Q21DE8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE8"
FT                   /protein_id="ABD85588.1"
FT                   /translation="MTTTLLTRDFSHYVKDVDAEIAHLDLAVEGVSCAGCMAKIERGLS
FT                   AMPDVTRARVNLTDRRLAIEWKKGALDPSQFIDRLAELGYKAYPFEPVRAELDEADRSK
FT                   FLLTCLGVAAFAAMNVMMLSVAVWAGSDMTQDTRDFFHWLSALVVLPCAAYAGQPFFTS
FT                   AFRALRARSVNMDVPICIGVTLALAMSVVETINHAEHAYFDAAIMLLTFLLAGRFLDQK
FT                   MRQRTRAVAGNLAALKAETATKFFGADEIREVPIAAIEPGDIVLLRPGQRCSVDGQVIE
FT                   GRSELDQSLITGETLHAQAERGTQVYAGTLNISGTLRVRVAAAAEGTLLSEISRLLENA
FT                   LQARSHYVRLADRASRLYAPLVHAAALLTMLGWVAWGASWHDAIVTAIAVLIITCPCAL
FT                   GLAIPAVQTVAAGAMFRAGVLLNSGDSIERVAGIDTIVFDKTGTLTLPELDVVNAASVP
FT                   DEVFSLAGQLALASHHPVAAAVARAVGAKSPLAEVVEEPGQGVRGFVGGQELRLGSPAY
FT                   CHAEALANEILSQDPEVSVVAFSRGSSEHYVFAVRQRLRPDAVSVIAALQKQGIAIEML
FT                   SGDREPAVRHAADTLGISIWQAGVKPADKIAHIEALKQQGRKVMMVGDGMNDAPSLAAA
FT                   SVSMSPISATHLSQATADLVFLGKELAPVLAAVDYSRKAMSLMRQNLALAIGYNVLAVP
FT                   IAIAGLTTPLIAAIAMSGSSVLVMLNAIRARHAGRRDSLWK"
FT   gene            complement(13773..14273)
FT                   /locus_tag="RPC_0010"
FT   CDS_pept        complement(13773..14273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0010"
FT                   /product="FixH"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85589"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="InterPro:IPR018037"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE7"
FT                   /protein_id="ABD85589.1"
FT                   /translation="MSKPVTSPRPLTGGVVLASLLAFFAVVLGVNMTMMLLAIETLPGT
FT                   EVDSAYSASIRYSNEIAAARDQAQRDWRVNARVERQPDGSASLRVEARDRNGAPLAGLT
FT                   FSGRLERPADKRADKEVILAEIGDGVYRGNAVGVSPGQWDLVIEGDSTGNRMFLSKNRL
FT                   VLN"
FT   sig_peptide     complement(14184..14273)
FT                   /locus_tag="RPC_0010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.732 at
FT                   residue 30"
FT   gene            complement(14295..15752)
FT                   /locus_tag="RPC_0011"
FT   CDS_pept        complement(14295..15752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0011"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85590"
FT                   /db_xref="GOA:Q21DE6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE6"
FT                   /protein_id="ABD85590.1"
FT                   /translation="MNKPVLPKDLQTDPDGPLYVAQKKIYPQSVSGTFRRIKWYLMAIC
FT                   LGIYYFLPFVRWNRGLGAPDQAVLIDLPNSRFYFFFIELWPQEIYYFTGLLIVAAITLF
FT                   LMNSLGGRVWCGYLCPQTVWTDLFYAVERLIEGDRRERMKKAAEGLTLQRGAELVLKHS
FT                   IWILIAWWTGGAWVLYFADAPTLVKELVTFQAPMIAYIWIGILTSTTYLLAGFMREQVC
FT                   VYMCPWPRIQAALTDEWALNVTYKYDRGEQRTSLKKAEQARAQGEKVGDCVDCNQCVAV
FT                   CPTGIDIRNGSQLDCIQCGLCIDACDAVMTKIGRETRLIGYDNDINIHRRMEGKPEVFR
FT                   MIRPRTMVYSALIVGVGAIMLYALLTRTLLDVNVLHDRNPLAVRLSDGSVRNAYTMRLL
FT                   NKRGFDRVVAIDVEGPADATVSVVGMDSITPERPMIVLGRDQTTELRVLVTSSPDAKLA
FT                   PSTPVIFHITDIGLGEVASAADNFVTP"
FT   gene            complement(15869..16750)
FT                   /locus_tag="RPC_0012"
FT   CDS_pept        complement(15869..16750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0012"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85591"
FT                   /db_xref="GOA:Q21DE5"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE5"
FT                   /protein_id="ABD85591.1"
FT                   /translation="MAEHDKHGTFDEVTGKHTTGHEWDGIEELNTPLPRWWVLTFYACI
FT                   IWSFAYWAVYPAWPLVQSYTTGWFNYSSRAEVAVELGKLEAIRGDKMAALATAPLADIE
FT                   KDPGMFAMARARGKAVFGDNCAACHGSGGAGSKGFPNLNDDDWLWGGTLEQIEQTLKYG
FT                   ARNGHPEAHEGQMLAFGKEGVLKPEEIATVANYVRSLSGLSTRPGVDVAAGGKIFAENC
FT                   TVCHGEDAKGNPDIGAPNLTDRIWLYGSEEATIIETITNGRAGVMPAWIDRLDPGTIKA
FT                   MAVYVHSLGGGK"
FT   gene            complement(16757..16921)
FT                   /locus_tag="RPC_0013"
FT   CDS_pept        complement(16757..16921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0013"
FT                   /product="Cbb3-type cytochrome oxidase component"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85592"
FT                   /db_xref="GOA:Q21DE4"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE4"
FT                   /protein_id="ABD85592.1"
FT                   /translation="MKAIVTADNWVSDFVLTLWTPLFVAIFIAIVAYALWPKNKSKFDA
FT                   AASMPLREE"
FT   gene            complement(16931..17668)
FT                   /locus_tag="RPC_0014"
FT   CDS_pept        complement(16931..17668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0014"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85593"
FT                   /db_xref="GOA:Q21DE3"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE3"
FT                   /protein_id="ABD85593.1"
FT                   /translation="MTTFWDRHKIFEKNSIVLIVGILAVIAIGGLVEITPLFYLKSTIE
FT                   KVDGVRPYTPLELAGRNIFVREGCYLCHSQMIRPLRDEVERYGHFSLAAESMYDHPFQW
FT                   GSKRTGPDLARVGGKYSDDWHVTHLKNPRSIVPQSVMPGYAFLARTEVDTDHIADHLRT
FT                   NRIVGVPYTDDEIANASADMKAQVNPDTPEAAELLKRYPKAVVRNFDGKDGNPTELDAL
FT                   ISYLQMLGTLVDFKLYNEKANLR"
FT   gene            complement(17680..19332)
FT                   /locus_tag="RPC_0015"
FT   CDS_pept        complement(17680..19332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0015"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85594"
FT                   /db_xref="GOA:Q21DE2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE2"
FT                   /protein_id="ABD85594.1"
FT                   /translation="MNQALTSKRMTIGEGGLLALFTVMVALCVLAVIKAQDSAFAFHAA
FT                   IGAAVSAWAVFAIFTRFSGRPAARPPQEINGVPNYNFGPVKFCSFMAMFWGIAGFSVGL
FT                   MIALQLAFPLLNFDIQWISFGRLRPLHTSAVVFAFGGNVLLATSLYVVQKTSRVRLAGD
FT                   LAPWFVVIGYNVFILIAGTGYLLGVTQSKEYAEPEWYSDALLTVVWVAYLLVFLMTLVK
FT                   RKEPHIFVANWFYLAFIITIAVLHLGNNPAVPVSWFGSKSYIAWGGVQDAMFQWWYGHN
FT                   AVGFFLTAGFLAIMYYFIPKRAERPIYSYRLSIIHFWALIFLYIWAGPHHLHYTALPDW
FT                   TQTLGMTFSIMLWMPSWGGMINGLMTLSGAWDKLRTDPVLRMLVVSVAFYGMSTFEGPM
FT                   MAIKVVNSLSHYTDWTVGHVHSGALGWVGFVSFGALYCLVPWVWNRKQLYSLKLVNWHF
FT                   WIATLGIVLYISAMWVSGILQGLMWRAYTSLGFLEYSFIESVEAMHPFYMIRAAGGGLF
FT                   LCGALIMAYNLWMTVRTGESSETQPSVALQAAE"
FT   sig_peptide     complement(19237..19332)
FT                   /locus_tag="RPC_0015"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.878) with cleavage site probability 0.718 at
FT                   residue 32"
FT   gene            complement(19586..20509)
FT                   /locus_tag="RPC_0016"
FT   CDS_pept        complement(19586..20509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0016"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85595"
FT                   /db_xref="GOA:Q21DE1"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE1"
FT                   /protein_id="ABD85595.1"
FT                   /translation="MRILVVGAGAIGGYFGGRLLQAGRDVTFLVRPKRAAELQTHGLVI
FT                   NSPHGDVTLRDPPVVLATELNQPFDLILLSCKAFDLDDAIASFAPAVGPGTAILPLLNG
FT                   IAHLDVLDRKFGADRVLGGQCVVAATLNAVRQVVQLNPMHSITFGERDGTVSARVEAIA
FT                   AILSGAMFEVHASPLILQEMWEKWVFLATLAGATCAMRATVGNVLAAPGGADFILGVLD
FT                   ECTAVASASGYAPRGPFLERTRGMVTAAGSPLTASMFRDIQAGAPIESEHVIGDLIARG
FT                   DAAKTPLPRLRVIFTHLQAYQLQRGG"
FT   gene            complement(20585..21322)
FT                   /locus_tag="RPC_0017"
FT   CDS_pept        complement(20585..21322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0017"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85596"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DE0"
FT                   /protein_id="ABD85596.1"
FT                   /translation="MQQRNATVAVIGAGDYIGAEIAKKFACEGFTVFAGRRDGGKLEPL
FT                   VQEIEAAGGSIVARSLDARQADQVAAFLEEADAHAPLDVCIFNVGANVNFPILDTTDRV
FT                   FRKVWEMACWAGFLAGRESARLMIPRGRGNIFFTGATASLRGGSGYAAFASAKFGLRAV
FT                   AQAMARELGPKNIHVAHLVIDSGVDTAWVRERREQLWGKEALDNPDLLMPPASVASSYW
FT                   QLYQQPKSAWTFEMEIRPFGEKW"
FT   gene            complement(21556..22167)
FT                   /locus_tag="RPC_0018"
FT   CDS_pept        complement(21556..22167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0018"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85597"
FT                   /db_xref="GOA:Q21DD9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD9"
FT                   /protein_id="ABD85597.1"
FT                   /translation="MSQPPPQFLFDFGSPNAYLAHQAIPEIERRIGVKFDYVPVLLGGI
FT                   FKATNNKSPAETLAGIKNKREFHELETQRFIRRYHVEPYVWNPHFPVNTLNLMRAAVAA
FT                   QLDGVFEPYIAAAFRHMWAEPKKMDDPELALQALKASGLDADKLFARAQQPEVKAKLID
FT                   NTQRAVERGAFGAPTFFVGDEMFFGKEQLREVEEMYGELD"
FT   gene            22380..23048
FT                   /locus_tag="RPC_0019"
FT   CDS_pept        22380..23048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0019"
FT                   /product="glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85598"
FT                   /db_xref="GOA:Q21DD8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD8"
FT                   /protein_id="ABD85598.1"
FT                   /translation="MLTVHHLNNSRSQRVLWLLEELGVPYEIVRYQRQPDMLAPPELRA
FT                   VHPLGKSPVITDNGATIAESGAIIDYIIAAYGNGRLIPPPDTPERLRYTYWLHYAEGSA
FT                   MPPLLLKLLFTMIPTRAPALLRPLVRMITTPVLTTFIEPQLKQHMAFWESELGKSEWFA
FT                   GSEFTAADVQMSFPLEAASARGGLDGEYPKTRALLERIHARPAYARALEKGGPYTIGKA
FT                   "
FT   gene            complement(23282..24178)
FT                   /locus_tag="RPC_0020"
FT   CDS_pept        complement(23282..24178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0020"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85599"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD7"
FT                   /protein_id="ABD85599.1"
FT                   /translation="MASLKGKTLFISGGSRGIGLAIALRAARDGANVAIAAKTAEPHPK
FT                   LQGTIYTAADEVRAAGGNALPILCDIRDEAQVIAAIDKTVGEFGGLDICVNNASAISLT
FT                   NSQNTDMKRFDLMMGINTRGTFMVSKYCIPHLKKAENPHILMLSPPLDMKPKWFEHSTA
FT                   YTLAKFGMSMCVLGLSGEQKRAGIAVNALWPRTTIATAAVGNLLGGDAMMRASRTPEIM
FT                   GDAAYEIFLKPSREFTGQFCIDDKVLYEAGVTDFERYRVDPSVPLMSDFFVPDDDVPPP
FT                   GVSVRTLPSVDAAKAKG"
FT   gene            complement(24297..26057)
FT                   /locus_tag="RPC_0021"
FT   CDS_pept        complement(24297..26057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0021"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85600"
FT                   /db_xref="GOA:Q21DD6"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD6"
FT                   /protein_id="ABD85600.1"
FT                   /translation="MRLSPPRSRCILALLRGVVVTALLALAGASAQAQDIRGGALPAVA
FT                   APAVVGSRGMVVAQERIAATIGRDVLAKGGNAVDAAVATGFAMAVTYPRAGNLGGGGFM
FT                   VIHRAKQNDDIALDYRETAPAAATRDMFLGADGKPDPAKSRDSALGIGVPGTVAGLALA
FT                   LEKYGSGKFSLAEILQPTIALARDGFEIADDTADTLPDWHKRLARWPATQKIFSRDDGT
FT                   SLQGGDRLVQRDLAVTLGAIAAQGQRGFYQGEVAEKLARGIAAAGGLITVDDLKSYQPV
FT                   IRTPLRGTYRGYDIVAMPLPSSGGTVLIETLNLLEGFQLRELPQGSAASLHLLIEAMKR
FT                   GYADRARYLGDPAFVNAPLAALLSKDYAKKQRAGIDPQRATPWTEALPALPPREGENTT
FT                   HYSVVDADGNAVSNTYTLNFSYGIGLIAAGTGVLLNNELDDFTAAPGASNAFGLVGFEA
FT                   NLPGPGKRPLSSMSPTLVLKDGRVVLVTGSPGGSRIISTTLQVIVDVLDYDMDIAAAVA
FT                   APRLHHQWLPDEVRIEQGFPEAVIAALRAKGHVVVAPLGQTSANSIFVAKDGVRGAPDP
FT                   RTRGAAAVAE"
FT   sig_peptide     complement(25956..26057)
FT                   /locus_tag="RPC_0021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.944 at
FT                   residue 34"
FT   gene            26145..27536
FT                   /locus_tag="RPC_0022"
FT   CDS_pept        26145..27536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0022"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85601"
FT                   /db_xref="GOA:Q21DD5"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD5"
FT                   /protein_id="ABD85601.1"
FT                   /translation="MADSLAAGATRAAAAPRYPRRSAVVGWILFDWAAQPYFTLITTFI
FT                   FAPYFTTFVAADPAQGQSLWGFATGAAGLIIALASPVLGAIADASGRRKPWIFGFGALL
FT                   VIGSCAMWFGRPGDPTVILPLLIAYGVATIGVEFATVFNNAMMPHLVPPDQIGRLSGTG
FT                   WATGYVGGILSLILVLGFLAGSPDTGRTLFGLLPWFGLDPLTHQGDRITGPLTGIWFVV
FT                   FVLPMFLLTPDFPAKRKLGAAVREGLRELGQTLRELPKHRSMATFLLANMIYTDGLVSL
FT                   FAFGGIYAAGTFGWHTLQIGSFGILLAIAATFGAYLGGKLDDALGPKRVIAGSMMLLLI
FT                   AVLGILLVERDSILFIAVTPPQPGGALFAAPAERAYLLLGCLIGIAGGPLQAASRSLLI
FT                   HMAPKQRIAQFFGLFALTGKVTSFIGPMLIGAVTAITMSQKAGMAVLVLFFVAGLVLLA
FT                   KVRNK"
FT   gene            complement(27674..29266)
FT                   /locus_tag="RPC_0023"
FT   CDS_pept        complement(27674..29266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0023"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85602"
FT                   /db_xref="GOA:Q21DD4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD4"
FT                   /protein_id="ABD85602.1"
FT                   /translation="MTDHPRRVTRALLSVSDKAGLIDFARALVDHGVELVSTGGTAKAI
FT                   AAAGLAVKDVSELTGFPEMMDGRVKTLHPKVHGGLLAVRGNAEHVKAMADHDIAPIDLL
FT                   VVNLYPFEATVDKGAGYEDCIENIDIGGPAMIRAAAKNHDDVAVVVEAADYQAVLDELA
FT                   ANKGATTLTLRKKLAAKAYARTAAYDAAISNWFADQLKTAAPDFRAIGGRLIQSLRYGE
FT                   NPHQSAAFYRTPDHCPGVATARQIQGKELSYNNINDTDAAYECIGEFDATRTAACVIVK
FT                   HANPCGVAEGSSLLAAYRSALACDSTSAFGGIVALNRTLDAEAARAITEIFTEVIIAPD
FT                   ATDEAIAIVAAKKNLRLLLAGQLPDPRAPGLTYKTVAGGLLVQSRDNAVVEDMALKAVT
FT                   KRQPTEAELRDLKFAFRVAKHVKSNTIVYAKDLATVGIGAGQMSRVDSARIAARKAEDA
FT                   AAELKLAAPMTKGSVVASDAFFPFADGMLACIEAGATAVIQPGGSVRDDEVIKAADDAG
FT                   IAMVFTGVRHFRH"
FT   gene            complement(29426..31204)
FT                   /locus_tag="RPC_0024"
FT   CDS_pept        complement(29426..31204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0024"
FT                   /product="Heparinase II/III-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85603"
FT                   /db_xref="GOA:Q21DD3"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD3"
FT                   /protein_id="ABD85603.1"
FT                   /translation="MSVAYRRRLSTLILGRFARNLMARASAGSVALSRLWPGRTDRLII
FT                   APHDLRTADATRAAEIYAGRFVFAGKIVTCHGRSIFDYAPPSDDWEVALLGFGWLRHLR
FT                   AADTAITRANARSLVDDWISNMSHNRPVGRRPDVLARRVISLLSQAPLVLSDTDGRFYR
FT                   RYLRGLTREIRSLRYITPDIADGVPRLQVLIALCYASLCLANQARHIRAASRKLSDELQ
FT                   RQILADGGHISRNPGALIELMIDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRHG
FT                   DGSFALFNGMSSAPSDLLATLLAYDDTHGSPMSSMPHTGFQRLDAGTMTVIVDTGPPPP
FT                   PAVSDEAHAGCLSFEMSVAGCRVVVNCGIPATGRENWRSFARGTAAHSTVTYRETSSCQ
FT                   FVERSSMKRFLNGAPIVSGPVHVEHYREVGAEGVMLNMSHDGYQSRFGVTHRRVLMASV
FT                   DGSRLDGEDTVAAAPGARIKGNDASYAVRFHLHPAVKASRLTDARGVMLVLPNREVWTF
FT                   EALDDKVELEDSVFLAGNDGPRRTVQIVIRQDARHTSSIRWNFVRSPSSPAATAARRNN
FT                   RGQAELPLPPPTPSRS"
FT   gene            complement(31482..32834)
FT                   /locus_tag="RPC_0025"
FT   CDS_pept        complement(31482..32834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0025"
FT                   /product="Fmu (Sun)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85604"
FT                   /db_xref="GOA:Q21DD2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD2"
FT                   /protein_id="ABD85604.1"
FT                   /translation="MSSTRFAPHAEVPGLAARRIAADILDGVLHKHRTLDDQLEGAAAH
FT                   PGLKTLSDRDRALMRRLVATILRRLGTLGHVLSRMLDRGLPTDAPRAQSALLIGAAQIL
FT                   WMEVPDHAAVDLSVRLVQSDRRAAKYAGLVNAVLRRCAREGQPLIDEVQGQSLDVPPWL
FT                   LARWSAHYGADTARAIARAIGEEPSLDLSVKSDAEAWASRLHGEVLPTGTVRTLLQGSV
FT                   KMLPGFDDGQWWVQDAAAALPARLFGDLTGKSVADLCAAPGGKTAQLCNAGAWVTAIDR
FT                   SQSRVARLRENLGRLGLPAETAVADAAEWPGNGGDGFDAVLLDAPCSSTGTIRRHPDVA
FT                   WLKQEADIGALAAQQQRLLHKAVSLLKPGGTLVYCTCSLEPEEGEVAIAALLAGNSGMR
FT                   RAPVDSSEVAGLGDLITPDGALRTLPCHLPHPDPRLGGLDGFYAARLVKPL"
FT   gene            33124..33357
FT                   /locus_tag="RPC_0026"
FT   CDS_pept        33124..33357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0026"
FT                   /product="protein of unknown function DUF1674"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85605"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD1"
FT                   /protein_id="ABD85605.1"
FT                   /translation="MTDESETTAADTAAPPRKELPPAAQRALAEAAARRAAADAKALAG
FT                   SAAHPTQEVNGPKGPEPTRYGDWETKGIASDF"
FT   gene            complement(33376..33642)
FT                   /locus_tag="RPC_0027"
FT   CDS_pept        complement(33376..33642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0027"
FT                   /product="Addiction module toxin, Txe/YoeB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85606"
FT                   /db_xref="GOA:Q21DD0"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DD0"
FT                   /protein_id="ABD85606.1"
FT                   /translation="MKLVWTEDAWRDYLHWQATDQKLMAAINDLIRDIKRDPFKGIGKP
FT                   EPLKHTLKGWWSRRISGEHRLIYRVVGKAEDQQIEIAQCRYHY"
FT   gene            complement(33653..33913)
FT                   /locus_tag="RPC_0028"
FT   CDS_pept        complement(33653..33913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0028"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85607"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC9"
FT                   /protein_id="ABD85607.1"
FT                   /translation="MSHISYSELRKNLASYMDEVCDSRAPLHVTRQNARTVVMMAEDDY
FT                   DGLMETVHLLKSPANAVRLLRSIEEADAGRLTARELIEPTE"
FT   gene            34034..34624
FT                   /locus_tag="RPC_0029"
FT   CDS_pept        34034..34624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0029"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85608"
FT                   /db_xref="GOA:Q21DC8"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC8"
FT                   /protein_id="ABD85608.1"
FT                   /translation="MYPYFRTNPARIARSPWRGRFSAALPWVFVLGMAAGTMLPARHWI
FT                   HWPFPSATDSSSSAQRDRESEAIWQRAGSAGARHPVDVIRTIDGDTFEARVHLWPGLDM
FT                   TTRVRLRGIDAPELKAQCAQELKQAEAAGEALHALLGEGEVTIYNIGPDKYQGRVVADA
FT                   ATKRTPNLSAALLAGGYARAYEGGHRNGWCAGR"
FT   gene            complement(34627..36375)
FT                   /locus_tag="RPC_0030"
FT   CDS_pept        complement(34627..36375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0030"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85609"
FT                   /db_xref="GOA:Q21DC7"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC7"
FT                   /protein_id="ABD85609.1"
FT                   /translation="MIKPLAATFALLMSGTAAFAQTIYPIDRADILAGSRFDFKVEFPG
FT                   VVDPAKLKVTVNGADTTGAFGRAAEFIVREDGKEQSALLLREVALTKPGRYVIEASDGS
FT                   LSRSVAWNVYDTGPRKAKNVILFIGDGLSPAHRIAARLLSKGIVEGKSLGKLAIDDMPQ
FT                   MALVATAGSDSIITDSANAASAYATGHKAAVNAMGVYADRTASPFDDPQVETIGSLAKR
FT                   RLGLAVGIVTNTEIEDATPAAMLAHTRRRAAYDEIVAQYFAAKPDVLMGGGAANFLPKG
FT                   APGSKRRDDADYVAKFRDAGYTVATNAAELGAAKPDTQKLLGLFAPGNMDGVLDRKLLK
FT                   GGGVKKNPNQPDLTEQLGAALSVLSKNPNGFFLMVESGLIDKYAHALDMERAVYDTIML
FT                   DNAVRQARDWSAARGDDTLILVLADHNHPNALVGTINDDMTTVPNVPLRERVGVYEKAG
FT                   FPDYPAPDKDGYPSRVDVNRRLAIFSASLPDHYETYRPKLDNPNEPTEKAEAGTFKANE
FT                   KYKDVPGAVLRFGNLPAMMNASVHSGEDVILTAVGPGSDRVHGSMDNTEVFRVIADALG
FT                   LAPAKD"
FT   sig_peptide     complement(36313..36375)
FT                   /locus_tag="RPC_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(36651..37988)
FT                   /locus_tag="RPC_0031"
FT   CDS_pept        complement(36651..37988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0031"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85610"
FT                   /db_xref="GOA:Q21DC6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21DC6"
FT                   /protein_id="ABD85610.1"
FT                   /translation="MSTILKSLPKGENVGIAFSGGLDTSAALLWMKQKGARVFAYTANL
FT                   GQPDEADYDEIPRKAMEFGAEKARLVDCRSQLVHEGIAAIQSGAFHVSTGGVAYFNTTP
FT                   LGRAVTGTMLVSAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNPDLRIYKPWLDQQFI
FT                   DELGGRAEMSAFMTAHGFAYKMSSEKAYSTDSNLLGATHEAKDLEHLDSGIRIVNPIMG
FT                   VPFWRDDCAVAAETVSVRFAEGQPVALNGKTFTDPVALFLEANAIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPAMALLHIAYERLVTGIHNEDTIEQYRISGMRLGRLLYQGRWFDSQ
FT                   ALMLRETAQRWVARAITGEVTLELRRGNDYSILNTQSPNLTYAPERLSMEKVEDAPFTP
FT                   GDRIGQLTMRNLDITDTRAKLDLYAKSGLLSAGEGSHIPKLESDKG"
FT   gene            complement(38093..38875)
FT                   /locus_tag="RPC_0032"
FT   CDS_pept        complement(38093..38875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0032"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85611"
FT                   /db_xref="GOA:Q21DC5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC5"
FT                   /protein_id="ABD85611.1"
FT                   /translation="MNRTGLLIALGLFAGIGLLFGIFPGLDLWLAGLFYDAETKSFPLK
FT                   AVAWASFARDAAMWIAWAFAAPSIVALIIKLGWPDRPLLVRGRTVMFLLVSITLSAGIL
FT                   TNLTFKSHWGRPRPIFVTEFSGQNHFVPWWDPRGDCPKNCSFFSGEGATAFWTYAPAAL
FT                   APAPWRPAAYAAATVFGVVTSGLRMAFGGHFFTDVAIAGLVTFLVIWLLHGLIYRWAPT
FT                   RFSDARIDAALTRFAWPGYRWRQKRRGRDVGPAPVASA"
FT   sig_peptide     complement(38810..38875)
FT                   /locus_tag="RPC_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.676) with cleavage site probability 0.495 at
FT                   residue 22"
FT   gene            complement(39025..39498)
FT                   /locus_tag="RPC_0033"
FT   CDS_pept        complement(39025..39498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85612"
FT                   /db_xref="GOA:Q21DC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC4"
FT                   /protein_id="ABD85612.1"
FT                   /translation="MALIGRSFVILFGFLGASLVAGMIVVGAMLYPEFSDMGVEPIDPD
FT                   ALNIIFGFGFIFVSGFALLPALVVVLITEAFSIRSVLAYALGGAAVGLACYLGLVPFDS
FT                   ASMRFDGIVRRHLEIMTGAGIVAGLVYWVIAGRNAGAWREPPRPLPPAPRPTA"
FT   sig_peptide     complement(39412..39498)
FT                   /locus_tag="RPC_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.868) with cleavage site probability 0.334 at
FT                   residue 29"
FT   gene            complement(39498..40097)
FT                   /locus_tag="RPC_0034"
FT   CDS_pept        complement(39498..40097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0034"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85613"
FT                   /db_xref="GOA:Q21DC3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC3"
FT                   /protein_id="ABD85613.1"
FT                   /translation="MAMLPPDQIKGALAFLREAERLKDVLRSGHTSNGRPESTAEHTWR
FT                   LCLMAVLFADDLGDIDIAKLLKICIVHDLGEALHGDIPAIDQSADGNKAAQERADLEAL
FT                   TRPLDAKRRAEILALWQDYAAAASPEARLAKGFDKLETILQHNQGRNPADFDYAFNLGY
FT                   GVKQTAAHPLLAALRAVLDDDTRARVAAQQSAGGRG"
FT   gene            complement(40102..41301)
FT                   /locus_tag="RPC_0035"
FT   CDS_pept        complement(40102..41301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85614"
FT                   /db_xref="GOA:Q21DC2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21DC2"
FT                   /protein_id="ABD85614.1"
FT                   /translation="MTLSTSQSLLEKTALETYVPPARPSLIGLSRAELAEALGGIGVAA
FT                   SQRKMRAQQLWHWMYFRGVQEFAEMTSISKEMRSQLAEHFTVARPEVVAEQISNDGTRK
FT                   WLLRLPSGVSGEKAHEVECVYIPETDRGTLCVSSQVGCTLNCSFCHTGTQKLVRNLTAG
FT                   EIVGQVMVARDRLNDWADRETPNGNRLVTNVVMMGMGEPLYNFDAVRDALLIVSDNEGI
FT                   GISRRRVTLSTSGVVPNIVRAGEEIGVMLAISLHAVRDELRDELVPLNRKYPLAELLQA
FT                   CRDYPGASNARRITFEYVMLKDVNDSLDDAKLLVKLLSGIPAKINLIPFNPWPGTAYKC
FT                   SDWDQIEKFSEYIFNAGYSSPVRTPRGRDILAACGQLKSETEKLTAREREALRAMAMTD
FT                   "
FT   gene            complement(41502..42131)
FT                   /locus_tag="RPC_0036"
FT   CDS_pept        complement(41502..42131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85615"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC1"
FT                   /protein_id="ABD85615.1"
FT                   /translation="MCVRRLLIGLAAGGLVCGVSTLALAQTASPKGAKSAPAKPAAAKP
FT                   ESKKPAPAAASTGGGAEPQLIGQFGTWGAYVANPNGRKVCFALAKPSSSKTNPPNRPRD
FT                   PAYAFISTRPAEKVVNEVSVMIGYTLKPGSESTLEVGGANYAMYTQGDGLWIKNAAEEE
FT                   RMVQAMRKAADVTVKGVSAKGTATIDTFSLKGLAQALDRLAQDCQR"
FT   sig_peptide     complement(42054..42131)
FT                   /locus_tag="RPC_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            42455..43429
FT                   /locus_tag="RPC_0037"
FT   CDS_pept        42455..43429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0037"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85616"
FT                   /db_xref="GOA:Q21DC0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DC0"
FT                   /protein_id="ABD85616.1"
FT                   /translation="MKAVLCSEYCGPDDLVLADIADPVAGPGEAVIAIKAAALNFFDIL
FT                   MIQGKYQIKPPFPFSPAAEVAGVIESLGDGVSDLKVGDRVVASCGFNGARDKIALPAQS
FT                   IVKIPDNLDFDRAAGIIITYGTALHALEDRAHPKPGETLAVLGAAGGTGLAACELGKLM
FT                   GLKVIACASSDAKLDFAKQHGAELTLNYAAEDLKDGLKRLTEGRGADIIFDPVGGSYAE
FT                   AALRAIAWEGRFLVIGFAAGEIPKMPLNLALLKGCDIRGVFWGAWAKLNPAKNRANLEK
FT                   LVQWTAEGKISSHVDRSFPLAQTADALKVLAGRQAMGKVILHP"
FT   gene            43530..44771
FT                   /locus_tag="RPC_0038"
FT   CDS_pept        43530..44771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0038"
FT                   /product="amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85617"
FT                   /db_xref="GOA:Q21DB9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB9"
FT                   /protein_id="ABD85617.1"
FT                   /translation="MSLPSEIDIAIIGAGAAGLGAAHALQGSGHSAIILEARDRIGGRG
FT                   HTILAAPDIPFDVGCEWLHSADRNSFVGIATSLGIAIDRSRGSWRDHSFDVGFPAQAHA
FT                   AYYAAQDAFYARVEAAAELAQDTAAGDWLEPGNRWNPLIDAISTYINGCELDRVSSYDT
FT                   AAYEDSDINWRLHLGYGALIAAYGAPCPIALNTEVTLIDHSGPRVKLATSQGTLSAGKV
FT                   IITVPTNLIADEAIRFDPPLPDKVEAARGLPLGVAEKVMLALDEPTQAHHALPIDGHLR
FT                   GATDRVGTGSYDLRPRGLPVIAGFFGGRYARDLIEQGGDALAQAAIDELVGLLGSDYRN
FT                   RLRPLAQSRWLRDPLARGSYSHALPGHAGARAVLAEPVDGRLLFAGEATSPDIFSTAHG
FT                   ARDSGARAARQAIG"
FT   sig_peptide     43530..43604
FT                   /locus_tag="RPC_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.852) with cleavage site probability 0.827 at
FT                   residue 25"
FT   gene            44907..45449
FT                   /locus_tag="RPC_0039"
FT   CDS_pept        44907..45449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0039"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85618"
FT                   /db_xref="GOA:Q21DB8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB8"
FT                   /protein_id="ABD85618.1"
FT                   /translation="MPGPDLALISAMSTTLIEVRPAKAADASAVAATHDEAWRSAYQGI
FT                   IPGAELEKLINRRGPHWWDSAIRKGSRVSVLCFGDKVAGYANYGRNRARSLQFEGEIYE
FT                   LYLRPEFQGLGFGRRLFTAAKRDLVQSGLKSMVIWALSDNEPATEFYRALGGRMVARSS
FT                   ERFGAKSLDKVAFAWTN"
FT   sig_peptide     44907..44981
FT                   /locus_tag="RPC_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.711) with cleavage site probability 0.710 at
FT                   residue 25"
FT   gene            45530..46075
FT                   /locus_tag="RPC_0040"
FT   CDS_pept        45530..46075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0040"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85619"
FT                   /db_xref="GOA:Q21DB7"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB7"
FT                   /protein_id="ABD85619.1"
FT                   /translation="MRIDAVSLGANPPYDVNVIVEVPVGGEPIKYEMDKAAGTLVVDRF
FT                   LYTAMRYPGNYGFIPHTLSNDGDPCDVLVANTRGIVPGAIISVRPVGVLLMEDEAGGDE
FT                   KILAVPSSKLTQRYDRIQNYSDMPDITLQQIQHFFEHYKDLEPNKWVKITRWGDADEAR
FT                   RLIIEGIEREKAAKAAKA"
FT   gene            46115..47596
FT                   /locus_tag="RPC_0041"
FT   CDS_pept        46115..47596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0041"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85620"
FT                   /db_xref="GOA:Q21DB6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB6"
FT                   /protein_id="ABD85620.1"
FT                   /translation="MRRLLRVIRNLVAALVAAAVVLAGVLAFNAFRHGSRQLQVAAVPP
FT                   VQVDEAGAAKRLSEAIRFRTISNFLNPEQDAAALAALQAHIVASFPAFHAAAQREVVNG
FT                   KSLLYTWEGSDPTLKPFALLAHQDVVPIAPKTEQDWQQPPFDGVIADGYVWGRGSWDDK
FT                   GNLYAMLEAAEAMARQGFRPKRTVYFAFGHDEEVSGLRGAGAIAKLLASRGVKLDFVLD
FT                   EGLLITEGIMTGLPRPAALIGVAEKGYATLVLTARATPGHSSMPPRQTAIGMMSAALSH
FT                   LEDKRLPMQIRGTVAEMFDTLAPEMRGIYRVVLSNLWLFKPLLLREFEKTGPTEAMVRT
FT                   TTALTIFNAGDKDNVLPGVAEASVNFRLVPGDTQASITDHVRETIANDNIAIGGSEGNF
FT                   DPPPVTGSKSAAYRQLNQTIREIFPDVVVAPGLMVAATDSRHYAEVADNILRFSPVRAT
FT                   SEDLKRFHGTNERLSIANYADMIRFYRRLIENTAG"
FT   sig_peptide     46115..46198
FT                   /locus_tag="RPC_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.547 at
FT                   residue 28"
FT   gene            complement(47972..49915)
FT                   /locus_tag="RPC_0042"
FT   CDS_pept        complement(47972..49915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0042"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85621"
FT                   /db_xref="GOA:Q21DB5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB5"
FT                   /protein_id="ABD85621.1"
FT                   /translation="MSEKIYDVSPEWAARAFIDDAKYQEMYARSVSDPNGFWGEQAQRI
FT                   GWIKPFTKVEDTSFAPGHVSIKWFEDGVLNVAWNCIDRHLPDRAEQTAIIWEGDDPSES
FT                   REISYRELHDEVCKFANILRSRNVQKGDRVTIYLPMIPEAAFAMLACARIGAIHSVVFA
FT                   GFSPDSLAQRITDCQSKIVITADEGLRGGRKVPLKANVDAALKKCEGVDWVVVVKRTGA
FT                   DVFMDDVRDFWYAEAAEMVTTECPCEPMHAEDPLFILYTSGSTGQPKGVLHTSGGYLVF
FT                   AAMTHQYVFDYHDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSRFW
FT                   EVIDKHKVNIFYTAPTAIRALMQGGDEPVKKTSRKSLRLLGSVGEPINPEAWEWYHRVI
FT                   GEDRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVVPQILDAEANVLEGECQ
FT                   GNLCLARSWPGQMRTVYGDHARFESTYFSAYPGKYFTGDGCRRDADGYYWITGRVDDVI
FT                   NVSGHRMGTAEVESSLVAHAKVSEAAVVGYPHDIKGQGIYAYVTLMDGTEPTEELRKEL
FT                   VAWVRKDIGPIASPDLIQFAPSLPKTRSGKIMRRILRKIAEDEPSTLGDTSTLADPAVV
FT                   EDLVEHRQNKRV"
FT   gene            complement(50514..51212)
FT                   /locus_tag="RPC_0043"
FT   CDS_pept        complement(50514..51212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85622"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB4"
FT                   /protein_id="ABD85622.1"
FT                   /translation="MDIAAGSAQDPAMSSSAIADPTAFIAANTRLRPVPLVPEVMLHVA
FT                   DEALPLWSRTEEELGEVGLPPPFWAFAWAGGQALARYLLDHPDSVAGREVIDFASGSGL
FT                   VAIAAMKAGAQSVTAFDIDGFAREAIAINARANGVTIAISGDDLLAAPHVAPAQTVLAG
FT                   DIFYQRDIAALAFAFLQRRAAQGATVLIGDPGRTYLPKHQLTQLASYSVPVTRELEDAE
FT                   IKATGVWTLK"
FT   gene            complement(51255..51668)
FT                   /locus_tag="RPC_0044"
FT   CDS_pept        complement(51255..51668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0044"
FT                   /product="protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85623"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB3"
FT                   /protein_id="ABD85623.1"
FT                   /translation="MAFWLVKSEPSTWSWEQQVAKGAKGEAWTGVRNHSAKLHMMKMKK
FT                   GDRAFYYHSNEGKQIVGIAEIIREAYPDPTDDSGKFVCVDIKALTPLKTPVTLVAIKAE
FT                   KSLAEMALLKQSRLSVQPVTADEWKIVCKMGGV"
FT   gene            complement(51672..52661)
FT                   /locus_tag="RPC_0045"
FT   CDS_pept        complement(51672..52661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0045"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85624"
FT                   /db_xref="GOA:Q21DB2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21DB2"
FT                   /protein_id="ABD85624.1"
FT                   /translation="MLSYDSVAVLGGGAWGTALAQTGARAGRDVVLWEHDANNAQQLQQ
FT                   KRESLYLPGVTLDSSIKVTRDLSEAARAQAILLVVPAQVLRQVVTSLAPLIADRTPLVA
FT                   CAKGIEHGTHKFMTEIIAEAAPQATPAILSGPSFAADVARGLPTAVTIAATDAGIAQAL
FT                   AQAMNSGTFRPYHSTDVRGVELGGATKNVLAIAAGIVEGRKLGASALAAMTTRGFVELM
FT                   RFGKAYGARIETMHGLSGLGDLTMCCSTPQSRNFSFGVALGRGESASEASHGKLAEGAF
FT                   TAPVLLEMARLKNVEMPISTAVAAILAGQISVDAAIESLLTRPLKAEE"
FT   sig_peptide     complement(52599..52661)
FT                   /locus_tag="RPC_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.941) with cleavage site probability 0.933 at
FT                   residue 21"
FT   gene            complement(52957..54102)
FT                   /locus_tag="RPC_0046"
FT   CDS_pept        complement(52957..54102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0046"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85625"
FT                   /db_xref="GOA:Q21DB1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21DB1"
FT                   /protein_id="ABD85625.1"
FT                   /translation="MLRRARKTPYWRQTQGLNLATDTASLVLGIETTCDETAAAVVERR
FT                   SDGSGRILSNIVHSQIEDHAPFGGVVPEIAARAHVDLLDGIIARAMQQAGLGFKDLSGV
FT                   AAAAGPGLIGGVIVGLTTGKAIALVHDTPLIAVNHLEAHALTPRLTDALQFPYCLFLAS
FT                   GGHTQIVAVLGVGNYVRLGTTVDDAMGEAFDKVAKMLGLPYPGGPQVERAAAAGDAARF
FT                   AFPRPMLGRADANFSLSGLKTAVRNEASRLSPLEPQDVNDLCAGFQAAALESTADRLHV
FT                   GLRIFRERFGAPHALVAAGGVAANQAIRGALQQVALAAGTQFMIPPPALCTDNGAMIAW
FT                   AGAERLALGLTDSLEFAPRARWLLDANVITPAQFANTRAGF"
FT   gene            54230..54976
FT                   /locus_tag="RPC_0047"
FT   CDS_pept        54230..54976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0047"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85626"
FT                   /db_xref="GOA:Q21DB0"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DB0"
FT                   /protein_id="ABD85626.1"
FT                   /translation="MALLVTRPQPDNETTAVALRTKGYEVLLAPMLRFEAVAVKDDPEA
FT                   RYGAVIVTSANALRAVAGQTGIARLLDLPLFAVGARTAQSARDAGFRNVIVADGDASAL
FT                   RDKIVAAARAKQLQKADTLLYLSGAEVARDLAGELRALGFNIATQTAYKMIPVRDLPDE
FT                   VCDAFAANRIEAVLHYSGRSARSFLEAARSAGIEISALAVPQCCLSAAVAGVVREAGAT
FT                   RVMEARRPDEAALFDVLDRALSPLAR"
FT   gene            55033..56424
FT                   /locus_tag="RPC_0048"
FT   CDS_pept        55033..56424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85627"
FT                   /db_xref="GOA:Q21DA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA9"
FT                   /protein_id="ABD85627.1"
FT                   /translation="MVKVRPHDNRSATDANRSEHRTPPEDSQPPQDSAPAVDAETPAEQ
FT                   PAPEIDQQIAPQAVLPPGGDEVAPEAAEPAVTQQAEAAESERLAAESPSPVSEPAPRSP
FT                   SIAVPALTGAVAAAIVVGAAWFALGPNLAPPPAAPVVVQNDNAALGALTARVAGVESKV
FT                   AALSSAAATPAASAAPADATLAPRIDAVEKSIAALRDDFAAARTQSAQLSAAVNALKTA
FT                   PTDGSAPAVATGETPAAVDLAPLNERLSQLEQAVKTPAPTIDLAPLDERLDKLERAATT
FT                   PVAVPAAPDDTALRRVVAAMLLDVSVRQGEPYAGVLTVAKPLSPDAATLKPLDAFASTG
FT                   VPSITVLARELVALLPKLAPGPSGPDSTASIIERLQAGADRMVRIQRPDAATAKDRGAI
FT                   VARIAVAAQRSDLAEAVRELNLLEPADRAPAQPWLDKVAARDAALAVSRQFAAAAMAAL
FT                   PKKSP"
FT   gene            56432..58117
FT                   /locus_tag="RPC_0049"
FT   CDS_pept        56432..58117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0049"
FT                   /product="HemY-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85628"
FT                   /db_xref="GOA:Q21DA8"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA8"
FT                   /protein_id="ABD85628.1"
FT                   /translation="MLRIILFLVVIAAAAAGAGWLAEQPGNVVLSWRGWQAEMTLAVAA
FT                   LALLSAIVAVALGWTILAGVLRSPGRLRRSRRARREARARRAITQGLLAVGHGDAAIAR
FT                   AHANAAKRHAPQDPLALLLQAQSAQLDGDRDGAKRAFLAMAGRDDTKSLGMRGLFIEAQ
FT                   RAEDPYAALTIAEEALRLSPASSWASQAVLGFRCARGDWSGALEILETNLTSGLIDKKT
FT                   YRRLRGVLLTARAIECEETDVSLSRDSALEAVKLAPTLVPAAVLASKYLSEAHQIRRAM
FT                   KTIETAWLAHPHPDLAEAYAHIKPGDSAQVRLQRVEALAAKASGDTEGAVAVARAAIDA
FT                   GDFNRARGALMPFVDAPTQRVAMLMAEIEHTERKDSRSARAWTLRAVRALRDPVWTADG
FT                   CVSDRWRPVSPVTGRLDAFQWTTPLAELPTNKAVVLESDLFDETLIESPTEEVTEGVTS
FT                   EPATPEVSKAEPSKPETSGTPVEVVMESKPAAEAPVVGPTESSPPLFHRPQRSAAAPVI
FT                   PIVRAPDDPGIDEDEAATGDFDDKANPAASQAGNWRGYRPRRDN"
FT   sig_peptide     56432..56497
FT                   /locus_tag="RPC_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.653 at
FT                   residue 22"
FT   gene            58307..58382
FT                   /locus_tag="RPC_R0001"
FT                   /note="tRNA-Thr1"
FT   tRNA            58307..58382
FT                   /locus_tag="RPC_R0001"
FT                   /product="tRNA-Thr"
FT   gene            58569..58793
FT                   /locus_tag="RPC_0050"
FT   CDS_pept        58569..58793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85629"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA7"
FT                   /protein_id="ABD85629.1"
FT                   /translation="MARFLCIIAALLLASSAQAQQGQGQRQDPGCARDVQRFCRAQMND
FT                   GDMVILACLQQHRAKLSKTCAKALADNGR"
FT   sig_peptide     58569..58628
FT                   /locus_tag="RPC_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            59017..60405
FT                   /locus_tag="RPC_0051"
FT   CDS_pept        59017..60405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0051"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85630"
FT                   /db_xref="GOA:Q21DA6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA6"
FT                   /protein_id="ABD85630.1"
FT                   /translation="MSIAEASQMPLTRRPLLPPAPPRAPETMTAFGRLAAIRNNVIASW
FT                   GDRAYQDDVVRGRFFGSSSFILNTPDAIRQVLVDNYENYIRTAAGIRVLRPMLGDGLLL
FT                   AEGRAWKHQRRTLAPAFTPRAVATLVPHMRSAIDEMLAEFDAARGRPIDLREAMQRMAL
FT                   EIAGRTMFSFAMGRHGRTLRDFVIEYGTRLARPNFLDLLLPLAFPTPQDFARAGFRRRW
FT                   TAFIAQLMAERRAAGKAEGAPPRDLFDLMGAARDPETGEAFSEPQLGDQVATMILAGHE
FT                   TTATALFWALYLLALDQHSQDQLAAEVRGQPENHAREVEHLTFTRAVIDETMRLYPPAF
FT                   LIARAAAGPDVVAGSAVRKGDVMLIAPWLLHRHEKLWHDPGAFIPARFMPGSPPPDRFA
FT                   YLPFGVGARVCIGAHFALVEATLALSGIVGRFRVELLNAAPVMPIGVVTTQPDYSPMFR
FT                   LTPR"
FT   gene            60413..61858
FT                   /locus_tag="RPC_0052"
FT   CDS_pept        60413..61858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0052"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85631"
FT                   /db_xref="GOA:Q21DA5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA5"
FT                   /protein_id="ABD85631.1"
FT                   /translation="MDIRTTPNQPVVHSDSSAQFAALKQAADPAVAAAIERLVAEGCDR
FT                   DLNRINVLDFSARRELDEERVISGFLQASRLGLFDLSWNVLCPGCGGVLDAHNTLKSLR
FT                   PDEYHCGLCASDYEASVDKQVEVAFTVAPRVRRIAAHDPGTMPIWEYFRQMFWSSGVDF
FT                   NEQGFASLTGEVTLDAVELPIGRSVTRTLQLPPEFIIVFEPVTHAAQFIDVQGEPTDEA
FT                   QQLSLVYHKLPAPTKTVTLRPGPLQLSLDNRTDTRVLPSVFIAADALHHLLGQRKPFLT
FT                   AKRILSNQTFRDVFKADNLTIDQRLKITSLSFLFTDLKGSTALYERVGDLAAFDLVRAH
FT                   FRALLEIISSEKGAVVKTIGDAVMATFVAPEQALAAGLRMRAAMDALNAERGSNDLVVK
FT                   IGIHEGPCLAVMLNERQDYFGQTVNIASRVQGLATSQAIHITGTVIAAPAVAALLRRAA
FT                   ITPIQKQAALRGIADQVVVYEIP"
FT   gene            complement(61914..62219)
FT                   /locus_tag="RPC_0053"
FT   CDS_pept        complement(61914..62219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85632"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA4"
FT                   /protein_id="ABD85632.1"
FT                   /translation="MGELYDWLIDQHHGLRTYKALYQKAHQLAQSAPRHRALYRMLALV
FT                   VSDHIDAFDEQPVPTALAEAAFHRLLGVVAAAENSLHAPDSEQIVTLNRIAEERLF"
FT   gene            62585..63097
FT                   /locus_tag="RPC_0054"
FT   CDS_pept        62585..63097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0054"
FT                   /product="protein of unknown function DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85633"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA3"
FT                   /protein_id="ABD85633.1"
FT                   /translation="MLSRLRQFIADVVAPETEDDLAFDDTGYRLAATALLIHVISLDGE
FT                   PSDVERRKLHELLETRFGLDPGTTARLIKSATLAEGDAVDLYRFTSVIMRTVNEEGRLR
FT                   IIEMMWELVYADANVTEFEENVVWRAADLLAVSARDRINLKRQVAKNQVAEGPVAYASG
FT                   AGQVAET"
FT   gene            63376..64155
FT                   /locus_tag="RPC_0055"
FT   CDS_pept        63376..64155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0055"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85634"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA2"
FT                   /protein_id="ABD85634.1"
FT                   /translation="MTERVTLITGASAGIGTELARVFASHHHRVALVARREERLNTLAE
FT                   EIVAAGGAKPLVIACDLRQPDAGDAIAAALTEAGVEVEYLVNNAGYGLFGQATELDRGA
FT                   QLGMIDLNVRALTDLSLRFSASVIKHHGGILNVASIAGFLPGPGMAVYYASKAFVLSFT
FT                   EALRAELGRHGVRVTALCPGPVLTEFQQHAGFEPGFDSAILNVSAADVARQGFEGLMAN
FT                   KRAVLPGLGIKIVPLLLRLFPRGFVLAGVGKFQLRRR"
FT   gene            64314..65096
FT                   /locus_tag="RPC_0056"
FT   CDS_pept        64314..65096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0056"
FT                   /product="glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85635"
FT                   /db_xref="GOA:Q21DA1"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA1"
FT                   /protein_id="ABD85635.1"
FT                   /translation="MRLPTAVLPASIAPHVADLRPVLIILHQEMSTPGRVGNALRLLGH
FT                   PLDVRRPRFGDPLPATLEHHAGAVIFGGPMSANDPDDFVRREIDWIAVPLKEDRPFLGI
FT                   CLGAQMLAVQLGARVAPHAEGRAQIGYYPIRPTAAGRAICADWPEQVYHWHREGFDLPV
FT                   DAELLAEGSDFPVEAFRAGHAFGFQFHPDVTYAMMHRWTTRGHARMDLPGARPRHDHFS
FT                   DRAVHDVAERAWLREFLNVWLAQMPLIVPDAGMAQAAE"
FT   gene            complement(65297..65372)
FT                   /locus_tag="RPC_R0002"
FT                   /note="tRNA-Ala2"
FT   tRNA            complement(65297..65372)
FT                   /locus_tag="RPC_R0002"
FT                   /product="tRNA-Ala"
FT   gene            65569..65859
FT                   /locus_tag="RPC_0057"
FT   CDS_pept        65569..65859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0057"
FT                   /product="protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85636"
FT                   /db_xref="GOA:Q21DA0"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q21DA0"
FT                   /protein_id="ABD85636.1"
FT                   /translation="MRAILDIILIVLDLYIWLLIASAILSWLIAFNVVNTRNQFVSSIS
FT                   EFLYRITEPVLAPIRGIMPNLGGLDISPIIVILLIMFLQRVITYYIYPSVF"
FT   gene            65902..66225
FT                   /locus_tag="RPC_0058"
FT   CDS_pept        65902..66225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0058"
FT                   /product="protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85637"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D99"
FT                   /protein_id="ABD85637.1"
FT                   /translation="MTEAWRYSAQGISVALRVTPRGGRDDIDGLETLANGRTVVKVRVR
FT                   AIAEGGEANRAVTELLAKALGVPKRAVRVLSGTTSRLKQVAVDGDPNELGEALRKLTAP
FT                   KPD"
FT   gene            66341..67228
FT                   /locus_tag="RPC_0059"
FT   CDS_pept        66341..67228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0059"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85638"
FT                   /db_xref="GOA:Q21D98"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D98"
FT                   /protein_id="ABD85638.1"
FT                   /translation="MTARIIDGKTISAELRGKLADEVARVVRDHGVTPGLAVVLVGSDP
FT                   ASEVYVRSKHKQTKEAGMASFEHKLPADVPQAELLALIGQLNADPAVHGILVQLPLPKG
FT                   LDSNAVIAAVDPAKDVDGLNPVNAGRLASGLFALTPCTPLGCIVMAKQVHASLEGMNAI
FT                   VIGRSNLVGKPLVQLLLNENATVTIAHSRSRDLPALCRQADLVFAAVGKPEMVRGNWIK
FT                   PGATVIDVGINRTPSPDGGKDKLVGDVAFAEAKEVAGAITPVPGGVGLMTVACLLVNTL
FT                   RAACAIHGLPKPAV"
FT   gene            67811..68326
FT                   /locus_tag="RPC_0060"
FT   CDS_pept        67811..68326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0060"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85639"
FT                   /db_xref="GOA:Q21D97"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D97"
FT                   /protein_id="ABD85639.1"
FT                   /translation="MNLRTSLAIAAVVGAGLLASSRAEARPDVVAYSGDYSPGTIVVKT
FT                   HERRLYLILDDRTAVRYPVGVGKVGKQWAGATKIDGKYREPAWAPPADVKRDNPNIPDV
FT                   IPGGSPANPMGVAAMTLAGGEYAIHGTNRPASIGGFVSYGCVRMYNEDISDLYQRVPVG
FT                   TQVVVTER"
FT   sig_peptide     67811..67888
FT                   /locus_tag="RPC_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.840 at
FT                   residue 26"
FT   gene            68518..70542
FT                   /locus_tag="RPC_0061"
FT   CDS_pept        68518..70542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0061"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85640"
FT                   /db_xref="GOA:Q21D96"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D96"
FT                   /protein_id="ABD85640.1"
FT                   /translation="MAKFRIGTKLGLTTGIGVLLVGGMLTNEWLGNDSIATSSRLVLVN
FT                   TSNKANAQAADAAMLRAQLAIRDLSDVQTGEQLDGSARKGRDAITEAKREIEAAEQRAT
FT                   REVTKTAYREIRPLLERSDALIGELTAARKSAIAAMAGRAAVTAAWTQSLETLIASRAF
FT                   AALDNRGDIEGALRQADALLQSSRAASWQFVALSDLKLVATVTGDEAKSLEALNRARSL
FT                   TDNRASVAAIDALIADAKGYQTATDAVIKAEVQAIATRRDKIAPVIGEIDVRIDKLVGV
FT                   ANEFTAKRQGELLALLEQVRNVGSIVGVMVVLVLIGSALFSVMNIARPIRRIGEVLLEL
FT                   AGGNKAVAIPYTERGDEVGDNARAASTFKDNLIQIERMESEQKSLELATAAQRKADMNQ
FT                   LADQFQAAVGGIVATVSTASGELEAAAGKLSSTAEQTQQLSGMVASASEEASANVESVA
FT                   SATEEMSTSVIEISRQVHDSSRIAGEAVKQAQQTDLRINELLKAAGRIGDVVKLITAIA
FT                   EQTNLLALNATIEAARAGESGRGFAVVASEVKALAEQTAKATDEISTQIAGMQSATQDS
FT                   VGAIKEIGATITRIADISSTIAATVEEQGAATAEIARNVSEAAKGTAEVADKIVQVNHG
FT                   ASATGTASAQVLASAQSLSRQSSSLQTEVTNFLRTVRAA"
FT   gene            70622..71644
FT                   /locus_tag="RPC_0062"
FT   CDS_pept        70622..71644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85641"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D95"
FT                   /protein_id="ABD85641.1"
FT                   /translation="MAPPVTPHDRLQLLADRVRRQDPSLETLLLEPDGKYQTRRVTLDV
FT                   LMREMTDCLAAGFAGRAATDFPMHYLAWGKCRVGSTALTNLFGVTGMPSYYQPLKMMLR
FT                   HLFVGQQPAPWIIPRAADQPQIFSKETAGPYVVAESLFNPLRLLIEAGYPPHRLQLIML
FT                   DREPKSSLASSLDKLAGCVPDAMLLQNYVVAALNATRIESYARQQGVPVIHYVYEASKE
FT                   AVRSVRTLFDRLGLAGRFSETAVTDWRNTGKLRSDSSRITFGDEPSIYDVAGLHGADTA
FT                   YRYHPRDTETLSAYQRDMLERCGVNEVYRGSVEACIRDLGLDAATAARLFSHTVTHEPA
FT                   "
FT   gene            71641..72627
FT                   /locus_tag="RPC_0063"
FT   CDS_pept        71641..72627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0063"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85642"
FT                   /db_xref="GOA:Q21D94"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D94"
FT                   /protein_id="ABD85642.1"
FT                   /translation="MTDILDELDAGRAPLAPTLADLRGDWARAEPSAHLQRLESESIHI
FT                   LREVAAEFAKPVMLYSIGKDSSVLLHLAMKAFAPGKPPFPLLHVDTTWKFREMIEFRDQ
FT                   RMRELGLDLIVHINPDGVAQGIGPFSHGSALHTDVMKTQGLRQALEAHGFDAAIGGARR
FT                   DEEKSRAKERIFSHRSAAHRWDPKNQRPELWSLYNTLLAPGESMRVFPLSNWTERDVWD
FT                   YILVEQIPIVPLYFAALRPVVERDGALIMVDDARMPLRPGEVPQLRSVRFRTLGCYPLT
FT                   GAMPSTATTLEQIVDEMLASRSSERQGRVIDRDSTGSMERKKAEGYF"
FT   gene            72627..74480
FT                   /locus_tag="RPC_0064"
FT   CDS_pept        72627..74480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0064"
FT                   /product="adenylylsulfate kinase / sulfate
FT                   adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85643"
FT                   /db_xref="GOA:Q21D93"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D93"
FT                   /protein_id="ABD85643.1"
FT                   /translation="MLCLDHAHDTELAAPLKHPVDRPTLRFITCGSVDDGKSTLVGRLL
FT                   YDSKLLLDDQLSALHAESKSAGTAGQDLDFALLVDGLQAEREQGITIDVAYRFFATPQR
FT                   RFVVADTPGHVQYTRNMATGASTADLAVVLIDARKGVIDQTRRHSHIVGLFGIRHVVLA
FT                   INKMDLVGFDAARFIAITHAYRALAAELGITNVCYVPVVAPDGDNIFTPSARMPWYSGP
FT                   TIMEHLEAVEVGGEIRERPFRMPVQWVNRPNAEFRGFSGRIASGRVARGDAIMVQPSDR
FT                   SSHIARIVTPAGERDVAVAGQSVTLLLADEIDISRGDVVSSGAAAMVCDQLAARLVWFD
FT                   DAALVPGRRYLLKSARSCVGAVISALKHRVAIDSMAQQAATTLNANEIGAVELCLERPL
FT                   VCETYRDDRELGSFILIDPLSHKTAAAGIIDGASRRAANNNWPAQDAGTAVRAQSKPRP
FT                   CVLWLTGRSGGTTSILAHLLDKRLNEFGRHCILLDGDALRHGLNRDLGVGDAARIEGSR
FT                   RLAEIAKLFVDAGLIALVKPIAPPPSGTALARALFSAGEFIEIDVAAPVQETARRDPKP
FT                   LARRTRAAELPKRADLVIDAATLAEAGCDRIIASLRERGCV"
FT   gene            complement(74563..76416)
FT                   /locus_tag="RPC_0065"
FT   CDS_pept        complement(74563..76416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0065"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85644"
FT                   /db_xref="GOA:Q21D92"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D92"
FT                   /protein_id="ABD85644.1"
FT                   /translation="MITLRVALLATTALTLGQIAAMPSHAQTSPQQMAQAPAGETGPDG
FT                   KPVVKQPPKGPPPGAPQRPAGPGGGAAPPQAPPPAAAPPRAEPPARTAPPPAATAPAAP
FT                   PPAAAPRPTPPAAAPPEAPRRPTPPPAAAPQRPTAPPAATAPQRPAAPTQPAQPSAPTA
FT                   APPAAVTPPPGAAPAQRSAPGAGPAERQGLERRAPGATAPGAPAPGAAAPGAPAAAPTP
FT                   STAPSPAPTPAPGPGGGAASPPAAAPAPAAGGTPPNSPGASQRGAASPGGAAAAPPPPP
FT                   TVTAPIPPAPPPPQALAPIAPGAAAPGPRNLADFRNQRREVQEGGRTVITEPGRVIIRD
FT                   PGGQAFIRHNEVDRFRYGARDIRVQQVGDESRTIVVRPDGSEIITVNGRDGQLLRRIRR
FT                   DREGREIIIIDNSYREPRDRGSFYVDLPPPVLRIPRNRYIVDYEDASPELIYETLEAPP
FT                   VERIERRYSLDEIRYSAGVRQRMPSIDLDTITFELGSWEIPPDQAAKLQAIADGLNKSI
FT                   ARNPREVFLIEGHTDAVGNDTDNLSLSDRRAEAAAQLLTQQFGVPAENLTSQGYGEQYL
FT                   KVPTQAPERQNRRVTVRRITPLLNGGTASLPPPPPGVAPPR"
FT   sig_peptide     complement(76336..76416)
FT                   /locus_tag="RPC_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(76623..76880)
FT                   /locus_tag="RPC_0066"
FT   CDS_pept        complement(76623..76880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85645"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D91"
FT                   /protein_id="ABD85645.1"
FT                   /translation="MAGEPQEVPDTPPIDVPPPEIPPSTPGTPTEPPFESPPGNPMPDV
FT                   PPPMRDPGEPAPPEELPGYEPEEFPTRGPDGPTTPNPATM"
FT   gene            complement(76880..77371)
FT                   /locus_tag="RPC_0067"
FT   CDS_pept        complement(76880..77371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0067"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85646"
FT                   /db_xref="GOA:Q21D90"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D90"
FT                   /protein_id="ABD85646.1"
FT                   /translation="MMAAESNSGDVNHAWELMEKITFAMLATKDGDKIRSRPMGAYVEP
FT                   QNNAVYFLTDARRHKDEEIDRDRHVNLAFADTGGQKYVSVCGTAVVSNDRAKIRELFTT
FT                   AAKVWWDSAEDPNIRVLKVTPEEAEYWDSPGTIVSTVKMAVAAVSGGRPDLGEHRKVAI
FT                   "
FT   gene            complement(77632..78414)
FT                   /locus_tag="RPC_0068"
FT   CDS_pept        complement(77632..78414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0068"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85647"
FT                   /db_xref="GOA:Q21D89"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D89"
FT                   /protein_id="ABD85647.1"
FT                   /translation="MVEFSLPKNSKVTSGKTWPKPEGATETREFKVYRWNPEDTKNPSV
FT                   DTYHVNTHDCGPMVLDGLIWIKNNIDPTLTFRRSCREGVCGSCAMNIDGENTLACTKAM
FT                   DDVKDSAVKINPLPHQPVVKDLVPDLTNFYAQYASIEPWLQTITPTPQKEWRQTHEDRA
FT                   KLDGLYECILCACCSTSCPSYWWNSDRFLGPAALLQATRWVKDSRDEATGERLDNLEDP
FT                   FRIYRCHTIMNCAKACPKGLNPSEAIANLKLKLVERQI"
FT   gene            complement(78418..78957)
FT                   /locus_tag="RPC_0069"
FT   CDS_pept        complement(78418..78957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85648"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D88"
FT                   /protein_id="ABD85648.1"
FT                   /translation="MIDYFALDFAKAFALIRELTKVVGLAIGIGKKQEVRRVLRDLRSI
FT                   YFFPDRTFALLDRMAKGETISLTDLERAEIGFANSEKNVFEAMESLEEFAHKNSTEVSI
FT                   EALSGMRAIIGGKGGARLGIIEFFMEIEDQIRTGKYDANMGEISVRAETLKAFIVELNA
FT                   RIDDVDQHLLKLDQKD"
FT   gene            complement(78963..80786)
FT                   /locus_tag="RPC_0070"
FT   CDS_pept        complement(78963..80786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0070"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85649"
FT                   /db_xref="GOA:Q21D87"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D87"
FT                   /protein_id="ABD85649.1"
FT                   /translation="MAANGNGAPAINGHAYPIEDHSYDVVVVGAGGAGLRAVVGCSEAG
FT                   LRTACITKVFPTRSHTVAAQGGISAALGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMV
FT                   RNAPQAVYELEHWGVPFSRTDDGKIYQRPFGGMTLDYGKGQAQRTCAAADRTGHAMLHT
FT                   MYGQALRHSAEFYIEFFAIDLIMDDQGVCRGVIALKLDDGTLHRFKAQTTILATGGYGR
FT                   AYASCTSAHTCTGDGGAMALRAGVPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVN
FT                   SEGERFMERYAPSAKDLASRDVVSRAMTIEIREGRGVGKKKDHIFLHLDHLDPKVLHER
FT                   LPGISESARIFAGVDVTREPIPMIPTVHYNMGGIPTNYHGEVVTKKDGDDNAVVHGLMA
FT                   LGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCAEKLTPNGKQPELPADSAEQSLTRL
FT                   DRYRYASGGTPTARLRENMQHVMQNNCAVFRTGEVLQEGKGLIHNVHSGISDIHVTDRS
FT                   LIWNSDLIETLEFDNLIVQAVVTMDSAANRTESRGAHAREDFSARDDKNWMKHTLAWMD
FT                   HSGETTIDYRPVHDYTMTNDVQYIPPKARVY"
FT   gene            complement(80790..81212)
FT                   /locus_tag="RPC_0071"
FT   CDS_pept        complement(80790..81212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0071"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85650"
FT                   /db_xref="GOA:Q21D86"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D86"
FT                   /protein_id="ABD85650.1"
FT                   /translation="MSVEESHGPTPRRAKSLRTPLGKVRKFGPAGSGTSDFWQQRITGV
FT                   AMTLLILPVVVVIMMLLGRNQAGAAQIIGSPLIALTLILFIISSAVHMKIGMQVVIEDY
FT                   VQNEKLKLVTIMANNFFSIAVALAAIFAIFKLSSGV"
FT   gene            complement(81209..81607)
FT                   /locus_tag="RPC_0072"
FT   CDS_pept        complement(81209..81607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0072"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85651"
FT                   /db_xref="GOA:Q21D85"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D85"
FT                   /protein_id="ABD85651.1"
FT                   /translation="MTARIERPLSPHMQAYRWSLTMALSIVHRLTGITLYFGTLLLAWW
FT                   LIAVAAGPSAYANVQAFTGSWIGRLMLFGYTWSLMHHMLSGVRHFIWDLGYGFTAAERE
FT                   SMTWAALIGGVVLTVLLWIVAFTLGGAR"
FT   sig_peptide     complement(81434..81607)
FT                   /locus_tag="RPC_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.632) with cleavage site probability 0.571 at
FT                   residue 58"
FT   gene            81984..82973
FT                   /locus_tag="RPC_0073"
FT   CDS_pept        81984..82973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0073"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85652"
FT                   /db_xref="GOA:Q21D84"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D84"
FT                   /protein_id="ABD85652.1"
FT                   /translation="MSHSHPDHTLPAHAHDHDDHHRHAHGAGGHDHAGHSHAPKDFGTA
FT                   FAIGILLNTGFVIGEAAFGYASNSMALVADAGHNLSDVLGLLVAWSAAILSKRPPSQRY
FT                   TYGLRGSSILAALFNAAFLLVAVGAIGWEAILRLLDPQPVAEITVMVVAGVGIVINGVT
FT                   AWLFASGRKGDLNIRGAYLHMMADAAVSAGVVIAGLLILLTGWNWLDAVTSLLISAAIF
FT                   WGTWGLLRDSVAMSLAAVPRGIDPAAVRAYLERCDGVTQVHDLHIWPMSTTEVALTCHL
FT                   VIPSGPPGDRYLMEIAHRLKQEFAIHHATLQVETDPASACALAPDHVV"
FT   gene            83053..84252
FT                   /locus_tag="RPC_0074"
FT   CDS_pept        83053..84252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0074"
FT                   /product="putative branched chain amino acid periplasmic
FT                   binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85653"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D83"
FT                   /protein_id="ABD85653.1"
FT                   /translation="MKFGNWSIVAASVVMLATSAQGAAAQAVKIGILNDQSGVYADYGG
FT                   KWSLEAARMAVEDFGGEVLGQKIEIVTADHQNKPDTAISIARKWYDVDGVDMITELTTS
FT                   SVALAVQDLSREKKKIDIVVGAATSRITGDACQPYGFHWAFDTHALAVGTGGALVEAGG
FT                   NTWFFLTADYAFGYALEKDTSEIVLAKGGKVLGAVRHPLNSSDFSSFLLQAQSSKAKIV
FT                   GLANAGLDTANSIKQASEFGIVAGGQKLAGLLMTLAEVHGLGLQAAQGLVLTEAFYWDR
FT                   DDTSRAFAEKFFKRTGRMPNMIQAGTYSATLSYLKAVKAAGSKDTEAVAKKLKELPVDD
FT                   AFAKGKVLANGRFVHDLYLFEVKKPSESKRAWDYYKLLATVPGDKAFPTAAESGCPLTK
FT                   "
FT   sig_peptide     83053..83121
FT                   /locus_tag="RPC_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.409 at
FT                   residue 23"
FT   gene            complement(84336..84773)
FT                   /locus_tag="RPC_0075"
FT   CDS_pept        complement(84336..84773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85654"
FT                   /db_xref="InterPro:IPR018594"
FT                   /db_xref="InterPro:IPR036780"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D82"
FT                   /protein_id="ABD85654.1"
FT                   /translation="MGQSIDLNGAALKIFNHHLYELSKGLRPLAMMTLSAAAAAQVIAR
FT                   LEGIGIAHHVHEACPERVNVVFGSRPAVKAVRQFMVRPLCELSAEHDFMLGVLLGYDRE
FT                   MQCARYLSRAAAADAEISGVAPLGFVADQFVALPDQTELAM"
FT   gene            complement(84752..85234)
FT                   /locus_tag="RPC_0076"
FT   CDS_pept        complement(84752..85234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0076"
FT                   /product="Flavodoxin, long chain"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85655"
FT                   /db_xref="GOA:Q21D81"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D81"
FT                   /protein_id="ABD85655.1"
FT                   /translation="MSVNVIFGSDGGNTKAVASRIAKHIQGRAIDIKAANVADFESPSL
FT                   LILGSPTYGAGDLQTDWEAHLDKLTQAKLAGKKVALFGTGDQVSYPDCFVDAMGVLYDL
FT                   VVEQGATVVGFTETAGYDFTGSKAERDGQFVGLALDQDSQSSKTEKRITEWVSRLI"
FT   gene            complement(86477..86869)
FT                   /locus_tag="RPC_0077"
FT   CDS_pept        complement(86477..86869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0077"
FT                   /product="membrane-associated proteins in eicosanoid and
FT                   glutathione metabolism (MAPEG)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85656"
FT                   /db_xref="GOA:Q21D80"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D80"
FT                   /protein_id="ABD85656.1"
FT                   /translation="MFHFTAIVTCLAVMFYFYTSVQVSRARVTYDVKAPATTGHPDFER
FT                   VFRVQMNTLEWMPILLPSLWLFAIYLSDGFAAALGVVWIVGRIIYMVGYAEAANKRGAG
FT                   FAVQTVAALLLWAGAVVGIIWRVFGW"
FT   sig_peptide     complement(86789..86869)
FT                   /locus_tag="RPC_0077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.771) with cleavage site probability 0.558 at
FT                   residue 27"
FT   gene            complement(86951..87991)
FT                   /locus_tag="RPC_0078"
FT   CDS_pept        complement(86951..87991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85657"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D79"
FT                   /protein_id="ABD85657.1"
FT                   /translation="MALLALGGNARAQGFAGLGRDAGEFAPVLPGRQLSFPLDHGAHAE
FT                   FRIEWWYLTANLQDAAGQAYGVQWTLFRQAMRPGAQQEGWANQQIWMAHAALTRADTHR
FT                   SAERFARGGIGQAGVTATPFRAWIDNWQMQGGEAMAPATLSPLDLTASGADFSYALRLA
FT                   APQPLVLQGDNGYSKKSERGQASYYYSQPYFAATGSITLDGNAVEVNGQAWMDREWSSQ
FT                   PLASDQTGWDWFSLHLDSGDKVMLFRLRQSDGANYFAGNWIGTDGQSVQLAPDAIAITP
FT                   TGLTQIGKRQLPTSWRIAIAPRGLAIDTTPLNAQSWMGTSFPYWEGPIALRGSHAGVGY
FT                   LEMTGY"
FT   gene            complement(88026..90491)
FT                   /locus_tag="RPC_0079"
FT   CDS_pept        complement(88026..90491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0079"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85658"
FT                   /db_xref="GOA:Q21D78"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D78"
FT                   /protein_id="ABD85658.1"
FT                   /translation="MKRALWVLAVLLSHWRRHPLQLATLLVGLISATALWSGVQALNQQ
FT                   ARVSYDRAASALGGARTATLVGRDGETLAQHIFVDLRRAGWPVSPLVEGRIQIGGRSLR
FT                   LLGVEPLSLPIEASAAPAIGTSGLQGFLSPPGQALIAPDTLAELKAAAGDTPQTNSGAT
FT                   LPPLTPQNELVPGLLVVDIGVAQRLLNMPDKISRLLLGQRDLGPRAPLASVAGDTLRLV
FT                   EPDAETDLERLTDSFHLNLTAFGLLSFLVGLFIVNSAIGLAFEQRRPMLRTLRACGVSA
FT                   FQLNSVLIVELVALALLAGLIGLVCGYFIAATLLPDVAASLRGLYGAQIPGQLSLRPQW
FT                   WAAGIAISVIGALGAASASLLKAIRLPVLAAAQPYAWQQAQQTALVVQGALALLVFAGG
FT                   LGCLLLGDSLVAGFAVLAAILLGAALALPAVLGLVLLISERAARKPLSKWFWADSRLQL
FT                   SGLSLALMALLLALAVNVGVGTMVQSFSKTFTGWLDGRLAAEVYLNAASDAQAGEIKAW
FT                   LRDRPEVQALLPGSRAEAQLGGWPIELIGFADHATYREQWPLLESTANAWDLVARGEAA
FT                   LVSEQLARRLKLKLGDRVQVPTPQGPWPLDVAAIYADYGNPRGQLGVAIAPLVAHFPGI
FT                   AQTRFGLRVTPAAVPALVTALREKFALDNRSLADQTALKAESRKIFNRTFAVTNALNAF
FT                   TLGIAGVALLTSLLTLSQSRLPQLAPLWAIGITRRKLALIELMKTLSVALITALLALPL
FT                   GLVVAWCLIAVVNVKAFGWRLPFQVFPEQLVQLLGIAMLAALLAALLPILKLLRMQPAE
FT                   LVKVFADER"
FT   sig_peptide     complement(90366..90491)
FT                   /locus_tag="RPC_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.558 at
FT                   residue 42"
FT   gene            complement(90488..91141)
FT                   /locus_tag="RPC_0080"
FT   CDS_pept        complement(90488..91141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0080"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85659"
FT                   /db_xref="GOA:Q21D77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D77"
FT                   /protein_id="ABD85659.1"
FT                   /translation="MLSVRALAKSYRSGQDRVSVLRGVDLDVAAGESVALTGESGSGKS
FT                   TLLHLIAGLDAADAGAVRFGDTLISQLSDTGRAAFRRDRLGLVFQQFNLIPSLSVADNL
FT                   AFQSRIAGRHDAVWQAELVERLGLGSLLKRYPEQLSGGQQQRVAIGRALAVKPLLLLAD
FT                   EPTGNLDEATADEVMSLARDLVSRTGCGFLMVTHSARLAAMLDRQVHLHAGLIA"
FT   gene            91347..92603
FT                   /locus_tag="RPC_0081"
FT   CDS_pept        91347..92603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0081"
FT                   /product="protein of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85660"
FT                   /db_xref="GOA:Q21D76"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D76"
FT                   /protein_id="ABD85660.1"
FT                   /translation="MADPRAPMPPLRVLLSEGGSTSAREAITVLGLAGHHVEICDPSPR
FT                   CLGRFSRFVAKYHRCPGLGRDPAGYLRFIEGLLAQEEFDVLLPIHEQGLLFAKVAPRLQ
FT                   GLTALALPSFEAYRTAISKAGFSRLLDELQLPQPSTRLVTSAEQVRAEARAPCVIKTAI
FT                   GTASRGVWLVRDADQLEDALRELAAIDGFADEVLLQEFIEGAIEHAQAVFAHGELLAMH
FT                   AARRIAEGAGGGAAIKQSVRRDGVWADLARIGRALEWHGALSVDYILPSDDASPRYIDC
FT                   NPRLVEPMGAKLAGLDLLELLLKVSLGQHPPAAAESQAGMRTHLAMQALLGCARDGGSR
FT                   GDLFRECGDLLRRRGRYAESREELTPVRSDWLSAVPLTLTAALLLLAPSLAGPLAAKGW
FT                   GDHLLDAGAVRRIDGEEIG"
FT   gene            92978..93220
FT                   /locus_tag="RPC_0082"
FT   CDS_pept        92978..93220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85661"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D75"
FT                   /protein_id="ABD85661.1"
FT                   /translation="MKKPKLELDEPQPKKIIRADKAPTEGYSLVVDGHFKSHHDTVEAA
FT                   EEAGMALKNRYQMLQIQVYDAATKTRSMIEWPAPV"
FT   gene            complement(93491..93958)
FT                   /locus_tag="RPC_0083"
FT   CDS_pept        complement(93491..93958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85662"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D74"
FT                   /protein_id="ABD85662.1"
FT                   /translation="MPKASRRWPRLPPPTSPFASGPPIYGRSGWRRRPPTLPIRRRRNQ
FT                   PKRRRRNRPDMTKDDRDRAEARFNKAAKVADEGKSGKTDRDAATKAVIDNMARLKALRL
FT                   AREAAEPARTVVAKKTRSAAKPGAKSGKTSSAKTPALGEWLASQVNGGRRT"
FT   gene            complement(94303..96318)
FT                   /locus_tag="RPC_0084"
FT   CDS_pept        complement(94303..96318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0084"
FT                   /product="TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85663"
FT                   /db_xref="GOA:Q21D73"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D73"
FT                   /protein_id="ABD85663.1"
FT                   /translation="MSSRFHAASRPHRRFHAMLASSCLMPMLSLATGVAQAQQQSTTLP
FT                   TIVVSPTGLATPVDQIASSVTVISAADIERDQRRTVGDALTMVPGLNVVRTGGSGGLTS
FT                   VFMRGTNSNHVKVLIDGIDAGDPSKPSGAYDFANLLTADIERIEVLRGPQSGLYGSDAI
FT                   GGVISITTKRGQGPAKLTGMVEGGSFGTFNQTARAAGSDGNFDYAFNVAHYRSTEVAVT
FT                   PLDLLAPGQKRNNDIYDNLSYSTKLGLQASDDLAFNFVGRYTDAHKGFTGDDSSHWPNS
FT                   FPEVLQSTTASRDLLTRSEAVWSPLDGRFKSTLGVSYSNLWNRTNNPNPDYPISYTSYG
FT                   VGPATFYRGERTKVDWNGVVDAGYGQKIVLGAERQDDKIHTDSVGGYDLLGNYQQSMTT
FT                   ASTGDSAGFVELQSAFTNNFFLVSNVRYDDNDSFGGHTTWRVAPTFILPLTETKLKATY
FT                   GTGFKAPTLMQLYVNTPYTIANPALRPETSKGFDVGFEQPLFHNRVSFGATYFNNEIEN
FT                   LIENSVVSGQWTYDNVGLAKTYGVESFVALQATETLRFRADYTYTQTRDEKTGQRLRRR
FT                   PDNKVTLAAIWNPIERAMVSASIVHTSSWLDYDRFGTALLDAPAFTTVNLAANYTIDQH
FT                   VTVFGRIDNLFDKTYEVPVGFLQPGIGVFAGVRLTN"
FT   sig_peptide     complement(96205..96318)
FT                   /locus_tag="RPC_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 38"
FT   gene            complement(96430..96643)
FT                   /locus_tag="RPC_R0072"
FT   misc_RNA        complement(96430..96643)
FT                   /locus_tag="RPC_R0072"
FT                   /product="Cobalamin riboswitch"
FT                   /note="predicted by Rfam (RF00174), score 135.01"
FT   gene            96784..97833
FT                   /locus_tag="RPC_0085"
FT   CDS_pept        96784..97833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0085"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85664"
FT                   /db_xref="GOA:Q21D72"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D72"
FT                   /protein_id="ABD85664.1"
FT                   /translation="MTEGAQHTATMETAAARPRGLVTLALLLIVGLLMLASLGIGPVRL
FT                   SPLTVLGALFGGGGEIEQVIVQQIRLPRAILGLAIGGILGLSGAALQGLLRNPLASPSL
FT                   FGAPQAAAFGAVLMIALGLADVRSYALPAAAILASFISVFALLAVAGRNAGMLLLILAG
FT                   LAISSLAGAATVLVMNLASNPYVALEIAFWMLGSLEDRSFRHVMLALPFIIAAALILLS
FT                   QRHAFRALSLGEETAQSLGVDVGRLRLLVIVGVALGVGAGVAVAGTIGFIGLVAPHLMR
FT                   PLVGHDPARLMLPSALTGAALLLAADIAVRIIPSSSDIKVGVLTSLIGVPFFLYLIVRE
FT                   RRSLGGGIG"
FT   gene            97830..98612
FT                   /locus_tag="RPC_0086"
FT   CDS_pept        97830..98612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0086"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85665"
FT                   /db_xref="GOA:Q21D71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D71"
FT                   /protein_id="ABD85665.1"
FT                   /translation="MNETAFLQARGLGVDLGGRAVLRDVSLALAPKHLVALVGPNGAGK
FT                   TTLLRALAGLLPSTGEIAVGGERLSALSLRERALRFAYLPQGHVVHWPLPARDIVALGR
FT                   YPHGATDPSRLAPTDDAAVRRAMLATDTIALAERRVTELSGGERSRVALARVLAVEAPV
FT                   LLADEPTASLDPRYQLDVMQYLRDAADSGTLVIVVTHDLGLAARFADSVLVLADGRLAA
FT                   QGAPAEALTDQVMTEVFRVSAYRAQHQSEAVIVPWDAA"
FT   gene            98624..99442
FT                   /locus_tag="RPC_0087"
FT   CDS_pept        98624..99442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0087"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85666"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D70"
FT                   /protein_id="ABD85666.1"
FT                   /translation="MLAALALLGAIGTAVAQPLPRIASTNVCTDQLLITLADPNQIIGL
FT                   SPYSRDPAQSYAAAEAQRYRLLSGGAEDILMLKPDAVVSGQYDKRATRELLRQQGVRVV
FT                   EFDVLPQSLGAIKQQIRAMAELVGHPDRAAAAIARLDAAIGRARAAAQRPIRVLPLWRR
FT                   GWVSGAGSLISLLFAETGLINAAADLGIASGGFASLEAIIAARPDILLVSDGGDFAEDE
FT                   GTALLLHPALEQFYPPSKRIVLPERLTVCGGVMLADALDLLVAELARIER"
FT   sig_peptide     98624..98674
FT                   /locus_tag="RPC_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.889 at
FT                   residue 17"
FT   gene            99734..100405
FT                   /locus_tag="RPC_0088"
FT   CDS_pept        99734..100405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0088"
FT                   /product="protein of unknown function DUF938"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85667"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D69"
FT                   /protein_id="ABD85667.1"
FT                   /translation="MPEIPVEFGKQARGDSDGRLDAAAFHRNHAPIWEALAPLLGEQSG
FT                   EVLEAGSGTGQHVIAFARQSPNLIWWPSDFNPAHLASIAAWRTQAGLANVREPLSIDLS
FT                   DPAWCPQLQDGSGPGPLLAVFSANVVHIAPWRVAEGLFAGAARYLRPDGRLILYGPFKR
FT                   DGAHTAPSNAAFDHSLRATNPDWGVRDLAELEALGSAHGLILSNIIEMPANNLLLVWSR
FT                   G"
FT   gene            100508..101728
FT                   /locus_tag="RPC_0089"
FT   CDS_pept        100508..101728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0089"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85668"
FT                   /db_xref="GOA:Q21D68"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D68"
FT                   /protein_id="ABD85668.1"
FT                   /translation="MVDAIMIDEAAGDARARSNLLRLGIAQALTGANAAVIFATGAIVG
FT                   ATLAPDATFATLPVSVYVVGMAAGTLPTGAISRAFGRRVAFLLGGGCGALCGALACLAI
FT                   LHGSFALFCVATFLGGLYGAVAQSYRFAAADGASVAFRSRAIGWVMTGGIFAGVIGPQL
FT                   VQWTMDIWPPYLFAFSFATQAVVALIAMAVLAGVDAPRPKPAELAGGRPLWQIARQPRF
FT                   VIAVVCGVVSYAMMNLVMTSAPLAMQMCGLSISDSNTGIQWHMVAMYGASLLAGPMIAR
FT                   FGAARTAALGLVLEALAACIDLSGVTALHFWAGLIALGIGWNFGFVGASALVLETHLPA
FT                   ERNKVQALNDFLVFGVMALGSFASGGVLALYGWSTINWVVFPPVLLALAVLAFATWGQR
FT                   RAVPRGS"
FT   gene            complement(101910..102044)
FT                   /locus_tag="RPC_0090"
FT   CDS_pept        complement(101910..102044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85669"
FT                   /db_xref="GOA:Q21D67"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D67"
FT                   /protein_id="ABD85669.1"
FT                   /translation="MSAPPPETPRPLTKRLLWFVALWAAGVGAVGLVSFILRLWIAPH"
FT   gene            complement(102041..103057)
FT                   /locus_tag="RPC_0091"
FT   CDS_pept        complement(102041..103057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0091"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85670"
FT                   /db_xref="GOA:Q21D66"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D66"
FT                   /protein_id="ABD85670.1"
FT                   /translation="MGLGVDVDLATVWAFIIAFAVFVYVVMDGFDLGLGMLFPLFPKKA
FT                   DRDVMMNSVAPVWDGNETWLVLGGGGLFAAFPLAYAVLMPALYTPMIIMLLGLVFRGVA
FT                   FEFRWRTQRERNRWDIAFAGGSLLATMAQGVALGAILQGVQVEGRAYAGGWWDWLTPFS
FT                   ILTGLALVTGYSLLGATWLVMKTEGELRDEAYRLSWWLLMAMLIAIGAVSIATPFLNFE
FT                   YAQRWFAWPNVLVTAPVPIAVAGVTVLLLRALAKRQDYRPFFLSLTLFALAYAGLGISM
FT                   WPYIVPRSITIWQAAAPENSQIFMLVGVAILVPIILIYTAWAYWVFRGKVNSESGYH"
FT   gene            complement(103057..104466)
FT                   /locus_tag="RPC_0092"
FT   CDS_pept        complement(103057..104466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0092"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85671"
FT                   /db_xref="GOA:Q21D65"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D65"
FT                   /protein_id="ABD85671.1"
FT                   /translation="MFENFDAVVLARAQFAFTMSFHIIFPAFSIGLASYLAVLEALWLA
FT                   TKREVYINLFNYWLKIFAIAFGMGVVSGIVMSYQFGTNWSVFSDKTGPVLGPLMAYEVL
FT                   TAFFLEAGFLGVMLFGLERVGHKLHFIATLMVAIGTLISAFWILSANSWMQTPAGYAIN
FT                   ADGQFVATDWLKLIFNPSFPYRLVHMVLAAYLTTALVVGAVGAFHLMRDSHKSGPRVMF
FT                   SMAMWMATIVAPLQIVAGDQHGINTLEHQPAKVMAMEGHYQSHPDGAPLILFGLPDQDA
FT                   AVVRYALQIPKLSSLILKHALDAPLAGLDTVPRQDWPPVPVTFWSFRIMVGIGFLMLGL
FT                   GLFSLWSRFRGTLFSSPLLHGYALVMGPAGFIAVLAGWVTTETGRQPFTVFGVLRTTES
FT                   VSPLAAPAVGSSLIAFILVYFAVFIAGTVYILRLMKQPPHHGEQGPRGDTPERAAGITP
FT                   APAAIASRRFN"
FT   gene            complement(105246..105857)
FT                   /locus_tag="RPC_0093"
FT   CDS_pept        complement(105246..105857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0093"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85672"
FT                   /db_xref="GOA:Q21D64"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D64"
FT                   /protein_id="ABD85672.1"
FT                   /translation="MQNVIALNEAGRQGIVAARATTDEMLLEAIASGNRCAMHTLYARH
FT                   HLRVYRFILRMVRDASVAEDLVSQVFLDVWRTAGQFEGRALVSTWLLSIARFKALTALR
FT                   QRQHEELDQDDVLEIADGAETPEAALDRSRTNAILRACVAKLSPAHREIITLVYYHEKS
FT                   VEQAGLIVGIPPSTVKTRMFYARKQLAELLKSQGIENLAA"
FT   gene            complement(106054..106794)
FT                   /locus_tag="RPC_0094"
FT   CDS_pept        complement(106054..106794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0094"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85673"
FT                   /db_xref="GOA:Q21D63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D63"
FT                   /protein_id="ABD85673.1"
FT                   /translation="MSQNPNIIVVDDEAPAREMVGDYLKMHGFTVTLCDGGASLRAAIE
FT                   IAVPDLVVLDLNMPEEDGLSIIRDLKARTNVPVIMLTATASPIDRVVGLELGADDYVAK
FT                   PCELRELMARIRSVLRRSAPAKPAPAPVAAAVMPAKEHLVRFGTKWLDLEAQALRDDDG
FT                   NEHPLTASEFGLLKVFAANPKRVLSRERLLELANARDAEAFDRAVDLRIMRIRRKIEAD
FT                   PTKPAVIRTIRGGGYLFSPSGERA"
FT   gene            complement(106791..108539)
FT                   /locus_tag="RPC_0095"
FT   CDS_pept        complement(106791..108539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0095"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85674"
FT                   /db_xref="GOA:Q21D62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR021800"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D62"
FT                   /protein_id="ABD85674.1"
FT                   /translation="MAEQDDVLQLIDDSGFAPEPSSAKKWKVAVIDDDHAVHDGTRFAL
FT                   SDYCLNGQTLEILSAYSAAEGRVLMREHPDIAAVLLDVIMETDAAGLDLVEYIRNDIKN
FT                   ETVRIILRTGQPGQAPERRVIVDYDINDYKAKTELTADKLFTSLTAALRSYQQLERMVQ
FT                   TRRGLEIIIDAASTLYDFKSMQRLAEGVLTQIASLLNVDCAGILVLRDGGQVCDDFAVL
FT                   AGSGCYRRFIGSCGPGALDNDVRQMVEAAFRRRKHEFDDQRTVLYVRTGSGREVVVLLQ
FT                   AERELSDTDRSLVEIFGSRLSIAFDNVILYQQLNQANAQLEDRVAQRTRALSQANRRLS
FT                   SQWMRLQRANGFKNEILGTVAHDLKNPLGVILGRTEMLTELIGADAAKESVCAQVDHIR
FT                   DATRRLTAMVDHLISDAMADAFDITIRREPVDISALVTEVAEANRPLALNKQQEITVSA
FT                   PQDQVTVCDSDRIREAIDNLVSNAIKYSPVGGKIALIVDRSGDNTVIRVTDQGAGLSPE
FT                   DLGRLFGRFQRLSAKPTAGESSTGLGLSIVKKIIDMHGGNVSAESAGPGEGASFTITLP
FT                   AAAASA"
FT   gene            complement(108509..110587)
FT                   /locus_tag="RPC_0096"
FT   CDS_pept        complement(108509..110587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0096"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85675"
FT                   /db_xref="GOA:Q21D61"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D61"
FT                   /protein_id="ABD85675.1"
FT                   /translation="MDPVTQQTEQASAPQPKPLSGVVRLVRAVPIRWRILSIAALNSAV
FT                   ALVLAGLIWSGFQGLGSAWDDVRQVRESDKILALLESETGRLQNLIHRYINQPSPELFA
FT                   EILLLREAVLGTLTSRASTDPMLSGSVDELERVTERFLNGFGDLRALQTTITKTYQEQV
FT                   MAPAKDMAGLYSIIEGATGRREAAIWPPLGRSREAFTSLLVAANSYYLSLSTASAEQAR
FT                   ANTETIERTIPVMIEFADNDLQRMALERLKIRTEALRDGLGQLSAQLVSRTDLLRNSID
FT                   ASQAATIGAIDGLSVKMRQREQKAQETFDRTLRDISREVLWIAVIFLGIIIVAGVVIAL
FT                   SIRRPLQQLMRAMQAIASGDYDRRVAGTSARDEVGAMARAVEVFRENAIDKRKAEDELR
FT                   ASKEKAEGALLELNAAQRNLIDAERLAALGGLVAGVAHEVNNPIGISLTVASSFVRKAG
FT                   QFEAELHSATPLRRSQLDEFVRTSKDAAQQLMANLQRAAELIQSFKQVAVDRSHAERRQ
FT                   FNLNEATNQIVASLRPVLKRAPITLSLDVPEGLLIDGYPGSYGQILTNLFLNAVNHAFP
FT                   AGCAGGISISARPRGVDDIEIIFADTGIGMTPEVQRQAFDPFFTTRRNEGGTGLGLHIV
FT                   YNLVTQQLGGRMMLESRPGQGTIFRIIMPRAATGGAVHAETDSDGTPPWPSRTMSSN"
FT   gene            110786..112090
FT                   /locus_tag="RPC_0097"
FT   CDS_pept        110786..112090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0097"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85676"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D60"
FT                   /protein_id="ABD85676.1"
FT                   /translation="MRAALALGLLGLAGSSPAHAVIEVAWWHAMSGQLKLRLEQLAADF
FT                   NASQTEFRIAPSYKGNYTETVTAAIFAFRSHSQPAIVQVNEIGTATMMAAKGAVYPVFE
FT                   LMRDEQEAFSPAAYLPAVTGYYTDIDGNMLSFPFNASTPILYYNKSLFRKAGLDPEQPP
FT                   KTWPEVGAAAKRLLAAGAACGFTTSWPSWINIENFSAYHNLPLATQSNGLGGLDAVLTF
FT                   DNPTVARHIAQLAEWQTSKAFDYSGRATTAEPRFQRGDCAIFLGSSATRADILANAKFE
FT                   VGFGMLPYWPDVAGAPQNTMIGGATLWVLRGRPSEEYRGVAKFFGYLSQPEIQAAWHQN
FT                   TGYLPITRAAYELTRAQGFYDRNPGTAISIEQITLKMPTENSRGLRLGSFVLIRDVIED
FT                   ELEQAFSGKKSAKAALGSAVERGNRLLRQFERANP"
FT   sig_peptide     110786..110848
FT                   /locus_tag="RPC_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(112119..113036)
FT                   /locus_tag="RPC_0098"
FT   CDS_pept        complement(112119..113036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0098"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85677"
FT                   /db_xref="GOA:Q21D59"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D59"
FT                   /protein_id="ABD85677.1"
FT                   /translation="MDQHPESETSFLEQLGHRVRTTRALRGMSRKVLAKVSGVSERYIA
FT                   QLESGKGNVSIVLLRRVAQAMGSHPEDLIPAADPAPDWPLLRELLRRATPVQLAHARDV
FT                   LSGQGRLGAGARRLPEFCGIALIGLRGAGKSTLGRRLADHIGWRFVELNKEIERQNGLS
FT                   VPEIIALYGQEGYRRMEHAALTELLARKELTVLATGGGIVSEPLSFDLVLSSFYAVWLK
FT                   AEPEEHMARVRRQGDLRPMADDHAAMDELRTILKSREPLYARAAAVLDTAGLSVDDAAE
FT                   RLIAMVSPVLCRDACAFGTNRAAV"
FT   gene            complement(113163..114008)
FT                   /locus_tag="RPC_0099"
FT   CDS_pept        complement(113163..114008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0099"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85678"
FT                   /db_xref="GOA:Q21D58"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D58"
FT                   /protein_id="ABD85678.1"
FT                   /translation="MTFETVSLNQAHGGTQGVYKHQSRETGTAMTFSVFVPRRRDDAPL
FT                   PVVWYLSGLTCTHANVTEKGEFRKACAELGLIFVAPDTSPRGDGVPGDPDGAYDFGLGA
FT                   GFYVDATQQPFAKNYRMWSYLTTELPALIAAHFPADLDRQSVLGHSMGGHGALTLALRH
FT                   PQRFRAASAFAPIVAPSQVPWGIKALGGYLGEDRGAWRAHDAVALIEDGARFPDLLVDV
FT                   GDADPFLALQLRPELLEQACASAGIALTLRRQPGYDHSYYFISTFMDDHLRWHAARLRT
FT                   "
FT   gene            complement(114221..114790)
FT                   /locus_tag="RPC_0100"
FT   CDS_pept        complement(114221..114790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0100"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85679"
FT                   /db_xref="GOA:Q21D57"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D57"
FT                   /protein_id="ABD85679.1"
FT                   /translation="MTVHIHPAVDQGVKQGSGSFAGGTLVCKCQDRPVKVGIKGDVAHN
FT                   HACGCTKCWKPDGATFSVVAVVPRDNVTVLENGDKLHVVDASATIQRHACKVCGTHMYG
FT                   RIENKSHPFYGLDFIHPELFQEGGSAAPEFAAFVSSVIESGVDPSEMPGIRARLKELGL
FT                   EPYDCLSPGLMDAIATSVAKSQQKAA"
FT   gene            complement(114870..115979)
FT                   /locus_tag="RPC_0101"
FT   CDS_pept        complement(114870..115979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0101"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85680"
FT                   /db_xref="GOA:Q21D56"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D56"
FT                   /protein_id="ABD85680.1"
FT                   /translation="MKTRAAVAFEAKKPLEIVEVDLEGPKTGEVLVEIKATGICHTDAY
FT                   TLDGFDSEGIFPSILGHEGAGIVREVGPGVSSVKPGDHVIPLYTPECRQCKSCLSQKTN
FT                   LCTAIRATQGKGVMPDGTSRFSYKGQQIFHYMGCSTFSNFTVLPEIAVAKIRDDAPFDK
FT                   SCYIGCGVTTGVGAVVNTAKVTPGSNVVVFGLGGIGLNVIQGARLVGADKIIGVDLNDD
FT                   KEEWGRRFGMTHFVNPKKIDGDIVQHLVGLTDGGADYTFDCTGNTTVMRQALEACHRGW
FT                   GVSVVIGVAEAGKEISTRPFQLVTGRVWKGTAFGGARGRTDVPKIVDWYMNGKIEIDPM
FT                   ITHVLKLDEINKGFDLMHEGKSIRSVVVF"
FT   gene            116537..116965
FT                   /locus_tag="RPC_0102"
FT   CDS_pept        116537..116965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85681"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D55"
FT                   /protein_id="ABD85681.1"
FT                   /translation="MCDYSLHAVATRPAKVGETLITTTFRGTSTRGFAAVDEPDVAVCL
FT                   LPGTELSFQDEVRYDQRWIWTRASQFKVGKFGQIDKGTPATHHDAIEFPDGSNVLVTHL
FT                   VTGQLATVLQLPVQAGSRSETETTSETAALPSVTADSR"
FT   gene            complement(117105..118043)
FT                   /locus_tag="RPC_0103"
FT   CDS_pept        complement(117105..118043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0103"
FT                   /product="protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85682"
FT                   /db_xref="GOA:Q21D54"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D54"
FT                   /protein_id="ABD85682.1"
FT                   /translation="MSKKQNKIIITCAVTGGIHTPTMSDALPYTPDDIATQAIAAAEAG
FT                   ASILHLHARDPDNGSPTPAHEAYMRFLPRIKQATDAVLNITTGGSLNMTVEQRLAAPLL
FT                   LKPEMCSLNMGSMNFGIFPLAERYKSWKFDWEEPYLRSTEDFIFRNTFRDIERMLKLLG
FT                   EEHGTRFEHECYDIGHLYNLAHFVDRGLVKPPFFVQSIFGILGGIGPELRNLAFMKETA
FT                   DRLFGDDYQWSVLGAGRFQMPFATQSLLLGGNVRVGLEDSLYIGRGELASSNAQQVAKI
FT                   RNIAEELGLGIATPAEAREMLALKGGDRTGF"
FT   sig_peptide     complement(117969..118043)
FT                   /locus_tag="RPC_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.671 at
FT                   residue 25"
FT   gene            complement(118134..119609)
FT                   /locus_tag="RPC_0104"
FT   CDS_pept        complement(118134..119609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0104"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85683"
FT                   /db_xref="GOA:Q21D53"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D53"
FT                   /protein_id="ABD85683.1"
FT                   /translation="MNVVTPIASRTVDVSTIPTDLFIAGAWRASASGQRIEVINPSTEE
FT                   LLATIADASVEDGLAAVDAAAAAARGWAATAPRQRAQILLRAFELMIEKADWLAELISL
FT                   ENGKALADAMGEVKYAAEFFRWYAEEAVRIQGDISMAPGGGNRILVQYQPVGVSVLVTP
FT                   WNFPAAMATRKIAPALAAGCSCILKPASETPLTAFALVEILCAAGVPAGVVNVVTTSQP
FT                   GPLISAMLHDSRVRKLSFTGSTAVGRLLLREASDCVINCSMELGGNAPFLVFDDADLDA
FT                   AVDGAMIAKMRNGGEACTAANRFYIQRGIFHAFAHKLAAKMAAMQLGDGWLASTACGPL
FT                   VNEKSRDKVAAFVDDAMARGAKALTGGKPLDRKGYFYEPTVLIDVAPDSKLLHDEIFGP
FT                   VAALVPFDSEDDVIELSNASEYGLVCYVYTRDLAKGLRVSERLDSGMVALNRGLVSDPA
FT                   APFGGTKQSGIGREGAHHGLLEFTEAKYIATNW"
FT   gene            complement(119626..120852)
FT                   /locus_tag="RPC_0105"
FT   CDS_pept        complement(119626..120852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0105"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85684"
FT                   /db_xref="GOA:Q21D52"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D52"
FT                   /protein_id="ABD85684.1"
FT                   /translation="MTAFGVSRSPRNIVFGKGQRGALGLSAKALGSRALICTDERLGGE
FT                   PWFRAMVDDLTANGVGVQVYDRTIAELPLSCLDECTAAARPFGPDLVIGIGGGSCMDLA
FT                   KVAALMLTHGGDIRSYYGEFKVPGPVLPLICVPTTSGTGSEVTPVAVLGDPERAMKVGV
FT                   ASPRLISHTAICDPELTYSCPPGLTAISGADALTHAIEAFTAMQRPATPQLPHQHVFIG
FT                   KNLFSDRYALYAIELIARSLPRAVANGDDEAAREDLMLGALSAGLAFGTAGTAAAHAIQ
FT                   YPVGAMTHTPHGTGVALLMPYVMDFNRGACRDEFAAIAVAMGAKHSGQSADALAADAID
FT                   RVRRLFKEIGLPATLAELSVPADRLDWIAENAMSSQRLIKNNPVSLDVAGLRRIIDAAY
FT                   HGSPMQDAA"
FT   gene            complement(120849..121889)
FT                   /locus_tag="RPC_0106"
FT   CDS_pept        complement(120849..121889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0106"
FT                   /product="(R)-2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.1.1.272"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85685"
FT                   /db_xref="GOA:Q21D51"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D51"
FT                   /protein_id="ABD85685.1"
FT                   /translation="MIVEAERVRSCAVDALMAAGVLRQDADQQVDLLLEAELRGRPSHG
FT                   LLRLARIVERIDNGVIDPRASGCHHWKAAGFLEVDGQNGLGPVVALSALEAISLRARET
FT                   GVAVATIVNANHLGMLAWYAETIARRGLTIIALSISEALVHPWGGRRAMLGTNPVAIGV
FT                   PASPRPFVLDMASSLVSMGQIHDHANRGAPIPGHWALDAQGNATTDAAAAKAGSIAPFG
FT                   EAKGYALGLAFEVLVASLTGSALGRQVRGTLDSTEVCNKGDVFIVIDGASSAAMAQVIG
FT                   GYLEAIRAEPPADGFAAVAIPGDRSIAARQRALADGISIADQVWAGLVRLAQRNPKNPA
FT                   AKVAQS"
FT   gene            complement(122005..123555)
FT                   /locus_tag="RPC_0107"
FT   CDS_pept        complement(122005..123555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85686"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D50"
FT                   /protein_id="ABD85686.1"
FT                   /translation="MTDGTSGNPQRADAAALTTARPAAALSRHWGRGIARSLAFAAASI
FT                   GLVASAAAADLPAFVKAPPVMPDLTWHGITIFGAYDIAGQYESNGAPYNGSAYSSAGII
FT                   SPFNRGPQWVLAPNQSIQSFIGVKVDEKITDQLHVIARLEMGFNPTTGEISDTLKSMQK
FT                   ANGIPLNQQYVNGDGPRAGQVLNGEAWAGFEEKTWGTLHVGRNNAVSADMLFAYDPLSS
FT                   YGFSLFGYVGILGGGGSSETVRVDQSIKYLNKWGPIRVEAMYGNPNTNTKEFYQGSIGL
FT                   VDLNYSVDVVAGHASDLVSSSALAGPANLGSQFLGARVSDADTVGVFGKYVFDLGRNGL
FT                   RDPNESRFTLSGGVSRIEFSNPSDGGWAPGHTTIGGYQIGPAFATNGSSAAGIVNYAYT
FT                   GGNRVLIASFIAGKYQYDAQWSAALAYYRYDQKSYGLGVNGLPGIVAPSFSTQACSSSS
FT                   YINCAGGEQVVSFRVDYDWTKNLKLYGGLAYSKVDGGFAFSYLKTSEFAPTVGMRLTF"
FT   gene            complement(124109..124873)
FT                   /locus_tag="RPC_0108"
FT   CDS_pept        complement(124109..124873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0108"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85687"
FT                   /db_xref="GOA:Q21D49"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D49"
FT                   /protein_id="ABD85687.1"
FT                   /translation="MSGEQNEPGDRPGGKVVLVTGGARGIGAGVARRFAGAGCRVAIAS
FT                   RSASPAAAAVLAEIEALGAQGIAVAGDISNSEDARAMVGEVVARFGRIDVLVNCAGVAE
FT                   YRAFEATDLAMFRATFDTNVFGTVAMIQAALPHLTAPGGRIINFSSALATRPIPTASIY
FT                   AASKAAVSALTHALAKEFGPRGITVNAIAPGVIETEMTAAILAERGAAIKAMTPLGRIG
FT                   QTDDVAGLALFLASHDAGWLTGRTIIADGGVS"
FT   gene            complement(124896..125567)
FT                   /locus_tag="RPC_0109"
FT   CDS_pept        complement(124896..125567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0109"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85688"
FT                   /db_xref="GOA:Q21D48"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D48"
FT                   /protein_id="ABD85688.1"
FT                   /translation="MNVLFVYAHPEPSSFTGALKDAGAAALRRAGHHVEISDLYAEKFD
FT                   PVAGRHDFTSAADPERFHYQTEQALAHETNGFAPDLMREQRRFLNADLVVWLYPIWWGG
FT                   MPAILKGWFDRVLAFGFAYADGRRFDSGFFPDKRGLLCLSTGGTQRRFSKGDAYGDIET
FT                   VLWPAQRLMISYLGMQALQPFVAYAAPRVDADGRAAYLQQWCARLLQAAEQMTEAEAPP
FT                   N"
FT   gene            complement(125611..126498)
FT                   /locus_tag="RPC_0110"
FT   CDS_pept        complement(125611..126498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0110"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85689"
FT                   /db_xref="GOA:Q21D47"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D47"
FT                   /protein_id="ABD85689.1"
FT                   /translation="MPSGVELIQSLVNGVGIGLIYGLVAIGFCVIYNASGIVNFAQGVF
FT                   VMLGGMFAHALLTQFGLPMYLAAALSIVLVAGVGVLVQIFVINPMWRRKAPLFAIILAT
FT                   LAIQLLIEQVVILTLGDQPRTYPEFTSGGPLKIGPIAIGYQLFWVLGCGAVMVFALTQF
FT                   FNRTRIGRALRACSQNREAAALLGIPVERMLILAFALSSALGAAAGILITPTQYTAYSV
FT                   GAPFGINGFIAAIIGGFGSASAGLVGGILLGVIQSGAIVFFGAGFKNVIALTILLVVLL
FT                   FFPNGLFGGRAKKA"
FT   gene            complement(126491..127264)
FT                   /locus_tag="RPC_0111"
FT   CDS_pept        complement(126491..127264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0111"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85690"
FT                   /db_xref="GOA:Q21D46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D46"
FT                   /protein_id="ABD85690.1"
FT                   /translation="MALLKVKGLTKRFGGLFANNEIDLEVPQGSLFAVIGPNGAGKTTF
FT                   FSMISGFLGSTSGSIEFDGRDITHVRQDEIAAMGLVRTFQLVQLFKGMSVAENVEVGCH
FT                   LATKGGVAAALLRPAWFRRQEAEVVERAHELLRFVGLDAQADRDAELLPYGQQRLLELA
FT                   RALASRPRLLLLDEPAAGLNTKETDGLAHIIQKINDQGTTVLLIEHDVGLVTRIAHRIA
FT                   VLDFGRKIAEGTPDEIKAHPEVIAAYLGVEEVENA"
FT   gene            complement(127267..128250)
FT                   /locus_tag="RPC_0112"
FT   CDS_pept        complement(127267..128250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0112"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85691"
FT                   /db_xref="GOA:Q21D45"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D45"
FT                   /protein_id="ABD85691.1"
FT                   /translation="MTLPAITSPRPIVIANRFSIGLLGLAGLLFVAVLIYGGYLLTVMQ
FT                   LAMIYGIFCLGLNFFMGYTGQASFGQNAFACIGGYGSAILSVQYNWEPGLALLASMAVA
FT                   GVAALLIGYPTLRLRGHYLAMATFALGLITYDITVQWTSLTQGYMGYAGIPPLGVGSFT
FT                   VEDERMKLICLGLLLLFAFWISQRLRDSRFGRGLRAIAGSEDGASALGIRISRFKLIAF
FT                   VIAALYASAAGSLFAHTVGFISPEVFGPQMVIVTFTMLYVGGVGTMIGPVIGAIVASLL
FT                   PELFRSTGRFQDIAYALVLLVMLIYAPKGLSALGSLFRPRADKDEV"
FT   gene            complement(128222..128950)
FT                   /locus_tag="RPC_0113"
FT   CDS_pept        complement(128222..128950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0113"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85692"
FT                   /db_xref="GOA:Q21D44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D44"
FT                   /protein_id="ABD85692.1"
FT                   /translation="MTAAADYTPLLAVRDLAARYGHIEALRPTSLHVAPGEFVTILGPN
FT                   GAGKTTLLRAMTRLIASTGKVAFKGRDVTGLRTHELADLGIIMVQEGRGLFGDMSVREN
FT                   LQLGGYSRGGSHHEAEQRLDKVFRLFPRLRERVEQTASSMSGGEQQMLAVGRALMADPK
FT                   LLILDEPSLGLAPRVASEILSTLGALNQEGLGILLVEQKAPLALKLAQRVYILSSGRAR
FT                   AELPTHEIKSHHDLASYYFA"
FT   gene            complement(128947..130098)
FT                   /locus_tag="RPC_0114"
FT   CDS_pept        complement(128947..130098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0114"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85693"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D43"
FT                   /protein_id="ABD85693.1"
FT                   /translation="MGSHKALVVAIMLAATPILAAAAQETIKIGSSLGLTGYGSATDAH
FT                   WRDGMQIAIEQVNAQGGVLGKQLELVFEDNKSTPQQAVVGYRKMITDDKVVAFASGCIS
FT                   AGNFAAASFVAKAKLPMFLCSILPRQPAEQKWAFQFLPPPKFEVDARYQYLKEKTDIRK
FT                   VGILSDPSPYSLLMRDLAVKGAEEFGLTVVANESYQQDDADFSVQIGRVNAAGAGALIM
FT                   LGQGNAVVTVANNIRSLGLTKLLMLGSVNELDILLATGKVLNEQYLFPSPLIQVASDDI
FT                   SVISDPAARQAAEPFVKAMKAKYGRTDNAQASRGWDSILMMAAAMTKAKSVDGTAVRDA
FT                   MEQLGHFVGAGASYEFTADNHIGISHNPYVIAQVKDGALVLKK"
FT   sig_peptide     complement(130027..130098)
FT                   /locus_tag="RPC_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.543 at
FT                   residue 24"
FT   gene            complement(130163..130954)
FT                   /locus_tag="RPC_0115"
FT   CDS_pept        complement(130163..130954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0115"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85694"
FT                   /db_xref="GOA:Q21D42"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D42"
FT                   /protein_id="ABD85694.1"
FT                   /translation="MNAASTFRQRMMAGDKLVGTFVKTPTGHATEIVGDLGYDFVVIDQ
FT                   EHAPFDRTSSDIALMAARVTDTPALVRVPGPDWILSVLDGGACGVLVPHVKTAAEAREI
FT                   AALFRYRGGGRGFATSTRAGRYTSVPMWQHIAEADANMVFVAQIEDPVALDEVDAIAAV
FT                   DGVDALFIGRGDLTAAFGDDAKDPPEVRRAVERIIKAARNSNKPVSVFVGNATEAAWLG
FT                   SLGATVFVLSSDQGFMRQAAAAGLRDLRDTVCQERVGLDVS"
FT   gene            complement(130993..131892)
FT                   /locus_tag="RPC_0116"
FT   CDS_pept        complement(130993..131892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85695"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D41"
FT                   /protein_id="ABD85695.1"
FT                   /translation="MYDPTDPRAKLAPATAQAAPTGPFGQAEYLRFYDEPPQDDGPDGK
FT                   SWYGRGQNFVLVHTEANKGGVLARDEQPDEYAVLLSDPHVVVDITTADGTQRVNGRSLA
FT                   FVPPGPSSIKILEPGRVYRIFTTRSADLAAKSANAASYATAKPYVAPLRDWPLPKDGFR
FT                   LRVYSLDVAPEPGRFGRIWRCSTIMVNYLDGFQGPRDAAKLSPHHHDDFEQCSLAVEGE
FT                   FLHHLRWPWTVDKHNWRNDDHELCKTPSIAVIPPPSIHTTEACGSDFNQLVDIFCPPRL
FT                   DFSQKPGWILNADDYPMP"
FT   gene            complement(131967..132908)
FT                   /locus_tag="RPC_0117"
FT   CDS_pept        complement(131967..132908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85696"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D40"
FT                   /protein_id="ABD85696.1"
FT                   /translation="MTGSTDVKDEQRVAALLRGAIDPHVHSGPSIAARSLDHIELLEAA
FT                   SQAGFAAVVTKDHDYSGVMTAALIKKHRPDLTTKLYSSIVLNNVVGGLNPYAVEHTAAL
FT                   GGRIVWLPTLAAANHLRWQAAAKWVHPASTERMRPVTAIPVLNDDKSVRDDLKEVLDIV
FT                   AKNDMVLASGHLHVSETWLVFEEAQRRGVKRLVFTHPEDIVDASLNDVKGIAAMGAFVE
FT                   HSLCMFLDGCKFKSREPEDLRNQIDAAGVGQTMLCSDLGQVGTFSPLEGFGRGIQLCID
FT                   LGYDDDEIRKMVSTNTARALGIEADVAAAGAA"
FT   gene            133128..133949
FT                   /locus_tag="RPC_0118"
FT   CDS_pept        133128..133949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0118"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85697"
FT                   /db_xref="GOA:Q21D39"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D39"
FT                   /protein_id="ABD85697.1"
FT                   /translation="MSEQGSGGVHSVQLAIDVLEAVAFADEELGVTQIAERLSMTKGSV
FT                   FRHLQTFVDRGYLTQNPTTSRYAIGPKSRLLARHAPEADLVHLAEGPMRQLRDALGHPV
FT                   VLSEMTPRGALVLHTLSGTAPIEIGVRSGSELTFHASAQGKVMLAFAPAPFQARVLARP
FT                   LQRYTDKTMITTRRLEKELVKITSLGFASAPEENMLGLNAVAAPIFDAHDACIAAVALV
FT                   GSIQFLPEKPRPSDVTQLIETARQISRKLGHGNRSGEPPTAAKRRPRTAGV"
FT   gene            134177..134614
FT                   /locus_tag="RPC_0119"
FT   CDS_pept        134177..134614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85698"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D38"
FT                   /protein_id="ABD85698.1"
FT                   /translation="MTEDISVEFSLFVEHGREREAANFYAAAFGAREVGTYDIDGVLGA
FT                   VEMRFGNLPVWVAGAHPKRETAPSYGGPFFPKAPGAVSTIFQLKVGSIDGAMQRALAAG
FT                   AVIRDDIQTDTTGRRVASIFDPFGHIWALVQRKAAEVSRAA"
FT   gene            135298..136143
FT                   /locus_tag="RPC_0120"
FT   CDS_pept        135298..136143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0120"
FT                   /product="phage portal protein, lambda"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85699"
FT                   /db_xref="GOA:Q21D37"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D37"
FT                   /protein_id="ABD85699.1"
FT                   /translation="MAGREGFERPIRICAHRHSSPEEAHLHARLESLAIPANDVLHLYE
FT                   KQRTQVRGVPWGTPVMRALRDLDDWTQAELVRKKTEACVVGIVLGADEADQGIAPSVVD
FT                   ADGNRVEQFEPGLIAYARGGKDIRFNQPATTAGVGEWLRAQLHIVAAGFRMPYELLTGD
FT                   LSQVNYSSIRAGLVEFRRLIDAVQWQIVIPVLCQPMWVWFCQAAWAAGKLPRPDIAVEW
FT                   SPPRFEAVDPLKDAMADLLALRSGTMSLAQAIARQGHNPDAVLAEIATMNAKITPSGSF
FT                   "
FT   gene            136235..138197
FT                   /pseudo
FT                   /locus_tag="RPC_0121"
FT   gene            138244..138579
FT                   /locus_tag="RPC_0122"
FT   CDS_pept        138244..138579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85700"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D36"
FT                   /protein_id="ABD85700.1"
FT                   /translation="MKSYVQPGRTITLAAPYAVASGDGLLVGAIFGVATASAILAEQVE
FT                   ACLVGVFDLKKTASQAWSVGDKIYWDNTNKEATKTVGTNTLIGAAVEAVGNGAGETIGR
FT                   ARLNGTA"
FT   gene            138576..138897
FT                   /pseudo
FT                   /locus_tag="RPC_0123"
FT   gene            complement(138927..139967)
FT                   /locus_tag="RPC_0124"
FT   CDS_pept        complement(138927..139967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85701"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D35"
FT                   /protein_id="ABD85701.1"
FT                   /translation="MNLSDARETCPSTIGAQTYTIMNMHELDPKIVKAADFYDQHYAGI
FT                   EPLFIRPGTKIVLGDKNNRVCRFCGKGENEVSFKLEAHAIPESLGNKSVVTNFECDNCN
FT                   QLFGRGIENDLGNWSKPSRTFARIRGKSGVPTLKKGGPDPGWRIEYGETGFEMKHYEDD
FT                   PIFYVDEESKQLRFELKRDSYTPVAVLKAFVKIGLTLIPAVELPNFVEALAWIREQDHT
FT                   KGLVKEFPIFRTFQPGPMPNDLIVVMLMRRRPTVSGVPYAFLVIAYGNEVFQVFLPSPK
FT                   QDAAIAGQKLTFPAFPTPGGPDPTRYGRAKFSLLDLTGREVIRGETVPIVLGFDQVTLN
FT                   AVSASK"
FT   gene            140051..140599
FT                   /locus_tag="RPC_0125"
FT   CDS_pept        140051..140599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85702"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D34"
FT                   /protein_id="ABD85702.1"
FT                   /translation="MRDAADGLKQDLREDVVAAGLGERLSRTWRGKTFPEVGESAEAAT
FT                   YVWSRAPKIVDAFDRGVVIRSTRGLFLAIPTAAAGKSGRSAVGSREKITPEGWQRRTGL
FT                   KLRFVYRRGRPSLLVADDARINTRGLAARNRRKTGQASVIVFILVPQVALKKRLDVESA
FT                   AKRQAARVPSLIARHWPQS"
FT   gene            140613..141047
FT                   /pseudo
FT                   /locus_tag="RPC_0126"
FT   gene            141114..142342
FT                   /pseudo
FT                   /locus_tag="RPC_0127"
FT   gene            142385..142714
FT                   /locus_tag="RPC_0128"
FT   CDS_pept        142385..142714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85703"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D33"
FT                   /protein_id="ABD85703.1"
FT                   /translation="MLKLEPVSAEPFWLDVLSGVRIQFRPVSVAAMLIARGAADEALKA
FT                   GGEQATIEAGAAFIIAAVLVLVVVVEKGLGIDVPGVDVGSDWLTQILAALGLGTLRAGI
FT                   TGASK"
FT   gene            143017..144192
FT                   /locus_tag="RPC_0129"
FT   CDS_pept        143017..144192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0129"
FT                   /product="Mannosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85704"
FT                   /db_xref="GOA:Q21D32"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D32"
FT                   /protein_id="ABD85704.1"
FT                   /translation="MRRRNDGPSATKPSGIRTTNCSRDLSREWQSNAMFVGTMPAKAAI
FT                   VCLTQNTPTRVSFLRGSLTRLFEAFNARAGYPVLILHEGDFAAHEQDDLRRTLGGDRGD
FT                   ALQFIELEPDDFLAPDWVSEGVVRAHQRVVPDAPGVQYRTMTRWWLRDLPKYLSEYDVY
FT                   MRLDDDAYLDEAIGDPIASVLESGVDYASNCVHIEHPMNALGLADLCRRLIGESARLSG
FT                   LFVTGEHGPENCALRSFVAGLPSHLKSLVSTDRLEAPIMYYNNFHVARRCVWESKPLRD
FT                   FYSGIDESGGQYLLRWGDAPIQTIGVVALGFAIGRLEFRYSKRHERADGAFVNCNHELA
FT                   SPFMDASVDVNAPKAGSLTEFDAFNRMLQRRGIADIGRRIGKHDAKGRTDG"
FT   gene            144185..145129
FT                   /locus_tag="RPC_0130"
FT   CDS_pept        144185..145129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0130"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85705"
FT                   /db_xref="GOA:Q21D31"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D31"
FT                   /protein_id="ABD85705.1"
FT                   /translation="MDDATDELATLIARGLGVLRPKRLHAGAEAVAYELDDARVLKVYH
FT                   AGGSAERFATIASFYARLNSDRAGFAVPRILTHGVEGGRAYSVEKRLLGEPLSTRAHFL
FT                   TDTDLIDAYLAAALRVGRIQVEPEWNSWTMFGEQRHGDWHQHVRGQIESQSRALARMLQ
FT                   PAYWERLANATADVRQHFDRPFLGKVCLIHGDFHPGNVLVGATGRVLSLVDFGAFTTFG
FT                   DAAFDVATACGYFSMYEPDQATTRRSLVARLLRMEGSPPGALVAMYLKLAAFLTCTAYP
FT                   DDRVAVQDTGHFQWAMSVLFDPMLDELVDRVPH"
FT   gene            145145..145867
FT                   /locus_tag="RPC_0131"
FT   CDS_pept        145145..145867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0131"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85706"
FT                   /db_xref="GOA:Q21D30"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D30"
FT                   /protein_id="ABD85706.1"
FT                   /translation="MGQGARFDRATDLRVDAAEVDANAEMDSRVALHWARSVRENPRLF
FT                   NGPLLSPVGVSVRNGCATLRVKRSDYAHYLYARSIAHTDGASTPGTIFVSLVVPIGPSR
FT                   FIAGRMAAHTATPGIVQLPGGGVSDLGDPRLTAVEEASEELGLELHVERLRMLGVIVRD
FT                   APLDVGVVYLAPRQNPAALRATFENLLESDRRAQRESEFQELLEFDVGTLDRQHPGERL
FT                   VDYLGAVAGGLSRDRWHD"
FT   gene            145860..146765
FT                   /locus_tag="RPC_0132"
FT   CDS_pept        145860..146765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0132"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85707"
FT                   /db_xref="GOA:Q21D29"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D29"
FT                   /protein_id="ABD85707.1"
FT                   /translation="MTELLCWIDGVVRPAESVSMSLASDASLRGISVFEGIKAYRAPHQ
FT                   DRYCVVSLHSHIQRLQVSCELMRLRVDSLADRVNEGISALLKAETRSEVYIRPTVYLRS
FT                   GYYGTVADADLVVLARSAADHRAPLRCSIATQRHVPASAYPWGAKVGAMYAFFRLARLE
FT                   AVERGADEAILLSTDGRVAETPGASIFVVRAERISTPRLEMGILPSITRLTAIEILQRR
FT                   MNIEVIEEDLAPRDLCAADEVFVTGTLDEVRGVLSIDGQSIGSGETPVTNALLTTYLAA
FT                   CRVGDPTPPVGSAFFPGHPS"
FT   gene            146762..147457
FT                   /locus_tag="RPC_0133"
FT   CDS_pept        146762..147457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0133"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85708"
FT                   /db_xref="GOA:Q21D28"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D28"
FT                   /protein_id="ABD85708.1"
FT                   /translation="MRIKASPASPSHRPDAVLFDIGMTIIFPDGRVLAREFNRLSQGWI
FT                   VNPRDAARALAASAEMHHFGFSDSVEAVGAAMATHLNVHRDLGVAAWRAAIDAGDLYSE
FT                   IDPFSKIVLQELRRKGIKTAAVSNASNDLKEELASYDLLCLFDVAIGSNDGYAEKPHRA
FT                   MFDAAVDAIGVDPASAWHVGDGLINDVLGSARAGIGHQILVDRYGVYTAPPCEVVESME
FT                   ALNCMIAQL"
FT   gene            147454..148614
FT                   /locus_tag="RPC_0134"
FT   CDS_pept        147454..148614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0134"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85709"
FT                   /db_xref="GOA:Q21D27"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D27"
FT                   /protein_id="ABD85709.1"
FT                   /translation="MKVLLIVPSFPPRTGGLETYVAHLAEALAVQGHSIVVLTNSDLEE
FT                   QPAVEERYGYTVWRTRALLAGHGHENYVPWERSYFALLNDIADFASDAQFDVVHCHTQV
FT                   SLLIAHLSGLSQRFPIVASFHETNPLRDKLGEQRTKFIVRRCPAARYAVGSEAFAAQAR
FT                   SFGIEDELIRVVRMGIRDRHHTDRDVARRELSMRYGVSTERILITLLGRFTPRKQHEQA
FT                   LLALERMHQRHNVQLLFAGSDNSTDPVFVRQLRRVAAAAAPSVIWLENIPDADRDLLVD
FT                   ATDLGLQPSSKEGLGLAAIEFMMAGVPILVSDIEGLREVVGEHTTCLVDANSVEHLARR
FT                   IDKLVVNVQERATLGRQLQQRASMELSIEQAAVRTLSVYAEALSCE"
FT   gene            148605..149711
FT                   /locus_tag="RPC_0135"
FT   CDS_pept        148605..149711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85710"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D26"
FT                   /protein_id="ABD85710.1"
FT                   /translation="MRVMPPSLGVYGPGPRDRSGVATYIAESLEHLQPFFRTHWVANGE
FT                   TWISPNQFDYALYHIGNNELHRSSLRAAMLRPGVSLLHEYLHLDLYFQVWEDISEARQR
FT                   EILSELARKSGLSARSASHFVEQANARGIDPYAIDIGIERYVVEASKVGLVHSSGVAQR
FT                   LRERYRRSQIEAVPFPVRPWGDYDRSIPEKFGIHKNMFVFGAFGFIGEYKCIPLILDAW
FT                   QNWRGKPANVVLLLAGERQFTINTEFEGVIETGWLDSQTFNALIQRTDCGVQLRKPSLG
FT                   ETSGPAAAFCAHNRPVVLSDTPEMRGIGIGKNARFLNVNAGNEELLALMQALYEGRGDK
FT                   RAGYIEEFAWSLWAKRVHSCVTGAAMGI"
FT   gene            149708..150514
FT                   /locus_tag="RPC_0136"
FT   CDS_pept        149708..150514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0136"
FT                   /product="inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85711"
FT                   /db_xref="GOA:Q21D25"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D25"
FT                   /protein_id="ABD85711.1"
FT                   /translation="MMGALELESRYRALLDAVACSGVLLKRRQQSIVSSNSFITKADNS
FT                   IVTTADLESQTLLVDALVQFAPSPFSIISEEEGEFARPTEGSLWFLDPLDGTAHYAKGR
FT                   LDYAILLSEWRDRRPVFSVVHYPATGELGWAHEAMIGFESSVVTGTPSVLTQLCYISDE
FT                   NLRSDVQRRTGGACVQDATESTRALFDLAAGKLSGAVIQVCGHGAWDLAASTHLVLASG
FT                   GFVCDESGAALDMNDPTVTCKFVVAARDRAMGLLLLGALNGKSYAG"
FT   gene            150504..151250
FT                   /locus_tag="RPC_0137"
FT   CDS_pept        150504..151250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0137"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85712"
FT                   /db_xref="GOA:Q21D24"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D24"
FT                   /protein_id="ABD85712.1"
FT                   /translation="MQGDEQNPGTMWPIDFFDSGFEETFRLLGKYDSTERDVANLIELV
FT                   DLPRGARVLDVPCGWGRHSGVLNWLGYDVVGVDASPSQIARARQKWPSVEFHLADMRAA
FT                   PGTAYGAVLNLWTSFGSLPSASDDADALAHWCSITEVGGALVMELTTREYAEASNRKGA
FT                   ETVTYKRVTHNGVTERAKFDWNAGLSVNTYVRGGWERTCVTRLYERPVLASMLRNAGYA
FT                   NIEIFGGFDGSPVQDDRRTVFVARRP"
FT   gene            complement(151247..152494)
FT                   /locus_tag="RPC_0138"
FT   CDS_pept        complement(151247..152494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85713"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D23"
FT                   /protein_id="ABD85713.1"
FT                   /translation="MRVTFPIVLRDGLSEQLTKRWSTEYLAPSDRDRTREDGIWRRTQT
FT                   PANATESGWRDTSDQRRRIVHYTHHYDVVAGERGGTLVLKSAYIYFSTSLPKLELNFCQ
FT                   NQVEASLSAGGWRRRDSFAAHQTWILGDLICSMERIDRHPEDIKARRVMPENYQTLDVR
FT                   IRSQPYVPVPERLPWEVLAKGMRVKDVRGRPDIVSDLSGLAEYLPFHVELGCGPSLESG
FT                   IPALHHLHDLYCVTDLQTGKFIFGGTEDNLIARILEQPFDELKSLTKLFQASFLAEPAP
FT                   AHHALVTLKEGGVLVAPVMTNNFDGLAHRVGLPELFLRRYDETIPPISISPEARSLLVI
FT                   GSHADRRRVQARARAAGLKVFYLDPEGYNVGDRFIEYPLESVTDQDLLCRKGASEGLVE
FT                   LCAILGVSQARRLSPA"
FT   gene            complement(153004..153333)
FT                   /locus_tag="RPC_0139"
FT   CDS_pept        complement(153004..153333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0139"
FT                   /product="transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85714"
FT                   /db_xref="GOA:Q21D22"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D22"
FT                   /protein_id="ABD85714.1"
FT                   /translation="MDTVDSAITKPVRRPEVFTGAGRRRAWSDEDKARLVAEIEISGDS
FT                   VSGVARRHGLSPQQLFGWEGHHRSTGAISKRNALILGTNSPSGIRMSHVRQGFEPSARS
FT                   QLETP"
FT   gene            complement(154166..155452)
FT                   /locus_tag="RPC_0140"
FT   CDS_pept        complement(154166..155452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85715"
FT                   /db_xref="GOA:Q21D21"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D21"
FT                   /protein_id="ABD85715.1"
FT                   /translation="MGDAAAKDWVLPASIPFATLKGCDLEECVYWLLDAMGAKDLEWRT
FT                   GGAGGGAADGGRDLEATFYAPGADGEMESQRWWIECKGRAGTVEPDEVKAAVNNTLATG
FT                   NLDYVVIATNTQFSNPTRDWIKQWQSSHPRPKVKLWDHHQLERFLSKHPDVVLRLFSEA
FT                   LSPDGQFHALQEKFWNRLEFVQPGVLEKLWATRSDLALTELGLFAVIANEFANGSIVKR
FT                   PWGGAIDREALLNVLHFGLVNTSFLVMRSVKAGVDQHQMIRTLAYVILVAATYSEPEPL
FT                   ARFILESLCRGRPDEYPEDVKNYLIRPIVGQLLSEMQNVCSADCARFGSHERMGLSSGT
FT                   DELKDYWVRLDAEGVPEDEDNRVLLLIRTSGPCDAGFGNERSCPLFDIQPDVGNLAEIL
FT                   QLVQQVAKVRSLQAAEKRKDEIAKQKKPI"
FT   gene            complement(155598..156068)
FT                   /locus_tag="RPC_0141"
FT   CDS_pept        complement(155598..156068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85716"
FT                   /db_xref="GOA:Q21D20"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D20"
FT                   /protein_id="ABD85716.1"
FT                   /translation="MMLGLELKDYIGVAGLVLSVAIWMRTIWREWRRIEVSVSPAFHVY
FT                   ADGEVSTQNASIDIVNRGNRPVYVKAPTLLAPDGKHLSFVGVVDFKKFPKKLEEGESAS
FT                   LCVSYSEISRTLRKQGHSGKVKLRPCCLDATGKRHVGKRWTLDISKEWDRGA"
FT   gene            157489..159177
FT                   /locus_tag="RPC_0142"
FT   CDS_pept        157489..159177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0142"
FT                   /product="phosphoesterase (MutT family)-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85717"
FT                   /db_xref="GOA:Q21D19"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D19"
FT                   /protein_id="ABD85717.1"
FT                   /translation="MMVTYEKQTVSEDNRPDQVDVDGQTYLRVAETVLAKALSPLKARE
FT                   IVERGIEQGLFGDHVMGRTPEKSMQARLSIDILTRAGFSRFFRTARGRFALRASANSES
FT                   ESAEEYVAEKRVLNLPKEEVLCAPEANFRDVLTFQGIDPDSASILKRILTSHEPTYIAR
FT                   TEAETRDDAKQFITYVLVQCGERLLFFRRSYLSRAAEFLRGSKCIGFGGHVSAADVDMW
FT                   SREDYGLAACARRELAEEISLQDRSANQVANNRATIRLFQDVPLERLGILNDDSSEVGR
FT                   RHVAVVYRAWISDWNVAKKLMKGDSSIKGISWIDLSKDTLDIADFEYWSQLCLRKFYPS
FT                   TLIAKARLQVLNSSRLTKDHLLVVAGRVGSGKSETSTYLGERLSHPVIRTGELVRTLMN
FT                   APSITEIGREEFQKRAFEFITGPNGPNRLAQAILRQVTNNGGRPCIVDGVRNLQTFEKL
FT                   ESLYHGGDIGLIYIQTPPDVAFDMYRAREAQGTLSFSYRDFLKVYDAPVESEITSLGRK
FT                   AHAIVYNSFGMEAFRRTLDDFVSLNLKTPIAPVHVIEPGRVKVRS"
FT   gene            complement(159143..159790)
FT                   /locus_tag="RPC_0143"
FT   CDS_pept        complement(159143..159790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0143"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85718"
FT                   /db_xref="GOA:Q21D18"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D18"
FT                   /protein_id="ABD85718.1"
FT                   /translation="MATGPIKIVYCSWSSFKKEEWAIAKDQIALPSAGKPLGHLFDCQF
FT                   RDVHTTEPLLCDLEAMVRFKIASAYRAVQVPCIVEHAGLILEGYEDKSYPGGLTQPMWD
FT                   SLGAEKLVASCSTLSTKAIARAVVGYCDGLNTYTFVGETKGTLSATPRGDRDFYWDTVF
FT                   CPDGFGGKTYAEIVGSDRKGLIEKLKVSQSIRALQKFMEHRLKNEPSLFPAL"
FT   gene            complement(159795..160622)
FT                   /locus_tag="RPC_0144"
FT   CDS_pept        complement(159795..160622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0144"
FT                   /product="NAD-dependent protein deacetylases, SIR2 family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85719"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D17"
FT                   /protein_id="ABD85719.1"
FT                   /translation="MTCPTELRRLYRERRVIPFVGAGASMSVSWDGGKKRGPSWAAMVD
FT                   EAAKLLGCDEPELLRHRGSDLQILEYFKIRNHTLAPLTNWLSQQFSTATDDEILASPIQ
FT                   AALVELEKCSIYYTTNYDNFIERALNKRGRPCQIVTAEHTMSHDRSMVEVVKFHGDFNN
FT                   PDDMVVTESHYMDRMRLESPMDFKLRGDLLGRAVLFIGYSFRDPNVNYIFHVINHILSH
FT                   LPNSATGRRAYIILPDPSEFERQLFQQRNIEVVAIGSEDISNNVANIICEMAA"
FT   gene            complement(160619..161251)
FT                   /locus_tag="RPC_0145"
FT   CDS_pept        complement(160619..161251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0145"
FT                   /product="thiopurine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85720"
FT                   /db_xref="GOA:Q21D16"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D16"
FT                   /protein_id="ABD85720.1"
FT                   /translation="MSDSDQAGVGGYDQGYANCPCFWGTEAGSLVREFLSVNPNVSNLR
FT                   VLDLGCGEGKNAVAFAGRGASVVAVDCSAQALANGKSAFPHDYIEWVQSDALEYLNDCS
FT                   LFDVVIMYGLPHCMKSDSAVQKLIELALEKTRQDGIHILVAFNDGPHDLSAHPEFRPTL
FT                   VSHEFYLQCYSTSEIKKQSSSLLHETHPHNNIPHFHSVTRLLASKKT"
FT   gene            complement(161301..162077)
FT                   /locus_tag="RPC_0146"
FT   CDS_pept        complement(161301..162077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85721"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D15"
FT                   /protein_id="ABD85721.1"
FT                   /translation="MATLGEGYIHLNPYLASRGRLIDIGESSQAAAVEIAQRVYGGDVW
FT                   LQVRIEEGSAKAWFTVAASLAAAIAAYPNLRTGTIALVSDAREFGGYVNTTFLEKSKAK
FT                   PEQTFRAERRTKTPGKIARVIKHLDELNETPAKPEKRRLELAMVRLELEAIERDLQQQE
FT                   IQVLHAGLVFENIPPLWPQPNKTGAFGPTIGLPPRQTGEQEDFLEGLTFDANARMAGTS
FT                   NNPVVYIKTVFVPPRGIRLTENQTQPALKMEPPLEH"
FT   gene            complement(162727..162987)
FT                   /locus_tag="RPC_0147"
FT   CDS_pept        complement(162727..162987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0147"
FT                   /product="Conjugal transfer TraD"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85722"
FT                   /db_xref="GOA:Q21D14"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D14"
FT                   /protein_id="ABD85722.1"
FT                   /translation="MRAWQVERRKRTRNLIELGGLVVKAGIVELTGDDRAIILGALLWM
FT                   ANKLKSDQAEQARVLWAAKGKEAFAVDRHRCATISDEMPQD"
FT   gene            complement(162989..163330)
FT                   /locus_tag="RPC_0148"
FT   CDS_pept        complement(162989..163330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85723"
FT                   /db_xref="GOA:Q21D13"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D13"
FT                   /protein_id="ABD85723.1"
FT                   /translation="MPENMMRKPRDFDGELKALHDKARELKTRKVQQLGELVIATGADV
FT                   LSADELAGELIVLTETKDTGKREAWAKRGSAFFQSRARRTAPATDHDTDGASAQPSRAQ
FT                   SSTSSKGAA"
FT   gene            163391..166495
FT                   /locus_tag="RPC_0149"
FT   CDS_pept        163391..166495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0149"
FT                   /product="MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85724"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D12"
FT                   /protein_id="ABD85724.1"
FT                   /translation="MRRRSPVRDFFEGGRAYTSFRRTLRRGNDLVAMAIYHLHVKVIGR
FT                   KSGSSAVASAAYRSGSRLRDERLDRSQDFSAKRGVVHSEVMLPDNAPAAWSDRERLWND
FT                   VEAFEVRKDAQLAREVEFAIPREMTQAQGIELARDFVQSEFVGFGMIADLNVHWDIGED
FT                   GMPKPHAHVMLTMRQINVNGDENGFGPKVRDWNRTEMVERWRERWAELANKRLAELDID
FT                   ARIDHRSFEAQGIGLEPQSQIGASAQRIEGEGVEAADRAEMHREIARGNGERIIADPSI
FT                   ALDAITHQQSTFTPRDMAKFAHRHSDGIDQFNAVMGAMRGAPDLVELGQDGRGEDRFTT
FT                   RDMIEAEQRLHRAAELMAERERHEVNDADRQAALVRAEARGLVLSGEQADALAHVTDGR
FT                   DLGIVVGHAGTGKSTMLGMAREAWEAAGYEVRGVALSGIAAENLEGGSGIASRTIASME
FT                   HGWGQGRDLLSARDVLVIDEAGMVGTRQLERVLSHAAEAGAKVVLVGDPQQLQSIEAGA
FT                   AFRSIHERHGGVEIGEVRRQREDWQRDATRDLATGKTGAAIDAYDKNGMAHPAASREQA
FT                   RDDLIDRWDRDRQASPDRSRIILTHTNDEVRALNEGARERMRAAGDLGEDVRVTVERGA
FT                   RCFATGDRIMFLQNERGLGVKNGTLGTVEQVSALSMSARIDDGRSVEFDLKDYNRIDHG
FT                   YAATIHKAQGMTVDRTHVLATPGMDAHGSYVALSRHRDSTDLHYGRDDFASQDRLVRAL
FT                   SRARAKDMASDYERAEPIQGYAERRGITFRERVAEIVQKLVPEKLRGMFDGLRFPGDVS
FT                   GHDGGRRPERETPERESATAAVRRTTDAPERTVAADTDVALRQARTKALIRHARAVNAI
FT                   FEMQQQGGKASSEQVKELQEARKEFEAVRPYGSHDAEAAYKTNPDLAEQAASGNPARAI
FT                   RALQLETELRTDPSRRADRFVERWQKLDQTSQHQYQAGDMSGYKSTRAAMGDMAKNLER
FT                   DPQLESILAGRKQQLGIAFETGRRLGQELAFTHGIDLGRGRGIGL"
FT   gene            166679..166894
FT                   /locus_tag="RPC_0150"
FT   CDS_pept        166679..166894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0150"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85725"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D11"
FT                   /protein_id="ABD85725.1"
FT                   /translation="MREPDRIIRLKTVLSRTGLSRSTIYRKITEGTFPAQIRISVNGAG
FT                   WHESEINRWIADPVSWRPKHEFDNAR"
FT   gene            complement(167202..168491)
FT                   /locus_tag="RPC_0151"
FT   CDS_pept        complement(167202..168491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0151"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85726"
FT                   /db_xref="GOA:Q21D10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D10"
FT                   /protein_id="ABD85726.1"
FT                   /translation="MARGFGKLTVKTVEHLSRRGMHADGGGLYLQIAEGGSKSWLFRYK
FT                   LHGRTHWHGLGSLRDVGLEEAREKATGARKVRRNGGDPIQAKRQAEAAARIEAAKAITF
FT                   GEAAKRFIKANRAGWKNAKHADQWVMTLLGVDQKGKPSKNDYCKTIRDLPIGAIDTTLV
FT                   LRIIEPIWASKTETATRIRSRIEQVIDAAKAKGEFNGENPARWKGHLDNLLPATSKVRK
FT                   VRNHPALPYRQLPDFMRKLRERDGAAAAALEFQILTAVRPGNAVAAKWDQIDRQTSVWT
FT                   IPAALMKSDAEHRVPLSKAALAVLDRMEATKDDSEYIFPNTKGKPLSDASMAAVIDRMN
FT                   ELERRWIDPKLDREIVPHGFRSSFRDWAAEHGYDDPVAEAALAHKVSDEVVAAYRRTTF
FT                   LDLRNRMMEDWADYCARPSSSGDTVVAFRA"
FT   gene            complement(168656..168745)
FT                   /locus_tag="RPC_R0003"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(168656..168745)
FT                   /locus_tag="RPC_R0003"
FT                   /product="tRNA-Ser"
FT   gene            complement(169135..170316)
FT                   /locus_tag="RPC_0152"
FT   CDS_pept        complement(169135..170316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85727"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D09"
FT                   /protein_id="ABD85727.1"
FT                   /translation="MADDTLTATGIGNHGATRLPSVEVDSYNIELKDDEGFLGDRASRG
FT                   AFQKILDGWRKPLRKNGDDPFGKKSTEDINKHELDAILTGDDVGAVAVVHSAIEEFAQE
FT                   LAYVTRRFMKTKAWAGTECIVVGGGFRQSRLGELAIARTDIILKSEGIAVDLVPIRYHP
FT                   DEAGLIGCLHLAPSWIFEAHDSILAVDIGGSNIRCGVVETRWKKAPDLSKAVVWKSELW
FT                   RHAEEEPTREGAVKRLVKMLKDLIGAAEAEGFRLAPFIGISCPGVINADGSIEKGAQNL
FT                   PGNWESSRFHLPTSLIEGIPVIGDHDTAVLMHNDGVAQGLSEVPFMQQFERWGVLTIGT
FT                   GLGNARFTNRKPKVKKDKDVEKAKEKDKEADKGKSKDNEKDKDKEKKDKKDKD"
FT   gene            170699..171097
FT                   /locus_tag="RPC_0153"
FT   CDS_pept        170699..171097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0153"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85728"
FT                   /db_xref="GOA:Q21D08"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D08"
FT                   /protein_id="ABD85728.1"
FT                   /translation="MFAVIKTGGRQYRVVPDDVLEIGKIAGDVGTIIQLGEVLMLGGDT
FT                   PVLGLPTVAGATVAAEVLQHKRGPKVISFKKRRRKNSKRKRGYRDEITVLRITEILADG
FT                   KAPSIGPRPPREKKPVVETSAEADDAAA"
FT   gene            171160..171432
FT                   /locus_tag="RPC_0154"
FT   CDS_pept        171160..171432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0154"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85729"
FT                   /db_xref="GOA:Q21D07"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D07"
FT                   /protein_id="ABD85729.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGIKAYGGERVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKVEGHVEFRAKANGRTFVSVLPIAVAAAE"
FT   gene            171562..172161
FT                   /locus_tag="RPC_0155"
FT   CDS_pept        171562..172161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0155"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85730"
FT                   /db_xref="GOA:Q21D06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D06"
FT                   /protein_id="ABD85730.1"
FT                   /translation="MLQDLPTSTLRETSSCVLETERLALRKPTLADVKSIANLAKDRRV
FT                   AENTRRLPHPYRLDDATRFIKALAETGNETVFLIELDFRPIGVVGIDWRDQDAPELGYW
FT                   LGVDYWGQGFATEAARAVIDFTFDEFEDVDQLISGARVANPASRNVLEKCGFQWSGVEL
FT                   HRFEALGGSTPVDCFRLSRGVWSSLKSWSNSKKRLV"
FT   gene            complement(172559..173482)
FT                   /locus_tag="RPC_0156"
FT   CDS_pept        complement(172559..173482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0156"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85731"
FT                   /db_xref="GOA:Q21D05"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D05"
FT                   /protein_id="ABD85731.1"
FT                   /translation="MGLFARISSGAAPDNARLAGIGLMLAAMALFSFGDALGKLVVASY
FT                   SIGQLLLLRACAGLIVLSPLIWRQRAEFFRLQRPWLQLARTIIATLEVATFFLATAYLP
FT                   LADVITFYLASSLFVTVGSALFLREKVDAPRWIAIVVGFVGVLIALQPSAQTMTWPALI
FT                   ALCASVFFAALLLITRSLRGTPDMVLASQQFLGTLALGAVLIPAAPSGWITPGLFDSAL
FT                   FAIAGAVSALGLLCVNRSLRLAPASVVVPYQYTMIVWGVVFGYLVFGDWPSMATLSGAA
FT                   IIIGAGFYILLRERLGAAPGAISPGA"
FT   sig_peptide     complement(173378..173482)
FT                   /locus_tag="RPC_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.678) with cleavage site probability 0.647 at
FT                   residue 35"
FT   gene            173656..174705
FT                   /locus_tag="RPC_0157"
FT   CDS_pept        173656..174705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0157"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85732"
FT                   /db_xref="GOA:Q21D04"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D04"
FT                   /protein_id="ABD85732.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKYIEFGGPSGGNGGRGGDV
FT                   IIEVADGLNTLIDYRYQQHFKAQKGTNGMGKDRHGANGKDIVLKVPVGTQILDEDRETL
FT                   IHDFTKLGERFVLAEGGNGGFGNAHFKSSTNRAPRNANPGQEGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTLLSVVSAAKPKIADYPFTTLHPQLGVVDVDGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHVERCQVLLHLVDATCEHAGKAYKTVRNELMAYAGELTDKVEIVALNKI
FT                   DAVEADELKKQKDRLKRAAKKTPLLISGVAGTGVKEALRALVEVIGEAPVSEKAKGAAQ
FT                   AEPWAPQNV"
FT   gene            174957..176087
FT                   /locus_tag="RPC_0158"
FT   CDS_pept        174957..176087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0158"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85733"
FT                   /db_xref="GOA:Q21D03"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D03"
FT                   /protein_id="ABD85733.1"
FT                   /translation="MHRPELKNFRRIVVKVGSSLLIDSEAGEVKAAWLAALAADIAELH
FT                   LHGRDVLIVSSGSIALGRSRLKLARGPLKLEESQAAAAVGQIALARIWSEVLGDHGIGA
FT                   GQILVTLQDTEERRRYLNARSTIGKLLEWRAVPVINENDTVATAEIRYGDNDRLAARVA
FT                   TMSSADLLILLSDIDGLYDAPPGANPDAKLIPVVEQVTAEIEAMAGGAESELSRGGMRT
FT                   KIEAAKIATTAGTHMLIASGKIDHPLRAIANGGACTWFLTPANPVTARKRWIAGSLEPK
FT                   GTLTIDAGAVTALRAGKSLLPAGVIRVDGHFARGDAVVVRGPDTDEIGRGLVAYDADDA
FT                   DRIKGHSSPDVMSILGITGRAEMIHRDDLVMGAVPG"
FT   gene            complement(176084..176380)
FT                   /locus_tag="RPC_0159"
FT   CDS_pept        complement(176084..176380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0159"
FT                   /product="plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85734"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D02"
FT                   /protein_id="ABD85734.1"
FT                   /translation="MARKFRLSEQAEADLNSIWRYIASADVRAANGQIDRLTEAMDLLA
FT                   EAPLAGRARPEFGAQLRSFFLRGYTIFYVVTPGGIEIARVLHERMDIDPADFS"
FT   gene            complement(176370..176666)
FT                   /locus_tag="RPC_0160"
FT   CDS_pept        complement(176370..176666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0160"
FT                   /product="putative transcriptional regulators,
FT                   CopG/Arc/MetJ DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85735"
FT                   /db_xref="GOA:Q21D01"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q21D01"
FT                   /protein_id="ABD85735.1"
FT                   /translation="MASYHIGKHFEDLIDELIKSGRYASANEVICDGLGLLEDRELLRA
FT                   AKIEALRVEIQKGIDSGPGREIDGKTLAEEIKARGRQELAAAEQELAAAKHGS"
FT   gene            176825..178126
FT                   /locus_tag="RPC_0161"
FT   CDS_pept        176825..178126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0161"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85736"
FT                   /db_xref="GOA:Q21D00"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21D00"
FT                   /protein_id="ABD85736.1"
FT                   /translation="MTASLKAIDGAADPGAELAAMMTALGAQARAAARVLAIAPTAQKN
FT                   EALAAMERAIRAHTPAILQANAEDVAEARAGGATDAFIDRLTLTEARVAVMADGIGVIH
FT                   DIADPVGQVTERWQRPNGMTIERVRVPLGVIAVIFESRPNVAADAGVLALKSGNAVILR
FT                   GGSDSFRSCRAIHDCLVEGLREAGLPEAAITRVPVRDRAAVGLLLGGLDGNVDVIVPRG
FT                   GKSLVARVEAEARVPVFAHLEGINHVYVDRAADLDMAKSIVLNAKMRRPGVCGAAETLL
FT                   IDRAAASNLAPLVTTLLEAGCEVRGDDAVQRVDPRVKPVAEEDWDTEYEAAIMSVKLVD
FT                   GVDAALAHIAQHGSHHTEAIVTADQSVASKFLNEVDAAIVLHNASTQFADGGEFGFGAE
FT                   IGIATGKFHARGPVGAEQLTSFKYRVHGTGQIRP"
FT   gene            178158..178787
FT                   /locus_tag="RPC_0162"
FT   CDS_pept        178158..178787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0162"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85737"
FT                   /db_xref="GOA:Q21CZ9"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ9"
FT                   /protein_id="ABD85737.1"
FT                   /translation="MTPRSVAPSSRIPPHSDGMRIGLLGGSFNPPHQAHRDISLLALKR
FT                   LELDRVWWLVTPGNPLKDVSALQDLTVRAAAAQAMANDPRIVVSCLESFIGTRYTVDTI
FT                   DYLRRRCAKVRFVWIMGADNLGQFHRWQGWRRIAAQVPIAVIDRPPQSLRALAAPAARA
FT                   LGTSRIAATAAARLADRKPPAWVFLTGMKSPLASTGLRNPDGSWKK"
FT   gene            178904..179329
FT                   /locus_tag="RPC_0163"
FT   CDS_pept        178904..179329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0163"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85738"
FT                   /db_xref="GOA:Q21CZ8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ8"
FT                   /protein_id="ABD85738.1"
FT                   /translation="MSKSLASNSVLPKTRKASTPVAVLTARPDADETLKLILSRLDDMK
FT                   AEETVTIDLRGKSAFSDYMVVTSGRSNRHVGAVAENVVKGLKEAGVSSPHVEGLTNCDW
FT                   VLIDSGDVIVHVFRPEVRAFYNLERLWTQIPAAAKTL"
FT   gene            179398..179880
FT                   /locus_tag="RPC_0164"
FT   CDS_pept        179398..179880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0164"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85739"
FT                   /db_xref="GOA:Q21CZ7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CZ7"
FT                   /protein_id="ABD85739.1"
FT                   /translation="MRVVVIAIGRLKQGPERELAERYRERFDDLGRKLGFRGPEIHEIG
FT                   ESRARDAPTRIAEEAAAIAALIPDKAVLVTLDERGDSLDSAGFARKLGGWRDQSTAQAI
FT                   FVIGGADGLSPELRRKAKLSVSFGAATWPHQMVRVMLLEQLYRAATILSGHPYHRA"
FT   gene            179900..181246
FT                   /locus_tag="RPC_0165"
FT   CDS_pept        179900..181246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0165"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85740"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ6"
FT                   /protein_id="ABD85740.1"
FT                   /translation="MQTPRPHPTLGHTAALARPGAAVLLAGVIAAAAMLSQVQAQSAPP
FT                   PVDLIKQREQELEAARAQQKSAAELREKLKADIAAIGEDRTKLNERLIDIAARVRGIET
FT                   SIGDAEARLRPLDVREQQIRSSLEERRAEIGEVLAALQRAGRRAPPALLVRPEDALQSL
FT                   RSAMLLGAVVPEMRVRADRLASDLGELINLRKTIAAERDQLAADRAKLTEDQLRLASLV
FT                   EERQKKQSAAEKDMEAERARAATLSRQVDSLQDLIAKMEQDLKSAAKAAATANLQGAPT
FT                   AANGKPNMAALRDPGRLSPAISFASAKGLFALPVNGSKIREFGRSDGVGGTEKGISVAT
FT                   RPGAQVTTPCDGWVVYSGPFRSYGQLLILNAGGGYHVLIAGMERISVNIGQFVLTGEPV
FT                   ATMGSSSRVASILAANASQPVLYIEFRKDGTPIDSGPWWAASEGEKVRG"
FT   sig_peptide     179900..180022
FT                   /locus_tag="RPC_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.952 at
FT                   residue 41"
FT   gene            181243..182601
FT                   /locus_tag="RPC_0166"
FT   CDS_pept        181243..182601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0166"
FT                   /product="C-terminal processing peptidase-3. Serine
FT                   peptidase. MEROPS family S41A"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85741"
FT                   /db_xref="GOA:Q21CZ5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ5"
FT                   /protein_id="ABD85741.1"
FT                   /translation="MMRKTSVILLSVATGAALTLFVTQPRSILMGSTARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLVESAISGMLTGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASKAGIMANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIRLKIVRKGQDNPIDVTLVRDNIRVRSVRARVEGDDIGYIRITTFNEQTTEGLKRE
FT                   LAALTTQIGNDKLKGWILDLRNNPGGLLEEAVTVSDAFLDRGEIVSTRGRNAEETQRRA
FT                   AHGGDLAKGKQVIVLINGGSASASEIVAGALQDHKRATLVGTRSFGKGSVQTIIPLGSG
FT                   NGALRLTTARYFTPSGKSIQAKGITPDIEVLQDVPDEIKSRTDTKGEASLRGHLKAEGD
FT                   EKTGSQSYVPPEAKDDKALKMAADLLHGVKVNATAPATGDKAAIDKPAGKVEN"
FT   sig_peptide     181243..181353
FT                   /locus_tag="RPC_0166"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.793 at
FT                   residue 37"
FT   gene            182787..184025
FT                   /locus_tag="RPC_0167"
FT   CDS_pept        182787..184025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0167"
FT                   /product="protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85742"
FT                   /db_xref="GOA:Q21CZ4"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ4"
FT                   /protein_id="ABD85742.1"
FT                   /translation="MTTDELSAPLGQKRPRKRKFRLPFSGTQAIATLLGLVLLAFAGFA
FT                   LFNDNPQGGEPMVRMAIRPQPAADKPAAPETDKAAKAESHDGAAGGSHDKAAHVEVPGQ
FT                   KTVTIIDGSSGARQQVVVPGGGGDTAASDVAPAITVGIDQKLLEKSRYGMIPMVADGVK
FT                   PFNAYATAGEADRAKAARMPSIAIVVGGLGVGAAKTNDAIMKLPAAVTLAFTPYGSDPA
FT                   KLVERARAQRHEVLLQIPMEPFDYPDNDPGPQTLLTTLPSEQNIDRLYWHLSRFQGYIG
FT                   ITNFMGGRFVTTEPALQPIVREAAKRGLGYLDDGQSPRGVAALLATTQTLPFGKADLSI
FT                   DVVPTALEIDRALYRLESLARDNGNAIGMASALPISIERIATWSRSLEGRGLLLVPLTT
FT                   AMLKSKSGQAGAP"
FT   sig_peptide     182787..182933
FT                   /locus_tag="RPC_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.861) with cleavage site probability 0.507 at
FT                   residue 49"
FT   gene            184271..184798
FT                   /locus_tag="RPC_0168"
FT   CDS_pept        184271..184798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0168"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85743"
FT                   /db_xref="GOA:Q21CZ3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CZ3"
FT                   /protein_id="ABD85743.1"
FT                   /translation="MTRYDDLPYRTCVGMMLLNAEGLVFIGRRLGGIEHVDETHVWQMP
FT                   QGGVDPGEDPWTAAKRELYEETSVRSVEKLGEIADWLIYDIPRTVAGRSWKGRYRGQRQ
FT                   KWYAVRFTGDDSEIDVVSPGGGHKAEFISWRWEPMQNLPDLIVPFKRPVYERVVKEFAA
FT                   LAKDAAKVSGGG"
FT   gene            complement(185000..186121)
FT                   /locus_tag="RPC_0169"
FT   CDS_pept        complement(185000..186121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85744"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ2"
FT                   /protein_id="ABD85744.1"
FT                   /translation="MVVSGNPERAVPQFDISGLRILEIGSGYFKKQYPDQTTLLWSATK
FT                   FSDDFPLIDGFSTPDRVLRELAAAAEGRYDVVIANTVRYSPWHPRYWARAPFNTPRHPW
FT                   ASLTRQFGVEMLRWAKVPVPLVAIDMDDSFGIGTDSVFLLDKAKVFFKRELPVDKWQVL
FT                   YGTIHPHLPTLRYRNSDKWRRRMDKLQPISLPQFKYDERWRDAAFPEKTHDIFFSGSVN
FT                   GNSTVRSAGVPELERLKALGYRIDQPTERLPYAAFLERMSHSWLAWSPEGMGWDCYRHY
FT                   EAAIVQSVPVINHPTILRHAPMLGGVHAVYYDVEPGGLERAVVAALADKDRLCSMAKAA
FT                   RDNAFSHHVLKAYCDHILRAALAPEGDAGAATV"
FT   gene            186446..186982
FT                   /locus_tag="RPC_0170"
FT   CDS_pept        186446..186982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0170"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85745"
FT                   /db_xref="GOA:Q21CZ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ1"
FT                   /protein_id="ABD85745.1"
FT                   /translation="MSTTIDVGSAVLSETALYRRNVGIALFDPQGRVLIGHRYRDDGPE
FT                   IVLPGLDWQMPQGGIDADEEPRVAVKRELWEETGVSHADFLGETDWLSYDFPPYHGPKH
FT                   RLGHFRGQRQKWFALRFTGSDAEIDPLATRNGQPPEFDAWRWERLDRVADLVVPFRREV
FT                   YLAVARSFARFTDRV"
FT   gene            complement(186986..187960)
FT                   /locus_tag="RPC_0171"
FT   CDS_pept        complement(186986..187960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0171"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85746"
FT                   /db_xref="GOA:Q21CZ0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CZ0"
FT                   /protein_id="ABD85746.1"
FT                   /translation="MVAAFPIVRPRRLRRSEALRQLVRETRVCAHDLIYPIFVEEQIDD
FT                   AVPIATMPGVLRIPERKLAAEIERIARDGVKAVLLFGISHHKDAIGSDSWNPDGLMARM
FT                   VRIAKAAAPELVVITDNCFCEYTLHGHCGSLRGDSVDNDATLLNLGRQAVVAIEAGADM
FT                   VAPSAMMDGQIQAMRTALDEAGHCEAPILAYSSKFASALYGPFRVAAGSELEGDRRSYQ
FT                   MDPMNGREALRESALDEAEGADLLMVKPALAYLDVLAALRARTELPLVAYQVGGEYAMI
FT                   KFAAMAGALDEAATVRETLGAIKRAGADLIISYFARDIARDGW"
FT   gene            complement(188274..189065)
FT                   /locus_tag="RPC_0172"
FT   CDS_pept        complement(188274..189065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0172"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85747"
FT                   /db_xref="GOA:Q21CY9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CY9"
FT                   /protein_id="ABD85747.1"
FT                   /translation="MQRPAVALAKSTNPIDYQTAARPIVAMPKEFAAGSLIASHHHARA
FT                   QLIYAVSGVMEIRTKAGLWLVPPQRALWMPAELDHAMRCRGAVSLRTLYLRADGCPADA
FT                   PAAPRVVQVSILLRELILRIAGMPLDGDASEHDGRILALLFDEIGWAPDQELFLPMPRD
FT                   ARLARLCEEIVADPGDTRSLAQWAGVAGASSRTISRLFRQQFGCSFQLWRQQAKLLAAL
FT                   PRLAANEAVITIAGDLGYETPAAFAAMFRRLTGTTPSRYFG"
FT   gene            complement(189174..189581)
FT                   /locus_tag="RPC_0173"
FT   CDS_pept        complement(189174..189581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0173"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85748"
FT                   /db_xref="GOA:Q21CY8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CY8"
FT                   /protein_id="ABD85748.1"
FT                   /translation="MATFQFDLVSPEKLAFSGQVDQVDIPGVEGDFGVLAGHAPVVAVI
FT                   RPGLLTITAGGNQQKIVVLGGLAEVSDKGLTVLADVATSVAELDTAQFAQTISSMESSL
FT                   AGKQGSELDRAIERLDHYKSIQHQLNATAMH"
FT   gene            complement(189676..191106)
FT                   /locus_tag="RPC_0174"
FT   CDS_pept        complement(189676..191106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0174"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85749"
FT                   /db_xref="GOA:Q21CY7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CY7"
FT                   /protein_id="ABD85749.1"
FT                   /translation="MATPANQTGRITQVIGAVVDVQFEGHLPAILNAVETKNGNNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVTDTGNPIMVPVGVGTLGRIMNVIGEPVDEQG
FT                   PVANEGLRPIHAEAPTYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVAKAHGGYSVFAGVGERTREGNDLYHEFIESGVNKKGGGEGSKCALVYGQMN
FT                   EPPGARARVALSGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
FT                   TLATDMGALQERITTTHKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEK
FT                   GIYPAVDPLDSTSRMLSPLIVGDEHYQTARMVQQVLQKYKSLQDIIAILGMDELSEEDK
FT                   IAVARARKIERFLSQPFFVAEIFTGSPGKFVELADTIKGFRAICEGKYDHLPEAAFYMV
FT                   GTIEEAVEKGKKLAAEAA"
FT   gene            complement(191169..192047)
FT                   /locus_tag="RPC_0175"
FT   CDS_pept        complement(191169..192047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0175"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85750"
FT                   /db_xref="GOA:Q21CY6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CY6"
FT                   /protein_id="ABD85750.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQLAAEAARPY
FT                   AERMDAVISNIASAAAGSPGAPVLLAGTGKDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RALSLMNQGKEVKLFCVGRKGYEQLRRTFDRQIVENIELRSVRQLGFVNAEDIAHKVVA
FT                   RFNNGEFDVCTLFYSRFKSVISQIPTAQQIIPLVVEAPAANAGPATSYEYEPEEDEILA
FT                   GLLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGDMIRKQTLIYNRTRQAMITKE
FT                   LIEIISGAEAI"
FT   gene            complement(192190..193722)
FT                   /locus_tag="RPC_0176"
FT   CDS_pept        complement(192190..193722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0176"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85751"
FT                   /db_xref="GOA:Q21CY5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CY5"
FT                   /protein_id="ABD85751.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVQAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRAIVDTPVGKGLL
FT                   GRVVDALGNPIDGKGPIQSTERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAIGQKRSTVAQFVKVLE
FT                   EQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDHGSGSLTALPIIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDPLP
FT                   VSKVRAFEDGLLSLLRGKNVEILNTIRDSRDLSNETAAQLKSVVEGYAKTFA"
FT   gene            complement(193722..194333)
FT                   /locus_tag="RPC_0177"
FT   CDS_pept        complement(193722..194333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0177"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85752"
FT                   /db_xref="GOA:Q21CY4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CY4"
FT                   /protein_id="ABD85752.1"
FT                   /translation="MWRRFFPCEFDSKKERPVAAENPSVSGVSGRYATALFELARDEKA
FT                   VDAVKADLDRFKAMLADSPELTRLVRSPVFSAETQSKALAAVLDKAGFAGTTAKFLKVL
FT                   TANRRLFTVTDVIRAYGALVAKFKGEATADVTVAEPLSEKNLDALKTALKSVTGKDVAL
FT                   NVNVDPAIIGGLVVKLGSRMVDSSLRTKLNSIKHAMKEAG"
FT   gene            194913..195392
FT                   /locus_tag="RPC_0178"
FT   CDS_pept        194913..195392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0178"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85753"
FT                   /db_xref="GOA:Q21CY3"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CY3"
FT                   /protein_id="ABD85753.1"
FT                   /translation="MVALKTPALRITTGPKTAMAMIVASVFLGGAITEASAKARHHRHH
FT                   SHHAGHSSWRAANASVAEGAGGRSFAGMASYYGNESGSRTASGQRMNASAMTAAHRSLP
FT                   FGTKLRVTHGERSVIVTINDRGPFIRGRVLDLSTGAARAIGLTSRGVGRVVAEVM"
FT   sig_peptide     194913..195026
FT                   /locus_tag="RPC_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.772) with cleavage site probability 0.339 at
FT                   residue 38"
FT   gene            complement(195702..197906)
FT                   /locus_tag="RPC_0179"
FT   CDS_pept        complement(195702..197906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0179"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85754"
FT                   /db_xref="GOA:Q21CY2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CY2"
FT                   /protein_id="ABD85754.1"
FT                   /translation="MDHSTRSSSSSATRVVDVLLPVALDQAYSYRVPRGVELAPGDVVC
FT                   VPLGAREVIGVVWADNPNPDPRLHNRLKDVDSKLDVPRFREELRRLVDWVANYTLSPRG
FT                   QVLRMTLRMGEHLGPERVRLGVRLVGPKPQRMTPARARLIEILSDGLLHGKSDAIKEAG
FT                   CSPGVVDGLVDEGTLKVEPMARALAPPAPDPDFAQPDFSPEQTTAADSLRALAAGGAFK
FT                   VALLDGVTGSGKTEVYFEAVAEIIRRGEQTLILMPEIALTGQFLDRFAQRFGVRPLEWH
FT                   SELTPRTRARNWAAIAAGEAQVVVGARSALFLPYAKLGLIIVDEEHDQAYKQDEGAHYH
FT                   ARDMAVVRASIAKIPIILASATPSVESEVNARKGRYQRVALPSRFGGQHMPQIEAIDLR
FT                   REGPMRGRYIAPRLAEQIGIAIERREQALLFLNRRGYAPLTLCRACGHRFACTICDAWL
FT                   VDHRFRQRLVCHHCGFSMPRPKLCPHCNAEESLVAVGPGVERLQEEAQKLFPDARTMVL
FT                   SSDLVTSIESMRSELTEIAEGRVDIIIGTQLVAKGHNFPRLNLVGVIDADLGLGNGDPR
FT                   AAERTYQLLNQVIGRAGRDQGYGIGYLQTHQPEHPVMKALVACDREAFYESEIDARERT
FT                   GYPPFGRLASLIVSAGDRPTAEGFARKLVAMSPLDERIKVLGPAEAPLAVIKGRYRFRI
FT                   LVKSARGVDLSSYLRQWLALGPKTTGNLNLEVDVDPQSFL"
FT   gene            198407..199381
FT                   /locus_tag="RPC_0180"
FT   CDS_pept        198407..199381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0180"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85755"
FT                   /db_xref="GOA:Q21CY1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CY1"
FT                   /protein_id="ABD85755.1"
FT                   /translation="MTKPLISAPAPLELPGAAADLVAEATRWLAYLRSERRLSPKTLEA
FT                   YTRDLRQCLTFLNEHWDAQVSIKRFAALEAGDIRAFMASRRADEIGGRSLMRALAGLRS
FT                   FGRFLEREGKGKVGALSAIRAPKVGKSLPKPIQIAGAKRLADATERAGENREPWIWARD
FT                   AAVMALLYGSGLRISEALGLKRRDVPLPGKGDTLIVTGKGNKTRMVPVLQNVLSLIQDY
FT                   VAVCPHPLPQQGPIFVGARGGPLSPRIIQLTMERLRGALGLPDSATPHALRHSFATHLL
FT                   SRGGELRAIQELLGHTSLSTTQIYTGIDSERLFEVYKTAHPRA"
FT   gene            199667..200257
FT                   /locus_tag="RPC_0181"
FT   CDS_pept        199667..200257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85756"
FT                   /db_xref="GOA:Q21CY0"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CY0"
FT                   /protein_id="ABD85756.1"
FT                   /translation="MGAHESMEHAEHAEHASGSNKKIALLISVIALFLALSETLGKGAQ
FT                   TESISKNVEASNLWAFFQAKSIRRTVVQAVSENAKLGLGPIADETAKAALQKQIDEWQK
FT                   TAQRYRSEPETGEGSEQLAERAKHAEHDRDLAMARYHHYEVASAAFQIGIVLASATIIT
FT                   GMIVLAWLSGALAVTGLAFTAIGLFAPHAVHLM"
FT   gene            complement(200337..200879)
FT                   /locus_tag="RPC_0182"
FT   CDS_pept        complement(200337..200879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85757"
FT                   /db_xref="GOA:Q21CX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX9"
FT                   /protein_id="ABD85757.1"
FT                   /translation="MMRRISQSLWFLLAVAFLIEAWCWDHLEPIVARIVALIPLREFKA
FT                   WLAQRIEGLSPAMTLPVFLVPVAPLYPLKLFALALIAQGHLLAGLAIFLFLQVVGLGVV
FT                   AFIFDVTKPKLLQMRWFAAAYHWLIALRAKAHALVAPSIAAIKAKIAAALRGDGHGWGA
FT                   RTLRMIGRLRRRVRAAR"
FT   gene            complement(200915..202318)
FT                   /locus_tag="RPC_0183"
FT   CDS_pept        complement(200915..202318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0183"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85758"
FT                   /db_xref="GOA:Q21CX8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX8"
FT                   /protein_id="ABD85758.1"
FT                   /translation="MASYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKRDTFGGTCLNI
FT                   GCMPSKALLYASEMFEEAGHSFAKMGVVVPKPSLDLPAMMTFKQQGIDGNVKGVEFLLK
FT                   KNKIDALRGSGRVLGTGKVEVTSADGKTQTVDAKSIVIASGSTYTPLKGVTVDEKRIVS
FT                   STGALSLDKVPGKLLVIGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDGEVVKQFQ
FT                   RILEKQGFNFKLGSKVTAVDSSGATLKATIEPAAGGKPETLEADVVLVAIGRIPYTKGL
FT                   GLAEAGITLDERGRIAIDAHFATSLKGVYAIGDVVAGPMLAHKAEDEGVAVAEIIAGKA
FT                   GHVNYDVIPGVVYTTPEVSSVGKTEEELKQAGVAYTAGKFPFTANGRSKVNQTTDGFVK
FT                   ILADAKTDRVLGVHIVGREAGELIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAAL
FT                   AVGKRAIHM"
FT   gene            complement(202333..202623)
FT                   /locus_tag="RPC_0184"
FT   CDS_pept        complement(202333..202623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85759"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX7"
FT                   /protein_id="ABD85759.1"
FT                   /translation="MTEIIAMQSAEPVIFGVLKIVWRDGFAGVVDLRPLLTKGDMFAFL
FT                   RADPARFDTLKLELHGHKIFWLDDQGDEIDFGSDSLRQRAERQAGLLHLAS"
FT   gene            complement(202616..202870)
FT                   /locus_tag="RPC_0185"
FT   CDS_pept        complement(202616..202870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85760"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX6"
FT                   /protein_id="ABD85760.1"
FT                   /translation="MPVVAIVDAVKIEFYPDEHPPPHFHARYAEFIAQIEIRTGRVLRG
FT                   SLPPAKLRRVLFWADKHYIGLMNAWTAVEELRKPEKIDD"
FT   gene            complement(202892..203638)
FT                   /locus_tag="RPC_0186"
FT   CDS_pept        complement(202892..203638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0186"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85761"
FT                   /db_xref="GOA:Q21CX5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX5"
FT                   /protein_id="ABD85761.1"
FT                   /translation="MQHRVVIVTGGSRGIGRATALAAAARGYRVCIGYASNRAAAEEVV
FT                   AKIADSGGQAIAVQCDVGFEADIVGLFEAADGFGKLGALVNNAGIVGPTARVDEMSAER
FT                   IQRMMAVNVTGSMLCAREAVKRMSTRHGGEGGVIVNLSSVAAKLGSPNTYVDYAASKGA
FT                   IDSFTIGLGHEVAGEGIRVAAIRPGLIDTEIHASGGEPDRAHRLANHVPMKRVGTAEEI
FT                   ANAVVWLISEEASYVTSAILDVSGGR"
FT   gene            complement(203699..204103)
FT                   /locus_tag="RPC_0187"
FT   CDS_pept        complement(203699..204103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85762"
FT                   /db_xref="GOA:Q21CX4"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX4"
FT                   /protein_id="ABD85762.1"
FT                   /translation="MPPMPTEIVVLGWSVVLLIVQLFLASVPVTLELGGAYQAGPRDQP
FT                   RAAKGVFAGRAARAFRNLLETYPAFVALALALSVTGRSGGWGALGAEIWLAMRILYVPA
FT                   YLIHFPFARSLLWFASLLALLAMLARLLLS"
FT   gene            complement(204127..204426)
FT                   /locus_tag="RPC_0188"
FT   CDS_pept        complement(204127..204426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0188"
FT                   /product="pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85763"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX3"
FT                   /protein_id="ABD85763.1"
FT                   /translation="MPRPAHQQQARTLDISGAFVRRTDLSGASLRGANLAGADASNASF
FT                   RNADFQGAVLDGTILKGADLSGAKNLTVQQLSRAIVDRQTILPAYIDHDLLRSN"
FT   gene            complement(204419..204715)
FT                   /locus_tag="RPC_0189"
FT   CDS_pept        complement(204419..204715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85764"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX2"
FT                   /protein_id="ABD85764.1"
FT                   /translation="MQARSASTQAELARRTHVTELFIRAVGQLRDPNLEVRLAAIYVLR
FT                   EVAKDFPDLSNPVFELLQAYLREADIDYGDAEPPIDIQEIMSVLRSRLEQSDA"
FT   gene            complement(204840..206144)
FT                   /locus_tag="RPC_0190"
FT   CDS_pept        complement(204840..206144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0190"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85765"
FT                   /db_xref="GOA:Q21CX1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX1"
FT                   /protein_id="ABD85765.1"
FT                   /translation="MTEIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLGEIVAKDGETVAVGALLGQITDGAAKAAPKDAAKASGVAPETTTGRPDL
FT                   KTDGTKPINAGPEEPRLRPEAKAEAKSLPADTPQAPSVRRLSAENGVDAATVPGSGKDG
FT                   RVTKGDMLAAIEKAASAPTPVDQPAAAVQVRSPSPADDAAREERVKMTRLRQTIARRLK
FT                   EVQNTAAMLTTFNEVDMSHIMALRAQYKEVFEKRHHSKLGFMGFFVRACVQALKDIPAA
FT                   NAEIDGTDLIYKNYYHIGVAVGTDKGLVVPVVRDCDHKSIAQIEKSIADFGKRARDGQL
FT                   KIDEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHKIQERPVAIAGKVEIRPMMYL
FT                   ALSYDHRVIDGKDAVTFLVRVKESLEDPTRLVLDL"
FT   gene            complement(206243..209218)
FT                   /locus_tag="RPC_0191"
FT   CDS_pept        complement(206243..209218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0191"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85766"
FT                   /db_xref="GOA:Q21CX0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CX0"
FT                   /protein_id="ABD85766.1"
FT                   /translation="MSRQDANAAFALSSFLDGANAGYIDELYARYQSDPSSVDAEWQEF
FT                   FKSLKDRPADIQSNAEGPSWARTDWPLPPRDDLTSALDGNWAEVEKAIGTKIQAKEQAK
FT                   AKAQPKGAEAVPADVHQATRDSVRALMLIRAYRMRGHFHAKLDPLGLEPARDHEELDIR
FT                   TYGFTEADLDRKIFLDHVLGLEYGSLREIVAICERTYCQTLGVEFLHISNGAQKAWIQE
FT                   RIEGPDKEISFTREGRRAILMKLVESEGFEKFCDLKFTGTKRFGLDGGESLIPALEQII
FT                   KRGGNLGVREIVLGMPHRGRLNVLTQVMGKPHRALFHEFKGGSANPDEVEGSGDVKYHL
FT                   GASSDREFDHNKVHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDLPEERVSVLPLLMHG
FT                   DAAFAGQGVVAECFGLSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDVAKMID
FT                   APIFHVNGDDPEAVVFAAKIAVEFRQKFHKPVVIDMFCYRRHGHNEGDEPAFTQPAMYR
FT                   KIAAHPSTLEIYSKRLVADGVITEGEIEKAKADWRARLDAELEAGTGYRPNKADWLDGK
FT                   WAGFKTADQEEDPRRGITGVDVAVLKDIGRKITKVPDGFRLHRTVQRYLENRARAIDTG
FT                   VGIDWATGEALAFCTLLQEGHRVRLSGQDSERGTFSQRHSVLFDQEDENRYTPFNHLGP
FT                   DQGHYEVINSLLSEEAVLGFEYGYSLTEPNALTVWEAQFGDFANGAQVLFDQFISSGER
FT                   KWLRMSGLVCMLPHGYEGQGPEHSSARLERFLQMCAEDNMQVVHATTPANFFHVLRRQL
FT                   KREIRKPLILMTPKSLLRHKRAVSSLDELGADTTFHRILYDSAEVLPDEKIKLTPDDKI
FT                   RRVVLCSGKVYYDLYEEREKRGVDDVYLMRVEQLYPVPLKALVQELTRFKGAEFVWCQE
FT                   EPRNMGAWHFIEPYIEWVLNQIGATHRRPRYAGRAASAATATGLMSKHLAQLKALLDEA
FT                   LH"
FT   gene            complement(209350..210234)
FT                   /locus_tag="RPC_0192"
FT   CDS_pept        complement(209350..210234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0192"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85767"
FT                   /db_xref="GOA:Q21CW9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW9"
FT                   /protein_id="ABD85767.1"
FT                   /translation="MSVLIDSNTKVICQGFTGKNGTFHSEAAMAYGTKMVGGTSPGKGG
FT                   STHLGLPVFDTVREAVDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLD
FT                   MVRVRRSLIGSKSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVF
FT                   QTTREGLGQTTAVGIGGDPVKGTEFIDVLEMFLADPKTTSIIMIGEIGGSAEEDAAQFL
FT                   IDEAKRGRSKPTVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGIAVSPSP
FT                   ARLGKTLAEKLKS"
FT   gene            complement(210235..211434)
FT                   /locus_tag="RPC_0193"
FT   CDS_pept        complement(210235..211434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0193"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85768"
FT                   /db_xref="GOA:Q21CW8"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CW8"
FT                   /protein_id="ABD85768.1"
FT                   /translation="MNIHEYQAKAVLQPFGVSLSKGVAILKATDAEAAAKQLGGPIWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIEEVKQYAAEMLGATLVTIQTGPAGKQVN
FT                   RLYIEDGSDIEKEFYLSLLVDRVTSRISFVVSTEGGMNIEDVAHDTPEKIISFSVDPAT
FT                   GIMGHHGRTVAKALGLTGDLAKQAERLVAQLYAAFISKDMEMLEINPLVVTKQGELKCL
FT                   DAKMSFDGNALYRHPDISALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMTPANFLDVGGGANKEKVTAAFKIITADPNVKGILINIFGGIMKCDIIAE
FT                   GVVAAVKDVGLKVPLVVRLEGTNVEAGKKIIQESGLNVLSADDLDDAAQKIVKAVKEAA
FT                   "
FT   gene            complement(211633..212601)
FT                   /locus_tag="RPC_0194"
FT   CDS_pept        complement(211633..212601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0194"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85769"
FT                   /db_xref="GOA:Q21CW7"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CW7"
FT                   /protein_id="ABD85769.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHLVGLKELGDVVMFDIAEGIPQGKSL
FT                   DIAQSSPVDGFDAKFTGANSYEAIEGARVVIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGLPHRKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLVKYSTVAGIPLPDLVKMGWTSQARLDEIVDRTRNGGAEI
FT                   VNLLKTGSAFYAPAASAIAMAESYLKDKKRVVPVAAYLNGEYGVKDMYVGVPVVIGDKG
FT                   VERIVEIELAGKDREAFDKSVAAVQGLVEACKKIAPELLGH"
FT   gene            complement(212741..213934)
FT                   /locus_tag="RPC_0195"
FT   CDS_pept        complement(212741..213934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0195"
FT                   /product="AFG1-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85770"
FT                   /db_xref="GOA:Q21CW6"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW6"
FT                   /protein_id="ABD85770.1"
FT                   /translation="MLSPDPVSFSEQYQALVSSGAIEPDPAQADAVTAFSALEANLAGY
FT                   KPPKKQTLFGRLFGADKDQPPPRGLYVHGEVGRGKTMLMDLFFDSCPVTLKRRAHFHEF
FT                   MAEVHERIYAFRQNIKRGELGDSADVVALTANSIFEEAWLLCFDEFHVTDIADAMILSR
FT                   LFSKLFELGTVVVATSNVAPDDLYKGGLNRALFLPFIGLLKTRMELLRLDARTDYRMEK
FT                   LTGVKTWLVPADAAATAALDKAWARLTHGAPGHPRDISIKGRVLRVPRADHHVARFGFA
FT                   DLCEQPLAASDYLRLAHDYHTIMIDQIPLMDLADRNAAKRFITLIDTLYDNAVKLMASA
FT                   AADPTALYRASEGVEAMEFQRTASRLIEMGSESYLALPHGRSSDSTASGSSTGLVET"
FT   gene            complement(214210..214746)
FT                   /locus_tag="RPC_0196"
FT   CDS_pept        complement(214210..214746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0196"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85771"
FT                   /db_xref="GOA:Q21CW5"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW5"
FT                   /protein_id="ABD85771.1"
FT                   /translation="MPRLFTGLEIPAEIGQTLSNLRGGLPGARWINPENYHVTLRFIGD
FT                   IDGVSANEIASMLVRINRKPFDVAVQGLQSFGGKKPRAVVASVVPSRPLIELQAELERL
FT                   MQRLGLNPEGRKFTPHVTLARLRDASNQDVADYLSVRGYFPTRVFTASRFVLFSSRAST
FT                   GGGPYVVEDSYALSA"
FT   gene            complement(214887..215501)
FT                   /locus_tag="RPC_0197"
FT   CDS_pept        complement(214887..215501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0197"
FT                   /product="lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85772"
FT                   /db_xref="GOA:Q21CW4"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW4"
FT                   /protein_id="ABD85772.1"
FT                   /translation="MVGQSSAQTATAALTKPIKLVVLGDSLSAGYGLPAAAAFPARLQK
FT                   ALQDKGVATEMVNAGVSGDTASGGLARLDWSIPKDTEAVIVELGANDALRGTDPKVTRD
FT                   ALDQIVKKLKARNIAVFLCGMYAPPNYGPQYAAQFNAIYPELAKTYQVPLYPFFLEGVA
FT                   TIAKLNQADGLHPTAEGIDTVVKNILPSVQAFLGTVAEQRS"
FT   gene            215596..216351
FT                   /locus_tag="RPC_0198"
FT   CDS_pept        215596..216351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0198"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85773"
FT                   /db_xref="GOA:Q21CW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW3"
FT                   /protein_id="ABD85773.1"
FT                   /translation="MDSFIKASSPQGQAPDTRAPDSIVISNVDLSLGSGAARVHILKDI
FT                   SLRVGSGEAIGLIGPSGSGKSTLLMVMAGLERPDSGEVVVDGTAFNALDEDALARFRGR
FT                   HVGIVFQSFHLIPTMTALENVAVPLELAGRADAMERAARELAAVGLSERLHHYPTQLSG
FT                   GEQQRVALARALAPDPTILVADEPTGNLDEATGRQIVDLLFANHAERGMTLVLVTHDTS
FT                   LAQRCDRVVRLRSGRIDVAAPDRVRVQTA"
FT   gene            216377..218932
FT                   /locus_tag="RPC_0199"
FT   CDS_pept        216377..218932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0199"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85774"
FT                   /db_xref="GOA:Q21CW2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW2"
FT                   /protein_id="ABD85774.1"
FT                   /translation="MPQRRPATLPLPLRYAVRELRSGLRGFYVFIACIALGVLAIAGVG
FT                   SVAGSLSEGLAREGRALLGGDVAFSLMQREASPDELAFLRAHGRVSVVATLRGMARTAD
FT                   DRLALVELKAVDDTYPMLGTLTLEPKIAVPDLLAERDGVFGAAADAALLARLDLKVGDR
FT                   VHVGNAPFEIRSVVGAEPDKLSGGVGFGPRFLVSEQALRATQLLQPGSLVRWTYRLLLP
FT                   DNQADDRVANALADQARAALPQAGWEIRSRGNASPQLERTITRFTQFLTLVGLAALLVG
FT                   GVGVANAVKSHIDRRQDVIAAFKALGATGRDVFAIYLTQVMVLAGIGSLIGLALGAALP
FT                   YAIVGLFGQLLPLPVVPTLHPGELALSLVYGLLTALAFGMWPLARVHDVPVAALFREAV
FT                   ISERHRPRPKHLVWMALVVAVLVAVVIGLSYDKRVAAAFVATSVVVFALLRGIASALMA
FT                   LARRLPRANSTMLRLAIGNIHRPGALTPSVVMSLGLGLAVLVTVTQIDGNLRRQFTAAL
FT                   PDKAPSFFFIDIPSTETDRFAAFLKDQAPGASVEDVPMLRGRIVSARGIKTEDLKPSTD
FT                   AEWVLQSDRGLTYAAEVPHGSKVVEGQWWQPGYSGPPLVSFEKKLADGLGLKIGDEVVV
FT                   NVLGRDISAKIANLRNVDWQSLGINFVVVYSPNAFAGAPHTHIATLTEPNGTAAGDGAI
FT                   IKAVADAFPMVTSVRVREALETVGTVVTNLALAVRGASSVTLISAILVLGGALAAGHRH
FT                   RVYDAVILKTLGATRARLLGAYALEYLMLGLATAVFAVLAGSVAAWLIVSKLMTLGFVW
FT                   QLGSAAAVVVAALLVTVGLGLAGTWLALNQKPASVLRNL"
FT   gene            219235..220050
FT                   /locus_tag="RPC_0200"
FT   CDS_pept        219235..220050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0200"
FT                   /product="protein of unknown function UPF0005"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85775"
FT                   /db_xref="GOA:Q21CW1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW1"
FT                   /protein_id="ABD85775.1"
FT                   /translation="MSDFDRNYASPFGRAAGRVDAAAVDAGLRAYMLRIYNYMTIGLAI
FT                   TGAAALGVYKFAVTSDMAEAVRSASGAAIRVAEGQFLTSFGYMMFASPLKWVFILAPLV
FT                   MVFAISFGINRLKPATAQMLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALS
FT                   LYGYTTKRDLTGMGSFLMMGLFGVILASLVNLFVASTMLQFIVSVVGVLVFAGLTAWDT
FT                   QRLKNDYIYGYASQGGDVADRAAITGALSLYLNFINLFTLLLQLLGQRD"
FT   gene            220367..220891
FT                   /locus_tag="RPC_0201"
FT   CDS_pept        220367..220891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0201"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85776"
FT                   /db_xref="GOA:Q21CW0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CW0"
FT                   /protein_id="ABD85776.1"
FT                   /translation="MSELEIRPTSLADLPAITAIYAEAVRCGTATFELTPPDLAEMTRR
FT                   FAALTGGGFPYLVARRAGELLGYAYAGPYRPRPAYRFTVENSIYLAPAAQRQGVGSRLL
FT                   GRLIAESEARGYRQMIAVIGGSDNLGSIALHGRTGFQMIGVHPSVGFKFGRWLDSVLMQ
FT                   RMLGEGDATTP"
FT   gene            complement(221107..221460)
FT                   /locus_tag="RPC_0202"
FT   CDS_pept        complement(221107..221460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85777"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV9"
FT                   /protein_id="ABD85777.1"
FT                   /translation="MSEEADPSGIRPGGAAVAPPSLVTFNRLELNRILNLYGRMVAAGE
FT                   WRDYAIDFLKDRAVFSVFRRASEVPIYRIEKDPRLARKQGAYSVISATGLILRRGHELD
FT                   RVLLAIDRKLAVV"
FT   gene            complement(222054..222809)
FT                   /locus_tag="RPC_0203"
FT   CDS_pept        complement(222054..222809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0203"
FT                   /product="protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85778"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV8"
FT                   /protein_id="ABD85778.1"
FT                   /translation="MMAWSGLLNGPGALAACALLATICPAVAQPRAVVELFTSQGCSSC
FT                   PAADKIIGDLASDPSVIALSMPIDYWDYLGWKDTLADSRFSARQKAYSARRGDRDVYTP
FT                   QMIVNGAMQVVGNDRARIDGAISDTEKTAGVMSVPVTVTLDGKQLKVAVAAGAADVAPS
FT                   QAEVWICSISKAVPIAITRGENRGREVTYHNVVRTWLKVGDWTGQADSWTVPIENVAGA
FT                   GVDAAVVYVQSGSREQPGPMLGAALTALD"
FT   sig_peptide     complement(222723..222809)
FT                   /locus_tag="RPC_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(222956..225676)
FT                   /locus_tag="RPC_0204"
FT   CDS_pept        complement(222956..225676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0204"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85779"
FT                   /db_xref="GOA:Q21CV7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV7"
FT                   /protein_id="ABD85779.1"
FT                   /translation="MTSLDSFKCRKTLKVGAKTYVYYSLPTAEKNGLKGISRLPYSMKV
FT                   LLENLLRNEDDRTVKKADIVAVAKWLKKRKLEHEVAFRPARVLMQDFTGVPAVVDLAAM
FT                   RNAMQALGGSPEKINPLVPVDLVIDHSVIVNFFGDNKAFGKNVVEEYKQNQERYEFLKW
FT                   GQKAFSNFSVVPPGTGICHQVNLEYLAQTVWTRKEKLTIGKKKGTFEVAYPDTLVGTDS
FT                   HTTMVNGLAVLGWGVGGIEAEAAMLGQPLSMLLPEVVGFKLKGALKEGVTATDLVLTVT
FT                   QMLRKQGVVGKFVEFFGPGLDHLSVADKATISNMAPEYGATCGFFPVDAETIDFLKTSG
FT                   RKADRVALVAKYAKAQGLFRTSVSPDPVFTEKLILDLGKVEPSMAGPKRPEGRIALPAV
FT                   AEGFAAALAGEYKKAADPAARFPVEGRNFDLGHGDVVIAAITSCTNTSNPSVLIGAGLL
FT                   ARKAAALGLKAKPWVKTSLAPGSQVVAEYLANSGLQLDLDKVGFNLVGFGCTTCIGNSG
FT                   PLPEEISKSINDNGIIGAAVLSGNRNFEGRVSPDVQANYLASPPLVVAYALAGTVTKNL
FT                   NVEPIGEGKDGKPVYLKDIWPTTKEINAFVKKYVTAAIFKKKYADVFKGDTNWRKIKTV
FT                   DSETYKWNMSSTYVQNPPYFEGMKMQPEPIVDVVDARILAVFGDKITTDHISPAGSIKL
FT                   TSPAGKYLSDHQVRPADFNQYGTRRGNHEIMMRGTFANIRIKNFMLKGADGNIPEGGLT
FT                   KHWPDGEQMSIFDAAMKYQAEQVPLVVFAGAEYGNGSSRDWAAKGTRLLGVRAVICQSF
FT                   ERIHRSNLVGMGVLPLTFAEGDSWASLGIKGDEKVSIRGLQGDLKPRQQLTAEITSSDG
FT                   KKRDVSLLCRIDTLDELEYYRNGGILHYVLRRLAA"
FT   gene            225878..226483
FT                   /locus_tag="RPC_0205"
FT   CDS_pept        225878..226483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0205"
FT                   /product="heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85780"
FT                   /db_xref="GOA:Q21CV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CV6"
FT                   /protein_id="ABD85780.1"
FT                   /translation="MMRLTGRGLRCVRGGRQVFAGLDVDAAAGEAVAVVGANGAGKTSL
FT                   LRLIAGLLALAGGAIALEGGDSELTLAEQAHYLGHRDALKPSLSVAENLIFWQQFLGGE
FT                   PADAQASLAAVGLGHIAHLPAAYLSAGQRRRLSLARLTAVRRPLWLLDEPTSALDAEGQ
FT                   AMFARLMTAHLESGGLLVAATHTPLGIAARELRIGGAA"
FT   gene            226797..227465
FT                   /locus_tag="RPC_0206"
FT   CDS_pept        226797..227465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0206"
FT                   /product="heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85781"
FT                   /db_xref="GOA:Q21CV5"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV5"
FT                   /protein_id="ABD85781.1"
FT                   /translation="MTALLAMIRRDIRIALRVGGGALIGVLFFLAVVVLMPFAIGPDLA
FT                   LLQRLGPAVLWLGALLASLLTLDRLFMADHEDGSLDLIAMSRTPLEFACAAKALAHWLA
FT                   AGLPLVVATPVLGLLLNLDGSASLAIAATLLVGTPALTFTGMIGAALAVTLHRGGLLMA
FT                   VLVLPLSIPVLIFGVAAAGAAITGPVSFGTPFQILCALSLASMVIGPFAAAASLRQGLD
FT                   "
FT   gene            227572..228324
FT                   /locus_tag="RPC_0207"
FT   CDS_pept        227572..228324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0207"
FT                   /product="heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85782"
FT                   /db_xref="GOA:Q21CV4"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV4"
FT                   /protein_id="ABD85782.1"
FT                   /translation="MTLIDLANPTRFLKLTERVLPWLTGLTALLLAIGLVQSALAPDDY
FT                   QQGATVKIMFVHVPNAWLAMFVWGIMSLSALGTLVWRHPLADVAAKAAAPIGAAFTFLA
FT                   LVTGSLWGRPMWGTYWEWDARLTSMLILFLMYLGLIALWRAVEDPSRAARAAAIFTLVG
FT                   AINLPIIKFSVDWWNTLHQPASVLRVGGPALDKSFLMPLLVMAIAFSLLFITLHLAAMR
FT                   NEILRRRVRALQMLQASEQQGQLRSGAL"
FT   sig_peptide     227572..227688
FT                   /locus_tag="RPC_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.808 at
FT                   residue 39"
FT   gene            228321..228503
FT                   /locus_tag="RPC_0208"
FT   CDS_pept        228321..228503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0208"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85783"
FT                   /db_xref="GOA:Q21CV3"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV3"
FT                   /protein_id="ABD85783.1"
FT                   /translation="MMSLGPYASFIVLSYAVSALVVAILIVWVALDYRRQQAKLRALDA
FT                   AGVSRRSKRNAAEAS"
FT   gene            228500..229093
FT                   /locus_tag="RPC_0209"
FT   CDS_pept        228500..229093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0209"
FT                   /product="periplasmic protein thiol"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85784"
FT                   /db_xref="GOA:Q21CV2"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV2"
FT                   /protein_id="ABD85784.1"
FT                   /translation="MSDQPIQPAPSGRRSWLMALPLLGFTVLAGLFWLRLGADTTKIPS
FT                   ALIGRPAPQVALPALPGLARDGAAVPGLDPAAFKGKVSVVNVWASWCVPCHDEAPLLMD
FT                   LAKDPRIQLVGINYKDAADNARRFLGRYGNPFSIVGVDPNGRGGIEWGVYGVPETFVVG
FT                   RDGTIAYKLVGPVTPDNIDKVLKAQIDKALAAGS"
FT   gene            229343..229714
FT                   /locus_tag="RPC_0210"
FT   CDS_pept        229343..229714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85785"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV1"
FT                   /protein_id="ABD85785.1"
FT                   /translation="MRTFKLASLTAAALTLGLLASAPSMAQAPATTDHKSDHMAPMTKP
FT                   SESKMAPAKAEATKTDLLDINSATVDQLDALPGVGKAYSAAIIKGRPYKGKDELVQKKI
FT                   VPEKTYDGIKDKIVAKQKS"
FT   sig_peptide     229343..229423
FT                   /locus_tag="RPC_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(229936..230556)
FT                   /locus_tag="RPC_0211"
FT   CDS_pept        complement(229936..230556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0211"
FT                   /product="intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85786"
FT                   /db_xref="GOA:Q21CV0"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CV0"
FT                   /protein_id="ABD85786.1"
FT                   /translation="MEKPELLATNRPHPLFKLATELGPLLIFFFVNSKFNLFVATGAFM
FT                   VAVLIAIAVSYVVTKHVPIMAIVTAVVVIVFGTLTLVLHDETFIKMKPTIIYCLFAAIL
FT                   GGGLLFGRSFIAIMFDQMFNLTPPGWRKLTLRWALWFFAMALVNEAIWRTQSTDFWVAF
FT                   KVFGMVPLTMLFALTQMPLIKRYHLEPVTLETSEADAGDVSKG"
FT   gene            complement(230564..231514)
FT                   /locus_tag="RPC_0212"
FT   CDS_pept        complement(230564..231514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0212"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85787"
FT                   /db_xref="GOA:Q21CU9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU9"
FT                   /protein_id="ABD85787.1"
FT                   /translation="MNDTTETKKPSWWRRLSSGLKRTSSSIGTALAEFVTKRKLDRAML
FT                   DEIEDVLLRADLGTEVSARIAAAVGVGRYDKMISAGDVKTIVAAEVEKVLAPVAQPLVI
FT                   DAAHKPFVILMVGVNGSGKTTTIGKLAAKFAAEGRKVMLAAGDTFRAAAIEQLKVWGER
FT                   TGAPVISGTQGSDSAGLAFTALTAAKDDRRDVLLIDTAGRLQNKAELMNELEKVVRVIK
FT                   KVDATAPHAVLLVLDATVGQNALSQVEAFSRTAGVTGLVMTKLDGTARGGILVALAEKY
FT                   KLPVHFVGVGESVEDLAPFTAADFAKAIAGTDSGS"
FT   gene            231543..232265
FT                   /locus_tag="RPC_0213"
FT   CDS_pept        231543..232265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0213"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85788"
FT                   /db_xref="GOA:Q21CU8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU8"
FT                   /protein_id="ABD85788.1"
FT                   /translation="MSESHPEPTAMPELTAEEILARVLYRDGLMLVIDKPAGLPVHRGP
FT                   KGGANLESSFEFLRYGLPRPPVLAHRLDRDTSGCLVLGRHRKATASLGLLFKHGRISKT
FT                   YWAVVEGGPIEDEGTIELPIGRLNAERGWWQKIDPEGQPATTKWRVLGRGDGLTWLALQ
FT                   PVTGRTHQLRVHSAAMGWPIVGDNIYGNGPRFGEPTLHLHASEIVIPISRNKPPIVVTA
FT                   PAPVHLHARLRGCGWNGE"
FT   gene            complement(232473..233735)
FT                   /locus_tag="RPC_0214"
FT   CDS_pept        complement(232473..233735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0214"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85789"
FT                   /db_xref="GOA:Q21CU7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU7"
FT                   /protein_id="ABD85789.1"
FT                   /translation="MSVEVVTFGCRLNAFESELIRRQAEAAGCTDTIVVNSCAVTNEAV
FT                   AQARQSIRRLKRERPSARIVVTGCAAQTQAAMFADMVEVDRVLGNDDKMRGTAWRAAQT
FT                   AFAAGPVPGAEKIAVADIMAVREMAPHLLDGYQSGLPRVFVQVQNGCDHRCTFCIIPFG
FT                   RGNSRSVPLAAAVEQVRALTERGHAEIVLTGVDLTSYGADLAGAPTLGLLTKQILREVP
FT                   ELQRLRISSIDSIEADADLLDVVANEPRLMPHLHLSLQSGDDLILKRMKRRHCRAQAIE
FT                   FCAQLRRLRPDIALGADLIAGFPTETDEMFARSLDLVEACDLSLLHVFPYSPRPGTAAA
FT                   KMPQVDGNAVKQRAKRLREAGDAALLRRLDAEIGAAREVLIESPSQGRTEHFLPVAIAG
FT                   DTPGAVRRLTITGHDGARLTV"
FT   gene            complement(233732..234598)
FT                   /locus_tag="RPC_0215"
FT   CDS_pept        complement(233732..234598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0215"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85790"
FT                   /db_xref="GOA:Q21CU6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CU6"
FT                   /protein_id="ABD85790.1"
FT                   /translation="MNELANRSFSKMNGIGNEIVVLDLRDHPVAVSAADARAIASEVPY
FT                   DQLMVLQPPRTPGTEAFVRIYNNDGSESSACGNGMRCVARQVFATSASDALTFETRAGL
FT                   LNCWRPAPNLYTVDMGPPKLGWKDIPLAEEFRDTRSIELQIGPIDAPVLHTPSVVSMGN
FT                   PHAIFWVDDVNAHDLARFGPLLENHPIFPERANITLAQIVDRDHIVIRTWERGVGLTKA
FT                   CGSAACATAVAAARLRRVNRVVHITLPGGELGIEWRASDDHVLMTGPAAFEFEGRFDPA
FT                   VFAAAAS"
FT   gene            234825..235583
FT                   /locus_tag="RPC_0216"
FT   CDS_pept        234825..235583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0216"
FT                   /product="transcription activator, effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85791"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU5"
FT                   /protein_id="ABD85791.1"
FT                   /translation="MDVARCFRLAVAAPLATAGILIGVTGALAQSPPAVPAPTASEPTK
FT                   SAAEEPAKPAAAPAKPADPANPAAATPPTPPPAAAEAPVTPAPGTPAPAAPVQTADPFG
FT                   EEITLAGKSVVVLKGSANWDSAFETLVESFKTLTALLDKQAIKPAGNVMIVYTSTDDTG
FT                   FTFQAEIPVEQEPKDLAKNMSLGKSPDGKALKFVHRGSYDNMDNTYEAITNHLDDKKLE
FT                   AKDTFVEEYITDPLKTAEDKLVINVYVPLK"
FT   sig_peptide     234825..234914
FT                   /locus_tag="RPC_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            235580..236293
FT                   /locus_tag="RPC_0217"
FT   CDS_pept        235580..236293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0217"
FT                   /product="protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85792"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU4"
FT                   /protein_id="ABD85792.1"
FT                   /translation="MNSLDCRKALIGLTALAALTVPALADSIPPPAVSVTGEASVSVPP
FT                   DLASVDGGVTTEAKTAREASDANNVAMGKVLLALKGAGLEDKDLQTSRLSLQPQYANQN
FT                   RPGPNVVVGYRATNRITIRLRDVSKVASVIDTLVSSGANEVGGIDFAVAAASKLLDEAR
FT                   DQAFADARRKAEIYARAAGVALGAPLSISEDSAPGPMPMRKMMLDRAASAPVAPGEETL
FT                   RVSVSVSFAIKPATP"
FT   sig_peptide     235580..235657
FT                   /locus_tag="RPC_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(236531..237586)
FT                   /locus_tag="RPC_0218"
FT   CDS_pept        complement(236531..237586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0218"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85793"
FT                   /db_xref="GOA:Q21CU3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU3"
FT                   /protein_id="ABD85793.1"
FT                   /translation="MPLTRRSLLTLLAGGAAAALSSFWISRMPNYQGPLSDHFDGTRFF
FT                   DPDGAPPRSLVDVLRWQFKRTQAKWPDWAPSPFADTPPRRVDGDKVRLSFVGHVSWLIQ
FT                   TAGLNILVDPLWSERASPVSFAGPKRHNAPGIGFEALPPIDVVLVSHGHYDHLDLPTLS
FT                   KLAAKHSPRVITPLGNDLTMTSHDKAIRAEAFDWHDRVELGDGVAVTLVPTRHWTARGL
FT                   FDRNKALWASFVLHTPAGNIYIVCDSGYGDGKHFRRVGAAHGPLRLALLPIGAYEPRWF
FT                   MQDQHMNPADAVKALADCGAAQAVAHHHGTFQLTDEAIDAPVEDLRAALDAAGTPREKF
FT                   AVLEPGQVMEI"
FT   sig_peptide     complement(237530..237586)
FT                   /locus_tag="RPC_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.472 at
FT                   residue 19"
FT   gene            238018..238173
FT                   /locus_tag="RPC_0219"
FT   CDS_pept        238018..238173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0219"
FT                   /product="antenna complex, alpha/beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85794"
FT                   /db_xref="GOA:Q21CU2"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002362"
FT                   /db_xref="InterPro:IPR023623"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU2"
FT                   /protein_id="ABD85794.1"
FT                   /translation="MAEDLNKVWPTGLTIAESEELHKHVIDGTRVFGAIAIVAHFLAYV
FT                   YSPWLK"
FT   gene            238190..238393
FT                   /locus_tag="RPC_0220"
FT   CDS_pept        238190..238393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0220"
FT                   /product="antenna complex, alpha/beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85795"
FT                   /db_xref="GOA:Q21CU1"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002361"
FT                   /db_xref="InterPro:IPR018332"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU1"
FT                   /protein_id="ABD85795.1"
FT                   /translation="MNQARVWTVVNPTVGLPLLLGSVTVIAILVHFAVLENTTWFSGYW
FT                   NGAAKTATAAPAVAPVVAPAKK"
FT   gene            238910..240454
FT                   /locus_tag="RPC_0221"
FT   CDS_pept        238910..240454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0221"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85796"
FT                   /db_xref="GOA:Q21CU0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CU0"
FT                   /protein_id="ABD85796.1"
FT                   /translation="MFDNLSEKLGGILNRLTRRGSLTEADVDAAMREVRRALLEADVSL
FT                   DVVKSFTDKVREQAIGATVVKSVTPGQMVVKIVHDELVATLGSDAQIIDLNAVPPVPIM
FT                   MVGLQGSGKTTTTAKLARRLTQRDKRRVLMASLDVYRPAAMEQLAILGRDLEIDTLPIV
FT                   DGQKPAQIARRAIEAAKLGGYDVVLLDTAGRTTLDDEMMAEAAEIKAVASPHEVLLVAD
FT                   SLTGQDAVNLARAFDTQVGLTGIVLTRVDGDGRGGAALSMRAVTGKPIKLMGTGEKTDA
FT                   LEDFHPSRIAGRILGMGDVVSLVEKAASHLDAEKAAAVAEKMRKGQFDLSDMREQLLQM
FT                   TKMGGIGGLMGLMPGIAKMKSQIAASRIDDKVLSRQIAIIDSMTRQERKNPDILKASRK
FT                   KRIAAGAGLKVEEVNKLLKMHRNMADMMKAVGRGKGGPMAGLAQAMGFGGGMPSPEQIK
FT                   AMQEQQAQGGGGLPELPKDLPPSLRGGLPKLPGLTGLSGKPTLPGLGGFPGFGKKK"
FT   gene            240565..240897
FT                   /locus_tag="RPC_0222"
FT   CDS_pept        240565..240897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0222"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85797"
FT                   /db_xref="GOA:Q21CT9"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CT9"
FT                   /protein_id="ABD85797.1"
FT                   /translation="MSVVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGHFNPLLP
FT                   KDSEARLKLDLDKVKAWVAKGAQPSDRVARFLDAAGVKKREARNNPEKAVPRKERKAAA
FT                   EAAAKK"
FT   gene            241139..241669
FT                   /locus_tag="RPC_0223"
FT   CDS_pept        241139..241669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0223"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85798"
FT                   /db_xref="GOA:Q21CT8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CT8"
FT                   /protein_id="ABD85798.1"
FT                   /translation="MPADKICVARIGAPHGVRGAVKLWPFTADPLAVLDYGPLSTKDGK
FT                   RSFEVETAREAKGHLVATLQGVVSREDAERLNGVELYIDRAQLPPPEEGEYYHADLIGL
FT                   AAVDAAGAPIGKVLAIHNFGAGDIIEIAPPSGPTLLLPFTNAVVPTVDIASGRVVIELP
FT                   AEIEGDDPAQADI"
FT   gene            241867..242622
FT                   /locus_tag="RPC_0224"
FT   CDS_pept        241867..242622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0224"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85799"
FT                   /db_xref="GOA:Q21CT7"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CT7"
FT                   /protein_id="ABD85799.1"
FT                   /translation="MSKAMSCEPTPWRATVLTLFPEMFPGPLGVSLAGRALATGLWALE
FT                   VRDIRDSATDKHRSVDDTPAGGGPGMVLRADVLAAAIDAADAGETRPRLVMSPRGRPLT
FT                   QAKVAELAAGPGPLIVCGRFEGIDQRVIDARDLEEVSIGDYVLSGGEIAALALLDACVR
FT                   LLPGVMGKQGSALEESFSDGLLEYPQYTRPQLFEERPIPEILTSGDHAKVAAWRRAEAE
FT                   KLTRARRPDLFATRPQPNRQKPPKNTTDG"
FT   gene            242736..243131
FT                   /locus_tag="RPC_0225"
FT   CDS_pept        242736..243131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0225"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85800"
FT                   /db_xref="GOA:Q21CT6"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CT6"
FT                   /protein_id="ABD85800.1"
FT                   /translation="MNLIQELEKEQFDKLSAGKVIPEFGPGDTVIVNVKVVEGERSRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPLLSPMIDSIKVVRRGKVRRAKLYYL
FT                   RDLRGKSARIVEKKQDRPAKVVAGAAE"
FT   gene            243222..243524
FT                   /locus_tag="RPC_0226"
FT   CDS_pept        243222..243524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85801"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CT5"
FT                   /protein_id="ABD85801.1"
FT                   /translation="MWRASAAPRAGTVTDAAFRKGPGSAAQYFVLHRVRGTHADRPPHT
FT                   EPAAPSQAKRCRVVASCYMSGMFPIRPLAARIVLDDRSRLPWRFFGRLTTAALTA"
FT   gene            243589..245010
FT                   /locus_tag="RPC_0227"
FT   CDS_pept        243589..245010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0227"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85802"
FT                   /db_xref="GOA:Q21CT4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CT4"
FT                   /protein_id="ABD85802.1"
FT                   /translation="MTDSKSAAPTTLYDKIWNDHLVHEADDGTCLLYIDRHLVHEVTSP
FT                   QAFEGLRTAGRKVHAPEKTLAVVDHNVPTTDRSKPNPDPESADQIAALAENAREFGVTY
FT                   YNEFDKRQGVVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQ
FT                   TLIQKKAKNMRVTVDGALPDGVTAKDIILAIIGEIGTAGGTGYVLEYAGSAIRALSMEG
FT                   RMTVCNMSIEGGARAGLIAPDEKAYAYLKGRPMAPTGANWDAAMRYWETLRSDEGAHFD
FT                   HELRLDAAALPPIVTWGTSPEDVISILGSVPNPADIADEAKRLSKERALAYMGLTAGTK
FT                   ITDIKIDRAFIGSCTNGRIEDLRAAAKVAEGKTVNGNVNAIIVPGSGLVKEQAEAEGLD
FT                   KIFIAAGFEWREPGCSMCLAMNPDKLAPDERCASTSNRNFEGRQGFKGRTHLVSPAMAA
FT                   AAAIAGHFVDIRDWR"
FT   gene            complement(245287..245634)
FT                   /locus_tag="RPC_0228"
FT   CDS_pept        complement(245287..245634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85803"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CT3"
FT                   /protein_id="ABD85803.1"
FT                   /translation="MRERVMRDRTIAIGLALLTIGFSAPQMAAAQSGQGAPQASSGVAA
FT                   SDLSAQRRATRWPPTRLRVYPIYRSDSYGVIPRYNPGPNAVRDCTATYVEEYRPSGTVI
FT                   TPRMNCFWRPG"
FT   sig_peptide     complement(245548..245634)
FT                   /locus_tag="RPC_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.798 at
FT                   residue 29"
FT   gene            245733..246134
FT                   /locus_tag="RPC_0229"
FT   CDS_pept        245733..246134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0229"
FT                   /product="protein of unknown function DUF1025"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85804"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CT2"
FT                   /protein_id="ABD85804.1"
FT                   /translation="MWSSAKSPSLAEMEVMAHDMFSQLPKGFRDLCAGVIIRVEDFPTD
FT                   EVLEEMQAESEFDLLGLFQGVGLPHQSHDDIAPLPNMIWLYRRPILDYWAEHDESLGHV
FT                   VRHVLVHEIGHHFGLSDDDMEAIEAEVAD"
FT   gene            246209..246814
FT                   /locus_tag="RPC_0230"
FT   CDS_pept        246209..246814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0230"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85805"
FT                   /db_xref="GOA:Q21CT1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CT1"
FT                   /protein_id="ABD85805.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQFLKTIKRTGLGKGLFSE
FT                   QRYKDDGSENPDFILNKPAYRNAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGVLPIRVTQADLDKLFDDAERGANATITIDLGKQEIRGPDGGTVKFDID
FT                   PFRKHCLMNGLDDIGLTLEKKASIDSYEDKAKTERAWA"
FT   gene            complement(246905..247285)
FT                   /locus_tag="RPC_0231"
FT   CDS_pept        complement(246905..247285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0231"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85806"
FT                   /db_xref="GOA:Q21CT0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CT0"
FT                   /protein_id="ABD85806.1"
FT                   /translation="MATELKPIRTEADYQNALVEVEQLWGAKSGTPKGDRLDVLATLID
FT                   AYEARHDPMDPPDPIEAIQFRMEQQGLSRKDLEPLIGTRARVAEVMNRRRSLSIEMIRR
FT                   LHEHLGISAEVLIRPTRGDEAA"
FT   gene            complement(247275..247616)
FT                   /locus_tag="RPC_0232"
FT   CDS_pept        complement(247275..247616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0232"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85807"
FT                   /db_xref="GOA:Q21CS9"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS9"
FT                   /protein_id="ABD85807.1"
FT                   /translation="MVQSPPMRIIARRTLREFVASLAGTKDQRAVKAALDAWFDEVSKA
FT                   AWATTAEVKRRYATASIVSAERIVFNIKGNDYRLVVAVDFDKAIVWIKWIGTHTAYDRL
FT                   DVRKVQHGD"
FT   gene            complement(247696..248574)
FT                   /locus_tag="RPC_0233"
FT   CDS_pept        complement(247696..248574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0233"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85808"
FT                   /db_xref="GOA:Q21CS8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS8"
FT                   /protein_id="ABD85808.1"
FT                   /translation="MIRPRRSLLFMPGSNARALEKARLLHADGLILDLEDSVAPDAKAT
FT                   ARAQIAKAVGDKGFGKREVLIRINSLDSPWWIDDLNMAGKAKPDGILVPKVSSVAELSA
FT                   IADRLTDVGAEIAIKVWIMIETARGVLHAEELAAASQDSEMRLAGFVFGPNDISRETGI
FT                   RMLPGRSAMVPMMTHCVLAARSHGLAILDGPYSDIGNIEGFAHECAQARDLGFDGKTLI
FT                   HPGQIDACNAAFTPPAEDVAYARKVIAAFAEPENAARGAIQLDGRMVERLHVDMAKKTI
FT                   AIADAIAAMGS"
FT   sig_peptide     complement(248518..248574)
FT                   /locus_tag="RPC_0233"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.658) with cleavage site probability 0.649 at
FT                   residue 19"
FT   gene            248694..249344
FT                   /locus_tag="RPC_0234"
FT   CDS_pept        248694..249344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0234"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85809"
FT                   /db_xref="GOA:Q21CS7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS7"
FT                   /protein_id="ABD85809.1"
FT                   /translation="MASFPQHLLKGYRNFTTQRLPTEQSRYRELSERGQAPEVMVIGCC
FT                   DSRVSPEVIFDAGPGELFVLRNVANLVPVYAPDGAVHGVSAALEYAVQVLRVKHIVVLG
FT                   HAQCGGIRAFVDKTAPLSPGDFIGKWMAMFARAAETVEQRDQESMQEFITRLEQAAVKR
FT                   SLDNLMTFPCIKILAERGKLQLHGAYFGVAEGSLAVWDAQSGQFHAASELAIS"
FT   gene            249435..249650
FT                   /locus_tag="RPC_0235"
FT   CDS_pept        249435..249650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85810"
FT                   /db_xref="InterPro:IPR021425"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS6"
FT                   /protein_id="ABD85810.1"
FT                   /translation="MNNPKTDLNSNTEKDPDEWVSGDDPMTGAQASYLKTLCEQAKRPG
FT                   AFSETLTKAEASKLIDELRQAAGVAG"
FT   gene            complement(249665..250219)
FT                   /locus_tag="RPC_0236"
FT   CDS_pept        complement(249665..250219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0236"
FT                   /product="Uncharacterized protein UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85811"
FT                   /db_xref="GOA:Q21CS5"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS5"
FT                   /protein_id="ABD85811.1"
FT                   /translation="MTDLPAKRRTNPVERGLEALLFNSRWLMAPFYLGLVVSLVVLLYK
FT                   FGLLLWEFILHAPAAKESDIILGVLSLIDVSLTGNLILIVVFSGYENFVSRIDPRNHPD
FT                   WPAWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNIDAAFDAQKLGWLVGVHLVFVVTT
FT                   LLLALSDRWGSDHGGGDGAAH"
FT   gene            complement(250451..251485)
FT                   /locus_tag="RPC_0237"
FT   CDS_pept        complement(250451..251485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0237"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85812"
FT                   /db_xref="GOA:Q21CS4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS4"
FT                   /protein_id="ABD85812.1"
FT                   /translation="MGYKVAVVGATGNVGREMLNILDERKFPADEVVALASRRSMGVEV
FT                   SYGDKTLKVKALENYDFSDVDICLMSAGGAVSKEWSPKIGAQGVVVIDNSSTWRMDPDV
FT                   PLVVPEVNADAVAGFAKKNIIANPNCSTAQLVVALKPLHDKAVIKRVVVSTYQSVSGAG
FT                   KDAMDELFSQTKAVFTVEEVHSKKFPKRIAFNVIPEIDVFMEDGFTKEEWKMMMETKKI
FT                   LDPKIKLVATCVRVPVFVGHSESVNIEFENPISADEARNILRTAPGCLVIDKHEPGGYV
FT                   TPYEAAGEDATYISRIREDATVENGLVLWCVSDNLRKGAALNAIQIAECLINRKLITAK
FT                   KKAA"
FT   gene            251610..252422
FT                   /locus_tag="RPC_0238"
FT   CDS_pept        251610..252422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85813"
FT                   /db_xref="GOA:Q21CS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS3"
FT                   /protein_id="ABD85813.1"
FT                   /translation="MRTISAVRADREPPRIHPALRSCAGECRDVLVRVLAYFGALAFVA
FT                   AVGLYAVQPFAEAMRDAADPDQTAKPGFVSAPRSAPAFALSQFDSPGKIESYEVLRHPD
FT                   GGRKDILRWAAPGEAPIAELEIYRPGGEPSQALPPAAEIAARIDPDGVRAIEAAGLIDS
FT                   KFGAVRLFSLGGADAGLPRACLGFLKKLDRPSLRISGWACQGETLPARRAAISCMLDRL
FT                   VLLSAGNDPKLAELFAHAELRRSGCAAQAGPTADWVMGAQNPRLRGSL"
FT   gene            252589..252963
FT                   /locus_tag="RPC_0239"
FT   CDS_pept        252589..252963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85814"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS2"
FT                   /protein_id="ABD85814.1"
FT                   /translation="MTLKFSAARKLTVLLAAVAVIAIGFNSSDANAAKRKYYDRSSTAY
FT                   GPRGPNSSYQAGPRTRIYVTKRSWLDAGTEVLPGERKFTDYAYPPGRSFGMENLNRPLD
FT                   RQPLNPASDLGGYPERFPLY"
FT   sig_peptide     252589..252687
FT                   /locus_tag="RPC_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.617 at
FT                   residue 33"
FT   gene            complement(253250..254386)
FT                   /locus_tag="RPC_0240"
FT   CDS_pept        complement(253250..254386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0240"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85815"
FT                   /db_xref="GOA:Q21CS1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CS1"
FT                   /protein_id="ABD85815.1"
FT                   /translation="MTHLEELTMATHKLLLLPGDGIGTEVMAEVKRLIDWLNAQGIAHF
FT                   ETEDGLVGGAAYDADKVAITDATMAKAQASDAVIFGAVGGAKWDGVPYEARPEAGLLRL
FT                   RKDLGLFANLRPAVCYPALADSSSLKREVVEGLDIMIVRELTGGVYFGEPKTITDLGNG
FT                   QKRAIDTQVYDSYEIDRIARVAFDLARKRRNKVTSMEKRNVMKSGVLWNEVVTRVHAED
FT                   YKDVQLEHQLADSGGMNLVKWPKQFDVIVTDNLFGDILSDIAAMLTGSLGMLPSASLGA
FT                   VDANTGKRKSMYEPVHGSAPDIAGKGLANPVAMLASFGMALRYSLDMGELADKLDAAIA
FT                   AVLAKGLRTADIKSEGSTVISTSQMGEAILKEMQALHA"
FT   gene            254591..255772
FT                   /locus_tag="RPC_0241"
FT   CDS_pept        254591..255772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0241"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85816"
FT                   /db_xref="GOA:Q21CS0"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CS0"
FT                   /protein_id="ABD85816.1"
FT                   /translation="MTLIDRTTAQPRPAQLILMLALSPTISLGIGRFAYSLVLPDMRDA
FT                   LGWSYSAAGFMNTVNAAGYLGGALVAASLVKRFGLFRVVQAGTLACVASLVLCGLSGNF
FT                   ALLGLARLVAGLGAAVSFVAGGALAATLAQTEPSRSSFLLSLFYAGPGLGILLSGLLAP
FT                   LLLDRLGPGSWWAVWLVLALLAGALTLPLVLRPIEARAALSAAKPAPFTIRPVAIYLIS
FT                   YFLFGAGYIAYMTFMIAYVRDAGGGALAQSGFWCLIGAGAFASPWVWRRLIARGKSGVT
FT                   TAIILGVNALGAALPLLSPSPWMLAVSAAVFGVAFFAVVTTTTAFVRFNYPPEAWPSAI
FT                   AAMTIVFGIGQTIGPIATGAITDAMGSLSSALNVSAAALALGAVLAAFQRPVG"
FT   gene            complement(255893..256672)
FT                   /locus_tag="RPC_0242"
FT   CDS_pept        complement(255893..256672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0242"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85817"
FT                   /db_xref="GOA:Q21CR9"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR9"
FT                   /protein_id="ABD85817.1"
FT                   /translation="MRRFKSLLIPGVDKKLLVRDAAKLLPEPSRRRFIAGGASLGALTL
FT                   LTGCDVSDSFSAESMLTQISKFNDAVQAKIFNPNVLAPTYGEQDIKRPFPFNAFYSEDE
FT                   APKIDGQTWQLEVSGLVDNKKSWTLAELHQLPEVKQITRHICVEGWSAIGSWSGTPLRD
FT                   FLKLVGADSHAKWVHFRCAEDYASSLDMPTALHPQTQMTFKFDDKILPRAYGYPMKIRV
FT                   PTKLGFKNPKYVVAMEVTNDYKGGYWEDQGYNDFSGS"
FT   gene            complement(256685..257314)
FT                   /locus_tag="RPC_0243"
FT   CDS_pept        complement(256685..257314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85818"
FT                   /db_xref="GOA:Q21CR8"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR8"
FT                   /protein_id="ABD85818.1"
FT                   /translation="MSSITVSDDQATRRAGKAIQPAWVRLLHWINAAAVIMMIMSGWQI
FT                   YNASPLFDFTFSRSITLGGWLGGALQWHFAAMWLLMVNGLVYLALGVATGRFRDKLLPI
FT                   TPSGVLTDTKAALTGRLSHADLTTYNYVQRLLYLGIIAVGIVIVLSGLSIWKPVQLQWL
FT                   TALFGGYDVARYVHFAAMAAICGFLVIHVALSLLVPKALRAMIIGR"
FT   gene            complement(257538..258125)
FT                   /locus_tag="RPC_0244"
FT   CDS_pept        complement(257538..258125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0244"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85819"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR7"
FT                   /protein_id="ABD85819.1"
FT                   /translation="MSKRIALLSAAAFGALALSASVIAPASAEDKKMMKSEMSGEKTVM
FT                   VGGAAMFPSKNIVQNAVNSKDHTTLVAAVKAAGLVETLESKGPFTVFAPTNAAFAKLPA
FT                   GTVDNLIKPANKATLSKILTYHVVPGKLEAADLTDGKKLTTVEGETLTVKAAGGKVMLT
FT                   DAKGGTSTVTIANVNQSNGVIHVVDTVLMPAS"
FT   sig_peptide     complement(258039..258125)
FT                   /locus_tag="RPC_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            258610..260124
FT                   /locus_tag="RPC_0245"
FT   CDS_pept        258610..260124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0245"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85820"
FT                   /db_xref="GOA:Q21CR6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR6"
FT                   /protein_id="ABD85820.1"
FT                   /translation="MNANLFAQLFDGLEDPARLAIETEDGGRISYGDLMSRAGRVANVL
FT                   VARGVKIEDRVAAQTEKSVAALVLYLATVRIGAVYLPLNTAYTLNELDYFITDAEPSLV
FT                   VCDPAKRDGIAAIAAKVGAAVETLGADGEGSLTEASAAAAPAFETVKRAGGDLAAILYT
FT                   SGTTGRSKGAMLTHDNLASNSKTLVDYWHFTDKDVLIHALPIYHTHGLFVASNVTLFAR
FT                   ASMIFLPKLDPERIITLMARATVLMGVPTFYTRMLRSERLTREATGHMRLFISGSAPLL
FT                   ADTHREWAARTGHAVLERYGMTETNMNTSNPYEGVRLPGSVGPALPGVDARVVDAVSGV
FT                   ELPRGEIGMIEVKGPNVFKGYWRLPEKTNAEFRHDGYFITGDLGTIDDNGYVSILGRGK
FT                   DLVITGGFNVYPKEVESEIDALPGVLESAVIGVPHADLGEGVTAIVVREQGADCSEATV
FT                   LGALEGQIAKFKMPKRVMFVDELPRNTMGKVQKNLLRETYANLYAK"
FT   gene            260219..261025
FT                   /locus_tag="RPC_0246"
FT   CDS_pept        260219..261025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0246"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85821"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR5"
FT                   /protein_id="ABD85821.1"
FT                   /translation="MFKDLFSLQGRVALITGGSRGIGKMIAAGFLAQGAARVYITARKA
FT                   APCEATAQELTAQYQGECIALPIDISTLAGIALLAAEIAKREPRLDILVNNAGAAWGAD
FT                   FDEFPESGWDKVVDLNLKTPFFLTKALHAPLRAAASRERPGKVINIASIDGIFVNPLET
FT                   YPYAASKAGLIHLTRRMAVRLIKDHVVVTAIAPGPFSSDMNKAARDNADAVAARVPAGR
FT                   IGSDEDMAGAAIYLASRAGDYVVGATLAVDGGIVYANPGFQGEGWD"
FT   gene            261277..261909
FT                   /locus_tag="RPC_0247"
FT   CDS_pept        261277..261909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0247"
FT                   /product="40-residue YVTN beta-propeller repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85822"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR4"
FT                   /protein_id="ABD85822.1"
FT                   /translation="MIRAMAAALLLCALATRWASIARKPNASCSKDGLAMRNGSRNSKL
FT                   VSRARRSAKRCSADPGPFQALRSVTAPALQRTTPQERRAALRPGHDCIAEGGHRIEAGR
FT                   AMTRGVIVAAALLSLIAATPAAASIAYISNEESNTVSVIDTNIWSVTATIKVGQRPRGI
FT                   EFTRDGKFVLVAVGDDDTIELIDVAAQKVFKTIQVGELPWGITVAPK"
FT   sig_peptide     261277..261336
FT                   /locus_tag="RPC_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.716 at
FT                   residue 20"
FT   gene            261906..262715
FT                   /locus_tag="RPC_0248"
FT   CDS_pept        261906..262715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0248"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85823"
FT                   /db_xref="GOA:Q21CR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022467"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR3"
FT                   /protein_id="ABD85823.1"
FT                   /translation="MTVAELPRAGIDSAAAPRSSAAVAALSIEGVSYSYGARRALHDVS
FT                   FAVQPASFTALLGLNGAGKSTLVALITRLFGLQAGRISIFGDDITSAPGEALRQIGVVF
FT                   QPRTLDLDLSVMQNLQYHAALHGIGRGEARSRADALLTRIGLADRAGSKVRDLSGGQMR
FT                   RLEIARALLHRPRLLLLDEATVGLDVKARADLIGHVRRLVIDDGVSVLWTTHLFDEIEA
FT                   SDDLVILHHGQVLARGAIARIATETGTADLHAAFRQLTGADHLGGGL"
FT   gene            262712..263557
FT                   /locus_tag="RPC_0249"
FT   CDS_pept        262712..263557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0249"
FT                   /product="ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85824"
FT                   /db_xref="GOA:Q21CR2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR022403"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR2"
FT                   /protein_id="ABD85824.1"
FT                   /translation="MTAPTLERPSGFSPAQYLICLNGIVWREGLRFLHQRERFVSALVR
FT                   PLVWLFIFAAGFRQVLGISIIPPYETYILYEVYITPGLMAMIQLFNGMQSSLSMVYDRE
FT                   MGNMRTLLVSPLPRWYLLSCKLLAGTAVSILQVYAFLLIAWFWDIEPPHIGYLTVLPAL
FT                   ALSGLMLGALGMLISSGIKQLESFAGVMNFVIFPMFFASSALYPLWRVLQGSPALYYLC
FT                   QFNPFTHAIELIRFALYGQINWLSLAVVGGSTAAFLIGAMLAYNPSRGLGHRGAAGGDT
FT                   "
FT   gene            263554..263937
FT                   /locus_tag="RPC_0250"
FT   CDS_pept        263554..263937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85825"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR1"
FT                   /protein_id="ABD85825.1"
FT                   /translation="MRLFSRLAAAGMMLVGAIDAAHAVDPRYPDWPCVQAKVPEISLSA
FT                   VWAGPPLDEAGAKCKDDAQISALVARPSARRTPLEEAEKLVTEFLRQAGTDKSAAGTLI
FT                   FAGLFDTLNAERGSVALPDGSRN"
FT   sig_peptide     263554..263625
FT                   /locus_tag="RPC_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.901 at
FT                   residue 24"
FT   gene            264072..264500
FT                   /locus_tag="RPC_0251"
FT   CDS_pept        264072..264500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0251"
FT                   /product="protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85826"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CR0"
FT                   /protein_id="ABD85826.1"
FT                   /translation="MKILRHRIELETTAPIQIIDVTGQVRDWVASTGIQDGLVTVSSLH
FT                   TTARINVNEREAQLERDMITYLKRLVPRDGDYLHNLDPIDGRDNAHSHLLGLFMNSSET
FT                   IPVAAGAPVLGGWQSIFFVELDGPRETRGIELQLLGTD"
FT   gene            264504..265805
FT                   /locus_tag="RPC_0252"
FT   CDS_pept        264504..265805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0252"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85827"
FT                   /db_xref="GOA:Q21CQ9"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ9"
FT                   /protein_id="ABD85827.1"
FT                   /translation="MTPDDIAGFYAERGDLNLDDYIELDFTFECAGDPREAAAHLCSEQ
FT                   STAQWRRVGVDEDFRPRFAAKVLSLEAMPRPSGFSIAVECAATGPVHAVRVTIAHPHGN
FT                   FGPKLPNLLSAVCGEGVFFSPGIPLIRLEDIRFPDGYLAAFQGPQFGVQGLRDRLQAFE
FT                   RPIFFGVIKPNIGLPAAPFAELGYQSWKGGLDIAKDDEMLADVDWCPLSERAAALGEAR
FT                   LRAERETGVPKIYLANITDEVDRLVPLHDLAVANGANALLVNAMPVGLSAVRMLRKHAT
FT                   VPLIAHFPFIAAFSRLAAYGIHSRVFTRLQRLAGFDVVIMPGFGPRMMTPEHEVLDCVR
FT                   ACLEPMGPIKPCLPVPGGSDSAATLEGVYRKVGSTDFGFVPGRGVFGHPMGPAAGAASI
FT                   RQAWDAIASGIAVADHAKTHPELAAALQAFGAKK"
FT   gene            complement(265917..266228)
FT                   /locus_tag="RPC_0253"
FT   CDS_pept        complement(265917..266228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85828"
FT                   /db_xref="GOA:Q21CQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ8"
FT                   /protein_id="ABD85828.1"
FT                   /translation="MSDPTPKPQAEQPRVEPEIIPPGAGYDPARNRNFFHESFSERIYV
FT                   TKIGPLGMIGLVLTIGVVFAVILVLLLGAFLLWIPIVGLLVAFGLVAGILRPYLRRRG"
FT   gene            complement(266337..267836)
FT                   /locus_tag="RPC_0254"
FT   CDS_pept        complement(266337..267836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0254"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85829"
FT                   /db_xref="GOA:Q21CQ7"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ7"
FT                   /protein_id="ABD85829.1"
FT                   /translation="MPSHDSRVMSAALRSKIMSAEDAAALVKHGDNVGMSGFTGSGYPK
FT                   EIPLALARHIEAAHGRGEPFRIGVWTGASTAPELDGALAKVDGIELRLPYQSDPVTRER
FT                   INAGTMDYIDIHLSHVAQFVWFGFLGHLDVAVVEVAGILPDGSLVPTTSVGNNKTWLDR
FT                   ADRIILEVNSWHNPALQGMHDIYYGTQLPPYRQPIPIVTPGDRIGETTFRCDTSKVIAV
FT                   VETHAPDRNNTFSPPDQTSQAIAGHILDFLGHEVRRGRLPPELLPLQSGVGNVANAVMA
FT                   GLESGPFEQLTAYTEVLQDGMLDLIRSGKMTFASATALSFSAEKAEIFNRDTAQHKNRV
FT                   VLRPQEISNHPEVIRRLGVISMNGMIEADIYGNVNSTHIRGSRIMNGIGGSGDFARNAY
FT                   LSIFMTPSTAKNGTLSSIVPMVTHVDHTEHDVQVLVTEQGLADLRGLAPRQRAKVIIEN
FT                   TAHPSFKPVLQDYFDRARRGSAAQHTPHLLDEALRAIHPVS"
FT   gene            complement(268031..269401)
FT                   /locus_tag="RPC_0255"
FT   CDS_pept        complement(268031..269401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85830"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ6"
FT                   /protein_id="ABD85830.1"
FT                   /translation="MPDLNVLYQHRGTRAIQRMVEFAPSTGGLALWVKHQDLPVDAESP
FT                   AVLTDGNTVFYGVEFEVLPLSDQVGLVAHEVMHIALRHPQRFLDLRRQIGDVDLQLFNI
FT                   CADAIVNSTLGHLTWLRLPASSVFLDQLLSRVLAQKQDVEAALLEWDVEKLYRAIDDRQ
FT                   EQQQNGRQQKPGSRSQSGGEASEGGAKGDGAPKDDGAQERPSSRQDGPKSSKVRELGGQ
FT                   TQQDLAPSEEAQGAPEAEADAAREWSERILRGHAGDGAFSMLRTLIADLPKTRTPWEQM
FT                   LRTQLARALARKPDISWSRPSRSYIANQGRAGPNRRLPFEPGFSPTKNVPRLAVIVDVS
FT                   GSIADELMERFAREIESISRRLEAGSILIIGDDKVRSVTLFEPGKINLREIGFTGGGGT
FT                   DFTPLLEEAGKHRPDIAVVLTDLEGPANFRPRFPVIWAVPEAHTAAVQPFGRKLTLS"
FT   gene            complement(269394..270500)
FT                   /locus_tag="RPC_0256"
FT   CDS_pept        complement(269394..270500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85831"
FT                   /db_xref="GOA:Q21CQ5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ5"
FT                   /protein_id="ABD85831.1"
FT                   /translation="MLSNPMNIPPISIAGAKAALVEQYGDPVLRRRASMLWGTRGVGKS
FT                   SIVRQVAEHFGIPLVDLRLTTIEPVDIRGAIYADDTLAKTVWFPPEFLPAPDQHDGILF
FT                   LDELTAADQRLQISAYSLILDRRVGNYQLPDGWQVVAAGNASFHGAISHDMGTALADRM
FT                   FHFNVQTVIDAFLAHALERNFAPEVMAYLKIRPDKLDDTQAQLAGEHLIGASPRGWEDI
FT                   SNVLKSSLSDATKRIFVQGRIGAANAAEFFGVLREIQAGTDVIRLLAARPGPETAALLP
FT                   KSLDGLYGMTYGLLAACVDDRTLARALEIVEQLPDIRGVPLPIREIQTLAMELLMQRAL
FT                   SSGLEAAILESPSYHRYDEHRRRESQNA"
FT   gene            complement(270490..271638)
FT                   /locus_tag="RPC_0257"
FT   CDS_pept        complement(270490..271638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85832"
FT                   /db_xref="GOA:Q21CQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ4"
FT                   /protein_id="ABD85832.1"
FT                   /translation="MSLANLLTGGTRFDKPTHPLTHHEILGLMAPFTRRQRHLDLAASD
FT                   RSNRRLVFKPITHSGDDEAVLTEACETLLLENPRIGSFRLTRTVTLASGLKATLTTEGA
FT                   DPGDLLARIETVPPQRQFRCGDEGVIAQSYRLVPADSAWSRGEPDVRMELTRGEAEFEG
FT                   LTLILHAPTVKGYPADIDLVPKSPGCELPEDLLAVIGWAWGPLRKTQLGWNGKLKVRGS
FT                   EPHLSEKVEARLQRTVAHLSKTLAHPPCVFHDTLRRARWGVTLRRALPLLFFAALIAGA
FT                   AGLTFVEIPKDSMVNLLIMGAPPLLLFAAFGMRDTPPLEIPPLPRRSKAAAWLPSHPAP
FT                   ATAATNAPATLPAPPTAPTAPTAAMPSPKPKPTEPEVLLDAQ"
FT   gene            complement(271809..272798)
FT                   /locus_tag="RPC_0258"
FT   CDS_pept        complement(271809..272798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0258"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85833"
FT                   /db_xref="GOA:Q21CQ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ3"
FT                   /protein_id="ABD85833.1"
FT                   /translation="MSETTALREAGAAKTGHTGPNLANPLSGLRTDIVSVAGRIATYAA
FT                   GPEGDGDSATPLLLIHSINAAGSAFEVKPLYDFYAGRRRVYALDLPGFGQSERSDHDYT
FT                   ARTMTDAIHAAVEKLRDSHGGAPVDALALSLSCEFLARAAVETPDAFRSLGFISPTGFE
FT                   GKARDDATHSTLGKRWLLDGLKATSWKRGVFGLLTLRPVMRKFLESAWGSKKIDEPLLD
FT                   YDYITAHQPGAEHAAFYFVAGYMFSKDILRIYQALKVPVWMSHGTKGSFTDYRHKKRVT
FT                   NRLNWTIDIFETGAFPHFEVLGQVTDAYDAFLAKLGQVSRRVVVPSAI"
FT   gene            complement(273090..275438)
FT                   /locus_tag="RPC_0259"
FT   CDS_pept        complement(273090..275438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0259"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85834"
FT                   /db_xref="GOA:Q21CQ2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ2"
FT                   /protein_id="ABD85834.1"
FT                   /translation="MANISRQIAEELGVREQQVQAAVDLLDGGATVPFVARYRKEATGA
FT                   LDDAQLRTLEERLNYLRELEERRSAILNSVREQGKLDATLEAAIMAADSKGRLEDIYLP
FT                   FKPKRRTKAEIAREAGLAPLAEMLLTQPDNDPQAVAAPFVDADKQVADVAAALDGARAI
FT                   LVERFAEDADLIGSLRELMWSNGVMLSKQRDNKKDDGAKFSDYFDFSEPLHKLPSHRIL
FT                   AMFRGEKEEVLDLSIQPEVVPAGTAPAPVGSYELRIMNRFAVSDRGRPGDRWLIDTVRW
FT                   AWRTKIQVHLNIDLRMRLWTAAEQEAVRVFASNLRDLLLAAPAGARTTMGLDPGFRTGV
FT                   KVAVVDATGKVVATTAIFPHEPQRRWDEALAILGKLAREHRVELISIGNGTASRETDKL
FT                   ATELVKLLPELKMSKIVVSEAGASVYSASAFASEELPELDVTLRGAVSIARRLQDPLAE
FT                   LVKIDPKSIGVGQYQHDLGEAKLSRSLDAVVEDCVNAVGVDANTASAPLLARVSGIGAG
FT                   LAQSIVQHRDANGPFDSRSALKKVPRLGPKAFEQCAGFLRIQNGKDPLDASGVHPEAYP
FT                   VVRKILEATKSDIKALIGNAEALRQVQPKNFVDEHFGLPTVTDILRELEKPGRDPRPAF
FT                   KAAVFMEGVETLKDLKPGMVLEGAVTNVAAFGAFVDIGVHQDGLVHISAMSRSFIKDPR
FT                   EVVKPGDIVKVKVLEVDVARKRIALSLRLDDEVGAKADRVQAAPRGPSRSTVAAYAPKK
FT                   QQPSTGGGAFAEAFARANEKGKPDKPGRR"
FT   gene            275668..276921
FT                   /locus_tag="RPC_0260"
FT   CDS_pept        275668..276921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0260"
FT                   /product="molecular chaperone, Hsp70 class"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85835"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ1"
FT                   /protein_id="ABD85835.1"
FT                   /translation="MSACGLDFGTSNTTLGTMIDQVPVLCALEADHTTIPSAIFYGSDR
FT                   SVLIGRRAIDAYVEGTHGRLMRSLKSVLGTSLIDETTMVGRQRRSFRDVIGYYLGAVKR
FT                   RAEQATGRNLRNLVHGRPVHFVDNSPDADRRAEATLRDIARELGFDDVTFQFEPIAAAL
FT                   DYERQVTGEQIALIADIGGGTSDFSIVRLSPQRHLKTDRKADILANDGVRIGGTDFDRQ
FT                   LSLGVIMPLFGYRSPMLRAGLDVPSRYFHELSTWSDINKMYDPKVLTELRQIRREAKQP
FT                   ELLDRLMRVVDEQRGHTLAMEVEAAKIALAGATQAEIPLQWVEPDLNVAIGRPQLVQHT
FT                   RLLAERIASRIKLCLSHAQLDASAIDAVFLTGGSVRLAHVRKAMTKVLPDARIVEGDTF
FT                   GAVGKGLTIEAGRRYGPG"
FT   gene            complement(277245..278336)
FT                   /locus_tag="RPC_0261"
FT   CDS_pept        complement(277245..278336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85836"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CQ0"
FT                   /protein_id="ABD85836.1"
FT                   /translation="MRSEAKSYQFDQLPVIDYDKHPAYGRVLPMAQLGSRLKAVTYFAY
FT                   GLVLATARRLIDVENLPRPAAGEPKLGSVLRHLPVYLRLIMLQRLSRLAAGNAYQPKTE
FT                   RGDNLLAPLQRDGVAGVRLPPDKLFEIRNLLAPQLKILEQQLALKPALSADAEETRLWL
FT                   DPATNAEIYKAFNQTAADLGVLEAASAYLKRPVGVGQLAVQINDPVEGPSEFADVGVDS
FT                   SATKHFHIDTSGNLLKLVIYLGDVGPANGPLAYVPGSQRAAKGIWDGLVRRANDLAGLS
FT                   STTPSSRELFFALPEGWRRKASFGADLVVENDYARSILDDQWRVTSDDETAVLYDPNGI
FT                   HRDGIVSTGRRVAVVLKLTELPR"
FT   gene            complement(278633..279703)
FT                   /locus_tag="RPC_0262"
FT   CDS_pept        complement(278633..279703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0262"
FT                   /product="putative photosynthesis gene regulator, AppA/PpaA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85837"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP9"
FT                   /protein_id="ABD85837.1"
FT                   /translation="MDRAVAVPSLWRYQYTPRVVRPLQNLPHRSRRFDPEQRLLARLAF
FT                   PCPTAPQTENFATAFLRRNRMIVADHPPIALIPTHPTHVPLDQGQPDRAGIVNIENIVP
FT                   TIIPRLFVKPSAARLAASRETNPRAAELARLLLSPQPDDALALLDQSFALEKSPSQLFT
FT                   SLFEPAARCLGDLWSADHCSEFEVTIALCHLQSAMRRISFDRMAPPVANAAQRAVLVVP
FT                   QPGEPHLFCAALNAELLRQAGWAATCEFPDSDQALKQLVAQSWFDAIDLSLSPALRREH
FT                   WLPRLTETVRQARRASRNPAITIIVSGRVFAERPEIGEQVGADAACESAVQIEQLIQRL
FT                   LLARYASRRPANLAWI"
FT   gene            280213..280992
FT                   /locus_tag="RPC_0263"
FT   CDS_pept        280213..280992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0263"
FT                   /product="histidine kinase, HAMP region"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85838"
FT                   /db_xref="GOA:Q21CP8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP8"
FT                   /protein_id="ABD85838.1"
FT                   /translation="MNFDLSNRSLAQKISILVLGITLFVTLTISGVGQMALQKVSAEKA
FT                   KNSNSVASLGRLVDQGGAVLSPVTGADGRVVGMLVMSKDAGAAVMPASFDGSMVIQTAD
FT                   SVVTSDPQYGLGAANTLLLLAGIAVFAIVGFVGTRIARGLLEPLGQLEKDIDQLAKGNT
FT                   QVRLHALSRTDEIGRIARSIAKIQESLVELARIKTQRFVSDHPSLVNNLKEFWNDLKGA
FT                   VRNAKVMLSSDGQMVGQHVRQSWSNWIHNSLGIPKSA"
FT   gene            complement(281606..281680)
FT                   /locus_tag="RPC_R0004"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(281606..281680)
FT                   /locus_tag="RPC_R0004"
FT                   /product="tRNA-Gly"
FT   gene            282106..283023
FT                   /locus_tag="RPC_0264"
FT   CDS_pept        282106..283023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0264"
FT                   /product="thioredoxin-related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85839"
FT                   /db_xref="GOA:Q21CP7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP7"
FT                   /protein_id="ABD85839.1"
FT                   /translation="MTIIEQGNGAAPQATDLIKETSTQSFVKDVIEESKRQPVLIDFWA
FT                   PWCTPCRQLTPLLEKAVRAANGKVKLVKMNIDEHPSIPGQMGIQSIPAVIAFVGGQPAD
FT                   GFMGAVPESQINAFIDKLTAGAGGGAPGVGELIEEAEAALAAGDAATAAAVYAEVLAVE
FT                   ADNLPALAGLARCYVETGAMEQAKQTLALVPDSKREDSAVKAVQAAIDLAEQAKALGPI
FT                   TELEQKVAANPLDHQARFELAVALNAAGRRADATSQLLEIVKRDRKWDDDGARKQLVLL
FT                   FEAWGPTDEATVDGRKRLSTILFS"
FT   gene            283060..283731
FT                   /locus_tag="RPC_0265"
FT   CDS_pept        283060..283731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0265"
FT                   /product="peptidase S16, lon-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85840"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP6"
FT                   /protein_id="ABD85840.1"
FT                   /translation="MPINADYRGPGDLPERIPVFPLPGALLLPRGQMPLNIFEPRYLAM
FT                   VDDALRDHRLIGMIQPDLSHSSNEDKPELFRVGCVGRITQFAEAGDGRYILELTGVARF
FT                   KVVEELAAITPYRQCRVDYAPFVDDFTARKGEEAVDRETLLAVLRDFLKANRLKVDWDG
FT                   IESAPNEALVNALAMMSPYGPPEKQAMLEAPDLKTRAEILVAVTQMDLAKKRTSGDPPL
FT                   Q"
FT   gene            283845..284045
FT                   /locus_tag="RPC_0266"
FT   CDS_pept        283845..284045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0266"
FT                   /product="protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85841"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CP5"
FT                   /protein_id="ABD85841.1"
FT                   /translation="MTTSASDRPEAGVDRKLLDILVCPITKGPLEFDAARQELISRGAK
FT                   LAYPIRDGIPIMLPEEARKLG"
FT   gene            complement(284271..285491)
FT                   /locus_tag="RPC_0267"
FT   CDS_pept        complement(284271..285491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0267"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase / 2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85842"
FT                   /db_xref="GOA:Q21CP4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP4"
FT                   /protein_id="ABD85842.1"
FT                   /translation="MTAQRGIVIGGGAFAGLALALALRQGLGPDVPVIVADPALSLRPS
FT                   RDPRATAIVAACRRLFDTLGVWQAVAPHAQPILDMVVTDSALEDATRPVFLTFAGQIEP
FT                   GEPFAHMVENRHLIDALAERAEAAGVELRATAVTGYESRLEATSVTLGDGSVIDAALLV
FT                   AADGARSKLRERAGISTYGWDYDQAGIVVTVEHERDHNGCAEEHFLPAGPFAILPLVGK
FT                   RSSLVWTESRAEAARIVALSDAEFHRELEQRFGLRLGEVKALDKPKSFPLGYFVAQSFI
FT                   GERLALIGDAAHVIHPIAGQGLNMGLKDVAALAEVIVDAARLGIDFGQADVLDRYQVWR
FT                   RFDTMAMGVATNSLNLLFSNKSTLLRSVRDIGLGVVDRLPPLKELFIRQAAGLGGEVPR
FT                   LLKGEAL"
FT   sig_peptide     complement(285429..285491)
FT                   /locus_tag="RPC_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.843) with cleavage site probability 0.748 at
FT                   residue 21"
FT   gene            285636..286511
FT                   /locus_tag="RPC_0268"
FT   CDS_pept        285636..286511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0268"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85843"
FT                   /db_xref="GOA:Q21CP3"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP3"
FT                   /protein_id="ABD85843.1"
FT                   /translation="MPMSKSLIDLISILDLEPLEVNLFRGTSPKTSWQRVFGGQVIGQA
FT                   MVAGCRTVEGRLPHSLHCYFILPGDPQVPIIYEVERLRDGKSYATRRITAIQHGQAIFS
FT                   MMMSFHVEEEGRFDHQDVMPQVPPPDKLSAEEISKQPFFKEMPDFIRRYYESDRPIELR
FT                   PVELSRYFGEKIADGRIHIWIRTAAKLPDDPALHMCALAYASDFSLLDAAMARYGRTLF
FT                   DKRMMPASLDHAMWFHRPFRADEWLLYAQDSPSAQGGRGLARGLIYRQDGALVASVIQE
FT                   GSLRERRDQP"
FT   gene            286696..287034
FT                   /locus_tag="RPC_0269"
FT   CDS_pept        286696..287034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0269"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85844"
FT                   /db_xref="GOA:Q21CP2"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP2"
FT                   /protein_id="ABD85844.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVDANLAEAAVGVITKSARTGQIGDGKIFVTPIDHALRIRT
FT                   GETDSDAL"
FT   gene            287101..288402
FT                   /locus_tag="RPC_0270"
FT   CDS_pept        287101..288402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0270"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85845"
FT                   /db_xref="GOA:Q21CP1"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP1"
FT                   /protein_id="ABD85845.1"
FT                   /translation="MASIRRAARLALAACFAASSFSTAALAEDSTINGADTAWMIVATA
FT                   LVLMMTIPGLALFYSGMVRKKNVLATMAQSLAAVALISILWVAFGYSLAFTGDGALIGS
FT                   FDRLFLSGMTMEGVNPLAKTIPEALFMLYQMTFAIITVALVAGSVADRMRFSAYLVFSI
FT                   GWFVVVYVPLTHWVWGGGFLGSAGVLDFAGGLVVHLSAGIGGLVAALVIGRRQGYGADN
FT                   LSPFDLSLAVMGTGLLWVGWFGFNGGSALGANAHAVMAITATHLSACAGALAWGAIEWI
FT                   TRRKPSVLGMISGAVAGLGTITPASGFVAPWHGIVIGLIAGTVCFWACTSLKQRFGYDD
FT                   SLDVFGVHGVGGLVGTLLGGVFATAAIGGTAGLIEGHWMQPLIQLYGIAVTLLWSGAAT
FT                   FGLLMLVRLMVPLRVSREHEREGLDISQHGEALQ"
FT   sig_peptide     287101..287184
FT                   /locus_tag="RPC_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            288789..289127
FT                   /locus_tag="RPC_0271"
FT   CDS_pept        288789..289127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0271"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85846"
FT                   /db_xref="GOA:Q21CP0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CP0"
FT                   /protein_id="ABD85846.1"
FT                   /translation="MKIVMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTEI
FT                   YRGAEYAVSFLPKIKIEVAIASNQVDKTIEAITSAAKTGQIGDGKIFVIALDHAVRIRT
FT                   GEADAAAL"
FT   gene            289167..290609
FT                   /locus_tag="RPC_0272"
FT   CDS_pept        289167..290609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0272"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85847"
FT                   /db_xref="GOA:Q21CN9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN9"
FT                   /protein_id="ABD85847.1"
FT                   /translation="MTFKRPYSAGLAALAVGMFAATAAYAEPTVNKGDNAWLMTSTVLV
FT                   LLMTIPGLALFYGGMVRSKNMLSVLMQVFYTVCIAIILWALYGYSLAFTGGSDFIGGFS
FT                   KAFLAGVTTDSKAATFSVDANVSELVYVCFQMTFAAITPALIVGAFAERTRFAAVALFI
FT                   PLWLTLIYFPIAHMVWYWAGPDAIDAAAKALAAATDDASKATAQAALDAVNADAGWVFK
FT                   KGAIDFAGGTVVHINAGIAGLMGAILIGKRTGYGKELMSPHSLTMSMIGASLLWVGWFG
FT                   FNAGSNLEATGGAGLAMTNSFVATAAAALSWMFAEWMIKGHPSVLGAISGAVAGLVAVT
FT                   PAAGFSGPMGAIVLGLVVGVVCLFFCTVVKNALGYDDSLDVFGVHCIGGIVGALGTGIL
FT                   VNPALGGTGIMDYAAGKIADYDMVAQLTAQSWGVGTTLVWSGIGSAILYKVVDVIVGLR
FT                   ATVEVEREGLDVVEHTERAYNM"
FT   sig_peptide     289167..289247
FT                   /locus_tag="RPC_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 27"
FT   gene            291034..291330
FT                   /locus_tag="RPC_0273"
FT   CDS_pept        291034..291330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0273"
FT                   /product="DNA polymerase, beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85848"
FT                   /db_xref="GOA:Q21CN8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN8"
FT                   /protein_id="ABD85848.1"
FT                   /translation="MNRLEVLATLQRSEQALRARGVRRAALFGSVARGDNGPDSDIDIM
FT                   VEIDPEAHITVFDYAGLKEFIAGLFDTRVDVVNRDSLKPAIGATATADAVYAF"
FT   gene            291320..291664
FT                   /locus_tag="RPC_0274"
FT   CDS_pept        291320..291664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0274"
FT                   /product="protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85849"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN7"
FT                   /protein_id="ABD85849.1"
FT                   /translation="MRSDASLAALRDIRNHIDLATRFIEGYDLAGFKADLRTLYAVTRC
FT                   LEIISEASRRLSDDVKVRHSQIAWKQISGAGNIYRHDYEEVGAQLVWDTVARALPTLRA
FT                   VVEHEIDRQA"
FT   gene            291745..293061
FT                   /locus_tag="RPC_0275"
FT   CDS_pept        291745..293061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0275"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85850"
FT                   /db_xref="GOA:Q21CN6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN6"
FT                   /protein_id="ABD85850.1"
FT                   /translation="MVADPFSLDPDPAIDRLKVLAPRMAMTASSRAALGAGNPTGATGA
FT                   EAERSPFARLTELLAPYQPALPLINLSVGEPQHALPPFVGAVLAQHIGEFGRYPAAKGI
FT                   APFREAAAGWLGRRFKLPRPIDPESEILVLNGSREGLFLAALAAARYVAPRAGTPAILL
FT                   PNPFYPAYGAGARAAGCEPIYLETTAASGFLPDLDSLDEATLARSVAIYLASPANPQGS
FT                   VADPAYFAKLKALADRHGFMVLADECYSEIYTREAPGSMLEAAGPDFAQVAAFQSLSKR
FT                   SNLPGLRVGFVAGDKRFLNLFHELRNVAAPQVPVPLQHVGVAAYGDEAHVEENRRLYRQ
FT                   KFDLADQILGNRYGYSRPAGGFCLWLDVSRHGGDEAAAVKLYRDGGVRVVPGSYLARRQ
FT                   TDGSNPGAGYIRLALVQDAEATAEALHRLVRLLDEKQGR"
FT   gene            293058..295505
FT                   /locus_tag="RPC_0276"
FT   CDS_pept        293058..295505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0276"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85851"
FT                   /db_xref="GOA:Q21CN5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN5"
FT                   /protein_id="ABD85851.1"
FT                   /translation="MSMAMERVIPLVGHLPQAIRESLARRLRELAGVGLVVLSMIAAAA
FT                   LMTWSVQDPSLSHATSQPIRNILGYSGAIGADLAMQILGLGAIATILTVAVWGWRMITH
FT                   RAFDREALRIACWILCTVLAAGFASCWPPVGSWPLPTGIGGVVGDALVRAPAVVFGPPG
FT                   FIYRLVLGLILGTATLASFLMACGFGAREQEQTSIVVDDSFDEEDDKDGGSVSLGFMVH
FT                   AAMSTKARLGRLLTLAYRALVSSAPTGRAAAFERQEPRLGGGRSPSIAPQADADHDDAD
FT                   EPEEPDEEEAPVARAPRKKAAPRQPVRKSSDKFELPGVSMLTSPKASDRQPLSKTELET
FT                   NSRALEGVLGDFGVRGEIVKAHPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSALSA
FT                   RVAVVPGRNAIGIELPNPHREKVYLRELLCVKDGNESVAKLPLCLGKNIGGDSIIVDLA
FT                   RMPHLLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYDGIPHLLTP
FT                   VVTDPKKAVVALKWAVREMEERYKKMSKLGVRNLDGYNSRLMEAKSRGEELTRTVHTGF
FT                   DKETGKAIYEAEKLDLEPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMARAAGLHVI
FT                   LATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLYMAGGGR
FT                   ISRVHGPFVSDEEVEKVVKHLKTQGQPEYLEAVTAEEPTDEDGAVFDATGMGGEGTDLF
FT                   SQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMELEGIVGQANHAGKREILVEEEE
FT                   SGF"
FT   gene            295667..296509
FT                   /locus_tag="RPC_0277"
FT   CDS_pept        295667..296509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0277"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85852"
FT                   /db_xref="GOA:Q21CN4"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN4"
FT                   /protein_id="ABD85852.1"
FT                   /translation="MTINAPTTDRTPRILRRKPGAQRTLALALAVGLLAAPVAAQNVPL
FT                   PKPAPKPRDGGIQLSATTTPTRGPTAGGASSVPPEPVIPDPRRNVPSPLFVTFDAQQKA
FT                   QAAKVSSYLSSLSTLVGNFVQVGPDGSRTKGDFYIQKPGKVRFEYDEPSPIAIIADGNS
FT                   VAVRDRKLATQDIYPLSQTPLRYLLSDRIDLLRDTNVVSVTADDVFISVVIEEKQVLVG
FT                   TSRLMLMIGAKDNQLKQWTVTDPQGYDTTVAVYNLDATKKPDPGMFKIDFTNYSTPPG"
FT   sig_peptide     295667..295789
FT                   /locus_tag="RPC_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.947 at
FT                   residue 41"
FT   gene            296852..297664
FT                   /locus_tag="RPC_0278"
FT   CDS_pept        296852..297664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0278"
FT                   /product="exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85853"
FT                   /db_xref="GOA:Q21CN3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN3"
FT                   /protein_id="ABD85853.1"
FT                   /translation="MRFSLSTWNINSVRLRIDLVAKFLESERPDVLCLQETKCPDDAFP
FT                   LKRFKRLGYEHVALNGQKGYHGVAIISRLPFASTDVRIFCENLDSRHISVAFAAEHTSA
FT                   PLVLHNFYVPAGGDIPDPELNPKFKHKLAFLDEMKSCEPLHPQGDARHILVGDLNVAPH
FT                   EHDVWSHKQLLKVVSHTPIECEKLLAAQHQGGWLDVARERIALSDKIYTWWSYRAADWT
FT                   IANRGRRLDHIWVSPALGPCVQDYQVTRDARGWERPSDHVPVTVTMEL"
FT   gene            complement(297782..298231)
FT                   /locus_tag="RPC_0279"
FT   CDS_pept        complement(297782..298231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0279"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85854"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN2"
FT                   /protein_id="ABD85854.1"
FT                   /translation="MSIEDDVALLERVPTLRLLGDASLRMLAIGSDQHIYARGDTLFNA
FT                   GDIADAGYVVQRGSFKISADDAGSHEIVAQPGALIGELALMLAMPRPSTAVAQEYSAVI
FT                   RIGRGLFQRVLEADPAAALRLRDEFAARTTRIANEILKAGARLGS"
FT   gene            complement(298298..298984)
FT                   /locus_tag="RPC_0280"
FT   CDS_pept        complement(298298..298984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0280"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85855"
FT                   /db_xref="GOA:Q21CN1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN1"
FT                   /protein_id="ABD85855.1"
FT                   /translation="MPNARKILIVDDDNDLRDALVEQLSLHEEFEASAVDTGAKGVIAA
FT                   KAESPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTVLGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFTVGPYSFRPGSKMLTGANAKKVRLTEKETAI
FT                   LRFLYRSGLSPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            299149..299748
FT                   /locus_tag="RPC_0281"
FT   CDS_pept        299149..299748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85856"
FT                   /db_xref="GOA:Q21CN0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CN0"
FT                   /protein_id="ABD85856.1"
FT                   /translation="MRARLPVQPPVSSTIRPLRQRRGRPCAAVAVVLVRPAAGNPSRGW
FT                   LTAAGITVPVALGRGGLKANKREGDGGTPRGTFHPLRLWWRADRAPRPQTPLPVRAITA
FT                   QDAWCEDPADRHYNKPIRRPSGGPGDRLRRDDHLYDFIIEIDHNARPRVAGRGSAVFLH
FT                   LVRDNFGPTAGCVAMRKSALLRLLARLGPQTRIVIG"
FT   gene            complement(299926..300585)
FT                   /locus_tag="RPC_0282"
FT   CDS_pept        complement(299926..300585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0282"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85857"
FT                   /db_xref="GOA:Q21CM9"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CM9"
FT                   /protein_id="ABD85857.1"
FT                   /translation="MSEAAGLAEVERQIARACADAGRERAAVTLIAVSKTFEADGITPV
FT                   LEAGQRVFGENRVQEAKGKWPALTAAYPGVALHLIGPLQSNKAKEAVALFDAIHSVDRP
FT                   SLCQALAKEIAAQGRAVELFVQLNTGEEPQKAGVVPAEADAFIKACRDTYGLNVSGLMC
FT                   IPPVDQAPAPHFALTAKIAARNGLQKLSMGMSADFAVAIQFGATHVRVGSAIFGHR"
FT   gene            300801..302483
FT                   /locus_tag="RPC_0283"
FT   CDS_pept        300801..302483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0283"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85858"
FT                   /db_xref="GOA:Q21CM8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CM8"
FT                   /protein_id="ABD85858.1"
FT                   /translation="MTMSHIGFYRKKAKFKGIFGIRARLVLLALILVGPLMVERIRSLE
FT                   DTRVKQVSMASSELSALAERTAASQREIISSVEAVLKSSAYIHASASRIGRGCATLRAS
FT                   LRVDLPSIRMLMVAGPDGVVRCSTSTMFVGLNISDRSYFKKAMESHDFVVSDFLVGRQT
FT                   GKGTILAAYPVSAIDSGEEAVLVAGLNLDWMSGVMGNLGGRPGVTAALVDGDGIVLATP
FT                   PDQMSLVGQPFVGPAQPVSPGLNDLGAEERAFSGEAPGNNRAVYFAPIRGTTARLVVAV
FT                   DEAKVSAGINRDIRTAYLQLFLVCFIVLLGALIAAERLIVKPVNMMTEVAKKFGQGDWS
FT                   ARVCRKRLPAEFVPLARAFNAMAAHLVERERGLVAINNRLTVMASIDVLSGLANRRGFQ
FT                   SRLDFEWMKAEQNGTDVGLLMIDVDHFKPFNDTYGHPEGDACISRIGETLAAIANDIGG
FT                   FAARYGGEEFCLLLAETDRASEVGEMVRSAIAHLAIPHRTSVFQQVTVSVGVACTVPHP
FT                   ANSPRDLIEAADAALYAAKHRGRNAVVEHGFIRGSDSGLSMAS"
FT   gene            302668..305316
FT                   /locus_tag="RPC_0284"
FT   CDS_pept        302668..305316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0284"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85859"
FT                   /db_xref="GOA:Q21CM7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CM7"
FT                   /protein_id="ABD85859.1"
FT                   /translation="MTNERYNARESEPRWQRQWDDNAIFATQNDDPRPKYYVLEMFPYP
FT                   SGRIHMGHVRNYTMGDVVARTMRARGYNVLHPMGWDAFGMPAENAAMANKVHPKSWTYA
FT                   NIATMKAQLKSMGLSLDWSREFATCDPSYYKHQQRMFIDFLAAGLVERKQSKVNWDPVD
FT                   NTVLANEQVIDGRGWRSGALVEQRELTQWFFKISKYSEDLLTALDRLDRWPDKVRIMQR
FT                   NWIGRSEGLLLRFALDTSTTPNHETEVEVFTTRPDTLFGAKFVALSPDHPLAAEAAKSN
FT                   PALAAFIEECRKTGTAQAEIDTAEKQGFDTGIRAVHPFDPSWQLPVYVANFVLMDYGTG
FT                   AIFGCPAHDQRDLDFVNKYGLGNLPVVCPEGQDPATFVVTDIAYDGDGRLINSNNGFIA
FT                   LDGMSIADAKEAVAKRLEAIALGNRPVAQRQVNFRLRDWGISRQRYWGCPIPIIHCEVC
FT                   GVVPVPIKDLPVKLPDDIEFDRPGNPLDRHPTWKHVACPQCGGKARRETDTMDTFVDSS
FT                   WYFSRFTDPWNEDAPTTRAVVDRMMPVDQYIGGVEHAILHLLYSRFFTRAMQATGHVGF
FT                   DEPFRGMFTQGMVVHETYRKLDGTFASPAEIRIVADGDNRLASLLDSGQPVEIGPIEKM
FT                   SKSKRNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEDGVKGASRFVQRVWRLVSA
FT                   MAPQLPAPGTRLDAANHPAAQALRVAAHRTLSEILAGIDRLRFNTAVAKLYVYVGELEA
FT                   VLANAPQGGLGGDPVLAAAAREAIDILVLLIAPMMPHLAEECWAAIGHSGLVSEARWPE
FT                   IETALLVSDSITLPVQVNGKKRGEVTVARDAQNPQIEAAVLALDAVKQALDGKPVRKII
FT                   IVPQRIVNVVG"
FT   gene            305303..305854
FT                   /locus_tag="RPC_0285"
FT   CDS_pept        305303..305854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85860"
FT                   /db_xref="GOA:Q21CM6"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CM6"
FT                   /protein_id="ABD85860.1"
FT                   /translation="MSWASPRLAARLIVVVALAALTAGCFQPMYAERSDGTPGLRDKLA
FT                   SVEVPAIDAPNGSRVARLGVEIRNALMFKMYGNATGMPPTHRLEIRLTTSRSSLIVDPS
FT                   TALPAIENYGIDASYVLKDSATDKVILTGSTFSRVSYDVPGQTQRFARQRAFRDAEDRA
FT                   SQEIAENIQTRLASFFSAGI"
FT   sig_peptide     305303..305362
FT                   /locus_tag="RPC_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.624) with cleavage site probability 0.377 at
FT                   residue 20"
FT   gene            305856..306884
FT                   /locus_tag="RPC_0286"
FT   CDS_pept        305856..306884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0286"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85861"
FT                   /db_xref="GOA:Q21CM5"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CM5"
FT                   /protein_id="ABD85861.1"
FT                   /translation="MVALRGREVDSFLARPDSGRPIILLYGPDAGLVRERAEALIASAV
FT                   DDPSDPFSTVRLDGDELAAEPSRLVDEAMTIPMFGGRRAIRVRAGSKNFVSGVETLALS
FT                   ALKDCRIVIEAGDLKPDAALRKACERAKTAVAIGCYTDGERDLAKLVDDEFRNANLRIA
FT                   PDVRALLVSLLGGDRQASRNEVRKLVLYTHGQSEVTLDDVMAVVADASELKLDPVIDGA
FT                   FAGKPSLVETEFTKAMNAGSNPGTIMMAAQRHAALMHKAALAVDAGSSESSAVEGGFPR
FT                   LHFSRKAIVEAGLRNFTAQRLLAIIDQLGNAALEMRKQSALAPVIAQRALLAIAVNARR
FT                   RG"
FT   gene            complement(307259..308140)
FT                   /locus_tag="RPC_0287"
FT   CDS_pept        complement(307259..308140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0287"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85862"
FT                   /db_xref="GOA:Q21CM4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CM4"
FT                   /protein_id="ABD85862.1"
FT                   /translation="MADEQRSRLGRGLASLIGDVGGEAAHLERPRAQRKVPIEFLKPNP
FT                   RNPRRAFSDAELGELSDSIKQHGVIQPIVVRPIKGAQDRFEIIAGERRWRASQLAGLHE
FT                   VPIVPIDVSDSVALEIAIIENVQREDLNALEEAQGYHALAENFKHGQDEIAKLVGKSRS
FT                   HVANMMRLTRLPDDVQALIAAGKLSAGHARALIGVPDASAAAQRIVAEGLNVRQAEALA
FT                   HEEGVPERAPQKARAGKAAKDPDTLALEKRVSDALGMKISIDDRGGAGAVQIKYRDLDQ
FT                   LDDIVRRLEAGG"
FT   gene            complement(308406..309260)
FT                   /locus_tag="RPC_0288"
FT   CDS_pept        complement(308406..309260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0288"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85863"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CM3"
FT                   /protein_id="ABD85863.1"
FT                   /translation="MTVIDQIYQGDTRNAGAAKPRILALANQKGGVGKTTTAINLGTAL
FT                   AAIGERVLIVDLDPQGNASTGLGIDRRNRNCSTYDVLIGEAPLRDAVVPTAVPRLHIAP
FT                   STMDLSGLELELGATRDRAFRLRDAIAALNDNIAPPLDYTYVLIDCPPSLNLLTVNAMA
FT                   ASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGIVLTMFDSRNNLSNQVVA
FT                   DVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDLKCAGSEAYLKLATEVIQRERELR
FT                   TAH"
FT   gene            complement(309257..309961)
FT                   /locus_tag="RPC_0289"
FT   CDS_pept        complement(309257..309961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0289"
FT                   /product="methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85864"
FT                   /db_xref="GOA:Q21CM2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CM2"
FT                   /protein_id="ABD85864.1"
FT                   /translation="MAQRSQKSPPPPELAADKAAALRLTPVSRETEARLDAYVALLLQW
FT                   QAKTNLISPATLPQLWTRHVADSLQLLRLAPDAKTWLDFGSGGGFPGVVLACALAESAG
FT                   GSVQLVERNVKKAAFLREALRVTGGAGQVILADIGDSVDRFAGQVDCVTARAVAPLHQL
FT                   IGFAKPLIRQGAKALFLKGQDVDAELTEATKSWKFSPRLHPSLTGGQGWIVELGAVEPQ
FT                   DQSAPTPHGASV"
FT   gene            complement(310649..312526)
FT                   /locus_tag="RPC_0290"
FT   CDS_pept        complement(310649..312526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0290"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85865"
FT                   /db_xref="GOA:Q21CM1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CM1"
FT                   /protein_id="ABD85865.1"
FT                   /translation="MQTSFDVIVIGGGHAGCEAAAAAARLGATTALVTHRFATVGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLMGRVADQGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
FT                   AMQALILATPHLSVVEAEADDLLTSDGRITGIRLADGRELGAGAVVITTGTFLRGLIHL
FT                   GERSWPAGRIDEAPALGLSKSFERLGFALGRLKTGTPPRLDGRSIDWGAVEMQPGDEPP
FT                   EPFSVLTEKITNPQIECGITRTTPATHAVIRANVHRSPMYSGQIQSSGPRYCPSIEDKI
FT                   VRFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQRAILATIPGLQRTTMLRPGYAI
FT                   EYDHVDPRELEPTLQAKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAALLASGGGEIA
FT                   FDRADGYLGVMIDDLVTRGITEPYRMFTSRAEYRLTLRADNADQRLTGQGIALGCVGAE
FT                   RTEFHTAKMAALAQAKALAQSLAITPSQAAKHGLSLNRDGVRRSAFELLAYPEVDWARV
FT                   EAIWPELAAIEPSIATHLEIDATYDVYLKRQTADVEGFRRDEGLLLTEIDYALVPGLSN
FT                   EARGRLEKARPRTVGQAGRLDGLTPAALGILAAYLRRDQRRKPAGSAAG"
FT   gene            complement(313243..314592)
FT                   /locus_tag="RPC_0291"
FT   CDS_pept        complement(313243..314592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0291"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85866"
FT                   /db_xref="GOA:Q21CM0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CM0"
FT                   /protein_id="ABD85866.1"
FT                   /translation="MHSRQQTIFALSSGRPPAALAIVRVSGPEAAIVLERIAGRLPPPR
FT                   QAMRALLHDASAQPIDDAIVLWFPAPRSATGEDVAEFHIHGGRAVLSAVIAAIGTNENL
FT                   RAAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTERQRRQALRQLQGLLGDRARDWRGE
FT                   IIAASALVEAAIDFADEGDVPDELIAPAKAKIEILLDEIEDVLAQEGRSEKLRDGLVVA
FT                   ITGPPNVGKSTLMNQLARREVAIVSPHAGTTRDIIEVHLDLDGYPVTVIDTAGIREAID
FT                   PVEQEGVRRARSRAAEADLRLWLVDAQAAGDGEDALRAWMAQGQNGFWVVRNKVDVAGE
FT                   PTGELSATGWPCFSISAANGRGVAELIAALGKFAAAHLGGESALITRARHRDLLRQTAD
FT                   ALGRAIDLPEQVELIAEELRIAAHRLGQLLGRVDVEDILDVIFREFCVGK"
FT   gene            complement(314850..316115)
FT                   /locus_tag="RPC_0292"
FT   CDS_pept        complement(314850..316115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0292"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85867"
FT                   /db_xref="GOA:Q21CL9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CL9"
FT                   /protein_id="ABD85867.1"
FT                   /translation="MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFASLKQL
FT                   AIKETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNTLNFEDPEKSKHKVNFDNLTPLFPDQRFRLELEDSSRKDLSAR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVSDKRTFPAIDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAI
FT                   DFLLDKLRNTKNNAEFFESMNT"
FT   gene            complement(316404..316835)
FT                   /locus_tag="RPC_0293"
FT   CDS_pept        complement(316404..316835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0293"
FT                   /product="conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85868"
FT                   /db_xref="GOA:Q21CL8"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CL8"
FT                   /protein_id="ABD85868.1"
FT                   /translation="MAELIYPWAKAFHIIAVISWMAGMLYMPRLFVYHCTATVGSKQSE
FT                   TFKIMERRLYKAIMTPAMLAAWAAGLYIAWDRGFLMDGWFHGKLAAVVLMTVIHLMMGR
FT                   YVRDFAADRNTRSHKFYRIINEVPTLLMIAAVILVVIKP"
FT   gene            317294..318133
FT                   /locus_tag="RPC_0294"
FT   CDS_pept        317294..318133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0294"
FT                   /product="protein of unknown function DUF299"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85869"
FT                   /db_xref="GOA:Q21CL7"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CL7"
FT                   /protein_id="ABD85869.1"
FT                   /translation="MMPTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPL
FT                   VRSQKQLDRVLTEIEEAPGIVLFTLLEKDLVGRLEAKCEEINIPSLSIIGPVMQLFQAY
FT                   LGSSTTGRVGAQHTLNAEYFKRIDALNYSMIHDDGQHVEGLEDADVVLVGVSRTSKTPT
FT                   SIYLANRGIRTANVPLVPGIAIPHQLETLTKPLVVSLHATPERLIQVRQNRLLSMGATV
FT                   GNEDYIDRQSVNDEVSFARRLSAKYGWALLEVTRRSIEETAAAVMKLLADRQRQRQE"
FT   gene            318130..318738
FT                   /locus_tag="RPC_0295"
FT   CDS_pept        318130..318738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0295"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85870"
FT                   /db_xref="GOA:Q21CL6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CL6"
FT                   /protein_id="ABD85870.1"
FT                   /translation="MTIWLGSQPLVLASQSYARQMLLQNAGIPFEAIPAAIDERGVQQA
FT                   SGLTSPAEIAARLAEEKALAVSQRLPGRLVLGADQTLALGERTFNKPADRAKATAQLRT
FT                   LSGRRHELHSAIALVRNGKTVFAETSVARMTMRQLTEAEIEAYLNEAGDAATSSVGGYQ
FT                   VEGLGVHLFDGIHGDHFTILGLPLVPLLNYLRQQRLLAF"
FT   gene            318758..319357
FT                   /locus_tag="RPC_0296"
FT   CDS_pept        318758..319357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0296"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85871"
FT                   /db_xref="GOA:Q21CL5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CL5"
FT                   /protein_id="ABD85871.1"
FT                   /translation="MRILGLTGSIGMGKSTTARLFAEAGVPVYDADATVHQIYEGEAAP
FT                   AVETAFPGTTVNGKVDRALLSARVLHDAAAMQRLEAIVHPMLRAHHQQFLADAEKSGAP
FT                   VAVVDVPLLYETGGDARVDAVVVVTTSHQVQRARILARQGMTDEKLDALLARQLPDAEK
FT                   RQRADFVVDTSNGLEPVRAQIREILAATAKMPQRRA"
FT   gene            319546..320241
FT                   /locus_tag="RPC_0297"
FT   CDS_pept        319546..320241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0297"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85872"
FT                   /db_xref="GOA:Q21CL4"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CL4"
FT                   /protein_id="ABD85872.1"
FT                   /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEIFNRMPTGQTFHRYINP
FT                   ERDMPQEAFAVHGLSAEFLSTKPLFAEVVDEFLEFIAEAPLVIHNASFDIGFINAELGK
FT                   IARPPIPRDRLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   IDLIGARQSQLILAEAAPSRSNRPGDAPRRQRETPLAARVTDADRIAHREFVATLGDKP
FT                   IWNEYFGEA"
FT   gene            complement(320513..321007)
FT                   /locus_tag="RPC_0298"
FT   CDS_pept        complement(320513..321007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0298"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85873"
FT                   /db_xref="GOA:Q21CL3"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CL3"
FT                   /protein_id="ABD85873.1"
FT                   /translation="MTNGNGAPPEAAQAPQLNVLAQYTKDLSFENPNAPASLAPQAQQP
FT                   SINIQINVTANTLADSEFEVTLAIEGKADNAGSLIFSFELLYAGVFRILNVPKENLHPL
FT                   VMIECPRLLFPFAREIIATAVRDGGFPPLMLDPVDFVGLYRQNMERQAAAAASADEAKP
FT                   S"
FT   gene            321481..322182
FT                   /locus_tag="RPC_0299"
FT   CDS_pept        321481..322182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0299"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85874"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CL2"
FT                   /protein_id="ABD85874.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRNVLGQKTGNERPPFDRAARDVVRGA
FT                   QDNVVPLPGAVVDQAPQTPSADVVPPTDRWKGVAEPGTPLAQGLNAIVAQDSSFDPQHF
FT                   LTGARGAYEMIVLAFANGDRRALKDLLSPEVYDSFEAVIREREKQEQKTETRFVSIDKA
FT                   ELVSAEARDRAAQLTVRFVSQMITVTRDKTGAIVDGNPDKVADITDVWTFARDVGSRDP
FT                   NWKLVGTGSVH"
FT   gene            322106..323734
FT                   /locus_tag="RPC_0300"
FT   CDS_pept        322106..323734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0300"
FT                   /product="MltA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85875"
FT                   /db_xref="GOA:Q21CL1"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CL1"
FT                   /protein_id="ABD85875.1"
FT                   /translation="MFGHLPETSDRAIRTGSWSAPAASIKHGGFRAAVCAALAVGCWLA
FT                   PALAEARHHVPRHRHLAVWPLEIPNGQYVPVGWADVAGWSEDDQLAAFKAFRASCKPIA
FT                   AQRGPPNETKPLGGSLREPCRIARAADISEPAAARAFFERHFHPVRISKLGETDGFVTG
FT                   YYEPVLDGSRTRTDVYTVPVYRRPSNLFVRGVSQGAAGLPNKGEVFRKIGRRKLVPYYD
FT                   RAAIEDGAVAGRGLELCWLKSQTDLLFTQIQGSARVRFEDGTTLRINYDAHNGYPYTPV
FT                   GRILIERNIIPKEQMSMQRIRQWMEENPDGAHELRRQNRSYVFFRAVDLSDKDEAVGAQ
FT                   GVPLTPGRSIAVDKALHVYGTPFFIEADLPLDSEQSATPFRRLMVAQDTGSAIVGPARA
FT                   DLYFGAGAEAGRVSGRLRHGARFVMLLPNSLDPLARGRTMPLPEARPSAKIAKLFPQTE
FT                   QPKPTVEQKPAEPPSAAPSANPATPSAEPAKAAPSTAERASKPAAAAAAVPLPEARPAT
FT                   APEIRPAHRRLHRPWRHHRRWHGAR"
FT   gene            323731..324339
FT                   /locus_tag="RPC_0301"
FT   CDS_pept        323731..324339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0301"
FT                   /product="Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85876"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CL0"
FT                   /protein_id="ABD85876.1"
FT                   /translation="MSKKPPQLSDPVVPSRRRRALSEPERELWESVAKQVKPLRKKHRV
FT                   VKAVALAAAPEPAVRVEKSPASLKPVAPSKAPPVPKLDAPRPAPPLAPIGRRERAHLSR
FT                   GKKSIDGRIDLHGMTQTRAHGALLSFLHRASHEGMTFVLVITGKGRTVGPESERGVLRR
FT                   QVPHWLGLPEFRTLVVGFEEAHIGHGGEGALYVRVRRVR"
FT   gene            complement(324509..325813)
FT                   /locus_tag="RPC_0302"
FT   CDS_pept        complement(324509..325813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0302"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85877"
FT                   /db_xref="GOA:Q21CK9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CK9"
FT                   /protein_id="ABD85877.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQHDAKRAVSIALRNRWRRLQLEGSLR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAISQVREKKRKDVEARAQIAAEERVLDALVGANSSATTRDSFRKKLRAGELNDKEIE
FT                   VETQSTGGGSPMFEIPGMPGAQMGAISLGDIFGKMGGRTKTRRLTVEDSHELLVNEEAD
FT                   KLLDSDQLVQEAINAVENNGIVFLDEIDKICVRDGRSGGEVSREGVQRDLLPLIEGTTV
FT                   STKHGAVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELSALTRDDMRRILTEPEA
FT                   SLIKQYVALLQTEGVTLEITDEAIDALADVAVAVNSSVENIGARRLQTVMERVLDEISF
FT                   TAPDRDGETIQVDAAYVQKHVGDLAKNADLSRFIL"
FT   gene            complement(325896..326468)
FT                   /locus_tag="RPC_0303"
FT   CDS_pept        complement(325896..326468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0303"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85878"
FT                   /db_xref="GOA:Q21CK8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CK8"
FT                   /protein_id="ABD85878.1"
FT                   /translation="MTPQFSASGEGSPQVWHGTTILTVRKGGKVVIGGDGQVSIGQTVI
FT                   KSNARKVRKLGKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLTRAAVELAKDWRTDR
FT                   YLRRLEAMMIVADKEVSLVLTGTGDVLEPEAGVMAIGSGGNYALAAARALIDSDKDAEA
FT                   IVRRSLDIAADICVYTNRNVTVETLSA"
FT   gene            326645..327238
FT                   /locus_tag="RPC_0304"
FT   CDS_pept        326645..327238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0304"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85879"
FT                   /db_xref="GOA:Q21CK7"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CK7"
FT                   /protein_id="ABD85879.1"
FT                   /translation="MRTATIKRKTKETAIEVTVDLDGTGASNIATGIGFFDHMLDLLAR
FT                   HSRIDITVKAVGDLHIDYHHTTEDVGIALGQAVKQALGNMAGITRYAGIHLPMDETLTR
FT                   VVIDISGRPTLVFKAEFPRDKIGEFDTELVREWFNAFAMNAGVTLHVETLYGENSHHIA
FT                   ESCFKGLARVLRAAVAIDPSAAGEVPSTKGQLGG"
FT   gene            327269..327778
FT                   /locus_tag="RPC_0305"
FT   CDS_pept        327269..327778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85880"
FT                   /db_xref="GOA:Q21CK6"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CK6"
FT                   /protein_id="ABD85880.1"
FT                   /translation="MSVYTVHAPVAHTSNRPSSAERFVFVRDGFHVWAFLAGPFWLLYH
FT                   RLWLALAGYVALNVVATLIMAAAHAGAGSRFAVLLLIALLMGLEAASLRRWTLSRRGWR
FT                   QLDLVVADDADAAERRFFDRWSAARPSDDYRPPVERGAPPPTRSGSPSSAQQDIFGLFP
FT                   RPGSSR"
FT   gene            327775..328425
FT                   /locus_tag="RPC_0306"
FT   CDS_pept        327775..328425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0306"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85881"
FT                   /db_xref="GOA:Q21CK5"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CK5"
FT                   /protein_id="ABD85881.1"
FT                   /translation="MSVAIIDYGSGNLHSAAKAFERAARGMDVPDKIVVTSDPEVVYRA
FT                   DRVVLPGVGAFADCRRGLDAVDGMVQAMTEAVRDKARPFFGICVGMQLMATHGKEHVTS
FT                   DGLGWIPGDVVKITPREENLKIPHMGWNTLEMLREHPVLERLPLGPNGRHAYFVHSFHL
FT                   AAVNESDVLARAEYGGPVTAIVGRDTMFGTQFHPEKSQRFGLALISNFLKWKP"
FT   gene            328577..329314
FT                   /locus_tag="RPC_0307"
FT   CDS_pept        328577..329314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0307"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85882"
FT                   /db_xref="GOA:Q21CK4"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CK4"
FT                   /protein_id="ABD85882.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMDRATVFNLDPAAQAKSFAAQGFE
FT                   YLHVVDLDGAFAGKPMNAQAVESMLQVVKMPVQLGGGIRDLATIEAWLGKGVSRVIIGT
FT                   AAVRDPALVKDAAKKFPGRVAVGLDARDGKVAVQGWAESSEVTALEIAQRFEDAGVAAI
FT                   IFTDIARDGLLKGLNLDATIELAATISTPVIASGGFGSIDDVKALILPRAAKLAGAIVG
FT                   RALYDGRLDPTEALALMRRAAAA"
FT   gene            329323..329712
FT                   /locus_tag="RPC_0308"
FT   CDS_pept        329323..329712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85883"
FT                   /db_xref="GOA:Q21CK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CK3"
FT                   /protein_id="ABD85883.1"
FT                   /translation="MFKLDQIVRAGLSRVDTIRVVRTAVNPMLWLAGFAAPMFLLAAVL
FT                   TDGASRLVSIALAAAFCFPAIVAYFILLFRDPDRLQSEEYRVRLQELKFRYRKGRKPVI
FT                   VTSTKEIGSIEHDHGGKDGNPPSGI"
FT   gene            329687..329974
FT                   /locus_tag="RPC_0309"
FT   CDS_pept        329687..329974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85884"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CK2"
FT                   /protein_id="ABD85884.1"
FT                   /translation="METRLLVFDDGNGDDLDLRAFVDGLDDNAEMIELEAHVCFVRSGL
FT                   SVSELSNRFIAVAGSRVFFISDIASSKFEGRMPGVYWDFIKNKSLASAAE"
FT   gene            329975..330751
FT                   /locus_tag="RPC_0310"
FT   CDS_pept        329975..330751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0310"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85885"
FT                   /db_xref="GOA:Q21CK1"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CK1"
FT                   /protein_id="ABD85885.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGINFVDLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPLTVGGGVRTVDDIKVLLRSGADKVSINS
FT                   AAVSRREFVKEAAEKFGDQCIVVAIDAKRVKRGGGGERWEIFTHGGRNSTGIDAIEYAQ
FT                   EVVSLGAGEILLTSMDRDGTRQGFDIPLTSAIADSVHVPVIASGGVGTLDHLVDGIRNG
FT                   HATAVLAASIFHFGEFTIRQAKDHMVRAGLPMRLDP"
FT   gene            330811..331134
FT                   /locus_tag="RPC_0311"
FT   CDS_pept        330811..331134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0311"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85886"
FT                   /db_xref="GOA:Q21CK0"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CK0"
FT                   /protein_id="ABD85886.1"
FT                   /translation="MARFTIHDLAATVDARAASGGEGSYTRKLLDKGPEHCAKKFGEEA
FT                   VETVIAAVENDRAHLIAESADVLFHLLVLLKSRDVRLEEVEAALAQRTTMSGLAEKASR
FT                   KRD"
FT   gene            331242..332195
FT                   /locus_tag="RPC_0312"
FT   CDS_pept        331242..332195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0312"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85887"
FT                   /db_xref="GOA:Q21CJ9"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CJ9"
FT                   /protein_id="ABD85887.1"
FT                   /translation="MDARADQIYNPYRVFTRAQWAKLRDDTPMTLNATEIAALRSMYDR
FT                   LDLKEVEEIYLPLSRLLSIYVAATQQLYFAQRRFLGIVDRKMPYIIGVAGSVAVGKSTT
FT                   ARVLQALLARWSPRPKVDLITTDGFLYSNAMLERQGMMQKKGFPESYDLPRLLAFLSDI
FT                   KAGRRRVRAPIYSHLTYDIVPNEYVTVDRPDILIVEGVNVLQTGRLPRDGKAVPVVSDF
FT                   FDFSVYIDADEPVLREWYVQRFLALRDTAFHDPRSYFHRYAPLSDEEATATALAIWERT
FT                   NLANLEDNILPTRPRATLIMKKGTDHVVETVALRRL"
FT   gene            complement(332477..332929)
FT                   /locus_tag="RPC_0313"
FT   CDS_pept        complement(332477..332929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85888"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ8"
FT                   /protein_id="ABD85888.1"
FT                   /translation="MTVDTTDYQPNGRHPEEPGVAQRSRASRRMGCKRCGAAPTRGRIL
FT                   RGSRETRERPRMTALFWWRARRATRRDHVARSRNGRAALLRTPVTIDTTDYQPNGRHPE
FT                   EPGVAQRRRASRRMGCKDWWPHPSRLARAPQDDGVVLAESARATRA"
FT   gene            complement(332977..333942)
FT                   /locus_tag="RPC_0314"
FT   CDS_pept        complement(332977..333942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0314"
FT                   /product="ornithine-acyl[acyl carrier protein]
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85889"
FT                   /db_xref="GOA:Q21CJ7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ7"
FT                   /protein_id="ABD85889.1"
FT                   /translation="MHGDDLARSTQRFIKLLRPENAGAMAATAITWLKTPPYLPQPRKA
FT                   LRPFPAAPASLGRMGALEVKLATEKRDVRHAQKLRYRVFYKNGTAVADAATLLARRDKD
FT                   GFDRICDHLLVVDHAAKPTLSGKQPVVGTYRLLRQELADRHGGFYTENEFDLSGMIERH
FT                   PGLRFLELGRSCVLPRYRNKRTVELLWQGIWNYVRQYDVDVMIGCASFEGTDPDRLALP
FT                   LSFLHHHASAPEEWRARAHPSRRIEMNRMAKDAIDPKAALRELPPLIKGYLRVGAMVGD
FT                   GAVIDYQFGTTDVLIVMPVAAIKGRYIEHFGGSDAPRRAA"
FT   gene            complement(334088..336361)
FT                   /locus_tag="RPC_0315"
FT   CDS_pept        complement(334088..336361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0315"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85890"
FT                   /db_xref="GOA:Q21CJ6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ6"
FT                   /protein_id="ABD85890.1"
FT                   /translation="MSGTLDLNLAPDGTARRAPWRKLAGRVAMIFAAAFGAAYGLIVGS
FT                   RVELAGYHPHAVAFAGSLLVGLGCVLFAIPSIKLRAARHELRLLALHNDALADRNWELQ
FT                   EAEYRARSLFESQSDLIVLRDAEGRIGFVNDAYCELAGRASAALIGSPDTLDVLEQSEV
FT                   ITEPNGTRTYDQKVATAHGPRWIAWREGIVRNDSGRPAETQCVGRDVTARAETERALAE
FT                   ARDIADTANRAKSRFLAMASHEIRTPLNGIIGMSGLLLDTHLTPEQATYARAVKTSGDA
FT                   LASLIEELLDYSKIEAGKIDLENRPFALSALIEDITELLAPRAQARHLEIAADVDERLP
FT                   AEVIGDAARLRQVLLNLAGNAIKFTATGGVALIVEPGAMPGEIRFMVRDTGIGIAPEAQ
FT                   ARIFREFEQADELIARNYGGTGLGLSISDRIVKRMGGQITLHSAQGTGSTFEFVVPLAA
FT                   AATAAGGATASVTAPDLSGQAIMLVAPQTIAASLIARRLQRWGAQTCVLADREVAQALL
FT                   PERAWQAILIDRAIGTDDVASLAEAARPHAAQRIVMLTPAERHELRDTAASGLTGYLVK
FT                   PLRAASLAARLGLPDVVSPGIADDDLAEPAQDPATDAATRPVKPAPQGLSILVAEDNEI
FT                   NALLMRSLLSKLGHRAVITSDGEQALESWLAADSAGAAYDLVLMDIQMPHLDGIETTKR
FT                   IRAHEAGHRARRTPILALTANTLVEDRYACFEAGMDGFLVKPLDRDKLTEALASMQASR
FT                   YLAA"
FT   gene            complement(336523..337008)
FT                   /locus_tag="RPC_0316"
FT   CDS_pept        complement(336523..337008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85891"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ5"
FT                   /protein_id="ABD85891.1"
FT                   /translation="MRIMLRFGILASTIPLLLVGVFAGGELSPGPRPCIALGDGAAQLA
FT                   PTPWQAGLHVSFTDDASRASVRVQIVDAPEQADFTVVDDIDAAEPAGCERGESPRLIAI
FT                   TPTPSGADPVIHLSRDRDADYRIFVRSSRVSEREAAALIVGANAAPAHLVAALDGGS"
FT   sig_peptide     complement(336937..337008)
FT                   /locus_tag="RPC_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.834 at
FT                   residue 24"
FT   gene            complement(337619..339157)
FT                   /locus_tag="RPC_0317"
FT   CDS_pept        complement(337619..339157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0317"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85892"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ4"
FT                   /protein_id="ABD85892.1"
FT                   /translation="MVQRVTTVAFEGIEARAVDVQVQVAPGLPAFYLVGLPDKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPADALAGFT
FT                   VLGELGLDGSIAPVAGVLPAAIGANSRDEGLICPAACGSEAAWASPDIQIIAANSLIQI
FT                   ANHFKGTQLLSRPQPKVHEAPASLLDLRDIKGQESAKRALEIAAAGGHHLLMIGAPGAG
FT                   KSMLAARLPSILPPLSPSELLEVSMIASVAGEIRDGALTARRPFRAPHHSASMAALTGG
FT                   GIRAKPGEISLAHQGVLFLDELPEFDARVLDSLRAPMENGEVAVSRANHRVTYPARFML
FT                   VGAMNPCRCGHAYDPGFSCKRGRLDRCTADYQSRISGPLMDRIDLRIEVPAVTAADLIL
FT                   PPPSEGSAEVAARVAAARDIQRQRYAAAGLPQVRTNAEAPAAVLEKIARPDSSGAALLR
FT                   DAAESMRLSARGYHRVLRVARTLADLDGAETIGRLHLAEALSYRALAEDLRRAA"
FT   gene            339356..340408
FT                   /locus_tag="RPC_0318"
FT   CDS_pept        339356..340408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0318"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85893"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ3"
FT                   /protein_id="ABD85893.1"
FT                   /translation="MPLHRLQPTASSAAEMTAALQSQVDAQAALIRELSASLAHSRKIF
FT                   DRSSAAARIGVWECTLPDESLSWTDVVYDLFDLPRGAVLNRRQLLDCYPEESARALHRL
FT                   RSSAIEQLSGFSLDTEIVTVKGNRRWIRITATVESEDGVAVRIFGIKQDITDEKILADR
FT                   TRYLAEFDVVTGLANRGRFQSTLAQLDEAADARPFGALLLVDLDEFKAVNDCFGHAAGD
FT                   ECLKQAGQRISKACGDARLVARFGGDEFAVLLGSHQRFAEISEIARSIIEEMRRPIVFH
FT                   GHELQLGASVGVALVDGCTASQLFVMADKALYAAKEAGRGTFRIHKPGTGGRTAAVTRP
FT                   PGGPRRILRG"
FT   gene            complement(340413..341354)
FT                   /locus_tag="RPC_0319"
FT   CDS_pept        complement(340413..341354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0319"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85894"
FT                   /db_xref="GOA:Q21CJ2"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ2"
FT                   /protein_id="ABD85894.1"
FT                   /translation="MTLNVAVQMDPIARINIRGDSTFALLLEAQQRGHTLSYYTPDQLS
FT                   LRGNDLVGSVQSLSVRDQPGDHFTLGEAQRKNMRDFDVVLLRQDPPFDLAYITNTHFLE
FT                   RIHPDTLVVNDPASVRNAPEKLFVMDFADLMPPTLISRNLAEINSFRAEHGAVVMKPLH
FT                   GHGGAAVFRVLPQDMNFGSLFDMFSVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAEDDLRSNMVRGGAARATDLTEREREICERLGPHLRQRGLLFVGIDVIDGHLTEI
FT                   NVTSPTGIRAIAKLGGPDVAARIWDVIEKKRG"
FT   gene            complement(341399..341806)
FT                   /locus_tag="RPC_0320"
FT   CDS_pept        complement(341399..341806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0320"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85895"
FT                   /db_xref="GOA:Q21CJ1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CJ1"
FT                   /protein_id="ABD85895.1"
FT                   /translation="MAKSSDARSPAPHAAAPERVAAFRTGISAEARAAAYLIAKGYRIV
FT                   ARRFRTPYGEIDLVARRRNLLAFVEVKARAKLDDAAYAVTPRQQQRIIDAAQAWLMAHP
FT                   EHADFELRFDAVLIAPKSLPRHLPAAFDASP"
FT   gene            complement(341793..342746)
FT                   /locus_tag="RPC_0321"
FT   CDS_pept        complement(341793..342746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0321"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85896"
FT                   /db_xref="GOA:Q21CJ0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CJ0"
FT                   /protein_id="ABD85896.1"
FT                   /translation="MHVTPGSSDTQSDPTAPKQRSFAIAGQLVSASRAVPGLHLVATPI
FT                   GNLGDITLRALETLAGVDIIACEDTRITRRLTERYNIHASLKQYHEHNAAQARPKILEK
FT                   LAQGCSIALVSDAGTPLISDPGFKLVREVTAAGFNVFALPGPSSVLTALAVAALPTDRF
FT                   FFEGFLPSKQMARRARLAELSRIDATLVLFESGNRVEDTLQDMAQVMGTRDAAICRELT
FT                   KLHEEVRRAPVAELAASAGALETRGEFVLVIGPPAADAQLMAAQDLDDLLRSALQQGSV
FT                   KDAVAQAVEVSGRHRREIYARALELAKQGASDHGEE"
FT   gene            342914..344116
FT                   /locus_tag="RPC_0322"
FT   CDS_pept        342914..344116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0322"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85897"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CI9"
FT                   /protein_id="ABD85897.1"
FT                   /translation="MAGPRDPTRPGHTRRNAVGLILGAPLLSACAGVQQSLTGPFSSTT
FT                   PQPGSAGPAQQPAAVGTGQVKVGLILPLSAPGNAGVAAQSMKNAAELALAEFQNPNIQL
FT                   LIKDDAGNPQGAQAGTQQALDEGAEIILGPLFALAVPATAQLARARGVSVIAFSTDSSV
FT                   AGRGVYLLSFLPESDVVRIVDYAASTGKRSFAALLPENAYGNVVEAAFKQAVGRKGGRI
FT                   VAFERYGTDRATPARTVAAALGGADALFLADDGEALVGVADALTAAGADLKRVQLLGTG
FT                   LWDNPRVFGNAALQGGLYAAPDPSGFRAFSARYRTRYGADPVRTATLAYDAVALVAALA
FT                   RTQGAQRFSPEVLTNPSGFAGIDGLFRFRADGSNERGLAVMRVGSGGSQPAAGSPKSFG
FT                   A"
FT   gene            complement(344279..345439)
FT                   /locus_tag="RPC_0323"
FT   CDS_pept        complement(344279..345439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0323"
FT                   /product="Putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85898"
FT                   /db_xref="GOA:Q21CI8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CI8"
FT                   /protein_id="ABD85898.1"
FT                   /translation="MTRADRDPAFGVYIHWPFCLSKCPYCDFNSHVRHVAIDQERYLRA
FT                   FVREIETTAERTPGREVTSIFLGGGTPSLMQPATVGGILEAIGKHWNVAADVEISMEAN
FT                   PTSVEATRFRGYRAAGVNRVSLGVQALDDLSLKTLGRLHTAQEAMEAVAIARSIFERYS
FT                   FDLIYARPGQTPAMWQAELQKAIGEAAEHLSLYQLTIEADTPFFGLHAAGKLQTPDEAT
FT                   ARALYDVTQEVCAAHGLPSYEISNHARAGAECRHNLLYWRGQEYAGIGPGAHGRLDING
FT                   IRHAIATEKRPEAWLMRVEACGHGVVVDDRLNSEERADEFLLMGLRLAEGIDPTRYQAL
FT                   SGRALDPARIAVLREEGAIVVDPNGRLRVTLSGFPLLDAVVADLAA"
FT   gene            complement(345426..346061)
FT                   /locus_tag="RPC_0324"
FT   CDS_pept        complement(345426..346061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0324"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85899"
FT                   /db_xref="GOA:Q21CI7"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CI7"
FT                   /protein_id="ABD85899.1"
FT                   /translation="MHRRITGQLVIATHNPGKLAEMRELLAPYGIAAVSAGELKLAEPD
FT                   ETGDSFRANARIKAIAAANAAQLPAFADDSGLVVEALDGAPGIFSARWAGEGKDFTSAM
FT                   TRIERLLQERGATTSDQRKAHFVSALCVAWPDGHLEEVEARADGTLVWPPRGTAGFGYD
FT                   PAFLPEGHVRTFGEMTSVEKHGLPPLGLGLSHRARAFVKLAEICLDPR"
FT   gene            complement(346103..346822)
FT                   /locus_tag="RPC_0325"
FT   CDS_pept        complement(346103..346822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0325"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85900"
FT                   /db_xref="GOA:Q21CI6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CI6"
FT                   /protein_id="ABD85900.1"
FT                   /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCMVKFGDTHVLVTATLED
FT                   RLPPWLKGQGRGWVTAEYGMLPRATLERTRREASAGKQNGRTVEIQRLIGRSLRATVDL
FT                   QALGERQITVDCDVIQADGGTRTASITGAWVALADCIGWMKTRNMFKGTAPVLRDNVAA
FT                   ISCGIYNGTPVLDLDYAEDSEADTDANFVMTGDGRIIEVQGTAEKTPFSQDEFLALMAL
FT                   AKKGVARLVDLQKMAVA"
FT   gene            346969..348057
FT                   /locus_tag="RPC_0326"
FT   CDS_pept        346969..348057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0326"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85901"
FT                   /db_xref="GOA:Q21CI5"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CI5"
FT                   /protein_id="ABD85901.1"
FT                   /translation="MAHHDPIGLIAPNAGLAQLNERSREIFRQIVESYLATGEPVGSRN
FT                   ISRLITVPLSPASVRNVMSDLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP
FT                   ERQSIQAQLASVGRAQSVEAALGEALTRLSGLTRAAAVVLTAKSNARLKHIEFVRLEPE
FT                   RALVVLVSEDGQVENRVLTLAAGVPSSALIEASNFLNARIRGRTLAEARLELETALSQD
FT                   RAELDQLTQKVISAGIASWSGGANDDRQLIVRGHANLLEDLHALDDLERVRLLFDDLET
FT                   KRGVIDLLGRAESAEGVRIFIGSENKLFSLSGSSTIIAPYSDGAGHIVGVLGVIGPTRL
FT                   NYARVIPMVDYAARVVSQMLGG"
FT   gene            348161..348778
FT                   /locus_tag="RPC_0327"
FT   CDS_pept        348161..348778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0327"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85902"
FT                   /db_xref="GOA:Q21CI4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CI4"
FT                   /protein_id="ABD85902.1"
FT                   /translation="MMTDPNGPKDTPAQPAQAAEPVVSKPYIMPDDPEVGSTEALAKEA
FT                   AESRDKMLRTLAEMENLRKRTAREVADARTYGIAGFARDVLDIADNLQRALDAVPADAR
FT                   ATAEPGLKALIEGVELTERSMLNALEKNGVKKFDPIGEKFDPNFQQAMYEVPDSSVAAG
FT                   TVVQVVQAGFTLGDRVLRPALVAVSKGGAKANSSANDSASSD"
FT   gene            complement(348924..349871)
FT                   /locus_tag="RPC_0328"
FT   CDS_pept        complement(348924..349871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85903"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CI3"
FT                   /protein_id="ABD85903.1"
FT                   /translation="MMLIQRLFAAVLLTAAVGAAAPAAAADPVYPRGIRVGIVPLDGLT
FT                   ASPSFVGFESADHGVKVLLAELPPAAYGEVEAAFKATPEGVGGIKPENLQTTAGKGYYT
FT                   IEKAKDGADSVRRYSLIVPGSGFSGYVAVQVAEASAKSLSDDDIRRMFTSVTVRPEVPV
FT                   DEQLALMPFKLNDLSAFKMVRTLAPGAALLLADASDDAGIEAAPFMVIGLIGSAPEKPD
FT                   DRGRFAQQAAGIIPGLRDGRITMSEPVRIDGAAGFETRIDAVSGKANTPVTVVQWLRFG
FT                   SGNVAMRIIASAPRDQWPKAFPRFRAVRDGMQAR"
FT   sig_peptide     complement(349794..349871)
FT                   /locus_tag="RPC_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.936 at
FT                   residue 26"
FT   gene            350281..352179
FT                   /locus_tag="RPC_0329"
FT   CDS_pept        350281..352179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0329"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85904"
FT                   /db_xref="GOA:Q21CI2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CI2"
FT                   /protein_id="ABD85904.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKAPKVIENAEGMRTTPSIVAFSDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLVGRRYDDPMVEKDKKLVPYKIVKASNGDAWVE
FT                   ADAKTYSPSQVSAFILQKMKETAEAHLGAKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKAKAGVIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVSYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEIGEVVLVGGMTR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIP
FT                   PSPRGMPQIEVTFDIDANGIVNVSARDKATGKEQQIRIQASGGLSEADINKMVKDAEIN
FT                   AAEDKKRREAVDAKNHADALVHTTEKALAEHGAKVEEGERRAIEDALGDLREALKGDDA
FT                   EAIKAKSNTLAQASMKLGEAMYKQQAEADAAKDAAKDDVVDAEFTEVDDDKPKKSA"
FT   gene            352360..353499
FT                   /locus_tag="RPC_0330"
FT   CDS_pept        352360..353499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0330"
FT                   /product="Chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85905"
FT                   /db_xref="GOA:Q21CI1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CI1"
FT                   /protein_id="ABD85905.1"
FT                   /translation="MSTTKRCYYETLEVDRSADDSSLKAAFRKLAMKWHPDRNPGDASS
FT                   ESRFKEINEAYEVLKDGDKRAAYDRYGHAAFEQGGAGGPGFGAGFASSFSDIFEDLFGM
FT                   AGQRGGRGTGRERGADLRYNMEITLEDAFVGKTAQIEIPVSVTCESCSGTGAKAGTKPK
FT                   TCSMCGGAGRVRQAQGFFTLERTCPGCQGRGQTIEDPCPACSGAGRIERERTLSVNIPQ
FT                   GVEDGTRIRLAGEGEAGLRGGPPGDLYIFLSLASHEFFQRDGADLHCRVPISMVAAALG
FT                   GEIEVPTIDKGKSKVKVPSGTQSGRRFRIAAKGMPVLRSRQTGDMYVQVVVETPQNLTK
FT                   RQQELLAEFEKLSSGATQPEAAGFFTKVKDFFGTRGAAS"
FT   gene            353587..354189
FT                   /locus_tag="RPC_0331"
FT   CDS_pept        353587..354189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0331"
FT                   /product="Ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85906"
FT                   /db_xref="GOA:Q21CI0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CI0"
FT                   /protein_id="ABD85906.1"
FT                   /translation="MALQSSVRALKKPARLDDEVRFLRSWIEKPLHMGAVMPSGKVLAR
FT                   TMANYVEIDSDDPVIELGPGTGAITHALIEHGVDQKRLVLVEYNPSFCALLRERYPQAT
FT                   VVQGDAYRLRDSLWKILKAPAAAVVSGLPLVTKPMLTRLRLIRDSFALLAPGAPFVQFT
FT                   YSVAPPIPKSLPGVATEASERIWMNIPPARVWVYRKG"
FT   gene            354220..354858
FT                   /locus_tag="RPC_0332"
FT   CDS_pept        354220..354858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0332"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85907"
FT                   /db_xref="GOA:Q21CH9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CH9"
FT                   /protein_id="ABD85907.1"
FT                   /translation="MLHVRDRRCRRSARYNAIGSMSAVKILVIPGSLRTGSLNARLAAA
FT                   AIDEFVRADVDVTRLSLADYPLPIYDADLEATSGVPKPAVDLKRMLGAHRGVLLVSPEY
FT                   NSAPPPLLKNAIDWVSRVKDPHETQGQVFRERAFALASASEGRLGGTRCLAALRLILSG
FT                   CRATVIPNQLALSFADQAYDETDRLKHPADIEALRGLVRQLIDFAQQMK"
FT   gene            354880..355587
FT                   /locus_tag="RPC_0333"
FT   CDS_pept        354880..355587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0333"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85908"
FT                   /db_xref="GOA:Q21CH8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CH8"
FT                   /protein_id="ABD85908.1"
FT                   /translation="MSEKLAARDRMIVALDLPSVEAAEAMIARLGDSASFYKIGYQLAY
FT                   AGGLSMVGRLADAGKKVFVDLKLHDIGNTVGRGVESLSALGATFLTVHAYPQTMKAAVE
FT                   ARGDSGLKILAVTVLTSYDDSDLQEAGYRLGVRELVEQRARQAQAIGIDGLVCSPEEAA
FT                   HLRGIVGRNIALVTPGIRPAGAAAGDQKRIMTPARAIAAGADYLVVGRPIVEAADPKAA
FT                   ASAIVEEIATATA"
FT   gene            355602..355904
FT                   /locus_tag="RPC_0334"
FT   CDS_pept        355602..355904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0334"
FT                   /product="protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85909"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CH7"
FT                   /protein_id="ABD85909.1"
FT                   /translation="MAKGYWIARVEVANMDGYKEYVAQNGAVFNKYGAKFLVRAGRYEN
FT                   PEGSSRSRNVVLEFKDYDTALACYHSPEYQRLVAIRKPHGENDLVIVEGYDGPQP"
FT   gene            356172..356987
FT                   /locus_tag="RPC_0335"
FT   CDS_pept        356172..356987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0335"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85910"
FT                   /db_xref="GOA:Q21CH6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CH6"
FT                   /protein_id="ABD85910.1"
FT                   /translation="MSDMRLIVAGAGGRMGRALIRAITETPGAVVAGALEAPTSALLGQ
FT                   DAGTLAGLPPSGVKLSADLWALSAEADGIVDFTVPEATIANVAIAAQRGMVHVIGTTGL
FT                   TASDDAVISSVTSRATVVKSGNMSLGVNLLAALVKRVARSLDDGFDIEIVEMHHKAKID
FT                   APSGTALLLGEAAAAGRGVALAEHSIRGRDGVTGARKAGDIGFASLRGGTVTGDHTVIF
FT                   AGPYERIELTHKAEDRMIFAHGALKAALWARDQGPGLYSMADVLGLSDI"
FT   gene            357009..357632
FT                   /locus_tag="RPC_0336"
FT   CDS_pept        357009..357632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0336"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85911"
FT                   /db_xref="GOA:Q21CH5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CH5"
FT                   /protein_id="ABD85911.1"
FT                   /translation="MTDRLLVLVRHGQSEWNLKNLFTGWKDPGLTEKGVAEAIEAGKKL
FT                   KAQGLVFDVAFTSVLTRAQTTLDLMLNELGQTGLPTSKNLALNERDYGDLSGLNKDDAR
FT                   KKWGEEQVHVWRRSYDVPPPGGESLKDTLARALPYYVQEILPCVLRGERTLVAAHGNSL
FT                   RALIMVLEKLTPESILKRELGTGAPVIYRLNADSTVASKLDLAE"
FT   gene            complement(357889..358821)
FT                   /locus_tag="RPC_0337"
FT   CDS_pept        complement(357889..358821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0337"
FT                   /product="DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase / Transcriptional regulator Ada /
FT                   transcriptional regulator, AraC family"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85912"
FT                   /db_xref="GOA:Q21CH4"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CH4"
FT                   /protein_id="ABD85912.1"
FT                   /translation="MAAGIVPAYITTMMNLAVTDHRLAKPGPQDSALRDYDSVRRAIGF
FT                   ISERWRAQPAIESIADAAGVTPDELHLLFRRWAGLTPKAFMQALTLDHAKSLLRDSASV
FT                   LDAALDSGLSGPGRLHDLFVTHEAMSPGEWKSGGTGMTLRYGFHPSPFGTAVVIESARG
FT                   LAGLAFADPGEELTALADMQRRWPRASYVEDAAGTAALAQRIFDTRQWRADQPLRVVLI
FT                   GTDFEVRVWETLLKIPMGRAVSYSDIAGCISLPKASRAVGAAVGKNPVSFVVPCHRALG
FT                   KSGALTGYHWGLTRKRAMLGWEAGQVGME"
FT   gene            complement(358856..359356)
FT                   /locus_tag="RPC_0338"
FT   CDS_pept        complement(358856..359356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85913"
FT                   /db_xref="GOA:Q21CH3"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CH3"
FT                   /protein_id="ABD85913.1"
FT                   /translation="MTSLSEPTTQLFSAMLTPHRSLSKTGFWALMVFLSTVSFAAGLAF
FT                   WLLGAWPVMGFFGLDVLAVYGAFKINFRHARASEEISVTPSELRVRRVSHRGDVVEWVL
FT                   NPLWVRLEQIIDPEFGVEKLYLVSRGRRLGVASFLGPAEKASFAKALSGALEAARRGLL
FT                   HNP"
FT   sig_peptide     complement(359234..359356)
FT                   /locus_tag="RPC_0338"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.987 at
FT                   residue 41"
FT   gene            359419..360189
FT                   /locus_tag="RPC_0339"
FT   CDS_pept        359419..360189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0339"
FT                   /product="endonuclease III / DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85914"
FT                   /db_xref="GOA:Q21CH2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CH2"
FT                   /protein_id="ABD85914.1"
FT                   /translation="MAKTLKSLPAKPAASSNPVAKAAIRGIKPAVAGKAATPAAKAKSK
FT                   PWTAAEVREAFGRFAKANPEPKGELEHLNPFTLLVAVVLSAQATDAGVNKATRALFAVA
FT                   DTPQKMLDLGEDAVRDSIKTIGLYRNKAKNVIALSQKLISEFGGEVPRSRAELETLPGA
FT                   GRKTANVVLNMAFGERTMAVDTHVFRVANRTGLASGDTPLAVELGLEKVIPTEFMLHAH
FT                   HWLILHGRYTCLARKPRCEVCLINDLCRWPEKTV"
FT   gene            complement(360209..361006)
FT                   /locus_tag="RPC_0340"
FT   CDS_pept        complement(360209..361006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0340"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85915"
FT                   /db_xref="GOA:Q21CH1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CH1"
FT                   /protein_id="ABD85915.1"
FT                   /translation="MSGRPIDLTIALPSSIEVGTGAEQRRIAVRARAGTSPGVFWLGGF
FT                   HSDMTGTKAVALDGFAAETGRACVRFDYSGHGESGGAFIDGSISRWLEESVAVFDEFCE
FT                   GPQIVVGSSMGGWLALLLARRLARRTTPARGRIAALVLIAPAADFTEALMWDGFSPQIR
FT                   KQIETTGTWLRPSDYGEPYPITRKLIEDGRKHLVLGGSIELGCPVRILQGRQDPDVPWR
FT                   HAFTLAERLPCDDVVLTMIPDGDHRLSRPQDIARIIATVKEFG"
FT   gene            361514..361912
FT                   /locus_tag="RPC_0341"
FT   CDS_pept        361514..361912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0341"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85916"
FT                   /db_xref="GOA:Q21CH0"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CH0"
FT                   /protein_id="ABD85916.1"
FT                   /translation="MAAEAGMDLVEISPNTNPPVCKIMDYGKFKYSAQKKAAEARKKQK
FT                   IVEIKEIKLRPMIDDHDYEVKMRAMQRFFEEGDKVKITLRYRGREMAHQEIGTKLLDKV
FT                   KNDVAEYAKVEQDARFEGRQVVMVLAPR"
FT   gene            362242..365037
FT                   /locus_tag="RPC_0342"
FT   CDS_pept        362242..365037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0342"
FT                   /product="UTP-GlnB (protein PII) uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85917"
FT                   /db_xref="GOA:Q21CG9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG9"
FT                   /protein_id="ABD85917.1"
FT                   /translation="MDTTIAPAETATDDRFETARITGEIDALAATHAGRDDVFRVAMAQ
FT                   LLKAEFIKARQVTQALLLQDRHGRHCAERLCFIQDEIIRILYAAATKHLYNSPNHSSGE
FT                   RMAVIATGGYGRGLMAPESDIDLLFILPYKQTAWGEQVAEAILYCLWDMGLKVGHATRS
FT                   VDESIRQARADMTIRTAILETRYLTGDEILYAELVERFDKEVVEGTASEFVTAKLAERE
FT                   ERHRRSGQSRYLVEPNVKDGKGGLRDLHTLFWIAKYVYRVRESSQLVARGVFDAQEYRI
FT                   FKRCEDFLWSVRCNIHFVAGRAEERLSFDMQREIAIRLGYTSHPGLQDVERFMKHYFLI
FT                   AKDVGDLTAILCAKLEDQEAKPAPALTRMMARLRPNTKRRRVPGSDDFVIDNNRINLAA
FT                   PDVFKQDPVNLIRVFRLAQKNNLAFHPDAMRTVTRSLRLLNAQLRENPEANRLFMEILT
FT                   SDNAEIVLRRMNETGVLGHFIRAFGKIVAMMQFNMYHHYTVDEHLLRCVGFLQEIERGG
FT                   NDEFTVASDLMRKIRPEHRAVIYISVLLHDIAKGQPEDHSVAGARIARRLAPRLGFNAA
FT                   DTELIAWLIEKHLVMSSVAQSRDLSDRKTIENFAAVVESVEQMKLLTILTTADIRGVGP
FT                   GVWNGWKAQLIRTLYYETEPVLTGGFSEVNRAERIRAAQAEFRANFTEWPEAELNAYIS
FT                   RHYPAYWLKVELARKIRHARFLRASEQAGHKLAINVGFDEARGVTELTILAVDHPWLLS
FT                   IIAGACASAGANIVDAQIYTTTDGRALDTIAITREYDRDDDEGRRATRIGEMIEDILEG
FT                   KLRLPEVVARRASGKGKLKPFTVEPEVAINNQWSERYTVIEVSGLDRPGLLYQLTTSIS
FT                   KLNLNIASAHVATFGERARDVFYVTDLLGAQITAPTRQAAIKRALIHLLANGDVEQKQA
FT                   S"
FT   gene            complement(365217..365465)
FT                   /locus_tag="RPC_0343"
FT   CDS_pept        complement(365217..365465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85918"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG8"
FT                   /protein_id="ABD85918.1"
FT                   /translation="MTRPRKSIAEIEALLLEDVRAQRHCDKVAHVEIRLCEPDDDSNGA
FT                   NWTVAVVDNGQCSREFAGAAVMVAMDRLQREVDAIAE"
FT   gene            complement(365462..366265)
FT                   /locus_tag="RPC_0344"
FT   CDS_pept        complement(365462..366265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0344"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85919"
FT                   /db_xref="GOA:Q21CG7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG7"
FT                   /protein_id="ABD85919.1"
FT                   /translation="MSKNDTVLVERNGPVLIVSINRPQSRNAVDPATAQKLFDTFLAFD
FT                   ADDTASVAVLTGCGGHFCAGADLKAVADGDLHNPGAIGGHGTLAPMGPSRLRLSKPVIA
FT                   AVEGYAVAGGLELALWADMRVVADDATFGVFCRRFGVPLIDLGTIRLPRLIGQSHAMDL
FT                   ILTGRPMSGIEAHRVGLANRLVRRGEAATQAIAIAREIAHFPQACLRADRASALGQWDM
FT                   PEEDAIAAELRGGLAVIASGETADGAARFAAGFGRHGVFGAEAGE"
FT   gene            complement(366314..367231)
FT                   /locus_tag="RPC_0345"
FT   CDS_pept        complement(366314..367231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0345"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85920"
FT                   /db_xref="GOA:Q21CG6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG6"
FT                   /protein_id="ABD85920.1"
FT                   /translation="MSTMLSSDLPLPKIGRGKVRDIYDAGDDRLLLVTTDRISAFDVVM
FT                   TETIPFKGAVLTQLSAWWFGQLGGVVPHHMISADIDAIIEALPQLGAQRAALAGRTMLC
FT                   RRTTVFPIECVIRGYLTGSAWKEYAASGTLAGEQLPAGLLESAKLEPWIFSPATKAETG
FT                   HDENITVARMAELIGEEASYTLESMSRAVYTQGEAIAREQGIIIADTKFEFGRDAEGRI
FT                   ILIDEVMTPDSSRFWAAADYQPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPPALPDS
FT                   VLQATSLRYRDAFRRLTGAELAID"
FT   gene            complement(367280..368197)
FT                   /locus_tag="RPC_0346"
FT   CDS_pept        complement(367280..368197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0346"
FT                   /product="Pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85921"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG5"
FT                   /protein_id="ABD85921.1"
FT                   /translation="MSWMPDNDPVLGDPASCDALSLVIVPRTRDLGDGFLVRRALPHGK
FT                   RQMVGPFIFFDHFGPVQFIAGKGMDVRPHPHIGLATVTYLFDGRIRHRDSEGNVQDIEP
FT                   GAMNLMTAGRGIAHSERTPDVERRDGQNMLGLQSWIALPQGAEQIAPSFQHYAAANLPT
FT                   YSDRGISARLIAGRGFGLQSPVAMLSPWFYAEVSLAAGVSAPLDPDHEERAIYLVEGEV
FT                   EIAQERFEAPRLLIFRPGDRITVRAVLPTRMMFLGGDALEGPRYIWWNFVSSSKERIEQ
FT                   AKQDWKTGRFAAVPDETEFIPLPE"
FT   gene            complement(368532..369380)
FT                   /locus_tag="RPC_0347"
FT   CDS_pept        complement(368532..369380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0347"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85922"
FT                   /db_xref="GOA:Q21CG4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG4"
FT                   /protein_id="ABD85922.1"
FT                   /translation="MQGLMQGKRGLIMGVANDHSIAWGIAKALAAQGAELAFTYQGDAL
FT                   GKRVKPLAQSLNAELVLPCDVENIDSVDALFAAVGEKWGGLDFLVHAIGFSDKNELKGR
FT                   YADTTRENFSRTMVISCFSFTELVKRAALLMPQGGSIVTLTYGGSTRVMPNYNVMGVAK
FT                   AALEASVRYLASDFGPQGVRVNAISAGPIRTLAGSGIADARQMFNYQQRHAPLRRTVTI
FT                   DEVGGSALYLLSELSTGVTGEIHFVDSGYNIISMPQPDALKTVDEAETAAEKSRAALAA
FT                   K"
FT   gene            complement(369560..370786)
FT                   /locus_tag="RPC_0348"
FT   CDS_pept        complement(369560..370786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0348"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85923"
FT                   /db_xref="GOA:Q21CG3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG3"
FT                   /protein_id="ABD85923.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLASLHEAKPGITRADKFAELGFR
FT                   SQVQGAPTLNPADTVDRRAMRFLGEGAAWNHVAMEQAIQDSGLEQDDISNIRTGIIMGS
FT                   GGPSARTIVEAADITRSKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYEMIQWNKQDVVFAGGCEELDWSLSVLFDAMGAMSSKYNATPSTASRPYDV
FT                   SRDGFVIAGGAGVIVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKM
FT                   ALATTNGIKIDYINPHATSTPAGDPPEMQALRAVFGTGEACPPISATKALTGHSLGATG
FT                   VQEAIYSLLMMQNGFICESANITELDPVFADMPIVRKRIDNAKVGTVLSNSFGFGGTNA
FT                   TLVFKRMDA"
FT   gene            complement(370963..371493)
FT                   /locus_tag="RPC_0349"
FT   CDS_pept        complement(370963..371493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0349"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85924"
FT                   /db_xref="GOA:Q21CG2"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CG2"
FT                   /protein_id="ABD85924.1"
FT                   /translation="MRDRRASYEYEDLLACGRGELFGPGNAQLPLPPMLMFDRIAEISE
FT                   TGGEHGKGLIRAELEVKPDLWFFGCHFKGDPVMPGCLGLDAMWQLVGFFLGWSGGIGPG
FT                   RALGLGELKFSGQVQPNIKKVVYTIDIKRVMRSKLWLGIADGTLAADGEIFYRAKDLKV
FT                   GLFKQTAAAQPAE"
FT   gene            371823..372317
FT                   /locus_tag="RPC_0350"
FT   CDS_pept        371823..372317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0350"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85925"
FT                   /db_xref="GOA:Q21CG1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG1"
FT                   /protein_id="ABD85925.1"
FT                   /translation="MRDSSESTGFFRAETAAEDTPHQHAQLTGCPWHDVNEMLQSVGLR
FT                   PTRQRMALGWLLFGKGARHLTAEMLYEEATHAKVPVSLATVYNTLNQLTDAGLLRQVSV
FT                   DGTKTYFDTNVTQHHHFYLENNHELIDIPVTHVSLQNMPTVPAGYEISRVDMVVRLRKI
FT                   G"
FT   gene            complement(372335..372694)
FT                   /locus_tag="RPC_0351"
FT   CDS_pept        complement(372335..372694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85926"
FT                   /db_xref="GOA:Q21CG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CG0"
FT                   /protein_id="ABD85926.1"
FT                   /translation="MVLAWPAIGVAAMCLFGWFMSRWIDRTYPRKSATSAAVTNGTSPS
FT                   AGPFKGNAMQTATVVGVMPAADPNRGPEPAEGLDQLRERLARLQADSTRNGLDIKRIEV
FT                   LIEEKNPADQSLPSP"
FT   gene            complement(372699..372947)
FT                   /locus_tag="RPC_0352"
FT   CDS_pept        complement(372699..372947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85927"
FT                   /db_xref="GOA:Q21CF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF9"
FT                   /protein_id="ABD85927.1"
FT                   /translation="MPGQARSESVKLIASWFNTVSAAVITVGVFTPLAVTIYGIGDPPR
FT                   NSNLLDGLPIICIGGSWLLHWSGQWFLRKLDDPDDAQ"
FT   gene            complement(372957..373484)
FT                   /locus_tag="RPC_0353"
FT   CDS_pept        complement(372957..373484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0353"
FT                   /product="protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85928"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF8"
FT                   /protein_id="ABD85928.1"
FT                   /translation="MAVKRFVVSLVVASAVLGAAATVGHAAKDGPISASGLPIPRYVSL
FT                   KSDHVNVRAGPTKDNDVAWVYTRSGLPVEITAEYENWRRVRDSEGAEGWVYHSLLSGRR
FT                   TAVVTMKSKDELAPLYDSASVTSPVAARLQAGVLTQVKRCAQGWCRVIGNGFDGWIQQE
FT                   RLWGVYADEKVD"
FT   sig_peptide     complement(373404..373484)
FT                   /locus_tag="RPC_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.853 at
FT                   residue 27"
FT   gene            373978..374979
FT                   /locus_tag="RPC_0354"
FT   CDS_pept        373978..374979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0354"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85929"
FT                   /db_xref="GOA:Q21CF7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF7"
FT                   /protein_id="ABD85929.1"
FT                   /translation="MSVKKKPLVVVTRKLPDSIETRMRELFDARLNLDDEPMSPEALAE
FT                   AVRTADILVPTVTDEITEEILQQPDSRLKLIANFGNGIDNINVAAAHARGITVTNTPKV
FT                   LTEDTADMTMALILAVPRRLIEGASLLTEGRDWPGWSPTWMLGRRLGGKRLGIIGMGRI
FT                   GQAVARRARTFGLQIHYHNRRPVAPKIADELSATYWESLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLIRKDAYVVNTARGEVIDEETLTRLIESGDIAGAGLDVFENEPAVNPKL
FT                   VRLAKHGKVVLMPHMGSATIEGRVEMGEKVIINIRTFLDNHKPPDRVLPHML"
FT   gene            complement(375226..376065)
FT                   /locus_tag="RPC_0355"
FT   CDS_pept        complement(375226..376065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0355"
FT                   /product="protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85930"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF6"
FT                   /protein_id="ABD85930.1"
FT                   /translation="MICFCAERFQWRRIWQNPGEFSLSGSAEMAFRALLYRRPAEPQSI
FT                   AVKFGSQIFAIRLRRHRRARRYTLRIHPSDREAILTMPPRGTLVDAKEFAQRHGAWIAA
FT                   RLGRLPKAAPFHPGTLVPLRGSDHKIVHRAGVRGTVWAETRESGERILCVAGEPEHIDR
FT                   RVHDFLKREARRDLSKAAQHYAELFGVKVTRISIRDQSSRWGSCTSAGSLSFSWRLILA
FT                   PPYVLDYLAAHEVGHLVEMNHSAKFWRVVGKVCPQMDRAKKWLDGYGNDLHRYGITD"
FT   gene            complement(376322..377650)
FT                   /locus_tag="RPC_0356"
FT   CDS_pept        complement(376322..377650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0356"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85931"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF5"
FT                   /protein_id="ABD85931.1"
FT                   /translation="MPNVIGEFGRPPELPAEVSPAMTTPMYWFYELAHASLNPARAFGD
FT                   VTKIMFQNPLNPWTHTELGKSIAAACEVFERTTRRYAKPEWGLDSTEVLGVRTPIEIES
FT                   VWEKPFCRLLYFNRLHERPLRHAQPRVLIVAPMSGHYATLLRGTVEAFLPTHDVYITDW
FT                   SDARMVPLTDGRFDLDDYVDYVIEMLQHLGGNVHVIAVCQPSVPVLAAVSVMEAASDPF
FT                   VPLSMTLMGGPIDTRSNPTAVNNLAAERGIDWFRNHVITKVPFPHPGFMRDVYPGFLQL
FT                   NGFISMNLDRHMDAHKNLFNHLVQGDGDLADKHRDFYDEYLAVMDLTAEYYLQTVDVVF
FT                   VKHSLPKGEMMHRGARVDPSKIRRTALMTVEGENDDISGIGQTEATHRLCTSIPDERRV
FT                   HYVQKGVGHYGVFNGSRFRSEIVPRISDFMVSAANAKPANAAE"
FT   gene            complement(377763..378578)
FT                   /locus_tag="RPC_0357"
FT   CDS_pept        complement(377763..378578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0357"
FT                   /product="ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85932"
FT                   /db_xref="GOA:Q21CF4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF4"
FT                   /protein_id="ABD85932.1"
FT                   /translation="MSAVVHRGIAAHRIGAMILRYWYLLLSSWPRLLELVYWPALQIIT
FT                   WGFLQNYISQNAGFFAQAGGTLIGAVVLWDILFRGQLGFSISFLEEMWARNLGNLMMSP
FT                   LKPVEFLIALMIMSLIRLAIGIGPMLALATWLFDFNLFGFGLPLVAFFCNLIFTGWSLG
FT                   IFVSGLVLRNGLGAESIVWTVMFGLMPLACVYYPVTVLPHWLQYVAWTLPPTYVFEGMR
FT                   ALLIEHVFRPDLMISALLINAVLFAASFMSFIWLLNSARRHGSLIQGGE"
FT   gene            complement(378575..379387)
FT                   /locus_tag="RPC_0358"
FT   CDS_pept        complement(378575..379387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0358"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85933"
FT                   /db_xref="GOA:Q21CF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF3"
FT                   /protein_id="ABD85933.1"
FT                   /translation="MTRTESASPPGTPAPDPDHAAAIEVAHLVKIYKATRAVDDVSFDI
FT                   ARGSITGLLGGNGAGKTTTIAMIMGLVLPTSGTVRVLGYAMPEQSEDVLGRMNFESPYV
FT                   DMPMRLTVRQNLTVFGKLYAVPDLRERIAQLADDLDLNEFLDRPNGKLSAGQKTRVALA
FT                   KALINRPDLLLLDEPTASLDPDTADWVRQRLETYRQQHRATILLASHNMLEVERLCDRV
FT                   IIMKRGRIEDDDSPDNIMQRYNRATLEEVFLDVARGRVQDGALQDEAS"
FT   gene            379701..381023
FT                   /locus_tag="RPC_0359"
FT   CDS_pept        379701..381023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0359"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85934"
FT                   /db_xref="GOA:Q21CF2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF2"
FT                   /protein_id="ABD85934.1"
FT                   /translation="MTDTEVSDFRHPRRHVRLDTILRLRWLAALGQLAAVFVVAHGLEF
FT                   ELPVVPCLGIIALSALVNLALQIAFNPMQRLEPLHAAALLALNIAELAGLLFLTGGLQN
FT                   PFSFLFLGPVLIAATALPTRMTITLGIFAASCAGALLFYHLPLPWDPEDPVVLPQIYLI
FT                   GVWLSILLALGVTSLYTFQVTEEARKLSDALSATELVLTREQHLTQLDGLAAAAAHELG
FT                   TPLSTIFLIAREVERSVPADSPLAADLRTLREQAQRCREILAKITQLSSSGAPFDRMPL
FT                   STLIEEAVAPHRDFGIEIRVRIAVAGVSEPVVMRNPAILYGVGNILENAVDFARTAVEV
FT                   NAWWNAETVQIVISDDGPGIAPDMLRRIGEPYLSRRRAAETSGGHGGLGLGVFIARTLL
FT                   ERTGAKVSFGNKTFPDHGAVVQIVWPRADFETVQTATATEA"
FT   gene            381106..381693
FT                   /locus_tag="RPC_0360"
FT   CDS_pept        381106..381693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0360"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85935"
FT                   /db_xref="GOA:Q21CF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CF1"
FT                   /protein_id="ABD85935.1"
FT                   /translation="MLSGRPGDARTVNAIPELSDYADRSLLIVEDDKPFLERLSRAMET
FT                   RGFTVTACDNVADGLLQIGKAAPAFAVVDLRLGDGNGLDVVAALKQQRPDARAIVLTGY
FT                   GNIATAVTAVKMGAVDYLSKPADADDVVAALLASGSEKSELPNNPMSADRVRWEHIQRI
FT                   YEMCNRNVSETARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(382237..384435)
FT                   /locus_tag="RPC_0361"
FT   CDS_pept        complement(382237..384435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0361"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85936"
FT                   /db_xref="GOA:Q21CF0"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CF0"
FT                   /protein_id="ABD85936.1"
FT                   /translation="MDAKTDDKAGKCPVAHGPAPRGNRDWWPEQLNLSMLHQRSPSADP
FT                   LGKDFHYAEQFKTLDLKALKQDLTALMTESQDWWPADFGHYGGLFIRMAWHSAGTYRTT
FT                   DGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGQKISWADLYVLAGNVALES
FT                   MGFQTFGFAGGRADTWEPEELFWGPEGTWLGDERYSGERQLADPLGAVQMGLIYVNPEG
FT                   PNGNPDPLGSAKDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPSLLGPEPEGGDV
FT                   EDQGLGWKSKYGTGFGADAITGGPEVIWSQEPTKWSNHFFDNLFKFEWELTKSPAGAQQ
FT                   WVAKNAEPSVPDPFDPSKKRLPTMLTSDLALRFDPIYEKISRRFYENPDEFADAFARAW
FT                   FKLTHRDMGPVARYLGPEVPKETLLWQDPIPPVDHELINDADVEALKAKILGSGLSVAD
FT                   LVSTAWNSASTFRGSDKRGGANGARIRLAPQKDWEVNQPEQLATVLQKLEAIGKEFGKK
FT                   VSLADLIVLGGVAAIEKAAKDAGVAVKVPFSPGRMDASQEQTDAPSFAPLEPRADGFRN
FT                   YINSKKHQFMKPEEALVDRAQLLTLTAPEMTVLVGGLRVLGANAGDSKHGVFTTKPGTL
FT                   SNDFFVNLLTMATSWQPSGTEGIYEGRDRKSGEVKWTATRVDLIFGSHSQLRALAEVYA
FT                   QADSKEKFVNDFVAAWTKVMNADRFDLIAEPVLLEAAE"
FT   gene            384795..385697
FT                   /locus_tag="RPC_0362"
FT   CDS_pept        384795..385697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0362"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85937"
FT                   /db_xref="GOA:Q21CE9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE9"
FT                   /protein_id="ABD85937.1"
FT                   /translation="MVTLRQLRYLSALAKHGHFGRAAEACSVTQPALSMQIGDLERRLG
FT                   VKVVERRPGEVLLTDAGREIARRGDEVLTASRDLVDFARHRGKPLTGRLTLGVIPSLAP
FT                   YLLPKILPALQRGYPELRLELRESQTRSLVGDIKSGVLDAALLALPLEDSELDALPLFE
FT                   DLFLLAVPADDPRPDTARIGARDIDQSRLILLEDGHCLRDQALAFCATARRGRQQSSAG
FT                   MTFGASSLSTVMQMVANGYGITLIPQIAAEVERRDSRVRLLRLKDPQPGRSIGLVFRAT
FT                   SPRKADFTALGEVVKESVG"
FT   gene            385865..388513
FT                   /locus_tag="RPC_0363"
FT   CDS_pept        385865..388513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0363"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85938"
FT                   /db_xref="GOA:Q21CE8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CE8"
FT                   /protein_id="ABD85938.1"
FT                   /translation="MMEQYHEIKAANPGLLLFYRMGDFYELFFEDAEIAARALGITLTK
FT                   RGKHKGQDIPMCGVPVERSDDYLHRLIALGHRVAVCEQTEDPAAARARKSVVRRDVVRL
FT                   ITPGTLTEDTLLDARANNYLLAIARARASAGADRIGLAWIDISTAEFIVTECAPAELAA
FT                   TLARINPNEAIVTDALYSDPELGPLLRELPAVTPLTRDVFDSATAERRLCDYFAVATMD
FT                   GLSAMSRLEATAAAACVTYIDRTQLGKKPPLSPPSREATGSTMAIDPATRANLELTRTL
FT                   SGERRGSLLDAIDCTVTAAGSRLLAQRLAAPLTDVEQIAQRLDAVAALLPDPGLREALR
FT                   ATLRAAPDMSRALARLSVGRGGPRDLAALRDGLLAADQALAQLGALEVPPKEIQTAMAA
FT                   LRRPSRDLAQEFSRALADDLPLMKRDGGFVREGYHDALDETRKLRDDSRLIVAAMQARY
FT                   ADDCGVKGLKIRHNNVLGYFVEVTAQHGDKLMAPPLNLTFIHRQTLAGQTRFTTAELGE
FT                   IEAKIANAGDRALGLELEIFERLVALVQAATDDLRAAAHGFAALDVTLALAKLAVDDNY
FT                   VRPEVDGSLSFAIEGGRHPVVEQALRRDGQPFIANACDLSPGPGQQSGQIWLITGPNMA
FT                   GKSTFLRQNALIALLAQIGSFVPASRARIGIVDRLFSRVGAADDLARGRSTFMVEMVET
FT                   AVILNQASERALVILDEIGRGTATFDGLSIAWAAIEHLHESNRCRSLFATHYHELTALS
FT                   AKLPRLFNATVRVKEWHGDVVFLHEVLPGSADRSYGIQVAKLAGLPPSVITRAKSVLAK
FT                   LEAQDRGQSARALAEDLPLFAVTARAAAEPSPPSEAERLIEALKALHPDELSPREALDA
FT                   LYALKAKLGKA"
FT   gene            complement(388772..389572)
FT                   /locus_tag="RPC_0364"
FT   CDS_pept        complement(388772..389572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0364"
FT                   /product="UBA/THIF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85939"
FT                   /db_xref="GOA:Q21CE7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE7"
FT                   /protein_id="ABD85939.1"
FT                   /translation="MLSGDELERYARHIVLREVGGPGQAKLQAASVLVIGAGGLGAPSL
FT                   MYLAAAGVGTLGVVDDDTVSLSNLQRQIIHATPDIGRSKVDSAEDRITALNPHVRFVRH
FT                   PMRIDADNAMQLIGSYDMVLDGSDNFATRYLVSDACYLARKPLITGALGVFDGSLTTIR
FT                   AHEKNADGELNPTYRCLFPEAPPPGTVPSCQEAGVLGALAGVLGSMMALEAIREIVGFG
FT                   EGLVGRLLMIDARAMRFETLRYNRDPANPLNGDRPSILDLSAHA"
FT   gene            389665..391035
FT                   /locus_tag="RPC_0365"
FT   CDS_pept        389665..391035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0365"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85940"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE6"
FT                   /protein_id="ABD85940.1"
FT                   /translation="MRTMLAATLMMVFAAGSATAQMSPPATAGGKPKPVATVAIRPALQ
FT                   TPANTANAMAQAERTAIQSDLAWAGHYNGAINGEGSERMVAAIKAFQTDRGGKPTGVLN
FT                   PQERGTLAEVAKKAKDNVGWKLVSDSVTGARLGLPLKLVPQQTSDANGAKWSSSTGTIQ
FT                   VLLSRRKEAEPSTAKLAAQEKTEPAGRKVEYSAVKPDFFVLSGLQGLKKFYVRGAFKDA
FT                   EVRILTILYDQATEGTMEPVVIAMSSAFTPFPAGVQAAGPPPRKSVEYSTGVVVSADGA
FT                   ILADRQAVDGCQAIVVAGLGRAEKVAEDKAHDLALLRVYGAQGLAPLGLGGGAAKPSVE
FT                   LIGIADPQSQGGGSAASSVRAQIAPVAAGRDLALTPAPGLGFSGAAAVDAEGRFAGLAL
FT                   LKPVLFAGPANGAAPAQAMLVPAETVRGFLKDNAVATTAASAGDAKASVLRLICVRK"
FT   sig_peptide     389665..389727
FT                   /locus_tag="RPC_0365"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.697 at
FT                   residue 21"
FT   gene            391234..393090
FT                   /locus_tag="RPC_0366"
FT   CDS_pept        391234..393090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0366"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85941"
FT                   /db_xref="GOA:Q21CE5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE5"
FT                   /protein_id="ABD85941.1"
FT                   /translation="MDDASKRPPIPVAPDDNPASTDATKIDKLLRQQAAIARFGTFSLR
FT                   EWDLSKILNEAVRVCAEGLDAPFSKVCRHRPEQNDLLIVAGYGWQDGVVGHVVSRADMS
FT                   SPQGRAFSTGTPAVCDDLKKDRYFDPPAFYAAHGIVSTIDVVIRGSGDQPYGILEIDNN
FT                   QQQDYDQYDVNFLTGFANVLAEAVATASRARELQDAFDRMKRLAEDKERLLQEKNAVDL
FT                   QMRQAQKMEAVGQLTGGLAHDLNNILTVISGTIEILAAAVADRPQLAAIAKMIDEAAVR
FT                   GAELTQRLLAFARKQPLHPRAIDVNALIVEATNLLRPTLGDHITLVTTLAGELSRALID
FT                   PGQLTNTILNLALNARDSMPEGGEVSITTRDIVLDASAAAANELDAGSYVLVAVGDSGH
FT                   GIPADILPRVFEPFFTTKDVGKGSGLGLSMVYGFVKQSNGHVVIESVPDHGTTVTMLLP
FT                   QATGVAQPQLELVSQPKIQGGTETILVVEDDDLVRRYVIGQIESLGYATLTAANAAEAL
FT                   VVIDSAQPIDLLFTDMTMPGALNGRQLAVEARRRRPALSVLFSSGFTEESVVHDGHIDA
FT                   EMLFLAKPYRKADLARMIRVALTGTAQPQAVAQPGAPIPAVA"
FT   gene            complement(393337..394704)
FT                   /locus_tag="RPC_0367"
FT   CDS_pept        complement(393337..394704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0367"
FT                   /product="MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85942"
FT                   /db_xref="GOA:Q21CE4"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE4"
FT                   /protein_id="ABD85942.1"
FT                   /translation="MTDETATLAGYVAGLAFADIPPEVRTRAKSLTLDFLGSTIRARRD
FT                   AESTPAILQTLRALSLDGAGQSTVFGDDRGWTPAVAALLNGALGHSLDFDDTHADSSLH
FT                   PSAPVVPAAFAVGELVGASGAEVLTAIIAGYEVCCRLGNALDPTSHYARGFHPTATAGT
FT                   FGAAAAAAKLFKLSQHQIVAAFGVAGSQAAGSLQFLVNGAWNKRYQVGAAAMNGVIAAT
FT                   LARNGFLGATQSIEGKHGLLVGYSDDAHPDQAVAGLGSVYETMKIGVKPYPSCRYTHAA
FT                   IDALIAMRREHNLAPDQITRVAIGLHRNGITLTGDAATKRHPRSIVAGQFSMYFTGAVA
FT                   LEKGRFGWDDYARLGDPSIDALAEKFDVVQDVRLEGRSHPFGAHVSISTEDGVRERLIP
FT                   DPSGEPAAFPSAGAMQQKFLQLARPVLNGGAETFADAMLALERFDRVADVAALGRG"
FT   sig_peptide     complement(394648..394704)
FT                   /locus_tag="RPC_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.703) with cleavage site probability 0.703 at
FT                   residue 19"
FT   gene            394870..396006
FT                   /locus_tag="RPC_0368"
FT   CDS_pept        394870..396006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85943"
FT                   /db_xref="GOA:Q21CE3"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE3"
FT                   /protein_id="ABD85943.1"
FT                   /translation="MSKFGIKIGAQLKPRRLQLGLALRVTLAALLALAFAQAVHLRLPL
FT                   WAVLTSIIVTQLSVGRSLKVAIDYLIGTIGGAAYGGAVTIFVPHHSEWELLAVLAVIVA
FT                   PLALIAAIKPRFNVALVTAIIVLLVPTMTQVNPLDSTIDRVLEVGVGAITGLVVSFFVL
FT                   PSRALGLATNAAARALELMAVALRELLAGLTGGLDTDALHRLQDGIGESLVKLGEIAVE
FT                   AESERSAGLSNGPDTAPLLRTLLRLRHDLVMVGRAAGGPLPEPLQARLGGVLEHFSEAA
FT                   TGYLSASAMALRGRGDPPSLQPLQAALAAYDAEVDKVRKDGLTRQLTGDRIEQFFALGF
FT                   ALDQLQQNFQDLEMRVTERAKPGDTVTGTKQAGDEGEG"
FT   sig_peptide     394870..394980
FT                   /locus_tag="RPC_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.716 at
FT                   residue 37"
FT   gene            complement(396208..396678)
FT                   /locus_tag="RPC_0369"
FT   CDS_pept        complement(396208..396678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85944"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE2"
FT                   /protein_id="ABD85944.1"
FT                   /translation="MTVVAVRPEVDAGAVLPGAQFIDAFAVTVPGPIDARQAAERMMTR
FT                   SPPWVTALMTLRDAVVKPFGLKTADSARQATIDRVGMFPVLSETPQRLIAGFDDSHLDF
FT                   RVVVDVADTEPDAGVRVTATTLVLTHNLLGRTYLATITPFHRLVVRAMLRQA"
FT   gene            complement(396702..397163)
FT                   /locus_tag="RPC_0370"
FT   CDS_pept        complement(396702..397163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85945"
FT                   /db_xref="GOA:Q21CE1"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE1"
FT                   /protein_id="ABD85945.1"
FT                   /translation="MYDVLKALHVLGVVLLVGNVTITAYWKVLADRTADPKIVAHAQHG
FT                   VNAADWIFTLAGIALVMIGGYGAAYVKGLPLFDSVWLLGGQILFAVSGMMWLGILVPLQ
FT                   IRQGRAARGFASLDRIPLSYLRDAQKWLVWGILATVPLVAATVLMVLKP"
FT   gene            397551..398735
FT                   /locus_tag="RPC_0371"
FT   CDS_pept        397551..398735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0371"
FT                   /product="Esterase, PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85946"
FT                   /db_xref="GOA:Q21CE0"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CE0"
FT                   /protein_id="ABD85946.1"
FT                   /translation="MSLSKNIEFLRQLRNLNGISGLNGDSRATKAAAANSRLTEAADFG
FT                   PNPGRLRMLSYVPSDAVKKPPLVVVLHGCTQTAGGYDVGAGWSTLAKRYGFALLMPEQT
FT                   NANNPNRCFNWFVPEDIRRGGGEAASIRRMIEQMAVAHHIDRDRVFVTGLSAGGAMAAV
FT                   MLATYPETFAAGAVIAGLPFGVAGNVQQALSAMMQSASRPASELGDLVRDASSHRGPWP
FT                   KLSVWHGSADRTVNPSNADELVKQWLDLHQLPSSPMSTAKVDGYPRQVWWNAAGETVVE
FT                   SYTITNMAHGTPLGTGENTESYGAQGAYLLDVGISSSYHIAKFFGLTERVHRPATAAAS
FT                   LPTVPVEQLEEIPRARKARATQDRRAEPRDPPGRRGFDVNAVITRALTAAGLMK"
FT   gene            399090..399506
FT                   /locus_tag="RPC_0372"
FT   CDS_pept        399090..399506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85947"
FT                   /db_xref="GOA:Q21CD9"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD9"
FT                   /protein_id="ABD85947.1"
FT                   /translation="MIRRILGTAAVIIAVATPAMVQAQGVPGGIERGAREGERAAGPIG
FT                   AVVGGTIGGVVGGVAGVLGADQRPRFRSYAVEQRHPSYRYKDEVRVGAVLPGEGVTYYE
FT                   VPQEYGVRNYRYTVVNDRTVLVDPATHRIVDIVE"
FT   sig_peptide     399090..399161
FT                   /locus_tag="RPC_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.953 at
FT                   residue 24"
FT   gene            399808..400071
FT                   /locus_tag="RPC_0373"
FT   CDS_pept        399808..400071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85948"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD8"
FT                   /protein_id="ABD85948.1"
FT                   /translation="MTQPDIWYVAYGPDQAVKSDDRASGMVRSTKTFKSEAEAKQFAME
FT                   IVEKGWSANAGTLNPYQPKQMIGSSQIGKWASTRPVQQRSFR"
FT   gene            complement(400423..401091)
FT                   /locus_tag="RPC_0374"
FT   CDS_pept        complement(400423..401091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0374"
FT                   /product="beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85949"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD7"
FT                   /protein_id="ABD85949.1"
FT                   /translation="MTDASETKAKAGAAIIPVTLFQQNCTLLWCETTRKAVVVDPGGEV
FT                   PQILAAIKQAEVTVEKIWLTHGHIDHVGGAADLRDDLKVPIEGPHRADKYLLNNVVTSG
FT                   EMFGMTGMRDVLPDRWLEEGETVSVGELSFSILHCPGHSPGSVVYFNDQMRFALVGDVL
FT                   FKGSIGRTDLSGGCHATLMESITRKLLPLGDDVSFICGHGPGSTLGHERLSNPFLTGDL
FT                   "
FT   gene            401209..401691
FT                   /locus_tag="RPC_0375"
FT   CDS_pept        401209..401691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0375"
FT                   /product="protein of unknown function DUF1052"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85950"
FT                   /db_xref="GOA:Q21CD6"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD6"
FT                   /protein_id="ABD85950.1"
FT                   /translation="MDPHSAAKLVPPPDRRQSETALLIARGTARLLHALGFSCVGELPL
FT                   PSGRRADLVGLNGRGEIWIVEIKSSLEDLRADSKWPDYRAHCDRLFFAFTQDLPCEIFP
FT                   GDTGLIVADGYGAHLHCEAPEHRLAAPTRKLMTLRFAIAAAQRLQRLHDPQGFAEF"
FT   gene            402179..402493
FT                   /locus_tag="RPC_0376"
FT   CDS_pept        402179..402493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0376"
FT                   /product="Excinuclease ABC, C subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85951"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD5"
FT                   /protein_id="ABD85951.1"
FT                   /translation="MGIFVYMLRCADGSYYVGSATGDDLAPRVAQHDAGSYPGYTSTRR
FT                   PVTLVWSEHFDRITDAIAVERQIKGWSRAKKEALIRGDWGDISRLARRRGRVCSGESTV
FT                   "
FT   gene            complement(403844..404725)
FT                   /locus_tag="RPC_0377"
FT   CDS_pept        complement(403844..404725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0377"
FT                   /product="Formamidopyrimidine-DNA glycosylase /
FT                   DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85952"
FT                   /db_xref="GOA:Q21CD4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CD4"
FT                   /protein_id="ABD85952.1"
FT                   /translation="MPELPEVETVRRGLEPAMAGARIDGFEARRADLRFALQPDLATRL
FT                   IGQTVKGLGRRAKYLLAELSSGDVLLMHLGMSGSFRVLQGEASGAPGAFHHPRNDDRAH
FT                   DHVVFRMSNGAVVVFNDPRRFGYMKILAPGEIADEPFLKGLGPEPLGNSFDAAMLASAC
FT                   AGRKTSLKAALLDQRVVAGLGNIYVCEALFGAHLSPKRLAATLATRTGAPTERAERLVE
FT                   AIRAVLHAAIKAGGSSLRDHRQTSGELGYFQHSFAVYDREGEPCRSKGCDGVVKRFVQN
FT                   GRSTFWCPKCQK"
FT   gene            404811..405623
FT                   /locus_tag="RPC_0378"
FT   CDS_pept        404811..405623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0378"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85953"
FT                   /db_xref="GOA:Q21CD3"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD3"
FT                   /protein_id="ABD85953.1"
FT                   /translation="MRTGSGPGCGRLQENKGMTQPGETTHFGFKDVALDDKQTLVNDVF
FT                   HSVASRYDLMNDLMSGGLHRAWKNVMITTLNPPRSDAPFALLDVAGGTGDISFRAAKAA
FT                   GAGFTATVCDINSDMLSVGRERAIARHLDHQVSFIEGNAEALPFPDKSYDAYTIAFGIR
FT                   NVPRIDQALKEAHRVLKPGSRFLCLEFSTVDVPGLAKIYDLFSFNVIPQIGRAVTGDAE
FT                   SYQYLVESIRKFPKPTVFAEMIRDAGFARVSYQSLSGGIVALHSGWRL"
FT   gene            405620..407188
FT                   /locus_tag="RPC_0379"
FT   CDS_pept        405620..407188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0379"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85954"
FT                   /db_xref="GOA:Q21CD2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD2"
FT                   /protein_id="ABD85954.1"
FT                   /translation="MISALTHAARLLRAGYVFAREGVFGVVDPSLVPPPGQLALRLARL
FT                   IERPGAKSGPRLSRALTRLGPAYLKLGQFLATRPDVVGVAMAHDLESLQDRLPPFSQTE
FT                   AEAVIAASLERPVAQVFVSLSEPVAAASIAQVHRGETDTDGVRKRVAVKVLRPNVAARF
FT                   NRDLGDFFFVAEKAEIYSSEARRLRLVEIINTMSRSVAMEMDLRLEAAAASEMAENTKD
FT                   DPDFRVPQVDWDRTTHNVLTMEWIDGIPLNDHTRLAEANVDVAELGRKVIQSFLRHALR
FT                   DGFFHADMHPGNLFLDPSGRLVAVDFGIMGRLAPKERRFLAEILLGFITRNYRRVAEVH
FT                   FEAGYVPAHHSVENFAQAIRAIGEPIHNRIAEDISMAKLLTLLLEVTGLFDMRTRPELI
FT                   LLQKTMVVVEGVARSFDPKLDIWKVADPVVREWIERNLGPVGKIETALSGAGELSHLLG
FT                   GLPAIAARSVAVLNQLEVMTRNGLVLSPETIAAIGRSERNRTRGRTIALWIIAATFIGV
FT                   LLTLQ"
FT   gene            407272..408699
FT                   /locus_tag="RPC_0380"
FT   CDS_pept        407272..408699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0380"
FT                   /product="Phosphopantothenoylcysteine decarboxylase /
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85955"
FT                   /db_xref="GOA:Q21CD1"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CD1"
FT                   /protein_id="ABD85955.1"
FT                   /translation="MASLTIRKLDEAIKAELRQRAARHGRSMEDEVRTILRDAAQPRHE
FT                   FAASFDEAVSQPVAPAPEPVAATGQPRMTLIVGGGIAAYKSMDLIRRLMERGFTVRCVL
FT                   TKAAQQFVTPLTASALSHQRCYTDLFDPASEFDAGHIRLGRDCALIVVAPATADLMAKM
FT                   ANGHADDLASAILLAANRPILLAPAMNPLMWNNAATRRNVAQLVRDGVHMVGPNAGEMA
FT                   EANEAGTGRMAEPIEIAAAAQAFLRPQQAQPLTGCKLLITAGPTHEPIDPVRYIANRSS
FT                   GKQGFALAAAAATAGAEVTLISGPVDLHDPAGVKVIRVESAREMLEAVDAALPVDVAIF
FT                   AAAVADWRVADQGAQKLKKGSAGVPPLQLVENPDILATISKRAENRPPLVIGFAAETEH
FT                   LLDNARAKLARKGCDWIVANDVTPATGVMGGDRNTIHLLTRAGDAIAIDSWPVMSKDQV
FT                   ATALIARISKAVRTTES"
FT   gene            408696..409154
FT                   /locus_tag="RPC_0381"
FT   CDS_pept        408696..409154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0381"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85956"
FT                   /db_xref="GOA:Q21CD0"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CD0"
FT                   /protein_id="ABD85956.1"
FT                   /translation="MTVAISAAVQQLPHGQGLALPAYQSAHAAGLDLLAAVAPDAPLVL
FT                   APGTYALVPTGLTLALPPGYEAQVRPRSGLAARHGVTVLNAPGTIDADYRGEIGVLLIN
FT                   HGSQPFTVRRGERIAQMVVARVARVDLTVAASLETTERGSGGFGSTGR"
FT   gene            409429..411960
FT                   /locus_tag="RPC_0382"
FT   CDS_pept        409429..411960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0382"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85957"
FT                   /db_xref="GOA:Q21CC9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC9"
FT                   /protein_id="ABD85957.1"
FT                   /translation="MSGVIASMRRTLLSCTAPARSGGAAVALAMWASVSPASAAETPVD
FT                   SALAALFDFSRQDIIALTMAVAVLGFSVVAAILLMRTRLRAAACETRLRGNIQTLQVEA
FT                   DRFRALLFAESQVLIAWAAGDSRPQISGDVSLLIPQAGLAADQSVQSQRILAFGTWMPP
FT                   EPALKMDHAVDALLESGEGFQLNLVTSTGRSIEAVGRAVGGQAIVRMRELSGLRRELAE
FT                   MTQRHKTLQEETEMLRDFAAAAPWPIWTRRDAGELNFANAAYARATEAGSVAEAIERNL
FT                   ELLESNDRTALSRALNDNANFSARLPIVVRGERRIYDVHAMKVRGGSAGAAIDASEAYA
FT                   LGAALVRMAEAHRRTLDQLSSGVAVFDEQHRLAFYNDSYRRLWDLDRAFLDSNPDDSSV
FT                   LDRLRAARKLPEQPNFREWKMRLHEAYRAVDPAKDVWYLPDGRAVSIVTTPNPEGGVTY
FT                   LFDDVTESLELARRFDGLINVQRETLDNLAEAVAVFGSNGCARLFNPPFARMWNLSPEA
FT                   LQLQPHIETVVDWCRPLFDDPAIWQTLRGAITGIENRIAIPLKLERRDGSVLNCMTMPL
FT                   PDGATMLTFQDITDTENVERALRERNEALETADQMKVDFVHHVSYELRSPLTTIIGFAH
FT                   FLSDPSTGPLTEKQEEYLSYITTSTNALLAIINNILDLATIDAGAMTLNLGQVDIRKAI
FT                   ADAIEGIQDRLARDHIVLEVNAAPDVGHFIADERRVVQVLYNLLANAVGFSPQHAAITL
FT                   SAKRTEQTVVFTVTDTGPGIPPDVKEKVFDWFESRSNGSRHRGAGLGLSLVRSFVELHG
FT                   GNVRIDSVVGKGTTLTCSFPIDQSQQRNAAE"
FT   sig_peptide     409429..409548
FT                   /locus_tag="RPC_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 40"
FT   gene            411957..413477
FT                   /locus_tag="RPC_0383"
FT   CDS_pept        411957..413477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0383"
FT                   /product="protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85958"
FT                   /db_xref="GOA:Q21CC8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC8"
FT                   /protein_id="ABD85958.1"
FT                   /translation="MTAPVTFSLALLNESATANLMADLALLIAPGDVITLSGDLGAGKT
FT                   AAARAMIRYLAGDPELEVPSPTFTLVQSYELSPFPLLHADLYRIEDPSELEEIGLSPLP
FT                   EGSVVLIEWPERAPDLLPEDRIDIALTHRPALGTAARAAEITGHGRAAAQVDRLITLLG
FT                   FLDETGYADAHRQRMAGDASTRSYARLLRDDVAVILMNAPRRPDGPAIYHGKSYSAAVH
FT                   LAEDVRPFVAIADGLRARGFSAPAIHHADLEAGFLITEDFGGVSFLAGDPPAPIAERYQ
FT                   SATDMLAALHREPLPDTLPLSAQADYAIPRFDVEAMLIEVGLMPEWYLPHRGAAPTPEL
FT                   RDAFVATWRMLLQAHEAEPATWVLRDFHSPNLIWLEDREGIAKVGVIDFQDTVLGPAAY
FT                   DLVSLLQDTRVDVPESLELALLARYIKARRAADPSFDAVAFAEIYAVMSAQRNTRLLGT
FT                   FARLNRRDGKPQYLHHLPRIWTYLNRSLAHPKLTPLRDWVVAHVPPPA"
FT   gene            413578..413904
FT                   /locus_tag="RPC_0384"
FT   CDS_pept        413578..413904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0384"
FT                   /product="type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85959"
FT                   /db_xref="GOA:Q21CC7"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC7"
FT                   /protein_id="ABD85959.1"
FT                   /translation="MAAAERRKGARVVFERGLDAHMMAIDGTWRRACTVEDVSEIGAKL
FT                   TIEGSVEGLNLKEFFLLLSSTGLAYRRCELTWVNGDQLGVNFLRPNDKKKRAGERGKPQ
FT                   TATT"
FT   gene            414057..414782
FT                   /locus_tag="RPC_0385"
FT   CDS_pept        414057..414782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0385"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85960"
FT                   /db_xref="GOA:Q21CC6"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC6"
FT                   /protein_id="ABD85960.1"
FT                   /translation="MPVKPDRAMILAAGLGLRMRPITDTIPKPLVSVAGKPLLDHVLDR
FT                   LAEAGVAEAVVNVHYLPDQIIDHVAGRKQPRVVISDERDAVLGTGGAVVKALPLLGSAP
FT                   FYHLNADTMWIDGAQSNLARLAATFDPERMDILLLMAATANSIGYTGSGDYAMAPDGTL
FT                   RKRKELEVVPFVYAGVAIMSPQLFADAPRGEFPLTKIFDRASEEGRLFGLRLDGVWMHV
FT                   GTPDAIQTAERAYLASSVA"
FT   gene            415074..418202
FT                   /locus_tag="RPC_0386"
FT   CDS_pept        415074..418202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0386"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit B"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85961"
FT                   /db_xref="GOA:Q21CC5"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC5"
FT                   /protein_id="ABD85961.1"
FT                   /translation="MRVFNTPASAPFLRTLIAALVEGRLVPGFEARANPERLAEATLYL
FT                   PTRRAGRMAREIFLDVLQSDAVLLPRIVALGGIDEDELAFADDAEPFDGVASLEIPPNL
FT                   AELDRRLILARLVAAWGKELAPLVVGGPASALALAGDLARLMDDMVTRKVEWAALDGLV
FT                   PDELDNYWQLTLGFLKIAREHWPAYLAANALIEPAARRDLLIEAEAKRLAAHHTGPVIA
FT                   AGSTGSMPATARFLRAIAALPQGAVVLPGLDTHLDDDAWRKIGGIRDANGKAVTPPSSN
FT                   HPQYALHALLETFGIERRDVAPLGAPAPRGRELLASEAMRPSNATAQWHQRLAEPAVEQ
FT                   NIAAGMTELAVISADNPELEALAIAVAMRQARELNKSAALVTPDRALARRVMAALGRWK
FT                   LPFDDSGGDALIDTPPGVFARLSAQAATAQLEPATLLALLKHPLLRLGQAPGFWRGAIE
FT                   TLEQAVLRGTRPAAGSAGLSRDFARFRDELGKLRRRETSMLHGSEPRARLNDDALDRAQ
FT                   ALIAQLQTALAPLETLDPNRPLDFSDLATKHRAVVAALSRDDDGFVAAFDGPQGNALNT
FT                   AFDDLPAPSGLAAQPGDYTELFQTAFADRVVRRPEAESASLRIFGPLEARLTQCDRVIL
FT                   GGLVEGIWPPAPRSDPWLSRPMRHQLGLDLPERRIGLSAHDFAQMLGADEVILSHAAKV
FT                   AGAPAVASRFLHRLEAVAGAERWKAAEARGQIYLDYAHALDRPDKVVPITQPMPRPPRD
FT                   ARPLQLSVTAIEDWLRDPYTIYAKFILKLAPLDPVDMPLSAADRGSAIHEALGEFTQVF
FT                   AQALPDDPAAALRAIGQKHFAPLMERPEARALWWPRFLRIAHWFATWETERRLNVAGVD
FT                   AETRGTLSIPLDATRRFVLSARADRIERRADRTFAILDYKTGRPPTGKQVRMGLSPQLT
FT                   LEAAILREGGFEGIAAGSSVSELVYVKLSGNNPPGEEKILELKRDRAEEALFPDDAAIE
FT                   ARAKLEALIRKFDDATTPYSSLNLPMWANRYGDYDDLARIKEWSAAGGLGDDQ"
FT   gene            418199..421693
FT                   /locus_tag="RPC_0387"
FT   CDS_pept        418199..421693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0387"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85962"
FT                   /db_xref="GOA:Q21CC4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC4"
FT                   /protein_id="ABD85962.1"
FT                   /translation="MSSLRVIPPAATERQVQASDPTASVFVSANAGSGKTHVLVQRVIR
FT                   LLLAGVPPEKILCITFTKAAAANMAQRVFTTLGHWVTLSDDSLDAAIRAAGIAQPDSKL
FT                   RMRARELFACALETPGGLKVQTIHALCTRLLQQFPFEANVPARFAVLDERDQTEMMERA
FT                   SLSVLLQAAQAPNSAAGKALTVAMTSAADVTFRDVVRDACFSRDKFMAWIARAGSTEAA
FT                   MAQLSAALGVAPDDSCAAVDQEIVDGPNLPRARWEKAASILEGGSKTDGDQAERLRQAA
FT                   TLTGNDQIARYLQIFLTKDFTPRKTLATKKITDARPDLVAAMKRECERIGPLLERRRAL
FT                   ALRERTQALLVIASDVAADYARQKQDRGLLDYDDLIDKTLDMLNRISSGWVHYKLDRGV
FT                   DHVLIDEAQDTSPRQWDIVDHLIAEFTAGVGARDVKRTIFAVGDEKQSIFSFQGASPRE
FT                   FALRRSALQTRFRNAELKFDPISFNYSFRSGAAILQSVDHVFRDQAIYRSIHADTTYPI
FT                   HESLADAGPSLIDLWELQQPDERQDLEGWRAPFDALPETSPEVKLSQRVQAEIAELIGN
FT                   GTLTGPKGDRRALRYGDVLILVRRRGKAFDAIIQALKRGGIPVAGADRLKLTEHIAIID
FT                   LMNLADALLLPQDDLALAVALKSPLFGLDDDDLFKLAWQRKGSLRDALAAHAAEDGKFN
FT                   TAHRRLQDCEKRARADTPFAFYAWLLGGDGGRARILRRLGHEATDALDEFLELALGYER
FT                   KAPASLQGFMAWLRAADTEVKRDMEISRDEVRVMTVHGAKGLEAPVVFLVDTTSSPADT
FT                   QRLNLVHLPQGNAALSGPSVAVWAGKKADDPPVVANARAAMIAETEDEYRRLLYVAMTR
FT                   AADRLIVGGCQPGNRAEVRPLSWYDLICKGLEGSGLAMQTVPPPDGVVKRYCRQEDLVP
FT                   EQDQAAAPPRVAAPAPQPLPAWLNQPAAPTPLAERVLRPSDDADSRRSRAEDSSAPRAQ
FT                   ARQRGQLVHRLLQSLPELPRERRAAAAARYLARNAKDPVWTEPDRAALAVSVLALIDDP
FT                   RLAALFGPGSRAEVPIAGRLTRLGGDTVLVSGQIDRLLVTPSEVLLVDFKTNQAPPRAL
FT                   AEIPSGYLRQLALYRAVLANLYPGRTLRAALIWSEVAEIMEISDNALDAGLAAIMSA"
FT   gene            421790..422110
FT                   /locus_tag="RPC_0388"
FT   CDS_pept        421790..422110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0388"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85963"
FT                   /db_xref="GOA:Q21CC3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC3"
FT                   /protein_id="ABD85963.1"
FT                   /translation="MAVGKVSDADFESEVLNATGPVVVDFWAEWCGPCRMIAPALDEIS
FT                   SALGEKVKIVKLNVDENPQTASKYSVMSIPTLLIFKGGEMASRQVGAAPKQKLHQWISA
FT                   AV"
FT   gene            complement(422358..423701)
FT                   /locus_tag="RPC_0389"
FT   CDS_pept        complement(422358..423701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0389"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85964"
FT                   /db_xref="GOA:Q21CC2"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC2"
FT                   /protein_id="ABD85964.1"
FT                   /translation="MSEGGAAPLTPLAEVRARLAKLHPQRIDLDLERMQRLLQRLDRPE
FT                   RSLPPVIHVAGTNGKGSTLAYLRAILEAAGLRVHAYTSPWLVRPNESIRLGRVGGGVLV
FT                   GDDELIAVLSHCERLNAGAPITLFEIETAAALQLCAQHPADVLLLEVGLGGRLDATNVI
FT                   ERPLASVIAPIGIDHTEFLGETLAAIAAEKAGIIKRDSPVICAEQPDQAMAVIEAEARR
FT                   LHAPLHAAGQHWHVGIERGRLVYQDDRGLLDLAAPKLFGRHQFDNAGLAIATLRAIATL
FT                   RIDHAAYEAGVAGAEWPARMQRLTAGALVDAAPQGSELWLDGGHNADGGRVAAAALGDL
FT                   EERVSRPLVVIAGMMANKDAEAFLGNFAGLTRHIIAVPIPSREGAMAPAMLADAARKLG
FT                   LRVEIAASVEAALASLRRLAYEVPPRILIAGSLYLAGEVLARNGTPPR"
FT   gene            complement(423698..424696)
FT                   /locus_tag="RPC_0390"
FT   CDS_pept        complement(423698..424696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0390"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85965"
FT                   /db_xref="GOA:Q21CC1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CC1"
FT                   /protein_id="ABD85965.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDSGHLVFYKDVEANQF
FT                   VIPGSNYHMRMGAAARLKSIFDNETWYDIALPEVTPDPLKFRDERKYVDRIKDARAKTG
FT                   MNDAIKVGYGKLEGGAVVVAVQDFDFMGGSLGMAAGEAIVRGIELAVEKQSPFILFAAS
FT                   GGARMQEGILSLMQMPRTTVGVQMLRDAKLPYIVVLTNPTTGGVTASYAMLGDVQIAEP
FT                   GALIGFAGARVIEQTIREKLPEGFQRAEYLKEHGMIDMVVHRHDLKATLARLCRLLTKA
FT                   PMPEVIVESEPEPEPEPVVAEIIPPTSDLPVSAPAPAPVAAQTPAPAAPSA"
FT   gene            complement(424841..425674)
FT                   /locus_tag="RPC_0391"
FT   CDS_pept        complement(424841..425674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0391"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85966"
FT                   /db_xref="GOA:Q21CC0"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CC0"
FT                   /protein_id="ABD85966.1"
FT                   /translation="MTRIDTRFAELNKQGRAAFVTFLMAGDPDLDTSLELIKALPKAGA
FT                   DIIEIGMPFTDPMADGPAIQAAGLRALKAGTTLKKTLALVQAFRRDDNATPVVLMGYYN
FT                   PIYIYGVDKFLVDAKAAGVDGLIIVDLPPEEDSELCLPAMQAGLNFIRLATPTTDDKRL
FT                   PAVLANTSGFVYYVSITGITGSGSADSAVVGQAVQRIKRHTKLPVCVGFGIRTPEGARD
FT                   IARHANGAVVGSALVDVLAKSLDKDGRATAGTVGAVAALVGSLAEGVHAAQQAAE"
FT   gene            complement(425674..426888)
FT                   /locus_tag="RPC_0392"
FT   CDS_pept        complement(425674..426888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0392"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85967"
FT                   /db_xref="GOA:Q21CB9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CB9"
FT                   /protein_id="ABD85967.1"
FT                   /translation="MTTQLPNSFRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYAGA
FT                   KADPSFQREMDGYLKDYVGRPSPLYFAERLTDHLGGAKIYFKREELNHTGSHKVNNVLG
FT                   QIMVARRMGKKRIIAETGAGQHGVATATLCARFGLECIVFMGAVDVERQQPNVIRMQML
FT                   GAKVVPVQSGARTLKDAMNEALRDWVTNVSDTFYCIGTAAGPHPYPMMVRDFQSIIGTE
FT                   TKTQMQAAEGRLPDSLVACIGGGSNALGLFHPFLDDPTVEIFGVEAAGHGLTQLHAASI
FT                   AGGRPGVLHGNRTYLLMDDDGQIQEGHSISAGLDYPGIGPEHSWLHETGRVTYLSATDD
FT                   EALAAFQLLSRLEGIIPALEPAHAIAKVLELAPQRPKDHLMVINLSGRGDKDIPQVAEI
FT                   LRGQK"
FT   gene            complement(426888..427544)
FT                   /locus_tag="RPC_0393"
FT   CDS_pept        complement(426888..427544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0393"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85968"
FT                   /db_xref="GOA:Q21CB8"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CB8"
FT                   /protein_id="ABD85968.1"
FT                   /translation="MPLVVKICGLSTRATLDAALAAGADMVGFVVFPASPRHVDLALAR
FT                   QLGDATGDRAAKVALTVDADDALLESVIETLRPDILQLHGHESAARVAEIRRTFGLPVM
FT                   KVLGVASAADLAPLPDYAAVADRILFDARAPKGASRPGGLGAVFDWQLLRDLDLALPFM
FT                   VSGGLTADNVAEAVRITGAGGVDISSGVETAPGVKDPDLIRAFIRAARASQELMI"
FT   gene            complement(427600..427992)
FT                   /locus_tag="RPC_0394"
FT   CDS_pept        complement(427600..427992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85969"
FT                   /db_xref="GOA:Q21CB7"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CB7"
FT                   /protein_id="ABD85969.1"
FT                   /translation="MQKFLTALVLIPLGLILFVFAVANRQLVTVSLDPFAGNDPELAVT
FT                   MPLFVLLIAVAILGVIAGSSVTWLRQRRWRKAARRHQAEAIEARAQLTELRASVVTQPA
FT                   AEAPRAPRLLQLGSANSARDKQSATL"
FT   sig_peptide     complement(427927..427992)
FT                   /locus_tag="RPC_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.606 at
FT                   residue 22"
FT   gene            complement(428026..428331)
FT                   /locus_tag="RPC_0395"
FT   CDS_pept        complement(428026..428331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0395"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85970"
FT                   /db_xref="GOA:Q21CB6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CB6"
FT                   /protein_id="ABD85970.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDTGAPDSGA"
FT   gene            complement(428504..429481)
FT                   /locus_tag="RPC_0396"
FT   CDS_pept        complement(428504..429481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0396"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85971"
FT                   /db_xref="GOA:Q21CB5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CB5"
FT                   /protein_id="ABD85971.1"
FT                   /translation="MSFDSDVIVDRRRMRRKLTFWRVAAALVAIAAVIAVGSATVPSGP
FT                   LAGTSGAIARVKIDGLIRSDADRVEALERLEKSAAAAVVVHINSPGGTTAGSEQLYDAL
FT                   VRLKAKKPLVVVIEGLAASGGYIAAIASDHIVAQQSSLVGSIGVLFQFPNFTELMKTVG
FT                   VKVEEVKSSPLKAAPNGFEPTSPEARAALESLVKDSYAWFRGLVKSRRGMDDQLLEKVA
FT                   DGRVFTGRQAVDLKLIDQLGDEKTAIAWLVAEKKVKADLPVRDYKLTPRFGDLTFLRAA
FT                   TSITLDALGLNAVARQIERAGVVQSVEQLGLDGMLALWRPAGSN"
FT   sig_peptide     complement(429338..429481)
FT                   /locus_tag="RPC_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.580 at
FT                   residue 48"
FT   gene            complement(429946..431643)
FT                   /locus_tag="RPC_0397"
FT   CDS_pept        complement(429946..431643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0397"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85972"
FT                   /db_xref="GOA:Q21CB4"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CB4"
FT                   /protein_id="ABD85972.1"
FT                   /translation="MASTASYNPSRDDFAAMLDESFAGGNLQESSVIKGIVVAIEKDMA
FT                   VIDVGLKTEGRVALREFAGPGKESELKVGDTVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFNNNEKVHGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNSQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVEVQ
FT                   VLEVDSVKRRISLGLKQTMRNPWEVFVEKYPVGSTVEGEVKNKTEFGLFLGLDGEVDGM
FT                   VHLSDLDWKQPGEQVIDNFKKGDVVKAIVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAIVTCEIMDVKESGIDVQIVGTDFNTFIKRSELARERSDQRAERFAVGEKVDARVIQF
FT                   DKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
FT   gene            complement(431949..432587)
FT                   /locus_tag="RPC_0398"
FT   CDS_pept        complement(431949..432587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0398"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85973"
FT                   /db_xref="GOA:Q21CB3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CB3"
FT                   /protein_id="ABD85973.1"
FT                   /translation="MIIAIDGPAASGKGTLGKRLAAHYGYRHLDTGVIYRAVAKALLDQ
FT                   GAELTDETRAVAAAEALDPDTFADPALKSQTVGEAASVVSALPRVRAALLNFQRQFAAH
FT                   PPGAVLDGRDIGTVICPEADVKIFVVADASVRAHRRTLEALARGEPADEAQVLADILKR
FT                   DERDKSRAAAPLKAADDAHLLDNSHLDIESGVRAAIDIVEAVRAGRQRV"
FT   gene            432811..433482
FT                   /locus_tag="RPC_0399"
FT   CDS_pept        432811..433482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0399"
FT                   /product="protein of unknown function DUF374"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85974"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CB2"
FT                   /protein_id="ABD85974.1"
FT                   /translation="MATPAFIKRILRSDAFQTSISYPLAAYFQIVTWTAKFDRPRPPVP
FT                   GPYIMAMWHGRLIMLPMLCMEDKALKALISGHRDGRIISKIGAIFGIQTVTGSSSKGGM
FT                   RAVRELMRFGRDGHCLFVTPDGPRGPRMHVNEGVLDLARLTGLPILPVSISPQRAVVFK
FT                   SWDRLFLPKPFSKIVVRWGAPITVDADADRAVISQQLEAALTAVQRDADTLAGRAPIEA
FT                   A"
FT   gene            complement(433640..435043)
FT                   /locus_tag="RPC_0400"
FT   CDS_pept        complement(433640..435043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0400"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85975"
FT                   /db_xref="GOA:Q21CB1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CB1"
FT                   /protein_id="ABD85975.1"
FT                   /translation="MMRASRSHPAAPAQRNTILTHSAHPSGQPSPLQARKSASLTGRVR
FT                   VPGDKSISHRALILGALAVGETRISGLLEGEDVLNTAKAMRALGASVERTGDFAWRIHG
FT                   VGVGGFAQPAAALDFGNSGTGCRLVMGAVAGCPITATFDGDASLRSRPMRRIVDPLELM
FT                   GARVIDSREGGRLPLTLQGARDPLPILYRTPVASAQIKSAVLLAGLAAPGITTVIEQEA
FT                   SRDHTELMLSHFGAQIVSEPEGAHGRKISLTGQPELRGAPVVVPADPSSAAFPIVAALI
FT                   VPGSDIVLTEVMTNPLRTGLFKTLREMGGSIEESEVRGDAGEPMAQFRVRASQLKGVEV
FT                   PPERAPSMIDEYLVLAVAAAFAEGTTRMRGLKELRVKESDRLEATAAMLRLNGVSVEID
FT                   GDDLIVEGRGHVPGGGLVATEMDHRIAMSALVMGLAADQPVTIDDTGFIATSFPDFIPM
FT                   MRRLGAEFG"
FT   gene            435136..435558
FT                   /locus_tag="RPC_0401"
FT   CDS_pept        435136..435558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85976"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CB0"
FT                   /protein_id="ABD85976.1"
FT                   /translation="MAKSDLGTKRICPTTGKKFYDLNKTPVISPYTGEVVPIAPIPPPR
FT                   TRADAASRAAAASAAAAAEAPEAAEAEELVPLEEADAEENTGKVKAVVPESEDDIEIDD
FT                   TIEDDDDDDSTFIADEEEGDEDVTDIIGDVSGDEET"
FT   gene            435624..435699
FT                   /locus_tag="RPC_R0005"
FT                   /note="tRNA-Ala3"
FT   tRNA            435624..435699
FT                   /locus_tag="RPC_R0005"
FT                   /product="tRNA-Ala"
FT   gene            435889..436125
FT                   /locus_tag="RPC_0402"
FT   CDS_pept        435889..436125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0402"
FT                   /product="Excinuclease ABC, C subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85977"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA9"
FT                   /protein_id="ABD85977.1"
FT                   /translation="MKYVYILESLDSEHFYVGIADDLRARLAKHNAGEVPHTSKFKPWR
FT                   LKTYIAFSDEDKAVAFEQYLKSASGRAFAKKRL"
FT   gene            436173..437378
FT                   /locus_tag="RPC_0403"
FT   CDS_pept        436173..437378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0403"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85978"
FT                   /db_xref="GOA:Q21CA8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA8"
FT                   /protein_id="ABD85978.1"
FT                   /translation="MPPDIAPGAMTGLRVIDLSRVLGGPYCTQILADHGADVIKVEPPA
FT                   GDETREWGPPFHDADAAYFIGANRNKRSISLDLASPGGRAVLLKMLGQADVVIENFKPG
FT                   TLEKWGLGNEVLSAQFPRLVHCRISGFGADGPRGGNPGYDAIVQSMAGMIAATGSKESG
FT                   PTRIGVPLVDITTGLYATVGILMALAERQKSGRGQFVETTLFETGLAIMHPHAANYFLH
FT                   GRPPALTGNEHPNLVPYAIFPTRTDDIFIGVGNDATFRKLAKEIGKPELGTDPRFARNK
FT                   DRIANRDALSAELAAVFSEADAEPLCDRLLAAGLPAGPVQTIDKALTSAHATYRGDVIE
FT                   KDWYKGVASPIRFERTKASLRRVPPTFAEHTGEVLGEFGFSSDEIRALVASGAVCDRQR
FT                   KR"
FT   gene            437561..438877
FT                   /locus_tag="RPC_0404"
FT   CDS_pept        437561..438877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0404"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85979"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA7"
FT                   /protein_id="ABD85979.1"
FT                   /translation="MALRHVGLAATLSLALGLASPALAATEIQWWHAMTGANNDVIVKL
FT                   AEEFNAAQTDYKVVPSYKGSYPDTMNAGIAAFRAGNAPHIIQVFEVGTATMMAATGAVK
FT                   PVYKLMAEAGEKFDSQAYLPAITGYYSTSKGEMLSFPFNSSSMVMWINKDALKKANIAE
FT                   IPKTWPEVFEDAKKLKAAGYATCGFSTAWVTWANLEQLSAWHNVPLASRANGLDGFDTK
FT                   LEFNGPLQIKHLETLIALQKDKTYDYSGRTNTGEGRFTSGECPIFLSSSGFFGQVKGNA
FT                   KFDWTNAPMPYYPDVQGAPQNSIIGGASLWVMGGKSPAEYKGVAKFLSFLSDTDRQVAI
FT                   HKASGYLPITKAAYAKAQEEGFYVNAPYLETPLRELTNKPPTENSRGLRLGNMVQLRDI
FT                   WAEEIESALAGKKTAKDALDTAVTRGNAMLRQFERTVSK"
FT   sig_peptide     437561..437635
FT                   /locus_tag="RPC_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            439012..439407
FT                   /locus_tag="RPC_0405"
FT   CDS_pept        439012..439407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0405"
FT                   /product="protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85980"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA6"
FT                   /protein_id="ABD85980.1"
FT                   /translation="MSRTIDHRVTRARSLRRNPTDAERKLWQRLRKVSLGEVHFRRQAT
FT                   IGPYFADFACHAIRLVVEIDGGQHAESATDHIRTDYMHAQGYRVLRFWNHEVLENIEGV
FT                   VETILSVASVAPPTPDPSPPQERGEGK"
FT   gene            439411..440292
FT                   /locus_tag="RPC_0406"
FT   CDS_pept        439411..440292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0406"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85981"
FT                   /db_xref="GOA:Q21CA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA5"
FT                   /protein_id="ABD85981.1"
FT                   /translation="MQKQAVFQSRALPFLLIAPQVGIVLVFFYWPALQAVWQSFLLQDA
FT                   FGLSTTFVAFENYTELLQQPGYFNAIVRTFAFSALIAGSSLSFALLLAVMADKPLRAVG
FT                   LYRTLLIWPYAVAPAVAGVLWMFMLHPSLGVLARGLRNLGLDWNPLLNGNHAVILVVLA
FT                   AAWKQISYNFLFFLAGLQSIPKSVLEAAAIDGAGPMRRFWTVTFPLLTPTIFFLIVVNI
FT                   VYAFFDTFGIIDAMTGGGPAKSTETLVYKVYLDGLLGGNLGSSAAQSVLLMVIVIGLTA
FT                   IQFRYVERKVTY"
FT   gene            440292..441140
FT                   /locus_tag="RPC_0407"
FT   CDS_pept        440292..441140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0407"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85982"
FT                   /db_xref="GOA:Q21CA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA4"
FT                   /protein_id="ABD85982.1"
FT                   /translation="MVERKGIRGFVAHLILWIGIAVVAFPVYLAFVASTQDAASIANGQ
FT                   MSLLPGGHFLETYTRTIFVGTSGSTREPVGVMLFNSLVMALVIALGKIAISILSAYAIV
FT                   YFRFPFRMWIFWMIFITLMLPVEVRIYPTYKIAADLNMLDSYAGLTLPLIASATATLLF
FT                   RQFFMTVPDELLEASRIDGAGPLRFFWDTLLPLSRTNIAALFVILFIYGWNQYLWPLLI
FT                   TTRDDMQTIVIGIRKMITTSDALTEWPVVMATAVLAMLPPVLVVIVMQRLFVRGLVETE
FT                   K"
FT   gene            441267..442367
FT                   /locus_tag="RPC_0408"
FT   CDS_pept        441267..442367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0408"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85983"
FT                   /db_xref="GOA:Q21CA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21CA3"
FT                   /protein_id="ABD85983.1"
FT                   /translation="MANVTLRNVRKTYPGGVEAIKGIDFAVGDGQFCVLVGPSGCGKST
FT                   LLRMVAGLETITKGEIDIGGRVVNDIEPADRDIAMVFQNYALYPHMSVYNNMAYGLRNR
FT                   GMPKPEIDSRVREAARILEIGALLERKPKQLSGGQRQRVAMGRAIVRQPKVFLFDEPLS
FT                   NLDAKLRIAMRVEIRKLQRRLNTTSIYVTHDQLEAMTLADILVVMNGGVVEQIGNPLEI
FT                   YRKPASTFVASFIGAPPMNLIALEPDEIRAQFAGDVRANTEAGILGIRPEDLLISTEAA
FT                   ASGGLALELVVDAIERVGAETFVYGARSRHGEPVISAKPGELPPGEVIVRVPGQSAPAA
FT                   GERIMVTAPREKLHLFSADGRRRIDL"
FT   gene            442530..442955
FT                   /locus_tag="RPC_0409"
FT   CDS_pept        442530..442955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0409"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85984"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA2"
FT                   /protein_id="ABD85984.1"
FT                   /translation="MSRVPTLSSPFLLGFDDIERALDRVVKGADGYPPYNIERCDRCNG
FT                   EPEKLQITLAVAGFTRDQLDVTIEENQLVIRGRQQDDKTRQYIHRGIAARHFQRTFVLA
FT                   EGMQVLGADLKNGLLSIDLARPEPERVVKTIAINEHE"
FT   gene            443008..443271
FT                   /locus_tag="RPC_0410"
FT   CDS_pept        443008..443271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0410"
FT                   /product="protein of unknown function DUF1150"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85985"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA1"
FT                   /protein_id="ABD85985.1"
FT                   /translation="MTAVNVVENVDVSTEALATLGEGHIAYVKQIRSEDVPGLFPQAPR
FT                   IAPGLKLFALHSADGTPIMLTDSREAAIANAWSQELQAVSVH"
FT   gene            443522..443779
FT                   /locus_tag="RPC_0411"
FT   CDS_pept        443522..443779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85986"
FT                   /db_xref="GOA:Q21CA0"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:Q21CA0"
FT                   /protein_id="ABD85986.1"
FT                   /translation="MATKAGTQMFAIPRRYSHFVFSVIQSGMTCAVAAAIASLPLTGAA
FT                   VFLRHWLQSWLLSWTVMLPVVLVAAPAIRRLTHFLTQEES"
FT   gene            complement(443850..444404)
FT                   /locus_tag="RPC_0412"
FT   CDS_pept        complement(443850..444404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0412"
FT                   /product="protein of unknown function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85987"
FT                   /db_xref="GOA:Q21C99"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C99"
FT                   /protein_id="ABD85987.1"
FT                   /translation="MFQIAILAFSLSTDAFAASVAKGVRFPNMSWLRSAGIALGFGTLE
FT                   GLAPLIGYLLGKQFAGTIEGYDHWFAFIILAGLGLRMIWRSFHPETLSSPQMTPTWAAV
FT                   LATAVGTSIDATAVGLTLALFGDNIPLTLFVIGIVTFVLTLIGLRVGGLIGERTGRWAE
FT                   LAGGFGLIAIGANILVTHLTA"
FT   sig_peptide     complement(444351..444404)
FT                   /locus_tag="RPC_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.870 at
FT                   residue 18"
FT   gene            complement(444530..444991)
FT                   /locus_tag="RPC_0413"
FT   CDS_pept        complement(444530..444991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0413"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85988"
FT                   /db_xref="GOA:Q21C98"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C98"
FT                   /protein_id="ABD85988.1"
FT                   /translation="MTITDLVAPEAVLPALKVNSKKQALQELAARAAVLTGQNERSIFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLDKLFGLFARLERPIDFEAMDGQPVDLVFLLLA
FT                   PEGAGADHLKALARIARLLRDMDVAKKLRASRDAQAIYSVLALPPATAA"
FT   gene            complement(445229..445834)
FT                   /locus_tag="RPC_0414"
FT   CDS_pept        complement(445229..445834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0414"
FT                   /product="SSU ribosomal protein S30P / sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85989"
FT                   /db_xref="GOA:Q21C97"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C97"
FT                   /protein_id="ABD85989.1"
FT                   /translation="MTIRVSGKSISVGEALRGRVSERTDEVLRKYFDGNYSGHITLSKD
FT                   GFGFRTDCALHLDSGITLEAESNAADAYASADQALLQIEKRLRRYKSRLKDRSARKIHA
FT                   AAAAVAELGSATLDAPSYVIEAPDTETEIADEGYNAVIIAEATTSLKRLSVSEAVMELD
FT                   LTGAPVVVFLHGGSGRVNVIYRRPDGNVGWVDPPVVPS"
FT   gene            complement(445890..447551)
FT                   /locus_tag="RPC_0415"
FT   CDS_pept        complement(445890..447551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0415"
FT                   /product="sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85990"
FT                   /db_xref="GOA:Q21C96"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C96"
FT                   /protein_id="ABD85990.1"
FT                   /translation="MALTQRLEFRQSQSLVMTPQLMQAIKLLQLSNLDLASFVEDELER
FT                   NPLLDRANENGEPPVPGELAPERAEFSDRDDAASGSGEDAGADGSDFSDRAAGDGFEAS
FT                   AEDWMQRDLGSRAEIEQTLDTGLDNVFSEEPAETAARTAQDAAPTAFTEWGGGSSNDDG
FT                   YNLEAFVAAEITLGGHLAEQLAVAFTDPKQRLIGQYLVDLVDDAGYLPPDLGDATERLG
FT                   ASAEQVEAVVAVLQKFDPAGVCARNLSECLAIQLRDRDRYDPAMQALVEHLDLLAKRDI
FT                   GALRRICGVDDEDLADMIGEIRHLDPKPGLKFGTARVQTVVPDVYVRPGPDGGWHVELN
FT                   SETLPKVLVNQVYYSELSKTIRKDGDKAYFTDCLQNATWLVRALDQRARTILKVSTEIV
FT                   RQQDGFFTQGVAHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGIFELKYFFTASI
FT                   ASADGGEAHSAEAVRHHIKQLIDGENPAIILSDDTIVEKLREAGIDIARRTVAKYREAM
FT                   RIPSSVQRRRDKQSMLGNALTAPATTADRSRDTAPA"
FT   gene            complement(447687..448640)
FT                   /locus_tag="RPC_0416"
FT   CDS_pept        complement(447687..448640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0416"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85991"
FT                   /db_xref="GOA:Q21C95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C95"
FT                   /protein_id="ABD85991.1"
FT                   /translation="MVDLLGMFRRRPAKAAPSFARAQRGDITGLGDSVGDLLTSPVRDV
FT                   PPVARDPAAAPPIAPQQPARSNPARAQRAPSRDGFLAVHGIEKSFGSRRIVRGVSIYVR
FT                   RGEAVGLLGPNGAGKTTVFYMITGLIKADRGAIELDGHDVTKLPMYQRARLGIGYLPQE
FT                   ASIFRGLSVEQNIRAVLEAVEPDRRKREAELDNLLHEFNIERLRKSPSIALSGGERRRV
FT                   EIARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRHLTNRGIGVLITDHNVRETLGLTD
FT                   RAYIVYAGEILTEGSPEEIVNNPDVRRLYLGEEFRL"
FT   gene            complement(448854..449531)
FT                   /locus_tag="RPC_0417"
FT   CDS_pept        complement(448854..449531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0417"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85992"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C94"
FT                   /protein_id="ABD85992.1"
FT                   /translation="MTKLQMTGRTLGGACVAMLVVAALGVAPAAAQAGMTGVPNAMQGF
FT                   SQNRDKPIQIEAATLEVRDKKKEATFTGDVKVVQGDTTMTSRILVVFYDQEQPASAEPT
FT                   PGRSAKAAAKPQMTAAAPGPGGGSSIRRLEAKGNVVVTQKDQVVTGDTAVFDTKTNLVT
FT                   MLGGVVLTQGKNVVRGDRLLVDMTTGVSRVESGSGRVQGLFQSSPGAGPLGTAPPPNSA
FT                   KPK"
FT   sig_peptide     complement(449436..449531)
FT                   /locus_tag="RPC_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.536 at
FT                   residue 32"
FT   gene            complement(449539..450273)
FT                   /locus_tag="RPC_0418"
FT   CDS_pept        complement(449539..450273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85993"
FT                   /db_xref="GOA:Q21C93"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C93"
FT                   /protein_id="ABD85993.1"
FT                   /translation="MTSSYQAGMETRFAAAARHSRLVRLLRVAVPLAVLLAMAAIVAVS
FT                   VFNPFRFLAKLPVDMGNLVVSGTKITMESPHLSGFSPDQRPYELWAKTATQDLTTPDHV
FT                   DLATLRAKLLTQDQATVTVDARQGLFDTKAQLLDLRKDVYLLSSTGYEAWMTRAFIDIG
FT                   KGTVVSDEPVDVKWQGGTLRGQRMRVTEKGEIVRFEGGVVMNLDGVQPAPAEPPAPQPS
FT                   APRAETAPASPPRAVSGKANVK"
FT   gene            complement(450451..451065)
FT                   /locus_tag="RPC_0419"
FT   CDS_pept        complement(450451..451065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0419"
FT                   /product="3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85994"
FT                   /db_xref="GOA:Q21C92"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C92"
FT                   /protein_id="ABD85994.1"
FT                   /translation="MTIRLHRGDLPDLSRYTDSVAIDTETMGLNPHRDRLCVVQLSNGD
FT                   GSADVVQIPVGHSDAPNLKKLLGDPAITKIFHFARFDLAALYNALGVMPQPVYCTKIAS
FT                   RLTRTYTDRHGLKDLVREVLGVDLSKQQQSSDWGAQSLSDAQLAYAASDVLHLHGLRTR
FT                   LDAMLAREGRTELAQACFDFLPTRAKLDLSGWAEQDIFAHS"
FT   gene            complement(451217..451444)
FT                   /locus_tag="RPC_0420"
FT   CDS_pept        complement(451217..451444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85995"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C91"
FT                   /protein_id="ABD85995.1"
FT                   /translation="MPLYSFHCAKCDSDVELLVGCDDKPACPHCRSKKLQRLVSRVVAP
FT                   GKSGGLIKAARAQAAREGHFSNYSRSERRG"
FT   gene            451606..452739
FT                   /locus_tag="RPC_0421"
FT   CDS_pept        451606..452739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85996"
FT                   /db_xref="GOA:Q21C90"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C90"
FT                   /protein_id="ABD85996.1"
FT                   /translation="MANPRQWRRSLNCRSLAFMMRRLDAFWAEWASRPWRRTGKWMAHV
FT                   KTCVENIPSGRGVLFPGTIGLLGVALAAATAAWIADIDPIAWVFESTPTSVVEVASFDA
FT                   RFLRDSISDQVAPVALPPAAMRSLTPELEAKLRQAKARLAQDLTAQSVAPPDLIAMTST
FT                   PPAQTTSVVAVPLPRSRPVLADLMAAQRSAAVSNDPQPGLLEKFSEMFSGRMTLASLDP
FT                   DGGLGSDGPNLVALGYDNATAVYDISARRVYMPNGVKLEAHSGFGALMDDPGHVDKHNV
FT                   GATPPNVYELKPRERLFHGVQAIRMIPVGRNDTLGRSGLLAHSYMLGPNGDSNGCVSIK
FT                   QYDRFLQAYQNGEIKRLVVVPSLGDTTAVARRSTSQL"
FT   gene            complement(452915..454432)
FT                   /locus_tag="RPC_0422"
FT   CDS_pept        complement(452915..454432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0422"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85997"
FT                   /db_xref="GOA:Q21C89"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C89"
FT                   /protein_id="ABD85997.1"
FT                   /translation="MRTSASHPLQIAAVAGGPGCGRVGLTFCPGKYDPYAASGAWKRDL
FT                   ASDLDLIRDWGAAAVVTLVEQRELAMLRVETLGEEVLRRQMAWFHLPIVDVSVPDQDFE
FT                   LAWDSAGAGLRAILRSGFDVVVHCRGGLGRAGTIAARLLAELGFEPAAAVREVRKARPG
FT                   AIETPTQKHYVLAVRTADESPPPADRIRDRAIGALAGLAIGDAVGVPLEFQPRDSTPPL
FT                   HDMIGGGPFRLEPGEWTDDTSMALCLADSLLACPGAFDAADLMGRFVAWWEQGANSVNQ
FT                   RGCFDIGLTTKAALQRWQRERDPYAGSPDPRAAGNGSLMRLSPVAIRFWNDRQALQDVA
FT                   IRQSRTTHAAAEALEACALYAEILADAIEGRPRSQLLRPRDGAYAGAVQAIAAGSWRGK
FT                   RRDQIQSSGYVLHSLEAALWCVGSTADFSSAVLKAANLGDDADTTAAIAGQLAGALYGA
FT                   SGIPRHWMARLAGREAILSRAAALFDRSLGAQAPPPTIADQRLFGLD"
FT   gene            complement(454432..455160)
FT                   /locus_tag="RPC_0423"
FT   CDS_pept        complement(454432..455160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85998"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C88"
FT                   /protein_id="ABD85998.1"
FT                   /translation="MPVVSDQIEILEASAWSKVGSQAGSNPGGIYQDDGGVRWYVKTPN
FT                   TADHARNEVLANRLYRLAGVAVPDVELAWRDGDLAVASRMVKGLMLAELPEHLSEQAAV
FT                   RVGEGFAADAWLANRDALGVDLDNMIVTAAGAVIRIDQGGALRYRAQGSLKTEFGPIVV
FT                   EFETLRDRRKNAVAASFFGALTQQQLLSSLRRVTQIGTAAIAAAVNGIYGDGAESSRLI
FT                   DTLIARRDDLAQRAQRLEAK"
FT   gene            complement(455416..456168)
FT                   /locus_tag="RPC_0424"
FT   CDS_pept        complement(455416..456168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0424"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD85999"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C87"
FT                   /protein_id="ABD85999.1"
FT                   /translation="MRAFLFVILLLALAAPGRAAEPIVKDGNTLQLGGTTFRLDGTDAP
FT                   EFDQLCVDDRADPRPCGQQAREQLVKLIGGREIACKDLGPDKVYTTRRLGICTIAGEAD
FT                   SLNQIMVREGWALAAESDGKPRFAAEEATARAERRGLWRGCFVAPRQFRRWDRTAALLG
FT                   ASCRADKKPELLAILFPDDPAMPPGCAIKAKFAARARFIGKVGIYHLQGCRSYATLGKP
FT                   NRWFCSEQDAQAEGFRKAFNCGRNAKTP"
FT   sig_peptide     complement(456109..456168)
FT                   /locus_tag="RPC_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.942 at
FT                   residue 20"
FT   gene            456597..457634
FT                   /locus_tag="RPC_0425"
FT   CDS_pept        456597..457634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0425"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86000"
FT                   /db_xref="GOA:Q21C86"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C86"
FT                   /protein_id="ABD86000.1"
FT                   /translation="MRRVTVLAAAGGGVLAIVIGATASHMFFNKASDAAEVQAELTTGT
FT                   VAARWPTPRADATESTAAAPSVATPQTRAAEAAKTSASCSHPGALGVSRTVQIDAAGGP
FT                   GFGLTQYRDYDFLQPGEVVLSFDDGPWPVNTRAVLAALEAECVKAVFFPIGKHASWHPA
FT                   ILKDVVAQGHTIGSHTWSHVNLAKKSLQEAKDEIEKGFSAIAIAAGRAPAPFFRFPQLR
FT                   QTPELKAYLGERNIAAFSIDVDSKDFAIHEPDAVVSSIMTKLQKAGKGIILMHDFQHST
FT                   ALAMPQVLQQLKAGGYKVVHVTAKDAVVTLPQYDSAVAALMPPAPAVSARATAGVVRTV
FT                   SGAAN"
FT   sig_peptide     456597..456701
FT                   /locus_tag="RPC_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.706 at
FT                   residue 35"
FT   gene            complement(457934..458821)
FT                   /locus_tag="RPC_0426"
FT   CDS_pept        complement(457934..458821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86001"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C85"
FT                   /protein_id="ABD86001.1"
FT                   /translation="MRTEPLLTVAPVAAVQSVAELYAIALTQAETAATHYQRHATAGDT
FT                   ASGDTSLLSTQSVFEVLARRERQRAEAITVGAVAALNKPPDAADLLWSPTDLVPAQEIS
FT                   EIGDSSLGTAYDAWALAVRHRERAFVFWTYVAALAGDPTVRSTAEGFAREALRDGDALR
FT                   RERRLAWRSLRHDATGEREAAREPASAALLESLLLKDIMAWAAQLTPSERGVLMTLAPS
FT                   PLPPDHDPHDPLVAEGSLDEIKSRALRRAEQLSNLYLEDADRALDQAGLEFAQRLAAQS
FT                   IARLAALRSMAATG"
FT   sig_peptide     complement(458762..458821)
FT                   /locus_tag="RPC_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.767) with cleavage site probability 0.747 at
FT                   residue 20"
FT   gene            458976..461270
FT                   /locus_tag="RPC_0427"
FT   CDS_pept        458976..461270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0427"
FT                   /product="FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86002"
FT                   /db_xref="GOA:Q21C84"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR011399"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C84"
FT                   /protein_id="ABD86002.1"
FT                   /translation="MRKLALTPLLLSLALALCCWLGNAAPGFAAGVLGDYLAKSQPGEL
FT                   VPGADRFGPPQGEPAIVPVYKSDRLLGFVYLNSDFTNATGYSGKPIEMLVGIDPKGVLT
FT                   GFKLVEHKEPIILLGIPEKRILDVVNKLIGVDMTVVARGGAKPPRVDIVSGATVTVLVI
FT                   GDSIVRSAIKLIRSNRLADGGPVAAVTTAPPDAAKIIDMDKSEVRDWQGLLADGALRRL
FT                   QLSVGDVNQAFEKSGNAAAAARPEDGEPDASFIDLYAADVAVPTIGRSLLGDDGYQRLK
FT                   ARLKPGQQALLVAGSGKYSFKGSGYVRGGIFDRIELIQDNNSIRFRDRDHTRLGSVAAA
FT                   GAPDFPEIALFLVPADFAFDPAAPWALQLVVQRVLDVRDKAALTFDLGYALPDSLLKRM
FT                   QPAPVAAKPSPAPAASTAAPRVGEGQGSDEDPLWMRIWRGDLVKIGIGAAALGVLTLIF
FT                   FFQNALVRRPLLYTWVRRGYLLFILVWLGWYANAQLSVVNVLTFVNSLMTGFSWQYFLS
FT                   APLIFMMWAATAAALLFWGRGPFCGWLCPFGALQELTNNIAQALKVPQYRLPWGLHERL
FT                   WPIKYIIFLGLFGMSLYSTALAEQLAEVEPFKTSIVLKFARDWPYVVYALTLLTAGLFV
FT                   ERFFCRYMCPLGAALAIPGRIRMFEWLRRWKECGSPCQRCGNECPVQAIHPEGHINVNE
FT                   CIYCMHCQELYFDDHRCPHMIQVRLKREKREVMSSPSMRTGKGPDTLITAGGRPIAGLS
FT                   AAPSPHLQPKA"
FT   sig_peptide     458976..459065
FT                   /locus_tag="RPC_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.839 at
FT                   residue 30"
FT   gene            461281..463230
FT                   /locus_tag="RPC_0428"
FT   CDS_pept        461281..463230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0428"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86003"
FT                   /db_xref="GOA:Q21C83"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023644"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="InterPro:IPR041142"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C83"
FT                   /protein_id="ABD86003.1"
FT                   /translation="MTDNTKDSKGVSRRTLLGTTAAAAGVGLAGGIALTGDGTGLIATA
FT                   DAQTKAAPTLPARPAIQKAEVAPGELDEYYTFFSSGQTGELRIVGLPSMRELMRVPVFN
FT                   RCSATGWGQTNESLKILTEGLLPESREFLKTRGGTYMNGDLHHPHLSFTEGTYDGRYAF
FT                   MNDKANTRVARVRLDVMKCDKIIQLPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLPNDG
FT                   SNLDKSKDYHAIFTAIDGDTMKVAWQVMVDGNLDNVDADYQGKYAFATCYNSEEGVNAA
FT                   EMTANEQDWVVIFNIKRIEEAVKKGDFKEMGGVPVIDGRHGSRYTRYVPVSNSPHGMNT
FT                   APDGIHIVANGKLSPTVTVMDVRKFDDLFDDKIKPRDVVVAEPQLGLGPLHTAYDGRGN
FT                   AYTTLFLDSQICKWNIDLAKRAFKGEKVDPIIDKIDVHYQPGHNHSSMGQTKEADGKWL
FT                   ISLNKFSKDRFLNVGPLKPENDQLIDISGEKMKLIHDGPSFAEPHDATIVHRSKINPIS
FT                   IWNRADPMFEDAVKQAKLDGVKLESDSKVIRDGDKVRVYMTSQAPAFGLEKFQVKQGDK
FT                   VTVYVTNIDDVEDLTHGFSIVNYGIQMEVAPQATASVTFSADRAGVYWYYCSWFCHAMH
FT                   MEMKGRMLVEPKTV"
FT   sig_peptide     461281..461388
FT                   /locus_tag="RPC_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.689 at
FT                   residue 36"
FT   gene            463476..464840
FT                   /locus_tag="RPC_0429"
FT   CDS_pept        463476..464840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0429"
FT                   /product="periplasmic copper-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86004"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C82"
FT                   /protein_id="ABD86004.1"
FT                   /translation="MPLRLRLIPAVLFAAAASSALAETIGVAPGQPLQAVLDRAQDGDV
FT                   IAVAAGEHPGAITIARRLTIAGEPGAILAGNGAGTVIKVTAPDVVIRGLTIKNSGRDLQ
FT                   TMDSGIFLEQSAERALVENNRLQGNLFGVYVHGATGSRVQGNVIEGLRDIRLAEAGNGV
FT                   SVWNAPEVTIADNTFRYGRDGIFTITSKNDRFINNRFENVRFAVHYMYTNDSEVSGNLS
FT                   IGNHAGFAIMYSNRLTIRGNVSDRDRDYGLLFNYANYAAIEGNRVSGGSLANIGNGRDE
FT                   GSDDEKGMLPEAKPAQAGSSQDGPQKCVFIYNANHNKFRDNWFERCGIGIHFTAGSEGN
FT                   EITGNAFIGNRNQVKYVGTRNLDWSKGGRGNYWSDNPAFDLDGDGIADTAYRPNDLVDR
FT                   VLWTAPSAKVLINSPAVQVLRWAQSQFPALYPGGVIDTHPLIAPPPKPSATRGQP"
FT   sig_peptide     463476..463544
FT                   /locus_tag="RPC_0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            464837..465742
FT                   /locus_tag="RPC_0430"
FT   CDS_pept        464837..465742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0430"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86005"
FT                   /db_xref="GOA:Q21C81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C81"
FT                   /protein_id="ABD86005.1"
FT                   /translation="MTATVTVSHVEKRYRAVRALRDVSFELLPGRLSALVGHNGAGKTT
FT                   LIKLMLGLIRAEHGDIRVLDEDPAAGEFAGRRLLGYLPENVAFNAALTGRETLAFYARL
FT                   KQIAPASAWPLLERVGLAPAADRKVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLD
FT                   PALRQTFYEILDELRDDGATVLISSHALNELEDRAEHVLIMNRGVLAAQGTMSELRKIS
FT                   QLPIRVAIELADDGAVPDWMNGPQDAAAPGHVLLVPDDAQKMALLRDAAADPRVRNIEI
FT                   AAPTLDELYAHFLNLQEPVA"
FT   gene            465739..466566
FT                   /locus_tag="RPC_0431"
FT   CDS_pept        465739..466566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0431"
FT                   /product="nitrous oxide metabolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86006"
FT                   /db_xref="GOA:Q21C80"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C80"
FT                   /protein_id="ABD86006.1"
FT                   /translation="MRTIAIIAAKEIQEGLRNRWVLATTLLLAALALSLSFLGSAPTGN
FT                   VGAGALDVVVVSLSSLTIFLLPLIALLISHDAVVGEMERGTMILLLSYPVGRGQVILGK
FT                   FAGHVLILGFATVIGYGAAGLALMLTGASALAASWYAFGAMLGSSVMLGAVFVAIGYLI
FT                   SSLVRDRGTAAGLSIGVWLLMVLVFDMALLGILVVDQGRIISGPILNALLFLNPTDLYR
FT                   LTNLTGFNVSQFSGMAGLAGSTNPGLWPLLLGLSVWIAVPLGLSMLSFARREL"
FT   sig_peptide     465739..465885
FT                   /locus_tag="RPC_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.818 at
FT                   residue 49"
FT   gene            466563..467108
FT                   /locus_tag="RPC_0432"
FT   CDS_pept        466563..467108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0432"
FT                   /product="NosL"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86007"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C79"
FT                   /protein_id="ABD86007.1"
FT                   /translation="MKLRLILALAAAVTLAGCKEDTVATAPPAVALNADAMGVFCGMNL
FT                   MEHPGPKGQIITAGRIDPYWFSSARDTVAFTLMPDQPRDIRAIYVSDMGRAASWDAPGD
FT                   TNWIDARKALFVIGGRKQGGMGAAEAVPFGERAAAEAFVAANGGRVVTFDKIPADYVLG
FT                   SEPPAAANEPEHSDVRTN"
FT   sig_peptide     466563..466622
FT                   /locus_tag="RPC_0432"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.638 at
FT                   residue 20"
FT   gene            467127..468128
FT                   /locus_tag="RPC_0433"
FT   CDS_pept        467127..468128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0433"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86008"
FT                   /db_xref="GOA:Q21C78"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C78"
FT                   /protein_id="ABD86008.1"
FT                   /translation="MPTPSLTRRRLITIAATAAGAGLLGRAGLARAATEPLRWQGQALG
FT                   AQVSLEIYHPDRAAAERLIALSLAEVRRLERQFSLYQPDSAICDLNRSGVLIAPDPDMV
FT                   TLLQAALRFAQLTGGAFDPTVQPLWRLYQAHFAAAQPDPEGPSAEALAQAMARVGHDGL
FT                   RVTPDRVVLLKPGAAITLNGIAQGYATDKVVALLRGAGLSTTLVDMGEIRALGARPDGT
FT                   PWRVGLADPDQVGAITETIDLVDRAVATSAGAGFRFDHEGRFTHLFDPATGRSPARYRS
FT                   VSVLAPTATEADALSTAFSLLPRDKIEGIVGERPGVQARMMDLDGRLSCCGA"
FT   sig_peptide     467127..467225
FT                   /locus_tag="RPC_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 33"
FT   gene            complement(468205..468774)
FT                   /locus_tag="RPC_0434"
FT   CDS_pept        complement(468205..468774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86009"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C77"
FT                   /protein_id="ABD86009.1"
FT                   /translation="MSAEIRKSRDVALLDALDGMPRHHFSGAVWRVTPQGRDPLLAGKS
FT                   QSRWCNGTFDVLYTSLTRQGALAEIFALYSSQPVFPSKIRSVAHTIEASSGQTLRLVDL
FT                   AALENLGVRTQNYSEREYGRTQEIADAAYFLGFSGLLVPSARWHGENLVLFTDHIDPEG
FT                   LRVVASDADPIDWSAWRAERRGTAQE"
FT   gene            complement(468775..469113)
FT                   /locus_tag="RPC_0435"
FT   CDS_pept        complement(468775..469113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86010"
FT                   /db_xref="GOA:Q21C76"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C76"
FT                   /protein_id="ABD86010.1"
FT                   /translation="MSTAVMKILNVLRDEGGLQGKDIANIVAVSPATVSRWSSGKATPD
FT                   LKTQTIIAELRYVVDRLAEFYTADETRLWLHTPHPMLDGEKAIDLINAGKTELVLGIIE
FT                   NLDSGAYT"
FT   gene            complement(470559..470858)
FT                   /locus_tag="RPC_0436"
FT   CDS_pept        complement(470559..470858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86011"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C75"
FT                   /protein_id="ABD86011.1"
FT                   /translation="MRAPAPTCLHPQLIGRSFMAFVEGPSRGYLVLNAADKVEAKGCLN
FT                   GVENRVSEFVRSQVKYTRLRPNHAWRYRLITLGRTHGLDPKLRRMIKGHAGQRR"
FT   gene            complement(471000..471086)
FT                   /locus_tag="RPC_R0007"
FT                   /note="tRNA-Leu3"
FT   tRNA            complement(471000..471086)
FT                   /locus_tag="RPC_R0007"
FT                   /product="tRNA-Leu"
FT   gene            471210..472259
FT                   /locus_tag="RPC_0437"
FT   CDS_pept        471210..472259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0437"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86012"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C74"
FT                   /protein_id="ABD86012.1"
FT                   /translation="MQERHQGAAAPRPRFFAIGFQPMASNLDTLVTVFGGSGFIGRHVV
FT                   GALAKRDFRIRVAVRRPDLTGHLQPLGKVGQIHAVQANLRYPDSVQAAVRDAGIVVNLV
FT                   GILAEGGAQKFQAVQAQGAGAIAQAAAAVGARMVHVSAIGADAQSASLYARSKAAGEQA
FT                   VLAAVPQAVIFRPSVVFGPEDQFTNRFAGLARMSAVVPLIGGGATKLQPVYVGDVATAV
FT                   AQAVDGKAKPGATYELGGPEVLTMRQVIEIILDVIQRRRILLSLPFGLARLQAQLLQFA
FT                   PGPLKLTPDQVALLQVDNVVSEAAQAAGLTLQGLGIPPDSLQAIAPSYLWRFRATGQFQ
FT                   RKIVEPKNS"
FT   gene            complement(472455..473261)
FT                   /locus_tag="RPC_0438"
FT   CDS_pept        complement(472455..473261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0438"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86013"
FT                   /db_xref="GOA:Q21C73"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C73"
FT                   /protein_id="ABD86013.1"
FT                   /translation="MLSDILRAVILGIVEGVTEFLPVSSTGHLLLAERFFDLGDTNFWK
FT                   SFTILIQLGAILAILALYFAKLWRIALGMFSDPAAQRFVIGVLVAFLPAAVIGALAGGY
FT                   IKSYLFNPWVVCFSLIVGGAILLWVDQLDLQPTQDEATAFPLPMYLYIGCAQCLAMIPG
FT                   VSRSGATIVGAMLLGADKRAAAEFSFFLAIPTMVGAFVYDLYKNRADMTMDHSLIVAIG
FT                   FAVSFVTAIIVVKSFLAYVTRHGFTLFAWWRVIVGTLGLIALALGK"
FT   gene            473441..474133
FT                   /locus_tag="RPC_0439"
FT   CDS_pept        473441..474133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0439"
FT                   /product="glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86014"
FT                   /db_xref="GOA:Q21C72"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C72"
FT                   /protein_id="ABD86014.1"
FT                   /translation="MYTLFHHPFCPLSRFVRLALGEHGLDLRLVEERPWERRAAFLALN
FT                   PAGTTPVLIADARPAIPGAGVICEFLDESHGPALGDRRMLPTVMDDRIEVRRLVAWFNE
FT                   KFFEEASGPLVTERIYKRFMNEEDGGGPPAMDVIRAATANVRYHLAYIGWLARTRNFLA
FT                   GDQLSYADLAAAAHLSAIDYLGDVPWTEDEAAKAWYARVKSRPSFRPLLSEWLAGVPAS
FT                   RTYVDLDF"
FT   gene            474276..475442
FT                   /locus_tag="RPC_0440"
FT   CDS_pept        474276..475442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0440"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86015"
FT                   /db_xref="GOA:Q21C71"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C71"
FT                   /protein_id="ABD86015.1"
FT                   /translation="MPGRNRSKPRHRIDRIAMSESLNEQLRSQAGALGFDALGICGVDA
FT                   IAGISPRLDAFLDAGLHGTMGWLAEHRDRRADPRVLWPQARSVIMLGMNYGPDADPRAI
FT                   LGERSRGAISVYAKGDDYHELIKPRLKQLARWLIAQAGGDVKVFVDTAPVMEKPLAQAA
FT                   GLGWQGKHSNLVSREFGSWLFLGAIFSTLELSRDAPETDHCGSCRSCLDACPTDAFVAP
FT                   YRLDARRCISYLTIENKAPIPREFRRAIGNRIYGCDDCLAVCPWNKFAAMGREAKLAAR
FT                   DALRAPPLAELARLDDAAFRALFSKSPVKRIGRDRFVRNVLIAIANSDDAGLAAEAERL
FT                   LGDASPLVRGAAVWALARLLPRESFEALAAHHLADEADEDVRAEWQHN"
FT   gene            complement(475518..476273)
FT                   /locus_tag="RPC_0441"
FT   CDS_pept        complement(475518..476273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0441"
FT                   /product="protein of unknown function DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86016"
FT                   /db_xref="GOA:Q21C70"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C70"
FT                   /protein_id="ABD86016.1"
FT                   /translation="MLDAAIKALTQILAPPMRAILYRSIGFALVLITVMAIGLQRALSW
FT                   FAESGEVWAETALGSSFHAPLNILAWVLSIAAGLGVVLGAVFLMPAVTSLVAGFFVDDV
FT                   AEHVEREHYPDERPGVALPFGLAITESTKTALLTILVYLLALPFVFIAGAGFIAFFVAT
FT                   AWLLGREYFELAAMRFRPAAEAKAMRKEYATTVFFAGLVIAAFVSIPIVNLATPLFGMA
FT                   FMVHMHKRLSGPRPELIVDAPRRRDLPVA"
FT   gene            complement(476349..477296)
FT                   /locus_tag="RPC_0442"
FT   CDS_pept        complement(476349..477296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86017"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C69"
FT                   /protein_id="ABD86017.1"
FT                   /translation="MGVVLDRIGKLIAAYLQKEVPGYEPFTPSDPEHLRMTMQPGDVLL
FT                   VEGNNRVSGIIKYLTQSTWSHAALYVGPIDGACEPNGEPHVLIEANIGEGVESSPLSRY
FT                   FPYHTRLCRPVGLSYEDRTTVCRYAINRIGFGYDTKNILDLMRYLFPLPVPQRWRRRLI
FT                   ALGSGDPTKIICSALIAQAFDAVRYPILPKVTRAGSRAARREILQIRDSSLYMPRDFDI
FT                   SPYFNIVKPTIVSGFDYTALHWADKQKPLTEVPDPDDPFLGAVDAPALMAEAADPQAPL
FT                   GNADAALVERVRVTEHFTVVDYVPARPPQRERVA"
FT   gene            477481..478911
FT                   /locus_tag="RPC_0443"
FT   CDS_pept        477481..478911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0443"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86018"
FT                   /db_xref="GOA:Q21C68"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C68"
FT                   /protein_id="ABD86018.1"
FT                   /translation="MSRREFLAASAALALTPALRWPAFAAPLPREADVVVIGAGAAGIA
FT                   AARRIIAAGRKVIVIEAGRQVGGRCLTDTTSFEVPFDRGARWLHNPETNPLVKLARGAG
FT                   LDVAPAPPGQKLRIGRRNARPGETEDLLASLVRANRAIDDAARKADLSCAAALPKDLGD
FT                   WAGTVEFLLGPYATGKDLKDLSALDQFRAQDRNAMVACRQGLGTMIGKLGEGLPVALAT
FT                   PATRITWGGRDVGVETPAGRITARAVIVTVSSNVLASGAIKFAPELPKRQLDAAAKLTL
FT                   GSYDHVALLLSGNPLGLPKDEIMIEQSSDARTAFLVANMAGSSLCSVDVAGAFGRDLAA
FT                   QGEAAMIDFAKEWLGKLFGSDAVAEVQGASATRWNAQPLVQGAMSAALPGGQFARRVLA
FT                   EPIGNLFLAGEASHETLWGTVDGAWDSGERAADAALKRIGSLKSDTPAQSSPRKPKQRR
FT                   ERGVSGASAGDLGWPGRR"
FT   sig_peptide     477481..477558
FT                   /locus_tag="RPC_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(479069..481480)
FT                   /locus_tag="RPC_0444"
FT   CDS_pept        complement(479069..481480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0444"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86019"
FT                   /db_xref="GOA:Q21C67"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C67"
FT                   /protein_id="ABD86019.1"
FT                   /translation="MKFSLSWLKDHLDTDESLERLADKLTMIGLEVEGIEDKAKLLKPF
FT                   SIAQIISAEQHPNADRLRVCKVDTGAAEPLQVVCGAPNARAGLKTVFAAPGTYIPAKDF
FT                   TISVGTIRGVESQGMMCSAGELALPDGIDGIIELPTDAPVGVSYAEWAKLGDPVLDINL
FT                   TPNRQDCAGVRGIARDLAAADMGRLIDHAIKPIRGEFPCPVKVAVEDDKLCPGFAMRLV
FT                   RGVKNGPSPEWLQQRLTSIGLRPINALVDITNYLTFDRARPLHVFDAAKVKGDLTVRHA
FT                   RDGETLLALDGKTYTLDSKVCVIADETGVESLAGIMGGEASGCSNETTDVLIESALWNE
FT                   INIAQTGRRLGINSDARYRFERGVDPAFMVPGLELATKLVLEFCGGSPSEIVVVGNAFG
FT                   DDRLIDFPLAEVKRLAGIDVALPEARRILSRLGFMVAGSGQTVKVAIPSWRSDVQGKAD
FT                   IVEEIVRIVGVDKVPLTPFERGDAPRKPVLTPIQLRTRRAKRALAARGLVEAVTWSFIS
FT                   KPQAELFGGGQPELALANPIAADLSDMRPSLLPGLIAAAQTNADRGNSDLALFEVGQVF
FT                   KGDRPQDQLVAASGVRHGFASSAGLGRHWSGSAAADALDVKADAFAVLAAAGCPMQALQ
FT                   IVTGKALPAWLHPGRSGAIQIGPQNVLGYFGELHPRALEALHADGPLLAFEVILDNIPD
FT                   GKQKPTRAKPTLELSAFHPVSRDFAFIVDRSVRAGDIVRAAQAVDKKLITGVSVFDVYE
FT                   GKGIDEAKKSVAIAVTIQPRDKTLTDQEIDAIGSKIVAEVTKKTGGSLRG"
FT   gene            complement(481477..481953)
FT                   /locus_tag="RPC_0445"
FT   CDS_pept        complement(481477..481953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86020"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C66"
FT                   /protein_id="ABD86020.1"
FT                   /translation="MTELEDRLLVVARDLCRRTGKRPREAFMRRAVSSAYYAVFHALCR
FT                   LCADTIIGGIHHKSQAWQRVYRGVSHTGAKAVLTSSKELSAFPAEVADFGVAFVLLKKE
FT                   REQADYSSAPFEKYFAGTESLVEQAANAIVILGKLEDAHRRALAAALLVKARTS"
FT   gene            complement(481950..482246)
FT                   /locus_tag="RPC_0446"
FT   CDS_pept        complement(481950..482246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86021"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C65"
FT                   /protein_id="ABD86021.1"
FT                   /translation="MNLDDVKKLTRKTLSAQLAAYGFDDVVVSAGKDHDEDDALFMTAK
FT                   YKSGSALPSGDVLNRTLAILRRELQKAGEERFPYLTHSPEGEETGYDDEDAPE"
FT   gene            complement(482263..483345)
FT                   /locus_tag="RPC_0447"
FT   CDS_pept        complement(482263..483345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0447"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86022"
FT                   /db_xref="GOA:Q21C64"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C64"
FT                   /protein_id="ABD86022.1"
FT                   /translation="MSDLAALQHTILADIAAASDEAALEAVRVAALGKKGAISALLATL
FT                   GKMSPEERKTEGAAINLAKMVVTDALAARRELLKNAALDKRLASETIDVTLPLRENPAE
FT                   QGRIHPLSQVMDELTTIFADMGFAIAEGPDIETDDYNFTKLNFPEGHPAREMHDTFYFN
FT                   PKQDGSRLLLRTHTSPVQVRTMLSQKPPIRVICPGRTYRSDSDQTHTPMFHQVEGLVID
FT                   KGSHLGHLKWILHEFCKAFFEVDNINMRFRPSFFPFTEPSLEVDIQCRRDKGEIRFGEG
FT                   EDWLEILGCGMVHPNVLTACGIDPEVYQGFAWGMGIDRIAMLKYGMSDLRQLFEADVRW
FT                   LNHYGFKPLDVPTLAGGLSS"
FT   gene            complement(483539..483898)
FT                   /locus_tag="RPC_0448"
FT   CDS_pept        complement(483539..483898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0448"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86023"
FT                   /db_xref="GOA:Q21C63"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C63"
FT                   /protein_id="ABD86023.1"
FT                   /translation="MARVKRGVTAHAKHKKVYKLAKGFRGRRKNTIRTAKAAVDKAGQY
FT                   AFRDRKRKKRTFRALWIQRINAAVRPLGMTYSVFINGLAKSGVMVDRKVLSDLAITEPA
FT                   AFLAIAEKAKAALAA"
FT   gene            complement(483984..484184)
FT                   /locus_tag="RPC_0449"
FT   CDS_pept        complement(483984..484184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0449"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86024"
FT                   /db_xref="GOA:Q21C62"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C62"
FT                   /protein_id="ABD86024.1"
FT                   /translation="MPKLKTKSGAKKRFKVTGTGKVVSAHAGKRHGMIKRTKKQIRQLR
FT                   GTRILFKTDGENIKKYFLPNA"
FT   gene            484452..484883
FT                   /locus_tag="RPC_0450"
FT   CDS_pept        484452..484883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86025"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C61"
FT                   /protein_id="ABD86025.1"
FT                   /translation="MLTRPLSHHSAEFDSSAAAPWRLVVVLAVAVIGAAGDAEAKDARR
FT                   APAGLYDGIWNVEFATQAGTCSSGYRVPFTVTGRLVSSAGGGKVSGGIGRGGAVSVRVA
FT                   VGASVANGSGRLGGNVGAGRWSGIISGDRCSGVWQATRG"
FT   gene            complement(484975..485973)
FT                   /locus_tag="RPC_0451"
FT   CDS_pept        complement(484975..485973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0451"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86026"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C60"
FT                   /protein_id="ABD86026.1"
FT                   /translation="MDKRTLGRSGPTVSALGLGCMGMSDFYGPADRGESIATIHAALDA
FT                   GITLLDTGDFYGTGHNELLIREAVAGRDRDGFQLSVKFGALRDPAGGFTGYDGRPLAVK
FT                   NFLAYSLGRLGVEHIDIYRPARLDPNVPIEDTIGAISELVQAGYVKHIGLSEVSADTIR
FT                   RAHKVHPIADLQIEYSLISRGIEADILPTCRELGIGVTAYGVLSRGLISGHWQKDHAAA
FT                   RDFRSVSPRFSGANLDANLALVERLREVAAELGASVAQVAIAWVAAQGADIVPLVGARR
FT                   RDRLTEALGALAVKLTPAQLATLAGAFPPDVAAGGRYPQEHLVHLDSEKRN"
FT   gene            486094..487008
FT                   /locus_tag="RPC_0452"
FT   CDS_pept        486094..487008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0452"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86027"
FT                   /db_xref="GOA:Q21C59"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C59"
FT                   /protein_id="ABD86027.1"
FT                   /translation="MTDLDLRDLAAFVAVARSKNFRRAALESAVSVSSLSQRLRDIEER
FT                   LGVRLLHRTTRSVALTEAGEALLARVGPALRDVDAALDQVRGLRGVPAGRLRINAPAPA
FT                   VDLVLAPMVTPFLQAYPQIDLEIVAQTSLIDIVAAGFDAGVRYGEHLAQDMIAISLGPP
FT                   ERFVVVASPHYVAQHGAPKQPQDLLAHRCIRIRFESGAMPDWEFEQAGRVVRVTPRGPL
FT                   VAGYSQLAIRAALDGLGFFAAFEGYVRADIAAGRLVSVLDDWCEPFPGPFLYYPSRRQP
FT                   PPALAALIGFVMEWRKKERRAGL"
FT   gene            complement(487129..489402)
FT                   /locus_tag="RPC_0453"
FT   CDS_pept        complement(487129..489402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0453"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86028"
FT                   /db_xref="GOA:Q21C58"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C58"
FT                   /protein_id="ABD86028.1"
FT                   /translation="MAWGKKKGSARQEPVFDLSSSLSGLRLSVQDRIGPPDEKLIKPKA
FT                   DAAKKADAKKPAGKSPKKPKSKPRGRISAAIFKLFYWGAVTAIWGVIAVVGLLIYVGAH
FT                   LPAIQSLEIPKRPPTIQIVGFDGSVLATRGEQAGTNIALKDVPPYLPKAFIAIEDRRFY
FT                   DHYGVDPIGIARAAAANIAHRGVSQGGSTLTQQLAKNLFLTQERTLQRKLQEVELALWL
FT                   ERKHSKSEILELYLNRVYFGSGAYGVEAAAQRYFGKSAKNVTLAEAAMLAGLVKSPSRL
FT                   APNRNPEGAENRAKTVLGAMADAGFITPAQAQVASANPSGTVKPSGAGTINYVADWIGE
FT                   VLDDLVGQIDRSIIVETSIDPKLQSVAEAAIIDELAAKSVKFNVSQGALVAMTPDGAVR
FT                   AMVGGRNYADSQFNRAVTAKRQPGSAFKPFVYLTALEAGLTPDTIRQDAPIDVKGWRPE
FT                   NYSHEYFGAVTLTQALAMSLNTVAVRLGLEVGAKSVVRTAHRLGIASKLDANASIALGT
FT                   SGVSLVELVGAYAPFANGGLGTAPHVVEKIRTADGNKVLYDRPQDAPAQVIEPRYVAMM
FT                   NSMMQETLISGTARKAEIPGWTAAGKTGTSQDFRDAWFIGFTSKLVTGVWLGNDDNAPT
FT                   KKATGGGLPVEVWTRFMRTAHQGQTPLPLPGAGQTGAGIATVAQVGSRGDPGLLQQGTA
FT                   QQGYASQPGYAASGPGGSNYQQAPSPPIPVNGGGRSAPQRAQTTRPEAAGGLDGWLVER
FT                   LFGR"
FT   gene            complement(489560..491053)
FT                   /locus_tag="RPC_0454"
FT   CDS_pept        complement(489560..491053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0454"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86029"
FT                   /db_xref="GOA:Q21C57"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C57"
FT                   /protein_id="ABD86029.1"
FT                   /translation="MSTTAAARSQSTALSLRDRLKHPALLREACYIDGQWTGTPETVVS
FT                   NPVNDLELGRVPKLGATEATQAVEAAQRAFPAWAKLTAKQRSNIMRKWYELIVANREDL
FT                   ALILTSEQGKPLTEALGEVDIGAAYVEFFAEEARRVYGETIPTQRPDARLIAIKQPIGV
FT                   CGAITPWNFPNSMITRKVSPALAAGCTVVLKPANETPFSALALAALAEQAGLPNGVFNI
FT                   VTGHASAIGKVLCEHPAVRFVGFTGSTEVGKILYQQAAVGVKKLGLELGGNAPFIVFDD
FT                   ADVDAAVDGAMVSKYRNMGQTCVCANRIYVQDGVYDAFVEKLAAKVGAMTIGDGTEPGV
FT                   TQGPLINQAAVEKTERHIADAVANGATIVIGGKRHARGGTFFEPTVLANVKPDALVAHE
FT                   ETFGPLAPVFRFKTEEEVIKLANDSPFGLASYFYARDLGRVWRVAEALEAGMVGVNSGL
FT                   ITTEVAPFGGVKESGLGREGSHHGMEDYVEIKYVMMAGI"
FT   gene            complement(491198..491527)
FT                   /locus_tag="RPC_0455"
FT   CDS_pept        complement(491198..491527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86030"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C56"
FT                   /protein_id="ABD86030.1"
FT                   /translation="MIVGWGGWKSYPRPGRGENIEAPIGPGIYEVRYANTGELFDFGAV
FT                   DNVAQALAGLQVTPRSLASFFGRRNAAPFPPLEYRICATATKADARIAAERMIGRRETY
FT                   LRGAA"
FT   gene            491816..493003
FT                   /locus_tag="RPC_0456"
FT   CDS_pept        491816..493003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0456"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86031"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C55"
FT                   /protein_id="ABD86031.1"
FT                   /translation="MREQAQIDQFLRQHADTGEIPGVVAIAATGSDIVYQGAFGRRDLS
FT                   KPDPMTPDSVFWIASMTKAITAAAAMQLVEQGKLSLDQPIGGLLPELAAPQVLDGFDAE
FT                   GNPRLRPATTRITLRHLLTHTSGLCYDMWNADMVAYRDKFGVPPITSCRHAALQVPIMA
FT                   EPGSRWEYAIGLDFVGKAIEAATGMRLDAYLRDHILAPLGMTDTAFKIGAAQRQRLVAM
FT                   HFRGPDGSLAPIPFELPQEPEFHMGGGGLYGTASDYIKFTQMILNQGRGNGNQILKPET
FT                   VAQMSQNHIGELCVGKMNSAIAFATNDVDLYPDMDKKWGLSFLINTAPTPEGRSPGSLA
FT                   WAGLANTYYWIDPSRDICGVILMQVLPFADPKCLAAFSGFERGVYAGLDAAQRAA"
FT   gene            complement(493414..494415)
FT                   /locus_tag="RPC_0457"
FT   CDS_pept        complement(493414..494415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0457"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86032"
FT                   /db_xref="GOA:Q21C54"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C54"
FT                   /protein_id="ABD86032.1"
FT                   /translation="MTSAKYDVLGIGNAIFDVLAPTEDDFLIKHGMVKGSMTLIDEPRA
FT                   AAIYAQMSQAVEMSGGSAANTIVGLANFGARAAYVGKIKDDQIGRLYSHDIRAAQVAFD
FT                   TKPALGGPASGCTYILVTPDGERTMNTYLGAAQDLGPDDIDPAQIAAASLIYLEGYLWD
FT                   PKNAKEAFLKASKIAHAAERQVALTLSDPFCVDRYRSEFLELMRTGTVDMIFANESELH
FT                   SLYQTADFDTALNQLQQDVALGVVTRSEKGCAVVAPDSITLVPASRIDKLVDTTGAGDL
FT                   FAAGFLFGLVRGTSFEDAGRLGALAAGEVIQHIGARPQVSLKDLAQQNGLPV"
FT   gene            494500..496113
FT                   /locus_tag="RPC_0458"
FT   CDS_pept        494500..496113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0458"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86033"
FT                   /db_xref="GOA:Q21C53"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C53"
FT                   /protein_id="ABD86033.1"
FT                   /translation="MARPITFAPTPARLHPADGFMIRPLLTVSSGTLASRLLGFVRDAL
FT                   VAALLGAGPVADAFLVAFQLVNVIRRLLTEGALNAALVPAWLRLRDAQGAAAAAAFAGR
FT                   VLGTVSAALVAAAVLIGLAMPLLIALLAPGFVGGPSLALAVDNARLMLPYLAFAGPVTV
FT                   LMGVLNAQQRFALTAFSPLLFNLALIGVMVALLLRPHDAAQAALLMAATIGAAGLLQLS
FT                   MLVWRRGAAVAGPLRISFDGEMRGFFAKAVPGMLANSGPQLLIVGGAIIASHAPAVVSW
FT                   LYFANRLIELPLGIVGTAMGTVLVPELTRAVQGGDKAAIAQAESRALELAVGLALPAML
FT                   GLIVLSEPIVRLLFEHGAFGAADAAATAQALAFLALGLPAHVAVKAIAPAFFARDNTRA
FT                   PLNAMLGGLGLAIVAAMPLGALFGASGIAAAVALGAWGSAWLLIRKAAASFGFAVDVLA
FT                   RRRLVLIAVAAAAMAGLLWLKAAFALPLVAGASIAIQALALGLVITGGIIIYGGLLMLL
FT                   GVVNPSDLLRALQRPDRLRD"
FT   gene            496181..497230
FT                   /locus_tag="RPC_0459"
FT   CDS_pept        496181..497230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0459"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86034"
FT                   /db_xref="GOA:Q21C52"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C52"
FT                   /protein_id="ABD86034.1"
FT                   /translation="MTIERVFSGVQPTGNLHLGNYLGAIVNFVKLQDTHNCIYCVVDLH
FT                   AMTMPISVWGGPDELRRHTREVTSAFIASGIDPKKQIIFNQSQVSEHAELAWVFNCVAR
FT                   LGWLNRMIQFKEKAGKDRENASVGLYDYPVLMASDILVYRATHVPVGEDQKQHMELTRD
FT                   IAQKFNNDFSASIAAQGYGEAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRIN
FT                   LTDDADAIAQKIRKAKTDPEPLPSEEKGLEPRPEADNLVGIYAALAGKPKSEVLAEFGG
FT                   AQFSGFKSNLVDLAVSKLAPLAAEMKRLTADTTYVDQVLADGADRARVIAAETMNAVKD
FT                   IVGLVRKKG"
FT   gene            497539..498033
FT                   /locus_tag="RPC_0460"
FT   CDS_pept        497539..498033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86035"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C51"
FT                   /protein_id="ABD86035.1"
FT                   /translation="MRTQRRSYEPGHQPKCLVIVDETAEWDRAVYYASRWAVRIGGGVV
FT                   MLRVIEILDHNQQWLGVADVMRAEAQEIAETALDRASGRANGIAAITPERVIREGDPLE
FT                   QIKDVIHRDVDIVMLVLAANAGAEGPGPIVTTMLRGIGAFPIPVMIVPGNLTDDEIDAL
FT                   S"
FT   gene            498193..499788
FT                   /locus_tag="RPC_0461"
FT   CDS_pept        498193..499788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0461"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86036"
FT                   /db_xref="GOA:Q21C50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C50"
FT                   /protein_id="ABD86036.1"
FT                   /translation="MSASISLTNLAWSTPDGRTLFSGLTLHFGRGRTGLVGRNGIGKTT
FT                   LLKLIAGGLVPQTGEVSIHGRLAMLDQTVQAAADAAVADLFGVADGLALLRRAEAGLLV
FT                   ADDQVGIDWTLETRIARALRRFGLQLALDAPLTNLSGGQLTRAKLAALAFAKPDFALLD
FT                   EPTNNLDRDGRAAVMAMLAEWQGGAIIVSHDRDLLETMDTIVELTSRGATSYGGNWSSY
FT                   RARKAIELASARQQLADAERRVGALAHAAQRGQERKARKDRVGRNKGRRGDIPAIALGL
FT                   RKAGSENTAGEAARLAERRRQQASEAVDAARQRIEILQPLAVALPSTGLSATKTVLEID
FT                   ALSGGYQIGCPIVENFTLKLVGPERVAIGGPNGSGKTTLLSLITGGLPPWSGRVRIMTG
FT                   FAMLDQQVSLLDRSVSIRDNFRRINPGCDENACRAALARFMFRADAALQIVSGLSGGQA
FT                   LRAGLACVLGGPAPPALLILDEPTNHLDIDAIEAVEAGLRGYDGALLVVSHDPAFLATI
FT                   GITRWVQLQVPPRA"
FT   gene            499907..501088
FT                   /locus_tag="RPC_0462"
FT   CDS_pept        499907..501088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0462"
FT                   /product="alanine racemase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86037"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C49"
FT                   /protein_id="ABD86037.1"
FT                   /translation="MMETDMLAPASNPGTPRLQELATPCLLLDEARLRGNVATMKRHLE
FT                   MLGVGFRPHLKTAKCLEVARIAMTHPGGPATVSTLREAEFFAAGGVRDMIYAVGIAPQK
FT                   LDRVGAIRKRFGADLAVILDSVEQADAVVEWVKANADALPVLIEVDADGHRSGVAPNDA
FT                   ATLTAIGRRLIEGGADLRGVLLHAGDSYGLSDPAAIAAAAEAERAAAVGAATQLRHAGL
FT                   PCPVVSIGSTPTARFAKELAGITEVRAGVFMIGDLVQAGIGACAIDDIALSVLGSVIGQ
FT                   QRAKGWIIVDAGWMALSRDRGTARQAVDQGYGLVCDLAGQPYPDLIVKDANQEHGIVAV
FT                   RPGSGAALPDLPIGAQLRILPNHACATGAQHDRYHVLDDAGAVSAIWPRINGW"
FT   gene            501258..501824
FT                   /locus_tag="RPC_0463"
FT   CDS_pept        501258..501824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0463"
FT                   /product="nitrogen-fixing NifU-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86038"
FT                   /db_xref="GOA:Q21C48"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C48"
FT                   /protein_id="ABD86038.1"
FT                   /translation="MFIQTEPTPNPATLKFIPGRVVLDSGTMEFNDRATAARSPLAERI
FT                   FEVPGVTGVFYGSDFVTVTKDDSDWQHLKPSILGAIMEHYMSGEPLMADGRVDGDEPSE
FT                   DDEFFDKADAETVDMIKDLIETRVRPAVANDGGDITFRGFKDGIVYLKMQGACSGCPSS
FT                   TATLQHGIQNLLKHFVPAVVEVRPI"
FT   gene            501958..502653
FT                   /locus_tag="RPC_0464"
FT   CDS_pept        501958..502653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0464"
FT                   /product="peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86039"
FT                   /db_xref="GOA:Q21C47"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C47"
FT                   /protein_id="ABD86039.1"
FT                   /translation="MLILAIDTALDACAAGVLNTDSATMIAQQSLPMQRGHAEALVPLI
FT                   ARVMADAGISFEALDRIAVTTGPGSFTGLRVGLSAARGIALAADRPVVGLTTLAAFAAP
FT                   LLGETAGDPILSAIDARHDQVYYQVSGGDGTTLLRPRVAPIDQAIAAAARFGAPRLVGN
FT                   AAQLLAARWPSDAPPVFVDAQPAPDIGWVAWLGAAVTPENSPARPYYLRPPDAKPQIPA
FT                   VQFAAAPSA"
FT   gene            502721..503206
FT                   /locus_tag="RPC_0465"
FT   CDS_pept        502721..503206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0465"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86040"
FT                   /db_xref="GOA:Q21C46"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C46"
FT                   /protein_id="ABD86040.1"
FT                   /translation="MMTWLAEFWGYADAQVEGATLRDAARLSELHAASFHRGWSEQEFE
FT                   DMLSQRNTLVHRLRLGRRIIGFVVSRMAADEAEILSIAIDPGYRGRRLSRELLQTHLGH
FT                   LAGRGVKTLFLEVEENNQPARRLYDHFNFAVVGRRERYYRQPDGEQLNALLMRRDLS"
FT   gene            503271..503726
FT                   /locus_tag="RPC_0466"
FT   CDS_pept        503271..503726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0466"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86041"
FT                   /db_xref="GOA:Q21C45"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C45"
FT                   /protein_id="ABD86041.1"
FT                   /translation="MTALEAMPVLKSTEIEARCAATGMRMTEQRRVIARVLAQAEDHPD
FT                   VEELYRRCVAVDDKISISTVYRTVKLFEDAGIIERHDFREGRARYEQMRDSHHDHLINL
FT                   RDGTVIEFTNENIEKLQAEIARELGYKLVDHRLELYCVPLDDDKKAE"
FT   gene            503723..504382
FT                   /locus_tag="RPC_0467"
FT   CDS_pept        503723..504382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0467"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86042"
FT                   /db_xref="GOA:Q21C44"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C44"
FT                   /protein_id="ABD86042.1"
FT                   /translation="MSVDLVIFDCDGVLVDSEIISCRVFAQALTHSGYPITADQVHDRF
FT                   LGRSSRETRREVERELGRMLPDDFHAQLNVELFRQLETSLEPMPHIAQALDALAQPVCV
FT                   ASSGPPQKIGVSLNRVGLYDRFAPHIFSATQVARGKPAPDLFLFAAAQMGADPARCLVI
FT                   EDSVAGITAARAAGMATLGFAGGSHCRPGHGQTLRQAGARAAFDDMRQLTDLIVEI"
FT   gene            504521..505942
FT                   /locus_tag="RPC_0468"
FT   CDS_pept        504521..505942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0468"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86043"
FT                   /db_xref="GOA:Q21C43"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C43"
FT                   /protein_id="ABD86043.1"
FT                   /translation="MTQPRKLHIKSFGCQMNVYDAQRMVDALAPEGFVETANADEADLV
FT                   ILNTCHIREKASEKVYSELGRLRVAKDEAALQGRRMNIAVAGCVAQAEGAEIIRRQPAV
FT                   DVVVGPQSYHHLPQLLAEAARGGRALETEFPVDDKFGFLPPPQPDAIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEVSRPVDKIVEDVRRLADNGVREITLIGQNVNAYHGDGPDG
FT                   RPWPLGALLHHLAKIPGIVRLRYSTSHPRDVDQSLIDAHRDLPALMPFVHLPVQSGSDA
FT                   ILAAMNRKHSADDYRRLVDRFRSANPAIAFSSDFIVGFPGETDEDFAATLALVTQIGYA
FT                   GAYSFKYSPRPGTPAAELQETVSAAVMDERLVRLQELIDSQQAAFNAAVIGTTVEVLFE
FT                   RAARNPGQIVGRTAYLQPAHVMAAPDIIGQVLPVRIDSLERYSLIGELAAPQQHSGFAT
FT                   RSEDSPQSLPITTGA"
FT   gene            505947..507005
FT                   /locus_tag="RPC_0469"
FT   CDS_pept        505947..507005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0469"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86044"
FT                   /db_xref="GOA:Q21C42"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C42"
FT                   /protein_id="ABD86044.1"
FT                   /translation="MPKSASDSPSLAPRRKLDRESQTQPETQVVVAFDDNRAVSSLVGP
FT                   YGQNLALVERRLAVVVDSRGNHITIAGSREGCDAARRVLDTLYELATQGHDLAQGDVEG
FT                   AIRAVIAQGSLFEFDAKPSSSAFEAINLRKRPVRARTAAQDSYIRALKRHELVFGIGPA
FT                   GTGKTWLAVAHAAQLFERKEVDKIILTRPAVEAGERLGFLPGDLKEKVDPYLRPIYDAL
FT                   YDLMDSRIVEKALQSNEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGEN
FT                   SRMIVTGDPSQVDLPNGQTSGLAEAAKLLDGVEGIAQVKFTAGDVIRHELVARIVAAYE
FT                   GVPRPAASKNGG"
FT   gene            507074..507580
FT                   /locus_tag="RPC_0470"
FT   CDS_pept        507074..507580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0470"
FT                   /product="protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86045"
FT                   /db_xref="GOA:Q21C41"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C41"
FT                   /protein_id="ABD86045.1"
FT                   /translation="MTRFIPPATEVLIVADCWQAEAEAEAIVLRAIEAAAAMTDADTAD
FT                   AELAVMLTDDAGVQTLNANWRGIDKPTNVLSFPALQPEGDAPDDAPKMLGDIAIAYQTT
FT                   RREADDEGKPFDHHLSHLAVHGFLHLVGYDHEKDAEAEAMESLEREILAQLGVPDPYAD
FT                   QDRVN"
FT   gene            507582..508844
FT                   /locus_tag="RPC_0471"
FT   CDS_pept        507582..508844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0471"
FT                   /product="CBS"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86046"
FT                   /db_xref="GOA:Q21C40"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C40"
FT                   /protein_id="ABD86046.1"
FT                   /translation="MPDPDPAQDNPVSDTMPSSSSLPAVVHQGDVMRPAADNWLLRAIR
FT                   TLFGWKPGSVREDLQVVLDATTPDDTGFSAIERTMLRNILGLHERRIADVMVHRADIVA
FT                   IKQDITLGELMGLFESAAHSRLVVYNETLDDPVGIVHIRDLLAYMTARARDELPSKSKA
FT                   SSKAAAAATPAAAVKTSPAKTSPAKTSPGKSSRKKPSPNSLDLRAIDLKIPLTETGIIR
FT                   KLLYVPPSMRAIDLLAQMQASRIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSA
FT                   EPPSIVRQADNSFIADARASLEDVRQVIGEDFVTGEAGEEVETLGGYLVTHVGRLPVRG
FT                   EVISGPGNYEIEVLDADPRRVKRLRIGVRKERPAPRQRELRRRDAPNEPGPAQGNEPGP
FT                   PQGNDNANVGPATPGDGVGSP"
FT   gene            508841..510445
FT                   /locus_tag="RPC_0472"
FT   CDS_pept        508841..510445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0472"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86047"
FT                   /db_xref="GOA:Q21C39"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C39"
FT                   /protein_id="ABD86047.1"
FT                   /translation="MTLARVLRSIGMSIILAWGWKRAAIALSAGALSSLAMAPINAWPV
FT                   LFVTFPVLVWLIDGAGAGRWRGVGAAALTGWWFGFGYFVPGLYWIGYAFLVDAPTFGWL
FT                   LPVAVCGLPAYLALFTALGAALARLLWTKDATRVLALAVSLTIGEWLRGHLLTGFPWNA
FT                   FGYALTEPLALAQTVSVIGLWGMTFVAVAIFASPAVLLDDGAATRRPWLAPAAALTVLI
FT                   AMAAYGMIRLSLEPTATVANVRLRIMQPNLQQDVRFNYAAKAEVMRKYLALSDRATGPQ
FT                   TTGVRDATILIWPESAFPFFLAREADAMAQIADLLPKDTILITGSVRAPELPPGTRITR
FT                   AYNSIYAIDHDGSILSVYDKLHLVPFGEFLPYQDLMEKIGFVQLTKVQGGFIPGDRRRA
FT                   IDLPHAPRVLPLICYEAVFPDELGSREGVGWIVNLTNDGWFGISSGPYQHLQQTRVRAI
FT                   EQGLPIVRAANSGISAVIDPLGRIVARLDLGVEGVLDSALPAARKPTLYARFGNIPAVI
FT                   IIALTMIVVLRRRLANS"
FT   sig_peptide     508841..508969
FT                   /locus_tag="RPC_0472"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.811 at
FT                   residue 43"
FT   gene            510669..511085
FT                   /locus_tag="RPC_0473"
FT   CDS_pept        510669..511085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0473"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86048"
FT                   /db_xref="GOA:Q21C38"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C38"
FT                   /protein_id="ABD86048.1"
FT                   /translation="MSTKAPNPVDKYVGSRVRMRRIMLGMSQEKLGEALGLTFQQVQKY
FT                   EKGTNRVGASRIQQISEILQVPVSFLFEGGPGGLAKADGFAEAASPAYVSDFLATSEGL
FT                   ALTRAFTRITDSKLRRSIVDLVEQIASREAPDQR"
FT   gene            511291..512046
FT                   /locus_tag="RPC_0474"
FT   CDS_pept        511291..512046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86049"
FT                   /db_xref="GOA:Q21C37"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C37"
FT                   /protein_id="ABD86049.1"
FT                   /translation="MPDPRDDDEAATAMPERAFFGRRKGHKLRSHQADLIAELLPRLSF
FT                   DLGAPAPARLETLFASGIAEVRLEIGFGGGEHLIAEALAHPTTGFIGCEPYVNGMAKIL
FT                   AQIEARELGNIRLFAGDAAELLAWAPPASLARVDLIHPDPWPKRRHWKRRFVQDTSVAA
FT                   MARVLHEDGEFRFVSDIDDYCAWTLAHLLRSKEFCWTAERACDWQLPFAGYTMTRYGRK
FT                   AEREGRRAAYLHFRRAAAAPNDRAKAGEL"
FT   gene            512279..512671
FT                   /locus_tag="RPC_0475"
FT   CDS_pept        512279..512671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0475"
FT                   /product="protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86050"
FT                   /db_xref="GOA:Q21C36"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C36"
FT                   /protein_id="ABD86050.1"
FT                   /translation="MTPNLLGDTYRDYIACLNQQDWAKLDYFVDHEVIHNGQPIGLRGY
FT                   LEMLQGNYREIPDLLFKIELLICDPPRVASRLRFDCAPRGEFLGVAVNGRRVSFAENVF
FT                   YEFAEAKIVRVWSVIDKAAIEAQLAG"
FT   gene            complement(512691..513776)
FT                   /locus_tag="RPC_0476"
FT   CDS_pept        complement(512691..513776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86051"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C35"
FT                   /protein_id="ABD86051.1"
FT                   /translation="MPFADTLFPGLDDIVKHGDPGRRADAVRRIAELFVAGADNFHADH
FT                   VNLFDGVFATLVPQTGIEVRGELSERLAALSNAPPVLVRNLARDEEVRVAGPLLSRSLL
FT                   IDDHTLIEIAQLRGQSHLLAIAQRPTLSPPLTDVIVVRGDGAVVRRLAGNAGADFSPVG
FT                   YSGLVRRAGLDDMLAVTIGQREDLPAPVLKDLLAASVDVVRQRLFEIAKPAAKIAINRA
FT                   MSELASAPGHVAVVRDFAPAQRLIVSLHNDGALNEAALLGFARTHRYEESVAALSAMSG
FT                   VRIRTLDQLLMGERQDPILILGKSIGIEWATVRALIGLRFGPGRSPSAPDIEEARLNFQ
FT                   RLAPTTALRVLNFWRMREPGA"
FT   gene            514077..514895
FT                   /locus_tag="RPC_0477"
FT   CDS_pept        514077..514895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0477"
FT                   /product="protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86052"
FT                   /db_xref="GOA:Q21C34"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C34"
FT                   /protein_id="ABD86052.1"
FT                   /translation="MPDRLHLTLDMTDPTPAAVDLDLLAEPRLVVEPGLGARVAAVAGP
FT                   VLQGMGYRLVRIKVSGELGCTVQIMAERPDGTMLVEDCEAISHALSPVLDIADPVERAY
FT                   RLEISSPGIDRPLVRRSDFERYEGYLVKIEMAVAVGGRKRFRGLLGPLQGDAVLLAREG
FT                   ARDGEDPNSLLPLEDIASANLVLTDELIAESMRRGKIAEREMKRELGVLPPPPPHAKKS
FT                   DPTKSNAPKAKLPKAKLKAAKKPPPTNTKEHRLAAAERKRLGQTDPTEGD"
FT   gene            514898..516523
FT                   /locus_tag="RPC_0478"
FT   CDS_pept        514898..516523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0478"
FT                   /product="NusA antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86053"
FT                   /db_xref="GOA:Q21C33"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C33"
FT                   /protein_id="ABD86053.1"
FT                   /translation="MAAVSANKLELLQIADAVAREKSIDRSIVIAAMEDAIAKAARARY
FT                   GSETDVHAEIDAKKGELRLSRHMLVVEEVENSSNQISLKDAQRANPGAQIGDTIADTLP
FT                   PLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVIVDLGRG
FT                   EAIVRRDEMLPREVFRNGDRVRAYIFDVRRETRGPQIFLSRTHPQFMAKLFAQEVPEIY
FT                   DGIVEIKAVARDPGSRAKIGVISRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPW
FT                   SPDIATFVVNALAPAEVSKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTG
FT                   WDIDILTETEESERRQADFENSTRVFMESLNVDEVVGQLLASEGFTSVEELAMVDVREL
FT                   ASIEGFDDETANELQSRAREYLEQLESELEAKRKELGVEDALKTVPGVTSKMLVKFGEN
FT                   DIKTVEDLAGCATDDLVGWSERKEGGEPVKFPGILDANEISRADAETLIMQARVIAGWI
FT                   TEADLAKTADATADADEASEDQPV"
FT   gene            516540..517244
FT                   /locus_tag="RPC_0479"
FT   CDS_pept        516540..517244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0479"
FT                   /product="protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86054"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C32"
FT                   /protein_id="ABD86054.1"
FT                   /translation="MLAFADPADLDKGPRTARSGTERMCAVSRDVRPIEELIRFVVAPT
FT                   GEVIPDLKRKLPGRGLWVTASRRAVAEAARRNLFAKGFKRELRGAATLADDTDALLVRG
FT                   VIEALAMAAKARQVVSGFSKVEAALNQGEAVALVHALDGAADGIRKLDAVARQNDRFTT
FT                   ESREFPVVTFLTSAELDLALGRSNVIHAALLGGAAGKTFLSRSQILVKYRLADDSTTAN
FT                   NFTAKTVRARTA"
FT   gene            517263..519905
FT                   /locus_tag="RPC_0480"
FT   CDS_pept        517263..519905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0480"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86055"
FT                   /db_xref="GOA:Q21C31"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C31"
FT                   /protein_id="ABD86055.1"
FT                   /translation="MVDTKNPGDKTLSVSPSKTLTLKRGVEQGTVRQSFSHGRTKQVVV
FT                   EKRGKRRVGGDGPADAPAAPAPVAAAKPAPVRAPMSRPPQSSHRGGGSGVVLRTLTEDE
FT                   RTARASALADARIRDEEERKAAEAELARRNSKEGIEQAEREAAEARKKAEEERHRQDEE
FT                   AKRKAELEAKKRFGEEEAKKAAAAAPAKTTAATTATAAKPGAPARAPGVAADATDEDEG
FT                   PRQIRRGPGGAARPVVAPKPTAKPAPAKQRGRLTLVTALSADDVRERSIASFRRRTQRL
FT                   KGHQSNEPKEKLVREVIIPEAITIQELANRMAERAVDVIRMLMKQGQMVKITDVIDADT
FT                   AQLIAEELGHSVKRVAASDVEEGLFDIVDDATDTEPRSPVVTVMGHVDHGKTSLLDALR
FT                   HANVVSGEAGGITQHIGAYQVTSPESGKKITFIDTPGHAAFTAMRARGAKVTDIVVLVV
FT                   AADDGVMPQTIEAINHAKAAKVPVIVAINKIDKQDAKPERVRTELLQYGIQVESLGGDV
FT                   VDVEVSAKNKTNLDKLLEMIALQAELLDLKTNTERPAEGTVIEAKLDRGRGPVATVLVQ
FT                   RGTLRVGDIIVAGAEMGRVRALISDQGVTLTEAGPSVPVEVLGFNGPPEAGDRMAVVDS
FT                   EARARQVTSYRAHQKREKSASAVSGLRGSLEQMMSQLKTTGRKDFPLIIKADVAGSLEA
FT                   ILGSLEKLGTDEVTARILHAGVGGISESDVTLAEGFNAAIIGFNVRAHKEAAAAAKRNG
FT                   IEIRYYNIIYDLVDDVKKAMSGLLAPTLRETMLGNALILEVFNISKVGKVAGCRVTDGS
FT                   VERGANVRLIRDNVVVHEGKLSTLKRFKDEVKEVQSGQECGMAFENYGDMRAGDIIECY
FT                   RVETIQRSL"
FT   gene            520122..520535
FT                   /locus_tag="RPC_0481"
FT   CDS_pept        520122..520535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0481"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86056"
FT                   /db_xref="GOA:Q21C30"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C30"
FT                   /protein_id="ABD86056.1"
FT                   /translation="MPKHHQKAQSPGGSQRQLRVGEIVRHAVAELLSQGGVHDPVLEGH
FT                   LITVPEVRMSPDLKLATVYVMPLGGRDTDVVLKALAANKPFIRTAVARRVNLKFAPDLR
FT                   FRIDERFDEAERIEKLLRTPGVQKDLQQDSDET"
FT   gene            520535..521698
FT                   /locus_tag="RPC_0482"
FT   CDS_pept        520535..521698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0482"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86057"
FT                   /db_xref="GOA:Q21C29"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C29"
FT                   /protein_id="ABD86057.1"
FT                   /translation="MNETTATAAIEPPSDEPIDVTTPNSAAMVSDQLTLQPDQDGGELG
FT                   DRAPRANNDPRQNGRGGKPKQNGQPRRDKRDVHGWVVLDKPIGMTSTHAVAVVKRLFSA
FT                   KRAGHAGTLDPLASGGLPIAMGEATKTVPFVMDGRKRYRFTVAWGEERDTDDTEGRATA
FT                   TSELRPSVEAIRALLPQFTGEIEQTPPQYSAIKIAGERAYDMARDGEIVPLVPRPVVIH
FT                   ELTLVDQPDEGHSTFEAECGKGTYVRALARDMGRILGCYGHICALRRTLVGPFGEQDMI
FT                   PLEQLEALCDRAASGEGSLADALLPVETALDDIPALAVTRADAARLHRGQAVLLRGRDA
FT                   PNCSGTVYVTVAGRLLALAELGNGELIPKRVFNLNGLTASSQPKESN"
FT   gene            521701..521970
FT                   /locus_tag="RPC_0483"
FT   CDS_pept        521701..521970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0483"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86058"
FT                   /db_xref="GOA:Q21C28"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C28"
FT                   /protein_id="ABD86058.1"
FT                   /translation="MSITAERKAEVIKTNAKKAGDTGSPEVQVAILSERIANLTSHFKT
FT                   HVKDNHSRRGLLKLVSTRRSLLDYVKKKDEARYKALLEKHNIRR"
FT   gene            522329..524476
FT                   /locus_tag="RPC_0484"
FT   CDS_pept        522329..524476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0484"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86059"
FT                   /db_xref="GOA:Q21C27"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C27"
FT                   /protein_id="ABD86059.1"
FT                   /translation="MFNIHSVEIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVV
FT                   AAKSAKEGVDFLPLTVDYIEKTYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFV
FT                   DGWRNETQVIVTVLSHDMENDPDILALVASSAALTLSGAPFKGPIGAARVGFINDEYVL
FT                   NPTLDEMVDTQLDLVVAGTADAVLMVESEAKELNEDIMLGAVMFGHRHFQPVVQAIIEL
FT                   AEKAAKEPREVAVVDESVLEKEILGLIEPELRAAYAIPVKQDRYAAVGKAKEKVMAHYF
FT                   PEGQEPQYDKLRIAGVFKELEAKIVRWNILDTGKRIDGRDSKTVRNIVAQVGVLPRAHG
FT                   SALFTRGETQALVVTTLGTGEDEQYIDSLSGTYKETFLLHYNFPPYSVGETGRMGGTKR
FT                   REIGHGKLAWRAIHPVLPPHHEFPYTLRVVSEITESNGSSSMASVCGASLALMDAGVPL
FT                   KRPTAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTEQGITSLQMDIKIAGITE
FT                   EIMKVALGQAKDGRIHILGEMSKALTNARAELGEYAPRIETFKIATDKIREVIGTGGKV
FT                   IREIVEKTGAKVNIDDDGTVKVASSDGESIKAAIKWIKSIASDPELNAIYDGTVVKVME
FT                   FGAFVNFFGAKDGLVHISQLAAGRVQKTSDVVKEGDKVKVKLLGFDDRGKTRLSMKVVD
FT                   QETGEDLEAKQKAAEGATAAE"
FT   gene            524727..525461
FT                   /locus_tag="RPC_0485"
FT   CDS_pept        524727..525461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0485"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86060"
FT                   /db_xref="GOA:Q21C26"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C26"
FT                   /protein_id="ABD86060.1"
FT                   /translation="MSLLSRRHLMMAATGIVAAAAAPRLAFAQATTAAPTGPFTLPPLP
FT                   YPVAALEPHIDAKTMEIHHGKHHQAYVSNLNNFAKDNPKLASMPVPEVLGNLGDVPEAI
FT                   RTGVRNNLGGHANHTMFWQIMGPNGGKPAGDVLAAIDRDLGGMEKFQADFNAAGGRQFG
FT                   SGWVFVTVSKDGKLAIETRPNQDNPMMDGKRALLGNDVWEHAYYLSYQNRRADYLKAWW
FT                   NTVNWNKVSERYAAAKAGQLGI"
FT   sig_peptide     524727..524813
FT                   /locus_tag="RPC_0485"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 29"
FT   gene            complement(525540..527102)
FT                   /locus_tag="RPC_0486"
FT   CDS_pept        complement(525540..527102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0486"
FT                   /product="Drug resistance transporter EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86061"
FT                   /db_xref="GOA:Q21C25"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C25"
FT                   /protein_id="ABD86061.1"
FT                   /translation="MTTAGAAPVAVPGLRRNMVTICAMTATIMQALDTTIANVALPYMQ
FT                   GSLSASQDQINWVLTSYIVAAAIMTAPVGWVANRFGRKRIFIICSAGFTIASVMCGLAQ
FT                   DITQMVAFRLLQGVFGAALVPLSQSVMLDIYALHERAKAMSIWGMGVMLGPIMGPSLGA
FT                   WLTETYSWHWVFFVNLPFGIVTVAGLLVFMDETKLNHALRFDWFGFAALAIGIGAMQLA
FT                   LDRGEQLGWLESGEIIAECIVSVIGFYYFFAHSFTTPKPFIQFAIFTDKNFIGGCVFMA
FT                   VMGLVLFSTMALSSPFMQNVIGFPILTAGLLLATRGTGTFVAMMMVGRIMRHIEARTLI
FT                   AGGLTLTCATLYFMTQWTDQTSVYSIIVVSIAQGFGFGLVFVPLSTVAFLTLPGHLRTD
FT                   GTAMLTLVRNVASSIGISVVIAELTSGTRRAHAVLTEYVTPFNHAMQMPDVRGTIDMAT
FT                   DTGRAMMDGIVTMQAQIIAFSQDYALVMFLTAAAIPAAIIIGSTKATLRQQSKGPDHAA
FT                   VID"
FT   gene            complement(527107..528270)
FT                   /locus_tag="RPC_0487"
FT   CDS_pept        complement(527107..528270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0487"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86062"
FT                   /db_xref="GOA:Q21C24"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C24"
FT                   /protein_id="ABD86062.1"
FT                   /translation="MADPVLKLAPEQKGNPPEPTTQRAAAPRRSLFGALKAYRRPLLLI
FT                   VLPLLVLIAGIAFYLEGGRYVTTDDAYVGAQKVLITPDVAGKIIDVAVKEGQLVNTGDV
FT                   LFQIDPVPFQLAVQQAKAKLDDAKTSHDNLVANVKLYGQTVELVNAGIAIKQRDVERKG
FT                   SLVKSSAGSQLDLDNSNSALVSAQAQLQLVKQQLSTALNQLLGNPELPLEQFPAYMQAK
FT                   AALDDAQRNLDLSTVRAPMNGTATQVDNIQLGRFVAAGNPVFSVIDTTAPWVDANPKES
FT                   DFTYVTVGQKVTIDIDAFPDHAFIGTVGSLSPGTGAQFAILPAQNATGNFVKVVQRVPV
FT                   RIYFDTNDRAVRKLKAGMSSYVSIDTKHTRSLAGLIGLSSAKAQPQD"
FT   gene            complement(528263..528745)
FT                   /locus_tag="RPC_0488"
FT   CDS_pept        complement(528263..528745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0488"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86063"
FT                   /db_xref="GOA:Q21C23"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C23"
FT                   /protein_id="ABD86063.1"
FT                   /translation="MPRGSVDLNFLFTLAEVQRLVRCYADKAASRYGITRAQWAVLAKV
FT                   ERCEGLKQSELAEMLEMQPITLTRLIDRLCEHGWIERRSDDTDRRAKRLYLRKAARPLL
FT                   GKLTGLRSELTATALAGISPVDVHRLVGHLETIRENVRTAIHDAHAAPQRKIQRHG"
FT   gene            528928..529431
FT                   /locus_tag="RPC_0489"
FT   CDS_pept        528928..529431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0489"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86064"
FT                   /db_xref="GOA:Q21C22"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C22"
FT                   /protein_id="ABD86064.1"
FT                   /translation="MTDAKPTFPPPDHDHVRCATDAIDHAERICQRRGQNFTPIRRRVL
FT                   QALLTSHRPLGAYEVIDELARDSARPAPITVYRALDFLMQNGLVHRIESRNAFLACAHD
FT                   HDHAATVAFLICDRCGSVGEIPAGPLANGLNEAARATGFAPKLAVVEIAGTCAHCLSAE
FT                   PPGP"
FT   gene            529465..530412
FT                   /locus_tag="RPC_0490"
FT   CDS_pept        529465..530412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0490"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86065"
FT                   /db_xref="GOA:Q21C21"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C21"
FT                   /protein_id="ABD86065.1"
FT                   /translation="MPSQQPSAGQAARPLSVGAIALVMLCCLSWGFNQIAIKLVLPEVP
FT                   PFLQATIRSLGALLVIGLIAQARGVKLWQRDGAWRAGLFAGVLFGIEFVLIYRGLMLTT
FT                   ASRAVVFLYTAPFFVAFGAYQLLHERLNRLQWGGLALSFVGVALAIGVPQPNVDAGVLL
FT                   GDLMMIGGGALWAATTLIVKTTRLGRVPAEKGLGYQVAVSIPILALAAWLSGETVPQWP
FT                   TPLSLALMAYQAVWVVGLTFLLWFGLVKTYSASKLSSFTFITPLFGVAAGYLIMDDPLT
FT                   PTFGVAALLVTAGLYLVNRPAPRAEPAARPDRTA"
FT   gene            530581..531870
FT                   /locus_tag="RPC_0491"
FT   CDS_pept        530581..531870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0491"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86066"
FT                   /db_xref="GOA:Q21C20"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C20"
FT                   /protein_id="ABD86066.1"
FT                   /translation="MNKLENPLSHDVAGPAPRHKTTQVMVGDVAVGGGAPIVVQSMTNT
FT                   DTADVAGTVEQVAALTRAGSELVRITVDREEAAAAVPHIRDALRKRGITTPLIGDFHYI
FT                   GHKLLADYPACAEALDKYRINPGNVGFKNKRDSQFADIVEIAIKNNKAVRIGANWGSLD
FT                   QELLTKLMDENAVSAKPRDVRAVTREAMVQSALLSAARAEEIGLAKNKMVLSAKVSAVQ
FT                   DLIAVYQDLASRSDYAIHLGLTEAGMGSKGIVASSAALGILLQQGIGDTIRISLTPEPG
FT                   GDRSLEVQVAQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELARSIQDFIRVEMPAWK
FT                   TRYPGVENLNVAVMGCIVNGPGESKHANIGISLPGTGETPAAPVFVDGQKFRTLRGANI
FT                   SGEFKALVIDYIEQRYGAGVAAPVTVTAAE"
FT   gene            complement(532306..533907)
FT                   /locus_tag="RPC_0492"
FT   CDS_pept        complement(532306..533907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0492"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86067"
FT                   /db_xref="GOA:Q21C19"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C19"
FT                   /protein_id="ABD86067.1"
FT                   /translation="MEAKFEIFLTLLAVLAGTAWLARRIDVAPAILLLLAGIVLALVPG
FT                   MPAIALPPELVLLVVLPPLIYSASVAMSWREFKFNLEPIALLAIGCVIFTACAVATATH
FT                   FLIGLPWSVGFLLGAIVAPPDVVAPLAIARKLGLPRRILVVLEGEGLANDATALILYRF
FT                   AVVAITTGAFSLPVASGTFAAILGCEIAFGIAIGWLSLRLRHHARDPQIEMTLSLITPY
FT                   AAYWIPEHLGGSGVIATVTCGLYISWNGPLLISSATRLQGIFFWDLVIYLIEGLLFLLT
FT                   GFQMRVLLEKSKEFPLADILVATGLVALIVIVARFAWVFPGTYLQRLWRPRLRAEPLPN
FT                   WRAMFVVAFTGVRGAVSLAAALALPLTLPSGVDFPYRDLIQLVSFGVILITLVGLGLSL
FT                   PMVVRLLGITQDGHAEHRREREAEIAARREALDAALSSLDAITDDRELSDEVVKLLRAR
FT                   HQTRANQLPQPPDADGNDVTATGAALVRELITEERKFIHAQLRDGNITDESRRRIERDL
FT                   DLEEASLANREYKKAL"
FT   gene            534059..535780
FT                   /locus_tag="RPC_0493"
FT   CDS_pept        534059..535780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0493"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86068"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C18"
FT                   /protein_id="ABD86068.1"
FT                   /translation="MLLQGSPCLLGIMPIRATSQSHALAQQSNSRSGSAPLDGGPEQAA
FT                   TLALSVFMQMGQAAALIGDDGRLLLSNSVFDDLFGAEGAAGILDPFSSEATRKGSKIDR
FT                   QVSFPDGRTFGIEILPVQEGRLITAGDITDHLAERAREAEAARTDRLTGLGNRLMFRER
FT                   LSKILGEADLAGGAAMLVVDLGRFKALNESLGHKIGDALLGLVAKRIRSAVGAGDVVAR
FT                   LEADKFGIIQTGRPQAQSADALAIRLVDLIGRSYLLDGQLINVAASIGVVLLSDGVDDA
FT                   DNVMKNADLALHRAKKDGHGSYHFFESAMDERMQARRKLEIDLRRALALREFALVYQPQ
FT                   VNLKSNTVTGFEALLRWQCPKRGAVSPLDFIPLAEETGVITPIGEWVLRTACCEAAKWP
FT                   PELSVAVNVSAVQFADPNLVSTIISALADSRLDPRRLELEITESVMLDARGTALAVLQT
FT                   LRTMGVRVALDDFGTGYSSLGYLRSFPFDKIKIDQSFVRGTSNDPAGQAIVRAVAALGH
FT                   SLGMATVAEGVETAEQLARVAADGCTEVQGYFFSRPIAPERIEGFLSTRNQGENLM"
FT   sig_peptide     534059..534130
FT                   /locus_tag="RPC_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.742) with cleavage site probability 0.510 at
FT                   residue 24"
FT   gene            535809..536252
FT                   /locus_tag="RPC_0494"
FT   CDS_pept        535809..536252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0494"
FT                   /product="BLUF"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86069"
FT                   /db_xref="GOA:Q21C17"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C17"
FT                   /protein_id="ABD86069.1"
FT                   /translation="MDPKLYRLVYFSKNRILGGPSSIAIEVESILHAAQRNNARLDITG
FT                   ALIFNTGIFAQVLEGPRDGVEAIFEKIQQDTRHGDVQVLAFDITKERTFAQWSMGFFGR
FT                   SREGHDLFGHIAVATGFTTARIEGARLFQIVRDLAFEEESRVA"
FT   gene            complement(536274..536555)
FT                   /locus_tag="RPC_0495"
FT   CDS_pept        complement(536274..536555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86070"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C16"
FT                   /protein_id="ABD86070.1"
FT                   /translation="MKIKLIATATALALFTTLAAAQPSQPQGGANTGPTSNSANSRGQD
FT                   MNQGTVGTSPATPGTGNSLSPGSGLTGSPHPSAQSNVGGNAGTGNSPR"
FT   sig_peptide     complement(536490..536555)
FT                   /locus_tag="RPC_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.938 at
FT                   residue 22"
FT   gene            complement(536657..537343)
FT                   /locus_tag="RPC_0496"
FT   CDS_pept        complement(536657..537343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0496"
FT                   /product="protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86071"
FT                   /db_xref="GOA:Q21C15"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C15"
FT                   /protein_id="ABD86071.1"
FT                   /translation="MAADALDDPHLARFRKLPRPVRVVYARPRTFVAIAAGAAAYFVLP
FT                   DQLRLVTRLLLSWDIFIGLYLALVLGMVLRSGIAHIRRNAILQDDGRFLILLVTALGAF
FT                   ASMAAIVSELGASHRGSAELVLATLTIALSWSMVHTTFALHYAHDYYRGAKPGGLQFPS
FT                   GDSHEDVDYWDFVYFSFVIGMTAQVSDVGITDKTIRRTATAHGVVSFVFNTALVALMVN
FT                   IAASAI"
FT   gene            complement(537350..538276)
FT                   /locus_tag="RPC_0497"
FT   CDS_pept        complement(537350..538276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0497"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86072"
FT                   /db_xref="GOA:Q21C14"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C14"
FT                   /protein_id="ABD86072.1"
FT                   /translation="MSTLTLSADFVQRLDQTADDTEALLARLLSDQLLPDEIARPRRLM
FT                   EAIRYSSLAGGKRLRPFLVVESAAVFGVPRGAALLAGAALECIHCYSLIHDDLPAMDNS
FT                   ELRRGRPTLHRAYDDATAILAGDALLTLAFDIITRDEIHSDAGVRLALTRALARASGIG
FT                   GMVGGQMLDLAGEGRFGDREPVDVARLQQMKTGALLRFGCIAGAILGQATKEQTKALDD
FT                   YGRALGEAFQIADDLLDVEGDAAALGKPAGADAALNKTTFVTQLGIDGAKKRVRDLLAR
FT                   ADKALLIFGEKGDVLRAAARFVAERKN"
FT   gene            538472..539149
FT                   /locus_tag="RPC_0498"
FT   CDS_pept        538472..539149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0498"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86073"
FT                   /db_xref="GOA:Q21C13"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C13"
FT                   /protein_id="ABD86073.1"
FT                   /translation="MRVARNILLAVLVVLALPYLLTPLYGGGHPVSTLMAWRWLTGAPV
FT                   ARQWVDLAQMSPALPRSVVGAEDAKFCVHHGIDWDSLRDVIDDAQDGEVARGGSTITQQ
FT                   VAKNLFLWPGRSVVRKALEFPLAMWIDLVLSKRRILEIYLNIAEWGPAGQFGGEAAAQY
FT                   AFGRPVTELSGREAGLLAAILPNPHTRSARNPKPGVRRLASTYVARGQSAELPRCWGDG
FT                   GDS"
FT   sig_peptide     538472..538537
FT                   /locus_tag="RPC_0498"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.750) with cleavage site probability 0.296 at
FT                   residue 22"
FT   gene            539296..539478
FT                   /locus_tag="RPC_0499"
FT   CDS_pept        539296..539478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0499"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86074"
FT                   /db_xref="GOA:Q21C12"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C12"
FT                   /protein_id="ABD86074.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADALKTPTYAEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVLKKKES"
FT   gene            539674..540387
FT                   /locus_tag="RPC_0500"
FT   CDS_pept        539674..540387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86075"
FT                   /db_xref="GOA:Q21C11"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C11"
FT                   /protein_id="ABD86075.1"
FT                   /translation="MSIIGFPLLLIPLAICNILVFLMPGVGFDAPLARLTLPSGASFAP
FT                   SIGELLLALGVLLLLLEVIKGARPGAKYVTDHLLSLLVFAGAIAEFLLLPPFGDSTVLL
FT                   LALLALVDFLSGVALRNRRRPAAAARAAKPGKAAAKELAAEPEVAAEPEPEAATAPEPA
FT                   VPPTAAGPALPTPHPAAPDSELPQPAPVAAASHAEPAASEAAHGDGAPAGASPQVKSPD
FT                   LQPDQPTRQATPPAR"
FT   gene            complement(540453..540752)
FT                   /locus_tag="RPC_0501"
FT   CDS_pept        complement(540453..540752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86076"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C10"
FT                   /protein_id="ABD86076.1"
FT                   /translation="MRAESELSVPEIAAATYTSTTEVMPPPRTAQADDEVVQLRILPRA
FT                   DASFVTHLIAIQQQSPQTRTLRRATSEDALAAYRSTAHRSDRPAEVASVTRRSV"
FT   gene            540965..542689
FT                   /locus_tag="RPC_0502"
FT   CDS_pept        540965..542689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0502"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86077"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C09"
FT                   /protein_id="ABD86077.1"
FT                   /translation="MTSADPSTAGSSAASPGRPDEADILAALGHAAFVWDIASDAMAWS
FT                   PAAAAIFRDLPAEALASGASFANLIEPVRAVRSEALLGSPGGSHGVAYRIEYGVRASTA
FT                   APVCWIEETGCWFAAPDGKPARVEGIVRVNNERHAREQQLVKLAQHDPLTGELNRSHLM
FT                   ASLAEAVDEASQFRSNFAFMLIGIDHLARVNDAFGFDVADQVIGEVAKRIRARLRAGDL
FT                   LGRFSGNKFGLILKNCTIDDMTVAAERFLAGIRDEVVPTKSGPVAVTASIGGVSAPRYA
FT                   RGADEALNRAHESLDAAKSRRRGSFSLWRPNVERDAQRRVNIRVTDEIVTALNERRIVM
FT                   AFEPVVQAVSRAPAFHECLVRMKQDDGELLLAPDIVPVAEKLGLIRLVDHRVLELVVAE
FT                   LAAAPGVELSLNISPDTTMDADWWASIESLLGANPGVAERLIVEITETVAIQDLDDVRG
FT                   FVNRLKNFGARIAIDDFGAGYTSFRNLRNLGVDIVKIDGAFVQNIARSADDRAFVQTLI
FT                   DLARRLEIKTVAEWVQDEASAIMLRDWGCDYIQGRLIGLASAERPWAVRATGVTAAS"
FT   gene            complement(542915..543553)
FT                   /locus_tag="RPC_0503"
FT   CDS_pept        complement(542915..543553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0503"
FT                   /product="Polyhydroxyalkanoate synthesis repressor PhaR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86078"
FT                   /db_xref="GOA:Q21C08"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C08"
FT                   /protein_id="ABD86078.1"
FT                   /translation="MAKSNLPTTIKKYANRRLYNTGTSTYVTLEDLAAMVKDGEDFLVF
FT                   DAKSGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPRYLEQSIDT
FT                   LTREQEKFRNQLTSTFSVGPFAPLEEHVRRNMELFERTFSMFKPFVPPHPSSQPAPAPE
FT                   PEAPPADPAVDAGNIEDLRRQMKEMQERLDRMAAEPKPLAEEPKKDEGA"
FT   gene            543843..545021
FT                   /locus_tag="RPC_0504"
FT   CDS_pept        543843..545021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0504"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86079"
FT                   /db_xref="GOA:Q21C07"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C07"
FT                   /protein_id="ABD86079.1"
FT                   /translation="MSDDVVIVSAARTAVGSFNGAFATLPAHDLGAVVIRAALERAGLE
FT                   PGRVSEVIMGQILTAAQGQNPARQASIAAGIPVESPAWGINQLCGSGLRTVALGYQALL
FT                   NGDSDIVVAGGQESMSMAPHAQYLRGGVKMGAVEFVDTMLKDGLWDAFNGYHMGNTAEN
FT                   VAKQYQITRQQQDEFAVASQNKAEAAQKAGRFNDEIVPVTVKNRKGDIIVDTDEFPRHG
FT                   ATIEAMAKLKPAFEKDGTVTAGSASGINDGAAAVVLMTAKQAAKEGKTPLARIVSWGQA
FT                   GVDPKIMGTGPIPASRAALKKAGWSIGDLDLIEANEAFAAQACAVNKDLGWDTSKVNVN
FT                   GGAIAIGHPVGASGARILVTLLHEMQKRDAKKGLATLCIGGGMGIAMCLARD"
FT   gene            545293..546018
FT                   /locus_tag="RPC_0505"
FT   CDS_pept        545293..546018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0505"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86080"
FT                   /db_xref="GOA:Q21C06"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C06"
FT                   /protein_id="ABD86080.1"
FT                   /translation="MARVALVTGGTRGIGAAISKALKAAGYHVAANYAGNDAAADKFKA
FT                   ETGIPVFKWDVSSFDASVEGVKKVEAELGPVEILVNNAGITRDGAFHKMTLDQWSAVTS
FT                   TNLGSLFNVTRQVIEGMRGRKFGRIINISSVNGQKGQFGQVNYSAAKAGDLGFTRALAL
FT                   ETARGGITVNAICPGYINTEMVQAVPKEVLEKNILPLIPVNRLGEPEEIARAVVFLAAD
FT                   DAGFITGSTLSINGGQSMG"
FT   gene            546077..546949
FT                   /locus_tag="RPC_0506"
FT   CDS_pept        546077..546949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0506"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86081"
FT                   /db_xref="GOA:Q21C05"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C05"
FT                   /protein_id="ABD86081.1"
FT                   /translation="MTVRAATLIGLSAILMWSLLAVLTVASGTMPAFQLAALTFAIGAL
FT                   VGFSSWLLRPGAARALRQAPLAWAVGVGGLFGYHALYFLALRLAPPAEAGLLNYLWPLL
FT                   IVLFSSLLPGERLRWHHVAGALLGLVGTVLLFAGNASARFEPGHIAGLVAAFVAAFIWA
FT                   AYSVMSRRLRAVPTDAVAGFCLATAVLAVLVHGAVETTVWPDTPLQWAAIAILGIGPVG
FT                   GAFYAWDIGMKRGDIRVLGAASYATPLLSTGFLILAGFAEPSATLGLAAALIAGGGLIA
FT                   AKDMIWRRR"
FT   sig_peptide     546077..546187
FT                   /locus_tag="RPC_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.384 at
FT                   residue 37"
FT   gene            complement(547137..547580)
FT                   /locus_tag="RPC_0507"
FT   CDS_pept        complement(547137..547580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0507"
FT                   /product="protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86082"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C04"
FT                   /protein_id="ABD86082.1"
FT                   /translation="MPPAHDLTAAEIIARLELAPHPEGGHFRETFRDARVDPAGRAAST
FT                   AIYFLLAKGERSHWHRIDAVEVWHYYAGAPLELQIADAEGRRTLRLGPDLAAGQLPQGL
FT                   VPPHAWQAAQSSGDWTLVGCTVAPGFDFATFELAEKGWEPAAR"
FT   gene            complement(547588..548355)
FT                   /locus_tag="RPC_0508"
FT   CDS_pept        complement(547588..548355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0508"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86083"
FT                   /db_xref="GOA:Q21C03"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21C03"
FT                   /protein_id="ABD86083.1"
FT                   /translation="MAAEIRVFTCLKDNFGYLVHDSDSGATASIDAPEAAPILAALARE
FT                   GWTLTDILVTHHHADHIGGIAELKQATNCRVVAPHDNGAAIPLVDLRVRQGDVVKIGGL
FT                   LARVLETPGHTLDHVAYVFDDDKALFAADTLFSIGCGRVFEGTYPMMWESLLKLRVLPD
FT                   DMRLYCGHEYTAANVKFALTVEPNNPALQARAAEVAHLRTAGLPTIPTLLGDEKRANVF
FT                   LRADEPTVAAGVRLKGAGAVEVFTELRERKNKS"
FT   gene            548494..549267
FT                   /locus_tag="RPC_0509"
FT   CDS_pept        548494..549267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0509"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86084"
FT                   /db_xref="GOA:Q21C02"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C02"
FT                   /protein_id="ABD86084.1"
FT                   /translation="MTIDVTELRDFYSQRLGVMARRLINRGIQAHWRDARGQRVLGFGY
FT                   STPYLGLFRSDSERCIAFMPAAQGVLKWPTARPTLSSLVEEHSLPLPDAAVDRILLVHA
FT                   LEMSDDPDGLMRELWRVLAPAGRLIAIVPNRRGVWARTDTTPFGHGRPYSRTQIAQLLR
FT                   RSWFTPTAWSEALFLPPIGHNWMLRSAPAWERLGAAMSLPFAGVHIVEATKQVARAIPV
FT                   RRERTRLIPALQPAMLPSPRDDDGHLGDLGMPTPR"
FT   gene            complement(549518..550336)
FT                   /locus_tag="RPC_0510"
FT   CDS_pept        complement(549518..550336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86085"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C01"
FT                   /protein_id="ABD86085.1"
FT                   /translation="MRNGQNNNNKRLRNRNNNNSNNNNNNNNNNRRGQNPMTRVFESNG
FT                   PDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNLPQ
FT                   QRTDNEMQDDSGEFGDGESYSNFGAEPGLVPVQPQPFVPREPQQQRDQQPREQQRDAQP
FT                   YQPREQREPREQQQPREHQSRDHQPREHRPQPQPQYQPQPQPVIPVSDSVDRLPSFITG
FT                   PQPQISGAPGFEGTGGERFPPRRRRRPPGPRPEGAAAPAAPADDFNPGNE"
FT   gene            complement(550837..551712)
FT                   /locus_tag="RPC_0511"
FT   CDS_pept        complement(550837..551712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0511"
FT                   /product="modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86086"
FT                   /db_xref="GOA:Q21C00"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q21C00"
FT                   /protein_id="ABD86086.1"
FT                   /translation="MTDSFTSPTIEAARRAVATRLRGSAIESAELDARLLIGAVLGLDL
FT                   TGLMVGAARLLTPEQASQLDALVTRRLAGEPVARIVGIKEFWGLPLALCGDTLVPRPDT
FT                   ETIVEAALQLFAGRPAPQRIADLGTGSGAILLALLSEWPQACGVASDISVAALHTARAN
FT                   AARLGLGDRAAFVACDYASALRGPFDLIVSNPPYIRSADIAALDREVRDHDPRRALDGG
FT                   ADGLAAYRTITTQAAGLLSPGGALIVEIGQGQGDEVSALMRAAGLTTDRPPTPDLAGIG
FT                   RAVTGRRPPG"
FT   gene            complement(551875..552960)
FT                   /locus_tag="RPC_0512"
FT   CDS_pept        complement(551875..552960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0512"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86087"
FT                   /db_xref="GOA:Q21BZ9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BZ9"
FT                   /protein_id="ABD86087.1"
FT                   /translation="MSLLPETKLDVLLAHHASLENQLQSQVGADTYVKLMRELAELNPL
FT                   IEAVKAYRQVGAERGEIDALLADAATDAEMRAMAEAEHAALEAQEAELAQQIRVALLPK
FT                   DAMDDRNVMLEIRAGTGGDEASLFAGDLFRMYEKFAVLQGWSVEVVSASEGTMGGYKEI
FT                   IAEVKGRGAFAKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEVEEVDVDIKPDDL
FT                   RIETMRAQGAGGQHVNKTESAIRITHIPTGLQVMMQDSRSQHKNRASAMNILRSRIYDA
FT                   EQQRIDSVRSAERKEKVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGEALGE
FT                   LIDALTTEHQAAQLAAQGNAA"
FT   gene            complement(553030..555297)
FT                   /locus_tag="RPC_0513"
FT   CDS_pept        complement(553030..555297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0513"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86088"
FT                   /db_xref="GOA:Q21BZ8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ8"
FT                   /protein_id="ABD86088.1"
FT                   /translation="MRSASGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   STYVLRVDNTLELYATEGLNRDAVHQTVLNAHEGLVGLVASEATPLNLSDAQTHPAFSF
FT                   RPETGEEIYHSFLGVPILRAGNTLGVLVVQNRAKRTYVEEEVEALQTTAMVVAEMIASG
FT                   ELSAMALPGAEPAARHSIHKTGAVLSDGIALGHVVLHEPRVVITNYIAEDLPKELKRLD
FT                   AALTKLRADLDRMLERGDVAESGEHRDVLEAYRMFANDHGWSHRLHEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRDRLHDLEDLGHRLMRQLVGQDHAPSREQLPDNAILIARS
FT                   MGPAALLDYDRKRLRGLVLEEGTANSHVSIVARALGIAAVGEIPNAPGIADPGDAIIVD
FT                   GTSGSIYVRPSAEVESAFAERVRFRARRQAQYSALRELPCVTKDGQPVDLMINAGLVID
FT                   LPHIEDTNCSGIGLFRTELQFMIGQSLPRSSDQLALYRAVLDAAGPKPVTFRTLDIGGD
FT                   KALPYMETVVEENPALGWRAIRLGLDRPGLLRSQIRALLRAGGGRSLRIMFPMISEVAE
FT                   FDQAKAIVERELTYLRQHGHTLPERVDVGTMVEVPALLYQLDELLERVDFVSVGSNDLF
FT                   QFLFAVDRGNAKVSDRFDSLSAPILRVLRQIVQRANAARRAVSLCGEMASQPLGALALI
FT                   ALGYRSLSLSAIQHGPVKAMILDLDAAKAAAMITPLLNAPAGSVSIRNKLTEFAESEGL
FT                   SL"
FT   gene            complement(555695..556948)
FT                   /locus_tag="RPC_0514"
FT   CDS_pept        complement(555695..556948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0514"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86089"
FT                   /db_xref="GOA:Q21BZ7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ7"
FT                   /protein_id="ABD86089.1"
FT                   /translation="MGRLVMKFGGTSVANIDRIRNVALHVKREVDAGHQVAVVVSAMSG
FT                   KTNELVAWCRDASPMHDAREYDAVVASGEQVTSGLLAIALQALGIQARSWQGWQIPILT
FT                   SDVHASARIVEIDGSEIIKRFDDRKEVAVIAGFQGINPETGRITTLGRGGSDTSAVAIA
FT                   AALKADRCDIYTDVDGVYTTDPRVVPKAKRLDKVSFEEMLELASQGAKVLQVRSVELGM
FT                   VHNMPIFVRSSFDKPEDIDPHGTPPGTLICSEEKIMENHVVTGIAFSKDEAQISVRRIE
FT                   DKPGVAASIFGPLAAANINVDMIVQSVSEDGATTDLTFTVPASDFDRAKQTITSAQATI
FT                   GYARFDSETDVAKVSVIGSGMRSHAGVAAQAFEALAARKINIRAITTSEIKFSVLIDAA
FT                   YTELAVRTLHTLYGLDQV"
FT   gene            557293..558057
FT                   /locus_tag="RPC_0515"
FT   CDS_pept        557293..558057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0515"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86090"
FT                   /db_xref="GOA:Q21BZ6"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BZ6"
FT                   /protein_id="ABD86090.1"
FT                   /translation="MSMQSNSSDASSATVDPAEIAKFSRLSAQWWDPTGKMAPLHKINP
FT                   LRLSFIRDAACRKFERNAKSLNCLSGLRMIDIGCGAGLLCEPFTRLGAQVIGVDPSATN
FT                   IAAAKLHAEKSQLLIDYRCTTVEQMDPRERFDIVLAMEVIEHVTDVGAFLARCAAITKP
FT                   GGLMVVATLNRNWKSFALAIVGAEYVMRWLPRGTHQWDKFVTPDELTKHLHNNKLAVTE
FT                   QAGLVYNPLADKWSLSADMDVNYMVVAETAAG"
FT   gene            558448..559347
FT                   /locus_tag="RPC_0516"
FT   CDS_pept        558448..559347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0516"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86091"
FT                   /db_xref="GOA:Q21BZ5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ5"
FT                   /protein_id="ABD86091.1"
FT                   /translation="MFSIAALWIPFTLVAALGQVARNAMQRQLTGPLGTWGATNIRFLF
FT                   GFPFSLVFFAVVIVATGDAVPWPTAAFWPWLLLGALSQILGTGLMLAAMNDRSFVVTTA
FT                   YLKTEAIQTAIFGFVFLGDHLTWLKVTAILIATLGVVITALRPGGDKSFTDLKPTLQGL
FT                   VAAAAFALSAVGFRGAIIVVPDVSFVTAASYTLVAALGVQTLVLTIYLLARAPKVLRDI
FT                   LQLWKPSMLAGFTGALASQFWFLAFALTAAANVRTLALVEVLFAQAVAYFSFKQPLLPR
FT                   ELFGIALIVVGVALLIAG"
FT   sig_peptide     558448..558519
FT                   /locus_tag="RPC_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.709) with cleavage site probability 0.179 at
FT                   residue 24"
FT   gene            complement(559615..560103)
FT                   /locus_tag="RPC_0517"
FT   CDS_pept        complement(559615..560103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0517"
FT                   /product="protein of unknown function DUF1178"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86092"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ4"
FT                   /protein_id="ABD86092.1"
FT                   /translation="MIRYTLRCDHGHQFESWFQSSSAYDSQARRKLVSCPNCGSVKVEK
FT                   AIMAPQISHQRKDPAQPAAAVPAPAPEVAAPDATSTSTPLLLAQERELRSKLKELRDHI
FT                   TKNADNVGQKFPNEARKMHYGDIEHRPIFGEATSDEARALIDEGIDVTPLPVLPEDRN"
FT   gene            complement(560100..560978)
FT                   /locus_tag="RPC_0518"
FT   CDS_pept        complement(560100..560978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0518"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86093"
FT                   /db_xref="GOA:Q21BZ3"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ3"
FT                   /protein_id="ABD86093.1"
FT                   /translation="MSAAGTFTAAMVQLRTGLLPQPNLAAASALIREAAAAGADYVLTP
FT                   EVSNMMQPNRAALFEQLAFQDDDLSLKAYRELAKALNIHLHIGSLAVKATPDRAANRSF
FT                   LIDPQGAILASYDKIHMFDIDLENGESYRESANYQPGETAVISDLPWGRIGLTICYDVR
FT                   FPALYRALADAGAAFISVPAAFTKTTGEAHWHTLLRARAIENGCFIFAAAQGGLHDNGR
FT                   STFGHSLIIDPWGVVLAEGGTEPGFIITEIDPGKVTKARSAIPSLQHGRRFGLADPKTN
FT                   PEHLHLVRGTV"
FT   gene            complement(560975..561316)
FT                   /locus_tag="RPC_0519"
FT   CDS_pept        complement(560975..561316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0519"
FT                   /product="Glutaredoxin, GrxC"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86094"
FT                   /db_xref="GOA:Q21BZ2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ2"
FT                   /protein_id="ABD86094.1"
FT                   /translation="MMSMVRKPESLFGIMLQQPECDMSAAIEIFTRPGCGYCSAARSLL
FT                   TRKKAAFTEYDVSLDPSFREQMTKRVGAGATYPQIFIGELHVGGCDDLYDLDRAGKLDS
FT                   LLAGETAAS"
FT   gene            complement(561334..562143)
FT                   /locus_tag="RPC_0520"
FT   CDS_pept        complement(561334..562143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0520"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86095"
FT                   /db_xref="GOA:Q21BZ1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ1"
FT                   /protein_id="ABD86095.1"
FT                   /translation="METDAPSPRSIAASFRGALGLCRQALGHGARLALDIALPTLCVAC
FT                   REPVSGHGVCAACWSQLSFIAPPYCERLGIPFVYDPGPGILSMQAIADPPAYARARAAV
FT                   RYDEVARTLVHALKFHDRVDLAPTMGRWMAQAGAPLLQDADLLVPVPLHWRRGFSRRYN
FT                   QSGALARAISRQANVPVSRDALRRVRATAHQIGLSKSERAANVQGAFRVPSENKATVQG
FT                   RRIVLVDDVLTSGATVDACARALLRARAASVDVLVFARVVDTHKSPI"
FT   gene            562254..562565
FT                   /locus_tag="RPC_0521"
FT   CDS_pept        562254..562565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86096"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BZ0"
FT                   /protein_id="ABD86096.1"
FT                   /translation="MSDPEAKPAETLIYVDISTAPIINFDIAPAHGIMANTVQIELASR
FT                   TLNPLADGSVEVKFVTTGRLRCSQAAAMHLRNALDASLRMFEAPQQSPGPAAASSKLN"
FT   gene            562601..563440
FT                   /locus_tag="RPC_0522"
FT   CDS_pept        562601..563440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0522"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86097"
FT                   /db_xref="GOA:Q21BY9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY9"
FT                   /protein_id="ABD86097.1"
FT                   /translation="MSSPQAPKLFDRALLAARQRRARALGPATFLLDRVAEEMAERLHA
FT                   VLREFPAAADIATPGDELRAVLRGRVGAMQPIALDADERLPLAEGSIDLAVSALALQFV
FT                   NDLPGVLKQIRRALKPDGLLLAVMSGGDTLTELRQAFAAAESELDGGVSPRVAPAADLR
FT                   DLGALLQRAGFALPVTDVDRIIVRYDNALALMQDLRRMGAGNVLVERRRTPLRRATLLR
FT                   MAEIYAERFADPDGRVRATFELVWLSGWSPHESQQQPLKPGSAKASLADAVKRMMPK"
FT   gene            complement(563593..563994)
FT                   /locus_tag="RPC_0523"
FT   CDS_pept        complement(563593..563994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0523"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86098"
FT                   /db_xref="GOA:Q21BY8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY8"
FT                   /protein_id="ABD86098.1"
FT                   /translation="MNLLLVVAVALIDADNRVLIAQRPPGKTLAGLWEFPGGKLDDGER
FT                   PEQALIRELDEELGITVREPCLAPLTFASHAYEDFHLLMPLYICRRWEGTATAREGQTL
FT                   AWVRPNKLRDYPMPPADIPLLSHLIDLLQ"
FT   gene            complement(563991..565232)
FT                   /locus_tag="RPC_0524"
FT   CDS_pept        complement(563991..565232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0524"
FT                   /product="glutamate N-acetyltransferase / N-acetylglutamate
FT                   synthase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86099"
FT                   /db_xref="GOA:Q21BY7"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY7"
FT                   /protein_id="ABD86099.1"
FT                   /translation="MATAVSPLAPTNVPELPPLAGVKLATAAAGIRYKGRTDVLLALLD
FT                   PGTAVAGVFTQSKCPSAPVEWCRLNLKGGKARALVVNSGNANAFTGKTGRVATALTAKI
FT                   AAKAIGCKPADIFLASTGVIGEPLDASKFDGVLDQLAEAAVPGGWMDAARAIMTTDTFP
FT                   KVATATVKLGKAKVTINGMAKGAGMIAPDMATMLAFVFTDAPIAAPALQSLLKAGVADT
FT                   FNAVTIDGDTSTSDTLLAFATGAAAANGAPKISKASDIRLKAFVKAFNAVLANLAEQVA
FT                   RDGEGARKLVEIIVDGATSKASARKIAMSIANSPLVKTAIAGEDANWGRVVMAVGKAGE
FT                   PADRDKLSISFNGIRVAKAGARDPSYNEAEVSKAMKSPEIQIKVALGLGKGRDRVLTCD
FT                   LTKEYIAINGDYRS"
FT   gene            complement(565430..566362)
FT                   /locus_tag="RPC_0525"
FT   CDS_pept        complement(565430..566362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0525"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86100"
FT                   /db_xref="GOA:Q21BY6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY6"
FT                   /protein_id="ABD86100.1"
FT                   /translation="MTSSPLDPKPRLRFGLACAALTGCLLLAGLPARAQDADPVLAKVN
FT                   GQEIRQSDVAIAEEELGPSLAQMDPATKTDNVLSFLIDLKIVAKAAEDKKIADREDFKA
FT                   KLAFARNRLLMDNLLAVEGKAATTDAAMKKVYDDAAKQITGETEVRARHILVETEDEAK
FT                   AIEDELKKGADFAELAKKKSKDPGASDGGDLGFFTKDQMVPEFSSVAFALEPGKISDPV
FT                   KSQFGWHIIKVEEKRNRKAPDFAQVKAQIETYVTRKAQADYVTKLRETAKIERLDKPAE
FT                   AAKADPAKPAEVAKPEAAKPDAAKTPAKK"
FT   sig_peptide     complement(566258..566362)
FT                   /locus_tag="RPC_0525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            566706..569549
FT                   /locus_tag="RPC_0526"
FT   CDS_pept        566706..569549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0526"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86101"
FT                   /db_xref="GOA:Q21BY5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BY5"
FT                   /protein_id="ABD86101.1"
FT                   /translation="MIGALARRLFGSPNDRRIKAYQPRVDAINALEPELVALSDEALRG
FT                   RTAEFRQQLADGKTLDDILVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLAVYLNALAGKGVHVVTVNDYLARRDSAWMGEIYGFLGMTTGVIVHGLDD
FT                   QQRQAAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQRGHYYAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSEFYNTIDTFMPSLDKATDYEVDEKQRTVTLTEAGMEHIEVLLRDAGQL
FT                   KGDSLYDVENVSVVHHVNQALRAHSLFQRDKDYIVRDDEVVIIDEFTGRMMPGRRYSEG
FT                   LHQALEAKEHVQVQPENQTLASITFQNYFRMYEKLSGMTGTALTEADELFDIYKLEVVE
FT                   IPTNVQIARLDEDDEVYRTQSEKYAAILAEVERANSRLQPVLVGTASIEKSEVLGEYLK
FT                   KHGYKQIDFTDPKGMEKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIAT
FT                   NMAGRGTDIKLGGSLEMRIQHETVGITDEAEKAAKIELIKADIERFREIVLKAEEVVEV
FT                   EPAKGNKPAKTLTRPGGLYIMGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLM
FT                   RIFGSDRLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDNVQND
FT                   QRKEIFDHRISLMKDDSVAETVAGMRHDFIDDIVAKHVPEHAYAEQWDVAGLKEELERV
FT                   LGLDLPVDEWAKEEGIADEELLTRIEQRVDEHMAAKVGQWGPEVMRYAEKSILLQTLDH
FT                   LWREHLVMLDHLRNVIGLRGYGQRDPLQEYKSEAFALFEAMITHLREAVTAQLMRVEIV
FT                   PPEQPQELPPMEGHKFNADTGEDDMAFANVSLAPADNADKTARNPNDPSTWGKVGRNED
FT                   CPCGSGKKYKHCHGRYA"
FT   gene            complement(570117..571550)
FT                   /locus_tag="RPC_0527"
FT   CDS_pept        complement(570117..571550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0527"
FT                   /product="protein of unknown function DUF949"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86102"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY4"
FT                   /protein_id="ABD86102.1"
FT                   /translation="MIDRTLVRALVTSVALATGVMLAGCNSDEISLANNAKANQPVPPK
FT                   LVAEMQTKDMDLQAPMLVRLFKQEAELEVWKQTRSGQFALLKTYPICRWSGDLGPKVRE
FT                   GDRQAPEGFYNITPAQMNPQSAYYLSFNTGYPNAFDKALGRTGSQLMVHGDCSSRGCYA
FT                   MTDEQIAEIYSLGRESFFGGQRAFQLQAYPFKMTPVNMAKHRNNPNMPFWKMIKEGYDH
FT                   FEVTRQEPKVEFCEAKYVFDPATPPNASRPLAFNATAKCPAYVVPNDIADAVRQKQRED
FT                   DVKTAELIAKGIPVAQRRPDIDGGMNRIFASKIPDGATGLSEPDVPGLQTAFARAPGTI
FT                   PAHVNPPKATVATASEEAEQLANSRAASPSEGLLNNMAHKGGSETTATAAPAKPKLSVA
FT                   TKPASTPPRPASVVAVKPPAAKPSSAPHQVAAARPPLKPSLSSADATASHASSTGGTLT
FT                   GAQPVVSANSFESRFSAVR"
FT   sig_peptide     complement(571467..571550)
FT                   /locus_tag="RPC_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.868) with cleavage site probability 0.703 at
FT                   residue 28"
FT   gene            complement(571855..572826)
FT                   /locus_tag="RPC_0528"
FT   CDS_pept        complement(571855..572826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0528"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86103"
FT                   /db_xref="GOA:Q21BY3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY3"
FT                   /protein_id="ABD86103.1"
FT                   /translation="MHPMPDPMRSYLDFEKPVAELDSKIDELRALAASGSNIGEEIARM
FT                   EEKAQQALTDLYVALTPWQKTQVARHPQRPHCIDYVETLIADFTPLAGDRKFGDDEALI
FT                   GGFGRFRGESICVLGQEKGSSTETRLKHNFGMARPEGYRKAVRLMEMADRFGIPVLSLV
FT                   DTAGAYPGIGAEERGQAEAIARSTDACLSLTVPNVAVIIGEGGSGGAIAIATANKVLML
FT                   EHAIYSVISPEAASSILWRDSAKAQEAATSMKITAQDLARFGVIDSILTEPRGGAHRDR
FT                   EAMIAKTGDAIAKAFGEMRDLDGAAIRAQRRQKFLDIGRKLG"
FT   gene            complement(573028..573675)
FT                   /locus_tag="RPC_0529"
FT   CDS_pept        complement(573028..573675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0529"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86104"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY2"
FT                   /protein_id="ABD86104.1"
FT                   /translation="MFGFHHDRHAQGRPGRGEGSHHHHAGHGEGFPHHHAGPRGGGRFG
FT                   RGPDAEDFQGDDRGHGGGRRRRFDGAELRLVLLKLIADKPRHGYDLIRAVEELTGGAYA
FT                   PSPGIVYPTLTLLSDMGLIAEQSAEGARKQFAVTPEGTAHLAEQATEVAAMLARLEALG
FT                   AMRERVDAVPVRRAMHNLRSVLQHRLGEGLDKERLQAAVALIDEAAQKIERL"
FT   gene            complement(573786..574748)
FT                   /locus_tag="RPC_0530"
FT   CDS_pept        complement(573786..574748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0530"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86105"
FT                   /db_xref="GOA:Q21BY1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY1"
FT                   /protein_id="ABD86105.1"
FT                   /translation="MPPGKNSDARLIELFLDMIAAEQGAGKNTLDAYRGDLTDLSDFLG
FT                   HARSSFVAADTEVLRGYLAELDERGYKSTSVARKLSAFRHLFRFLLTERIRADDPAAIL
FT                   SGPKRGRGLPKVLSIADVDRLLQHAKDLIAAPHANTQQRLRAARLYCLLEVLYATGLRV
FT                   SELVSLPLSAARRDARMIVVRGKGNKERLVPLNESSKQAMAGYLAALDELRQEKAKNAS
FT                   ASKWLFPSFGESGHLTRQHFARELKDLAGAAGLSPRLVSPHVLRHAFASHLLHNGADLR
FT                   IVQTLLGHTDISTTQIYTHVVEERLKSLVRDLHPLADKP"
FT   gene            complement(574761..574907)
FT                   /locus_tag="RPC_0531"
FT   CDS_pept        complement(574761..574907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86106"
FT                   /db_xref="GOA:Q21BY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BY0"
FT                   /protein_id="ABD86106.1"
FT                   /translation="MPSLLRFLTIIAVIGGLIYGAIFALANFVNPKPREMTVTIQADKF
FT                   LKK"
FT   sig_peptide     complement(574827..574907)
FT                   /locus_tag="RPC_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.862) with cleavage site probability 0.678 at
FT                   residue 27"
FT   gene            575086..575706
FT                   /locus_tag="RPC_0532"
FT   CDS_pept        575086..575706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0532"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86107"
FT                   /db_xref="GOA:Q21BX9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX9"
FT                   /protein_id="ABD86107.1"
FT                   /translation="MSETVSSASPLTAAEAEIVAALGRRPIVLVGMMGAGKSTVGRRLA
FT                   TRLHLPFVDADTEIEAAAGMTIAEIFANHGEPYFRDGEARVIARLLDNGPHVLATGGGA
FT                   FMRDDTRLRIAAQAVSLWLHAEADVILRRIKRRADRPLLKTADPAATIDRLIAERYPVY
FT                   QSADLTIASRDVPHEKIVDECVEALHAHLCRGDLAAPTMSPSS"
FT   gene            575703..576851
FT                   /locus_tag="RPC_0533"
FT   CDS_pept        575703..576851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0533"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86108"
FT                   /db_xref="GOA:Q21BX8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BX8"
FT                   /protein_id="ABD86108.1"
FT                   /translation="MTAPLNHSAPITVEVALGDRGYDIVIGRDVLRSLGTRIAALRPGA
FT                   RTAIVTDRNVATCWLAQTQAALDDVGIVSMPIVVEGGEGSKSYAGLQQVCEALIAAKIE
FT                   RNDLVIALGGGVVGDLAGFAASIVRRGLDFVQVPTSLLAQVDSSVGGKTGINSPHGKNL
FT                   VGAFHQPVLVIADTAVLDTLSPRQFRAGYAEVAKYGALGDEAFFAWLEANHAEIVRGGS
FT                   AREHAIATSCRAKAAIVARDERETGERALLNLGHTFGHALEAATGFSERLFHGEGVAVG
FT                   MVLAAQFSAERGMLSNDAAARLSHHLAEVGLPTRLQDIAGFAQEGLADADALMALMAQD
FT                   KKVKRGRLTFILLEAIGRAVIAHDVEPEPVRDFLARKLADKT"
FT   gene            576878..578188
FT                   /locus_tag="RPC_0534"
FT   CDS_pept        576878..578188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0534"
FT                   /product="protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86109"
FT                   /db_xref="GOA:Q21BX7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX7"
FT                   /protein_id="ABD86109.1"
FT                   /translation="MDWITFGIVLACLVGSAFFSASETALTGSSRASMMRLASQGSREA
FT                   GVVGELFAMRERMIGALLLGNNIFNIGASALATGLFTAWFGELGVLYATGVMTVVVVIF
FT                   AEVLPKTIAINAPDRVSLLVARPMRLMVLVLGPLLRVIEGIVRMLMNILGIRIGANQPL
FT                   LSPTERLRGAVELIHYEGGVAKQDRDMLGGLLDLSELQVSDVMVHRTEMVMINADLPAE
FT                   ELVREVLATEYTRIPLWRDKPENIIGVLHAKDLLRAIRAADGETDKIDVVGIALPPWFV
FT                   PEMRSVSEQLKAFRSRKTHFALVVDEYGEVEGMVTLEDILEEIVGDIADEHDIVFAGVR
FT                   AQPDGSVVVDGSVPIRDLNRAMDWHLPDEEATTVAGLVIHEARSIPERGQSFTFHGFRF
FT                   RVLRRERNRITALRIVPVLREGEADGDDKPKRAGTAL"
FT   sig_peptide     576878..576955
FT                   /locus_tag="RPC_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.437 at
FT                   residue 26"
FT   gene            complement(578253..578528)
FT                   /locus_tag="RPC_0535"
FT   CDS_pept        complement(578253..578528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0535"
FT                   /product="transcriptional regulator BolA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86110"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX6"
FT                   /protein_id="ABD86110.1"
FT                   /translation="MSAKHDITKKLSGAFTPQLLDVIDESHLHEGHSGHRHGGETHFRV
FT                   NIVSAAFAGKSRIERHRMVNATLAEELAGQLHALAIKALAPGEAGI"
FT   gene            578637..579296
FT                   /locus_tag="RPC_0536"
FT   CDS_pept        578637..579296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0536"
FT                   /product="heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86111"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX5"
FT                   /protein_id="ABD86111.1"
FT                   /translation="MAIDSSKFFDSIRIKPNKLSAKQQAAAREAAVMCEAPGCTNKGPH
FT                   RAPKGRGAEKEYWHFCLNHVREYNQGYNFFQGMAADAVARYQKDALTGHRPTWKMGANG
FT                   TKGKGKSADADLESAADPFHMFSELNGRGRWRPGPGSAAEEPKPETRKVFNAERKALQV
FT                   MGLGADATLETVKAKYKSLVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRGAS"
FT   gene            complement(579497..580132)
FT                   /locus_tag="RPC_0537"
FT   CDS_pept        complement(579497..580132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0537"
FT                   /product="DedA family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86112"
FT                   /db_xref="GOA:Q21BX4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX4"
FT                   /protein_id="ABD86112.1"
FT                   /translation="MGAFLDQLIAFAGHHAGWAYLTLFLAALLEAVPILGSLIPGSTII
FT                   LALSALVPGGQLALMPVLAAAAAGALIGDGTAYWIGRREQRQILEAWPMSRYPELVARS
FT                   EAFFKRFGIWAVFAARFVPPIRAFVPVTAGALGLSPARFFAVNILAILLWAPAHVLPGV
FT                   LAATELENPGGIRIHHWLPLLAGVVATLALAAWAVRWWRKNHLTSHDA"
FT   gene            580433..581428
FT                   /locus_tag="RPC_0538"
FT   CDS_pept        580433..581428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0538"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86113"
FT                   /db_xref="GOA:Q21BX3"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX3"
FT                   /protein_id="ABD86113.1"
FT                   /translation="MTAAMTTSQEPAGLPDMKVSVRQVFGIDSDLEVPAYSEVDAHVPD
FT                   VDADYRFDRATTLAILAGFAKNRRVMVTGFHGTGKSTHIEQVAARLNWPCVRVNLDSHI
FT                   SRIDLVGKDSIVVRDGKQVTEFRDGILPWALQHNIALVFDEYDAGRPDVMFVIQRVLEV
FT                   SGRLTLLDQNKVIKPHPAFRLFSTANTIGLGDTSGLYHGTQQINQGQMDRWSIVTTLNY
FT                   LPHDEEVEIVLAKAVHYRNPEGRDIANKMVRLADLTRNAFANGDLSTVMSPRTVITWAE
FT                   NAEIFGDIGFAFRVTFLNKCDELERPLVAEFYQRCFNAELPESSVNVAMS"
FT   gene            581552..582052
FT                   /locus_tag="RPC_0539"
FT   CDS_pept        581552..582052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0539"
FT                   /product="protein of unknown function DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86114"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX2"
FT                   /protein_id="ABD86114.1"
FT                   /translation="MTTSSKFRPPSNTASIASPCYEDDVYGWVEHQVALLKAGRLSEID
FT                   ADNIAEELSDVGGEQYDKLESAIRVVLLHLLKWDQQPTHRSRSWVFSIRTQRRHIARVL
FT                   MKNPSLKPHIAEAIGEAYVDARDEAQQETGLPAKVFGSICPYDWEAILTRAVEFDDVRS
FT                   PEE"
FT   gene            582055..583956
FT                   /locus_tag="RPC_0540"
FT   CDS_pept        582055..583956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0540"
FT                   /product="cobalt chelatase, pCobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86115"
FT                   /db_xref="GOA:Q21BX1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX1"
FT                   /protein_id="ABD86115.1"
FT                   /translation="MTTSNSKFRGNSREAPTEPFKRAVTACLRAIAKTPELEVSFAAER
FT                   PGLSPGKARLPEPARKMSRRDAAIVRGHADSIALKLACHDAKLHRKLMPGNPQARGVFE
FT                   AVEQARVEALGSRRMAGVAKNLTAMLDDHFHRGKFDEITDRADAPLPDALAMLVRERLT
FT                   GLAPPAAAKKMVDLWRPVLEDKIGPRLDRLERFAEDQTKFGDAIHDLLQALELGDDRNA
FT                   DADEDDTEEENKQGENDQSGAEGSPDSEAAQEMSADQAEASSEETSDSAMESAQASMSD
FT                   AFDDGELGDDETPGEATRPNSRGGNEPRGPEYHAFAPKFDEVVAAEDLCDHDELERLRS
FT                   YLDKQLAHLQGIVARLANRLQRRLMAQQNRAWDFDLEEGVLDPARLSRVVTDPFHPLSF
FT                   MSEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTRAW
FT                   KGGQSREAWLAAGKPALPGRLNDLRHIIYKSADAPWRRARKNLGLMMREGLLKENIDGE
FT                   ALDWAHKRLLGRSEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRHIIEEIETRSPVE
FT                   LIAIGIGHDVTRYYRRAVTIVDAEELGGAITEKLAELFSETETPPTGPGRRRRRLHS"
FT   gene            584285..585283
FT                   /locus_tag="RPC_0541"
FT   CDS_pept        584285..585283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86116"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BX0"
FT                   /protein_id="ABD86116.1"
FT                   /translation="MAWAQPATTASPKQRVATDYAADAPVAIEVNARPLRSFDTRDPSH
FT                   VRFGALQFRSGLILTSPFRGFGGLSALRLDDRGERFVAISDKATWFTGRIVYRGRDMVG
FT                   LADVEAAPMLGADGRPITARGWYDSESLALDNGIAYVGLERVQQILKFDFGRDGIRARG
FT                   EVLATPPALRKLPSNKGLEALLLVPKGLPMAGTLIALSERGLDADGNIVGFLIGGKTPG
FT                   PFAVRRRDDFDISDACLLPDGELLVLERKFSLLTGAGIRIRRIALRSLAPGAVIDGPSI
FT                   FDADLGDEIDNMEGLDVHRGAAGDLVVTLVSDDNFSMIQRTLLLQFTLLEE"
FT   gene            complement(585318..588470)
FT                   /locus_tag="RPC_0542"
FT   CDS_pept        complement(585318..588470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0542"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86117"
FT                   /db_xref="GOA:Q21BW9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW9"
FT                   /protein_id="ABD86117.1"
FT                   /translation="MKLSTRMALAMVALVSFTTIALGLLTYHSVMTLILPRALDRLQTH
FT                   ARVTAMLLDASLRSARTDAAIAQTSGAAMMMHLRKQFGAAPDKIESEWKEATAERFAAE
FT                   MSGKPAYAQMRVIGVADGGMEIVRVDRTGPNGAIRIVPDDELTRRGDRDYFLQGIKIGP
FT                   NQIHISRVELNKKATGLELPLVPTLRTVAPIHHPDGALFGVIVINVDLRPAIAEIRSSG
FT                   KPSALVYMVNDAGDYLVNPDPAKEFGFDLGRRFRIGDDFPEFASALQQTDARPRVMQDR
FT                   DGQRFGVGWQWVRLAGGPRVAVIEAFPYGTLMSVQTAVSNSTLIGGAAAVLCAILMAVG
FT                   VARSLTKPLVQITKAVEGFSRGEMIAISATGGNEIDVLAGAFIRMTAESQRKTAELNEE
FT                   IAERSRIAEVLNNTLNNMVDPVLIAGADGHVILTNFAARKLFGNPTGVGNMNAVRTFER
FT                   FYSDGVTPLPPQMSPLVRAFRGEIVENFEFVARPLASAHKSYLVANGRPIRSEAGILQG
FT                   AVMVYHDVTQTKKAQDELRESERMARAIIDTALDAFVQIDPSGAITEWSPHAETLFGWS
FT                   RNEALGENIGVLIFSPDQTSETKTNYRKFIDSVDHGGTGYRIETEATRRDGTTIQIEVA
FT                   LTALVRNGGHVTNAFMRDLTEKTIAEQQLRQAQKMESIGQLTGGIAHDFNNMLTVITGT
FT                   IDILGAAVADRPECATITKLISDAADRGAELTRHLLAFARKQPLQPCETDPNTLLSDLQ
FT                   NLLRPTLGEQIEICEVLQDGVWPIFVDRGQLDAALVNLAVNARDAMPDGGTLTLETTNV
FT                   VLDEDYVRRYAEGEPGPYVMITISDSGCGIPEAIRGRVFDPFFTTKEVGKGTGLGLSMV
FT                   YGFIKQSGGHITLYSEVGHGTTFRIYLPRAKTEPQLVAPSVSEAVEVGGNETILIVEDD
FT                   AMVRNYVTAQLKGLGYTTLAAPNAAAALALSAEGASFDLLFTDIVMPGKMNGVQLAAEM
FT                   AKQHPSLKVLYTSGYSENAVIHNNRLDPDILLLTKPYRRTALARMVRLALSAATEPERR
FT                   QA"
FT   sig_peptide     complement(588405..588470)
FT                   /locus_tag="RPC_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.492 at
FT                   residue 22"
FT   gene            complement(588808..589113)
FT                   /locus_tag="RPC_0543"
FT   CDS_pept        complement(588808..589113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0543"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86118"
FT                   /db_xref="GOA:Q21BW8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BW8"
FT                   /protein_id="ABD86118.1"
FT                   /translation="MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFLSDALGR
FT                   PVRLRVSTNALKSVDHRGGLDGFLLKAKDAELSPKAVDIKRQIQKKKLTAELAALA"
FT   gene            589337..590338
FT                   /locus_tag="RPC_0544"
FT   CDS_pept        589337..590338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86119"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW7"
FT                   /protein_id="ABD86119.1"
FT                   /translation="MKLFAPACRGGCGGALRRLGSAWSFAYGAPSRHTGSPFVTRSAVI
FT                   SSSLSAILASVARGAARCALVSLGLMAMARAVPALAQGSLDARYEATLAGIPVGKGVWR
FT                   IDIGDDQYSASAGGGSSGLLKAFAGGDGTGASQGRVLNGQLQPTNYNATTSTSRKSESI
FT                   RMTLAGGTIKEFAIVPEPPVDADRIPVTDAHRRGVFDPMTGSLLRVAGGGDPLAAESCR
FT                   TTTSIFDGRMRYDLRFDFKRMDTVKAEKGYRGPALVCAIYFSPISGYIADRAAIKYLVA
FT                   QRDMEVWLVPIAGTRILVPFRLKIPTPLGNAVLEATQFITAATPPRAASKTQ"
FT   gene            590709..594218
FT                   /locus_tag="RPC_0545"
FT   CDS_pept        590709..594218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0545"
FT                   /product="helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86120"
FT                   /db_xref="GOA:Q21BW6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW6"
FT                   /protein_id="ABD86120.1"
FT                   /translation="MAFSTSGSASANDRAPGAGVTAVLGPTNTGKTHLAIERMLAHSSG
FT                   VIGLPLRLLAREVYNKIVDRAGPDAVALITGEEKIKPPKPRYWVSTVEAMPRDLDVSFL
FT                   AVDEIQIAADLERGHVFTDRILHRRGRDETLLLGAATMRPIIERLLPGASIVTRPRLSQ
FT                   LEFAGDRKITRQPRRTAIVAFSADEVYAIAELIRRQHGGAAVVLGSLSPRTRNAQVAMY
FT                   QSGDVDYLVATDAVGMGLNLDVDHVAFASDRKYDGYQFRRLNPSEFAQIAGRAGRATRN
FT                   GTFGTTGRCAPFEPELVNALQNHTFDSVKTLQWRNSRLDFSSLGALQVSLSLTPSHEAL
FT                   TRAPIAEDLRVLDHAARDGEVRDIAHGAAAVERLWDACQIPDYRKIAPAAHAELVTTLF
FT                   GYLMRKGRIPDAWFATQIAQADRTDGDIDTLSGRIAQIRTWTFVANRPDWLADPEHWQG
FT                   ISRDLENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIVEGHVIGRL
FT                   DGFTFAPDAAEAGSDAKALQAAALKALAGEIESRAEKLAAAPDDQFVLASDGTVRWTGD
FT                   AVAKLVAADDALHPRLRIVADDRLAGAAREAVQTRLELWLKTHVEKLLGPLFDLAKAED
FT                   VTGIARGIAFQLIEALGVLERSKIAAEMKDLDQASRAVLRKYGVRFGAYHIYLPSLLKP
FT                   AARSLASLLWVQKRDQVDLSALSGAQHLAGSGRTSFPVDKQLDRDAYRTLGYRQCGERA
FT                   VRVDILERLADLIRPALSWRETSPGEKPAGAFDGRGFIVTQAMTSLTGSAGEDFASILR
FT                   ALGYRMEKKPPLPPAPPKPVVVETAPVEATDPEANPTETTVADQAAPDATVAETIVSET
FT                   SATDAAIADPEHAAAADIGAAVQEAVTEAPPLDPALTESAGEVPAVAEPTAAPQIAAEV
FT                   VSPDAEAPAESASAETVSEAADTPTSDAPGSEAIATEAVAVLTTAEADPAVVAGSDPAL
FT                   AADAAVAVPELVEVWRPGGRADDHRPRHDRNRYRNPDRAAQAGQPASAGEAGEAEQGKG
FT                   DRPNRGRRDRKPEFRRPRTDAPVAAAADAPAAEGTPDARPAQAPRPPRDRERFQGKGGR
FT                   GKDKFQGGKGGREGREGRDSGDRAPRVFSSSAPRERERVADPNSPFAKLAALKEQLTAN
FT                   RKD"
FT   gene            594272..594541
FT                   /locus_tag="RPC_0546"
FT   CDS_pept        594272..594541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0546"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86121"
FT                   /db_xref="GOA:Q21BW5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW5"
FT                   /protein_id="ABD86121.1"
FT                   /translation="MERQRLDKWLWHARVVKARTSAAALVEAGHVRVNGGRQTAPGHLL
FT                   KRGDVLTVSLDRTVRLLKVEAFAARRGDANAATGLYTDLQKPEV"
FT   gene            594615..594953
FT                   /locus_tag="RPC_0547"
FT   CDS_pept        594615..594953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0547"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86122"
FT                   /db_xref="GOA:Q21BW4"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW4"
FT                   /protein_id="ABD86122.1"
FT                   /translation="MTYVVTEACIKCKYTDCVEVCPVDCFYEGDNMLVIHPDECIDCGV
FT                   CEPECPADAIKPDTEPGLEKWLEVNAEYSKTWPNITQKKDAPADAKEFESVEGKFDKYF
FT                   SAEPGTGD"
FT   gene            595108..596205
FT                   /locus_tag="RPC_0548"
FT   CDS_pept        595108..596205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0548"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86123"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW3"
FT                   /protein_id="ABD86123.1"
FT                   /translation="MSRTRSRPLLCIRSPAQTSNRGVAVHAQAVSQKTRKKSVSKGVKK
FT                   AAAASRSATKTRSRTAARAAAKDSKKASAKASKSSNSSSSSSSSSNSKASAAKSSKNKR
FT                   SAMPKTTAKTTVKPTAAAPKAAPKAAAKPAVAKPPVVASKQPVAAAAKPAAKPAAAAPR
FT                   VEEAKKPLTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFMKDKMTLRV
FT                   PTAKVANVGMRKLSEPALVKRALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEV
FT                   VRDLYRSDSQPEQSYSERQLYEAALDRLSREIAVVQHVTETEAVKEVEGQLAKSPRRGA
FT                   KTEVEADADAEAETDGDDVAADEAA"
FT   gene            596420..597034
FT                   /locus_tag="RPC_0549"
FT   CDS_pept        596420..597034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0549"
FT                   /product="NIPSNAP"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86124"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW2"
FT                   /protein_id="ABD86124.1"
FT                   /translation="MIYELTTLSGPLLQLASLSQGARAWIADPAARGEVFGIWRSDIGT
FT                   LGQLLVLRGFAAEAELRKERDRALFNTNPFNCVGTASALSMDSYAGFAFLPPVRPQHYG
FT                   GVFEFRTYHLKPGGLPATLAGWEAAIAPAHDYTAHLVINMYALDGPPRITHIWGFSGVD
FT                   ERMKLRADHYAAKLWPPKGGPEQIAQASSTIAIAEPGLPLG"
FT   sig_peptide     596420..596494
FT                   /locus_tag="RPC_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.737) with cleavage site probability 0.680 at
FT                   residue 25"
FT   gene            complement(597051..598562)
FT                   /locus_tag="RPC_0550"
FT   CDS_pept        complement(597051..598562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0550"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86125"
FT                   /db_xref="GOA:Q21BW1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW1"
FT                   /protein_id="ABD86125.1"
FT                   /translation="MGATEERHDVTGVERRETGLSRRLWAASALLCAGLLLSACGDAGR
FT                   FQVATPQASPAKPPRAAQQNPAAEREHERILSSYGGAYDDPKLEALITKTVDRLVAASD
FT                   RPDLSYKVTILNSGAVNAFALPTGQLYVTRGLIALASDTSELSSVLSHEMAHVLAKHAS
FT                   IREDQARQAAIVTRVVTDMGSDPDLTALALAKTKLTMASFSRAQEFEADGIGVGISARA
FT                   QFDPYGAARFLSSMERNAALKASRASADPRSQDFLSSHPATPERVQNAQANARQYSSPD
FT                   GGERDRESYLATIDGMVYGEDPSEGFVRGRRFLHPKLGFTFTAPEAFTLDNTAQAVIGV
FT                   REGGNQAMRFDVVRVASEQTLAEYLNSGWMENVDKASTEEMTINGLPAAAAVAHGDQWQ
FT                   FRVYALRFGSDVYRFIFAAKQKTTESERNARETVGSFRRLTLEEIQAARPLRIKIITAQ
FT                   PGDTVESLSHRMSGVDKPAERFRVLNGLDAHAEVKVRDRVKIVVD"
FT   gene            complement(598704..599480)
FT                   /locus_tag="RPC_0551"
FT   CDS_pept        complement(598704..599480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0551"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86126"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BW0"
FT                   /protein_id="ABD86126.1"
FT                   /translation="MNAARRVFCLLPLVCHMVFAVDFASAAGCRLAPQGEGRAAAVVDG
FT                   RSFRLEDDRDVRLSGIEIFPERRQRATAALTALIAGREVTLHGDSDAPDRYGRQPAFVF
FT                   RDAEPVSLQAQLLAAGEAVSAGDAADAECRAELSRAEAQARRDRRGIWAESAAIKNAED
FT                   PGDILAGVGRFALVEGRVASVRAVGATTYLNFGRRWTRDFAVTISRRTGAALEAAGMSL
FT                   KSFERRRVLVRGWVEKRGGPRIEIFGAGQIQTRDES"
FT   sig_peptide     complement(599418..599480)
FT                   /locus_tag="RPC_0551"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.936 at
FT                   residue 21"
FT   gene            complement(599598..600401)
FT                   /locus_tag="RPC_0552"
FT   CDS_pept        complement(599598..600401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0552"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86127"
FT                   /db_xref="GOA:Q21BV9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV9"
FT                   /protein_id="ABD86127.1"
FT                   /translation="MTSYADIGVEKTGHVTTIEIQRPPLNYFDISLIDQIADALGEIDN
FT                   DPEARAVVLAAQGKAFCAGANFGDPSRTPIDASEQSDPASGLGKIGHLYIEAVRIFRNK
FT                   KPIVAAVHAAAIGGGLGLALAADFRVTCPEARFSANFTKLGFHPGFGLTVTLPELIGRN
FT                   NAELMFYTSRRVTGEEAYAMGLANVLVPHDELRGAALKLAREIAECSPLGLLSTRATMR
FT                   AGLAERVLAATHHELAEQTRLRATEDFREGVRASEERRLAHFKGR"
FT   gene            600735..601520
FT                   /locus_tag="RPC_0553"
FT   CDS_pept        600735..601520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0553"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86128"
FT                   /db_xref="GOA:Q21BV8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV8"
FT                   /protein_id="ABD86128.1"
FT                   /translation="MPTDGLNVIVTGSASGLGAATATILAKAGARIVINYASSQSDAEA
FT                   TAQACRAAGAAEVVVVQGDVARDEDCRKIVAAAAPWGRLDALINNAGTTKHVAHDNLDG
FT                   LSAEDFQRLFAVNTIGPFQMIRAARALLEAGAKQSGSAAAVVNVSSVAGLSGVGSSVAY
FT                   VASKGALNSMTLSLARALAPLIRVNTVCPGYIDTPWFAKGRGAAAAQQVREMVTAKVPL
FT                   KIASTADDVAALVCFLASPQSGSMTGELVRMDAGLHLVN"
FT   gene            complement(601543..601830)
FT                   /locus_tag="RPC_0554"
FT   CDS_pept        complement(601543..601830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86129"
FT                   /db_xref="GOA:Q21BV7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV7"
FT                   /protein_id="ABD86129.1"
FT                   /translation="MSGILYIVLVGFVAGIIARLVSPGPNNPSGFILTTVLGIGGAFVA
FT                   TFIGQAVGHYGPNQGAGFITATLGALVVLFVWNRLVARRMISDPGGRTRV"
FT   gene            complement(601883..602461)
FT                   /locus_tag="RPC_0555"
FT   CDS_pept        complement(601883..602461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0555"
FT                   /product="protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86130"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV6"
FT                   /protein_id="ABD86130.1"
FT                   /translation="MGLLDVLNGMQNGPRGPADPQAKGGMSPITMAILALLAYKAVKHI
FT                   GGNNQPAPAPTNTRASVPPAGNTVNAWLPGSSGGLGDLLKGGLGGLLAGGAAGSILSGG
FT                   LGDLLRQFQQSGHGDAANSWVSPGPNRQIAPNDLATALGADQIDSLTSQTGLSREDLLS
FT                   GLSQHLPEVVDQLTPDGRLPTDEEASRWI"
FT   gene            complement(602615..603976)
FT                   /locus_tag="RPC_0556"
FT   CDS_pept        complement(602615..603976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86131"
FT                   /db_xref="GOA:Q21BV5"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV5"
FT                   /protein_id="ABD86131.1"
FT                   /translation="MAQRLSGLFDSFHHDRRGNIAILFAFSLIPLLVAIGCAIDYARAT
FT                   QIRSKMQSAADAASVGSVSKASPAFLAAGSMTTDGPIAVGSTDATNIFNGNMASQSGYT
FT                   LSKLDAAVTKSGATLTSTVTFSASVATTFLTIIGKTALAIGGTSVSTSSMPVYIDFYLL
FT                   LDNSPSMGVGATPTDVATMVDNTSDKCAFACHDVNDEHNYYELAKTLGVKTRIDVLRDA
FT                   TQQLMDTAAATATYPNQFRMAIYDFGASAQSAALRRLFALSSSLSSAKTAAGAIDLMTV
FT                   KGQNDNDDRDTSYSKLLPAIDKQITAAGAGTSDAPQKYLLFVSDGVADETNAGCAKTMK
FT                   NAFWGNKSPRCQSPIDPALCKAMTDRGVKVAVLYTTYLALPLKQANGDPSWYASWIAPF
FT                   NVGPYGPSPNSEIANNMKACASPGFYFEVSPTDGIADAMNAIFRKAVADARISS"
FT   gene            604164..604240
FT                   /locus_tag="RPC_R0008"
FT                   /note="tRNA-Arg2"
FT   tRNA            604164..604240
FT                   /locus_tag="RPC_R0008"
FT                   /product="tRNA-Arg"
FT   gene            605109..607160
FT                   /locus_tag="RPC_0557"
FT   CDS_pept        605109..607160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0557"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86132"
FT                   /db_xref="GOA:Q21BV4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV4"
FT                   /protein_id="ABD86132.1"
FT                   /translation="MTTAESIPSPSVRVAGSMPRSLLWWSIAALVIYLALDLARSLIAH
FT                   FGYANPASTWQPDPAQYSDVEWPPTAMVPAGASNGRRVYLENCAICHGPDGRGNGAAAP
FT                   SMRPPPRDFTTAAFKYKSTPHDAAPTTADVRKVVADGLAASAMPFFRDVLTPAEIDDVV
FT                   GYVEALRATPAPQAAPVVVPQRPPVTAAGLAHGEQLYREQGCANCHGADLRGGAAMTDA
FT                   LGQPVSSRDLTAPWSFRGGARPEDVFLRLTTGLGTSPMPSFADLPASDRWDLVAFLEAR
FT                   RRAAPGEPGGVLAGPGQSQDALARGRYLVRAGMCGLCHTEVSVKGIYRDEQYLAGGTRV
FT                   GAHPQGVFISRNLTSDPDTGLGRWSEQQIVRAIRDGRTDDGRLLNVFSMPWVFLHNISQ
FT                   TDAMAIARYLKTLPAVHNQIPAPLHFGAIESFFSKLWSSDLFLGRPPSITYATGSFANF
FT                   KGPDLARIQGTLVAAQWMVLALWVALLSWLVPLQRWAPLGRRRWTGVLGCSFGLVIYST
FT                   PILGVLPAEMLSQQALGAVPRPDVSALPPERVALVERGRYLFTNASCVFCHQPNGGGGL
FT                   KLSGLPGTLFTANISSDPSAGIGTWSDAQIGRAIRSGVSRNGRPLYWQGMPWDHFSNFD
FT                   EEDVMALTAYLRLLPPVPEKVPAYRPPSPDDCAVYTAWTSPNAAEGCR"
FT   gene            607157..608173
FT                   /locus_tag="RPC_0558"
FT   CDS_pept        607157..608173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0558"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86133"
FT                   /db_xref="GOA:Q21BV3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV3"
FT                   /protein_id="ABD86133.1"
FT                   /translation="MSGPQRPHDSSSHLQENAVMRTIPTEQPAVAPRRAELHPKPCWER
FT                   DGHDWPNRDSSRFVQAAGFRWHVQQMGRGPALLLVHGTGAATHSWRKLAPLLAQHFTVV
FT                   APDLPGHGFTETPAWKRLSLDGMAEDLAALLRVLDHAPVLVAGHSAGAAVLARMCLNGS
FT                   ITPDGLFGLNGAMLPIGGMAGRLMTPFAQVLAGSRLVPRLFARFASSDKFIERMIADTG
FT                   SVLDPAGLEFYRRLTCSPGHVAAALRMMGNWKLRPLAAELPRLLTKLVLVTGGNDKTIA
FT                   PKDAARVHAMVPGSSVVAMPGLGHLAHEERPHEVSALMIEFARRAGLLPPLLAGAAE"
FT   gene            complement(608913..609155)
FT                   /locus_tag="RPC_0559"
FT   CDS_pept        complement(608913..609155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86134"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV2"
FT                   /protein_id="ABD86134.1"
FT                   /translation="MLSVALNPSRIAKGLRSTLTRPVDGLTMRDRFAVKPIDHSQVYGF
FT                   GAACHAKQSEEYFARLRRAEIGIHRHRWRLPAALC"
FT   gene            complement(609260..611725)
FT                   /locus_tag="RPC_0560"
FT   CDS_pept        complement(609260..611725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0560"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86135"
FT                   /db_xref="GOA:Q21BV1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV1"
FT                   /protein_id="ABD86135.1"
FT                   /translation="MVSHRGPRTPGRDALELSGLIARTVGLIIERHHATSALREREHEL
FT                   TRVQAIAKIGGVVVDLRYGLHNERRSPEYSTIHGLPPDAPDGHEDWVRRLHPDDRDRAL
FT                   RTLLDAIAGTADHYSSEYRIIRPNDGQIRWIAAEAQIERSPDGRAERLVGAHIDITDRT
FT                   LAKETLRESEQRFRLIANSAPVPMWVSRLDGKRAFANQAYLDFLGLDYDAALAFDWRTV
FT                   LHPDDLPRILQEQIAGETSLQPFVLEARYRRADGPWRWMRSESQPRWDAAGKHIGFIGV
FT                   AHDITASKEAETELRRLNETLEQRIKQRTAQLQANEAQMRAMFETTNQYQGLLDLKGNI
FT                   VYINATALAGIRSTVDAVLGIRFWDSPWFTGTEGMRDCVRGAFAAAKKGETVRTEMLLH
FT                   LPIGDRFFDFAMRPIFDEHGRVSAVLPEAVDITERRHSEEALRQSQKMEAVGQLTGGVA
FT                   HDFNNLLTIIRSATDFLRRRDLPEERRRRYIDAISETVDRASTLTGQLLAFARRQPLTP
FT                   QVFNIGSQVESIAQLIRPLVGSRIQIAVHLGCPDCFAMADVAQFETALVNLAVNGRDAM
FT                   NGEGCLTFDVVKVEALPPLRSHPGRRGSFIAVAVTDTGSGIAPERLEAIFEPFYTTKEV
FT                   GKGTGLGLSQAFGFAKQSGGEIEVTSTLGHGSTFTIYLPQAESPAELADVVAVGAEVTA
FT                   SGRGHRVLVVEDNEDVGRFSTELLRDLGYDIRWVGNANEALAAISEDEFAFDLVFSDVI
FT                   MPGMNGVELATLIRERYPGLPVVLTSGYSTVLAENAHHGFELIQKPYSVELLSRTLRRA
FT                   IADRRTALA"
FT   gene            complement(612292..613635)
FT                   /locus_tag="RPC_0561"
FT   CDS_pept        complement(612292..613635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0561"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86136"
FT                   /db_xref="GOA:Q21BV0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BV0"
FT                   /protein_id="ABD86136.1"
FT                   /translation="MTSHTHADDRPYWDAKLETQSRADWDALKLSLLQKHLAHAYAGSP
FT                   AYRAAFDKAKVQPDQVKSLDDIRRFPLINKSTLRDRQLAAPPFGDLVAVPERDIVYISA
FT                   SSGSTGVPTASPFTAQDFDGWIDYEARQFWSSGMRPHDRYAHSLNMSLFIGGPCVLGAQ
FT                   KLGALTIHAGTLPSERLLQILRQFQASIIWTTPSYAWYLGETAVKEGYDLRKDLSVRRI
FT                   FVAGEPGGSILETRERIEQLWGASVYDYYGLSDIFGSCAGMCEQKSGLHWAEDHILVEV
FT                   IDPDSGDPVKPGDRGEMVLTTLQKSARPMIRFRTGDIVSFNPEPCRCGRTAIRLNGVHG
FT                   RLDDMLIIKGVNLFPSDVEAVARKDHELTGEYRMIVERIDHLDRLTVEVEHVRGYNGGA
FT                   EDLQHRFVRTLKAVTGVTAKVNVLPPDTLPRATHKAKRVEDRRSGVWS"
FT   gene            complement(613740..614531)
FT                   /locus_tag="RPC_0562"
FT   CDS_pept        complement(613740..614531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0562"
FT                   /product="NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86137"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU9"
FT                   /protein_id="ABD86137.1"
FT                   /translation="MKLTRIAAIAAGLMLAAAGTVHAADPQVIRIGVTAGPYADILRYA
FT                   GELAGKQGIQLKIIEFTDYTVPNAALAQDDLDINNFQHQPYLDNQVAQRGYDIVPIAKS
FT                   IIVPIGLYSNKVKRIEEIRDGASTAIPNDPSNGARALQLFEKAGLIKLKPGAGIKATVA
FT                   DIAENPKHLKFNELDAAQLPRSLNDLDFSAVNLNYALNAGLDPNKALLLEDADSNWNLV
FT                   FAVRAKNKDNPTLKKFVEIYRSPEVKQFVDNKFNGTILTTW"
FT   sig_peptide     complement(614460..614531)
FT                   /locus_tag="RPC_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            614964..616034
FT                   /locus_tag="RPC_0563"
FT   CDS_pept        614964..616034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0563"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86138"
FT                   /db_xref="GOA:Q21BU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BU8"
FT                   /protein_id="ABD86138.1"
FT                   /translation="MELPASTAPSGISIENVAKTYPARKGSAEVVALDNINLNVPEGSI
FT                   VGVIGRSGAGKSSLIRLINGLEQPTKGRVIVNGTEITSLDEPALRQARRSIGMIFQHFN
FT                   LLSSRTAFDNIALPLEIAGVAKREIAKTVLPLLDMVGLADKRDRYPAELSGGQKQRVGI
FT                   ARALATSPKVLLSDEATSALDPETTDQILELLKRINADLRLTILFITHEMAVVKALADR
FT                   VAVLERGHIVEEGTTYNVFASPQHEVTKRFVSSVTGSQAPDWLLARLKAERGPQDEAVL
FT                   RISFRGSDAGQPLLSQIARSFGIDINILNGQVEMIAGHPFGTLIVSIPAEPELVGQVSN
FT                   QLKAAGSAVEHLGYVA"
FT   gene            616024..616689
FT                   /locus_tag="RPC_0564"
FT   CDS_pept        616024..616689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0564"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86139"
FT                   /db_xref="GOA:Q21BU7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU7"
FT                   /protein_id="ABD86139.1"
FT                   /translation="MSPELIEMIAWSTLDTLMMVGLSGLFGTVLGLPLGIFLATSRANE
FT                   LFPAPVANRIVGLIVNATRSTPFIILVVAIVPLTRLIAGTSIGTAAATVPLTIAAIPFI
FT                   ARVIEAAIREVDQGLIEAARAFGASPLQIVRKVLLPEAMPAVTLALTLTIVSLLGYSAM
FT                   VGAVGGGGLGDLGIRYGYQRFMPEVMLTVVLVLIALVQGVQTLGDTVARRLDKRSRQS"
FT   gene            616717..617493
FT                   /locus_tag="RPC_0565"
FT   CDS_pept        616717..617493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0565"
FT                   /product="Lipoprotein YaeC"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86140"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU6"
FT                   /protein_id="ABD86140.1"
FT                   /translation="MRLLTASLVAIAALIGSAQAETIRVGVTAGPHAEIIDVVRKVAAE
FT                   RGLDIKVVEFTDYVVPNQALAQKDLEANSFQHEPYLKNQISKTNWKIVKVGNTIISPQG
FT                   VYSTKYKTLADLPTGAKVAIANDPSNGARGLLILAQNGLIKLKDPSNTAASVADIAENP
FT                   KKLRFVELDAAQLPRSLPDVDLVSINNNYAVQAGLNPVTDPIAHETPGGPWVNILAVRE
FT                   EDKDKPWVKQLIEAYHSAPVRQFIETRFKGTYLAAW"
FT   sig_peptide     616717..616779
FT                   /locus_tag="RPC_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(617749..618798)
FT                   /locus_tag="RPC_0566"
FT   CDS_pept        complement(617749..618798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86141"
FT                   /db_xref="GOA:Q21BU5"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU5"
FT                   /protein_id="ABD86141.1"
FT                   /translation="MPPKAHVARRQAVDPEPADRSPATANRSVERHVMQYANRAIARVV
FT                   ETYCKQNGFDVEFGLDGWLMVMSKGVIKHYIYGYDVGLNSSVVHRIANDKSATAEILAS
FT                   CGIDCVPHALFMNHNQFKYVPLGGHWTRMLQMQGEHPEGLVLKPNEGTCGNLVFKVATE
FT                   LELEQAATAIFAVNQNLAVAPYLDIDREIRVILLDQHPLVVYEKQRPSVIGDGVRSAFE
FT                   LVLDRVPAQLLATTLSNLPPNRTLLDAVLPEGETFFLNWRHNLDLGAEPELLHDGPHWR
FT                   ASVDIAGRAAQAIGLAFGAIDVVWSKQTPRILEINSGVMIESLSKRHPDLAQRVYTQAL
FT                   DKIVQRLTR"
FT   gene            619250..620875
FT                   /locus_tag="RPC_0567"
FT   CDS_pept        619250..620875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0567"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86142"
FT                   /db_xref="GOA:Q21BU4"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU4"
FT                   /protein_id="ABD86142.1"
FT                   /translation="MDTLLLPFSPRFIALTICTVATLVLFGVGIFDPKAFDLVLLPLLL
FT                   FGALTLLGLRDLIQRSHAVLRNYPISAHLRFLLEEIRPEMRQYFFESEKDGMPFSRDTR
FT                   AVIYQRAKMVLDKRPFGTQEDVYREGYEWMHHSVAPRPNAEQQFRLSIGGPDCARPYSA
FT                   SVFNISAMSFGALSPNAIRALNGGAKKGGFAHDTGEGGVSPYHRENGGDLIWQIGSGYF
FT                   GCRNPDGSFNADEFAKVACEDQIKMIELKVSQGAKPGHGGVLPAAKVSEEISKIRGVGM
FT                   GEDCISPAFHKAFSTPLELMAFLDEMRQLSGGKPTGFKLCIGHPWEFLAICKAMLQSGI
FT                   YPDFIVVDGTEGGTGAAPLEFMDHLGMPMREGVNFVHNALIGIDARDRIKIGAAGKIAT
FT                   AFDMARAMAIGADWCNSARGFMFALGCIQSLSCHTDRCPTGVTTQDPSRNRALVVPHKI
FT                   ERVYNYHEAMLLALAELIAAAGLDHPQELRPIHFSQRTSTTEVRSFARLYPQLRPGELI
FT                   AGTSDLRFRDAWDLARADSFAAAL"
FT   gene            complement(620930..621199)
FT                   /locus_tag="RPC_0568"
FT   CDS_pept        complement(620930..621199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0568"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86143"
FT                   /db_xref="GOA:Q21BU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU3"
FT                   /protein_id="ABD86143.1"
FT                   /translation="MSFKTRSAAIALAAVVTAGAITSSTQAEAKGPGPAFAVGAGLLGA
FT                   AVVGSAIANNSGYYYSDYGYRRCGWVRQYDAFGNYIGRVRSCDY"
FT   sig_peptide     complement(621110..621199)
FT                   /locus_tag="RPC_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.507 at
FT                   residue 30"
FT   gene            complement(621304..622119)
FT                   /locus_tag="RPC_0569"
FT   CDS_pept        complement(621304..622119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0569"
FT                   /product="Creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86144"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU2"
FT                   /protein_id="ABD86144.1"
FT                   /translation="MTGKAPSRDWTAIRWPDFADTDVARWIAVLPLAATEQHGPHLPLG
FT                   TDVFIAEAYLSRVRALLPAAVPASFLPLQPIGISTEHIGFPGTLTLPAELAIATWTAIG
FT                   ASVARAGLRKLVIVTSHGGNSAAMNLVAQQLRADHGMLAVTTSWSRFGGPAGLFDDEEL
FT                   RHGIHGGAVETSIMLAHDPQQVRSDKIADFHPASLEIARRFQRLSTQRPAPLAWQAEDL
FT                   NRSGAIGDATKASAEAGRQLIAHGARAFCELLEDVDRFDLTTFGQTPQA"
FT   gene            622283..623302
FT                   /locus_tag="RPC_0570"
FT   CDS_pept        622283..623302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0570"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86145"
FT                   /db_xref="GOA:Q21BU1"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU1"
FT                   /protein_id="ABD86145.1"
FT                   /translation="MSRGLLRRALTAGLVTLALSAPGRAEDTLDKVSFGTNWVAEAEHG
FT                   GFFQAVADGTYKAYGLDVSIVPGGPNINNRALLIAGKLDFFMSANTLQSFDAVANNVPV
FT                   VAVAAMFQKDPQVFLAHPEAKVTKLQDLKPLTLFISKEGVASYFQWLKSEFGFSAARVK
FT                   PYTFNPQPFLFDRKSAMQGYVTSEPYVIEKQAAFKPTVLLLADYGFSSYSTLIETRRDM
FT                   VEKKQDLVQRFVDASIVGWYNYLYGDNKPGNAMIKNLNPEMTDDMLSYSVATMKQYGIV
FT                   DSGDSLTDGIGAMSDARIADFFGKMSRAGVVPRDLDFRKSYTLQFANKGVGIDLRTKR"
FT   sig_peptide     622283..622360
FT                   /locus_tag="RPC_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            623314..624129
FT                   /locus_tag="RPC_0571"
FT   CDS_pept        623314..624129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0571"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86146"
FT                   /db_xref="GOA:Q21BU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BU0"
FT                   /protein_id="ABD86146.1"
FT                   /translation="MAASAALTEHELAPRDAVAVRLRGVSKRYRSGAPALGPLDLDVGR
FT                   GEFVALLGPSGCGKSTALRLIAGLAQPSSGTVQRTAHPVTRRGEHAIGFVFQEPTLMPW
FT                   ASVRGNVALPLRLARASRADVAARVEEALTRVGLREAADALPRELSGGMKMRVSLARAL
FT                   VTDPDILLLDEPFAALDEITRFRLNNDLLTLWRELRKTVIFVTHSVFESVYLSQRVIVM
FT                   TPKPGRIAATFRIAAEEPRDDRFRTSAGYAAQCREISDALVRTNARESE"
FT   gene            624126..624956
FT                   /locus_tag="RPC_0572"
FT   CDS_pept        624126..624956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0572"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86147"
FT                   /db_xref="GOA:Q21BT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT9"
FT                   /protein_id="ABD86147.1"
FT                   /translation="MSDAGEPQRDREARGIAATRLLQIALPAIVLALAIAGWHLAVRLN
FT                   DIPPYVLPGPGLVLRTLIADWPVLSGSLLTTLWTTLEGFVAAAIGGIALAILFNQSRWL
FT                   EFALLPYAIILQVTPVIAIAPLLLIYLPQDTAVIACAFIVAFFPVLANTTLGLSSVDRN
FT                   LAGLFRLYGASRLQTLLRLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGSAGAGSGL
FT                   AYRIAESSYRLNIPRMFAALLLLSLAGIVIYGLLALVSHLALRRWHESALGKDN"
FT   gene            624956..625936
FT                   /locus_tag="RPC_0573"
FT   CDS_pept        624956..625936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0573"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86148"
FT                   /db_xref="GOA:Q21BT8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT8"
FT                   /protein_id="ABD86148.1"
FT                   /translation="MPDVSSEQVDLLLYGPDKPLIDAGFPDRFGLHKAEQLADLERLAP
FT                   DIAARIRGVAVTGLVPASGAVLARFPKLEIVSSFGVGYDHVDAGYAREHGIVVTNTPDV
FT                   LTEEVADVALGLLIATLREFIAADRHVRTGAWQSQNFPLSTGSLRDRSVGIVGMGRIGQ
FT                   AIGRRLEASKVPVVYHSRHPAAGVGYRHYPNLIEMAKAVDTLVVIIPGGAATAKLINAE
FT                   VLAALGPRGVVVNVARGSVIDEPALITALQTGTIQAAGLDVFADEPNVPEELRALPNVV
FT                   LLPHIGSASVVTRNAMDQLVVDNLTAWFDGQPPLTPIAETPVKDR"
FT   gene            625939..626655
FT                   /locus_tag="RPC_0574"
FT   CDS_pept        625939..626655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86149"
FT                   /db_xref="GOA:Q21BT7"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT7"
FT                   /protein_id="ABD86149.1"
FT                   /translation="MSTRRCSLWPAGAVVVAAMAALLIGEMPARAQDTSAMKKQMLGQW
FT                   ELSTAERSKTCVVTLKNDSTAQGFRLELEPTCAAALPFTKEIAAWSIKGLDIVRLQDAA
FT                   GQSVIDLTEVESGILEGLRSGEGIYILQNLIAARSLAKSMDQMIGDWSMVRGNGQSICG
FT                   LTLTNNEATPDNFQLFLKPRCDPAVAGFAPTMWRLERGALLLMAANGAVWRFEADDNAQ
FT                   WRRTPDTVDPLILLRQ"
FT   sig_peptide     625939..626001
FT                   /locus_tag="RPC_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.552 at
FT                   residue 21"
FT   gene            complement(626833..627561)
FT                   /locus_tag="RPC_0575"
FT   CDS_pept        complement(626833..627561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0575"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86150"
FT                   /db_xref="GOA:Q21BT6"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT6"
FT                   /protein_id="ABD86150.1"
FT                   /translation="MAADSADPDDRTEPGFFAEAPHYHGHRERLRERFRSAGAEALSDY
FT                   ELMELVLFRALPRRDVKPLAKALIGKFGSFAETVHASEPRLREIAGLGEAAITEIKLIA
FT                   AAASRVAKGELKQRAVLSSWSSVIDYCRTAMAFADKEQFRILFLDKRNQLIADELQQVG
FT                   TIDHTPVYPREIVKRALELSATAIIMVHNHPSGDPTPSQSDITMTKQIIDIAKPLGIAV
FT                   HDHIIVGKHGHASLKGLKLI"
FT   gene            complement(627687..627917)
FT                   /locus_tag="RPC_0576"
FT   CDS_pept        complement(627687..627917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86151"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT5"
FT                   /protein_id="ABD86151.1"
FT                   /translation="MADRPRDLADRMARRRPPADGFVRQTLTLPRQEARAAAREFFASF
FT                   PKAAYMSGVESWRELPGDRIEFTLKRLPSAD"
FT   gene            628058..629107
FT                   /locus_tag="RPC_0577"
FT   CDS_pept        628058..629107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0577"
FT                   /product="Ku"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86152"
FT                   /db_xref="GOA:Q21BT4"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT4"
FT                   /protein_id="ABD86152.1"
FT                   /translation="MAPRANWKGFLRLSLVTCPVALYPATSDSEKISFNQINRATGNRI
FT                   KYLKVDAETGEEVAPDEIMKGYKVDSDSYIEVTKDELDAIALESTRTIDIDQFVPKSEI
FT                   DELYLVRPYFIVPDGKVGHDAYAVIRETIRSLDKVALARVVLTNREHVIALEARDNGLM
FT                   GMLLRYPYEVRDAAEYFDDIQDVKITKDMLDLAKHIVEQKSGHFAPEGFEDHYEAALTE
FT                   LINQKRNGTPIAAKARPKGDNVVDLMEALRRSISGDAKAKTAEGGRSEGRAAAAAPAAV
FT                   GSAKSSAAGGTSAKGKKPRKAAAGQKEMLLPISGSRAAKEAAKEISKEEAGKTRKPAPR
FT                   AAAKARKAG"
FT   gene            complement(629649..630470)
FT                   /locus_tag="RPC_0578"
FT   CDS_pept        complement(629649..630470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0578"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86153"
FT                   /db_xref="GOA:Q21BT3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT3"
FT                   /protein_id="ABD86153.1"
FT                   /translation="MSYVDASETSVRKTGQIKLHGPNAFAGMRKAGQLVARCLDELVDI
FT                   VKPGVPTSRIDDFVREFAFSHGAYPATLMYRGYRFSTCTSINHVVCHGMPGDRPLKEGD
FT                   IVNIDVTYIVDGWYGDSSRMYPVGAISRKAERLIEVTYESLLRGIAAVKPGATTGDIGH
FT                   AIQSYVEPDMGVVRDFCGHGLGRMFHDEPNIIHVGSPGQGVALKPGMFFTIEPMINLGK
FT                   PYVKVLSDGWTAVTRDRSLSAQFEHSIGVTPTGAEIFTLSPKNLDKPPING"
FT   gene            complement(630587..631909)
FT                   /locus_tag="RPC_0579"
FT   CDS_pept        complement(630587..631909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0579"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86154"
FT                   /db_xref="GOA:Q21BT2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT2"
FT                   /protein_id="ABD86154.1"
FT                   /translation="MELDVKLNEIYEMLLAATRSVGAEITSPWFYFQLGLIIAGAGIAY
FT                   AIGATVRARVDLSTTSTGWPAPLRLLRRVMVGSASTAAFAVVMMAARGGMLAWTWPSRS
FT                   YLLAVCAKLALAWLVIRLVTSVIRNGFLVRLVSLSAWCVAALSILGQLEQTIEALDSVS
FT                   VVVGGLRLTPLLLIKLVVLLAIALWLTNVASKFLEGRIAQSRDLTPSIQVLLIKLVRVA
FT                   LMIFAVTVVMSAVGINLSALAIFSGAAGVGIGFGLQKIVANFISGVILLADKSVKPGDL
FT                   VTIGDSFGRISAMNTRYISVSAGDGREFLIPNEDLVTQKVVNWTYTDKNTMVKVNFGTN
FT                   YDADPRLVCKLAADVAAAVPRAIKHKTPSCLLTEFTEAGMKFSLTFWIADPDGMDRVRS
FT                   DVMLTLWEAFKREGIRVPYPVREIRIRGGALPVETVVEVAP"
FT   gene            632133..633929
FT                   /locus_tag="RPC_0580"
FT   CDS_pept        632133..633929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0580"
FT                   /product="sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86155"
FT                   /db_xref="GOA:Q21BT1"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT1"
FT                   /protein_id="ABD86155.1"
FT                   /translation="MASLDAVSIAILLGAFLVMVGILSSLLALRFGAPLLLVFLFIGMA
FT                   AGESGPGGLRFDDLQTTYLVGSVALALILFDGGLKTKLQSIQTVLAPSVVLATLGVLLT
FT                   ALITAPVAHYVLELNWAEALLIGAVVASTDAAAVFLLVHAQGLRLRPRVGATLEVESGT
FT                   NDPFAVFLTLMLVELITVGDSTAWHVIMLFLRDALLGAVVGFVGGRLVVLALNRVALPQ
FT                   GLHAPFVATAALVIFGAAQSSHASGFLAVYLAGIIIGNRPTRAHNSVVTFLDAATWLAQ
FT                   IVMFVLLGLLVSPQRLLGSIGPAIVIALALMLVARPVAVFLCLAPFRFNWREKLFVAWV
FT                   GLRGAVAIFLASIPMLVGLSNAYLYFDVAFVVVLISLLLQGWTLGFAARRLHVALPRAD
FT                   RGPRRVELDLPGQLEQQLVGYAVRPKSLYLRRGLIPSWSKPTLVIRDQRILSPAEAEPV
FT                   SAGDYIYLLAPPEKAEALDRFFVDMSPSSAPDPHLLGDFMVVGEVTLGDLAGIYGVNVA
FT                   PDEAQLTLADYFDVHLDRAPKLGATLPLDSIVLVARSLGGGRVNVIGLRLPEDDEPPRP
FT                   PMTRIQTLKRKLAAIWASVAGI"
FT   sig_peptide     632133..632219
FT                   /locus_tag="RPC_0580"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.641) with cleavage site probability 0.195 at
FT                   residue 29"
FT   gene            complement(634193..635131)
FT                   /locus_tag="RPC_0581"
FT   CDS_pept        complement(634193..635131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0581"
FT                   /product="peptidase U6, penicillin-insensitive murein
FT                   endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86156"
FT                   /db_xref="GOA:Q21BT0"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BT0"
FT                   /protein_id="ABD86156.1"
FT                   /translation="MIARLIPLLLMLPLTVVAAGVALAQDKGSVEPKPLPPLSNPNDPT
FT                   LAAKELFGRKATPVAAQPAQAIGFYAKGCLAGGEALPINGEAWQVMRLSRNRNFAHPAM
FT                   VALLKRLASKAQRAAGWPGLLIGDMSQPRGGPMITGHASHQVGLDADIWLTPMPNRMLS
FT                   RNEREEMSAVMMVRPDRLDIDPRVWKPSHLPVIRAAAQEPQVERIFVNAAIKKALCREA
FT                   KGDRAWLAKVRPMYGHDYHFHIRIKCPAGSTACEPQPAVTEGEACAASDLAYWFSDAVL
FT                   HPKPPPTPPKPKPPLTLADLPPSCRDVVAAP"
FT   sig_peptide     complement(635057..635131)
FT                   /locus_tag="RPC_0581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(635236..635481)
FT                   /locus_tag="RPC_0582"
FT   CDS_pept        complement(635236..635481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86157"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS9"
FT                   /protein_id="ABD86157.1"
FT                   /translation="MSEKTVSPATARTAPPALWATVADRRPFDWRPQCNQEGVVSDVRG
FT                   GNDNFELSSGDFPTFRFNRRLVRINLRQSTPGLLSG"
FT   gene            635522..637753
FT                   /locus_tag="RPC_0583"
FT   CDS_pept        635522..637753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0583"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86158"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS8"
FT                   /protein_id="ABD86158.1"
FT                   /translation="MPTNRPKKKQLQQAAHRRPALLRGAAKPKTKAVPKDRRIAAEIGE
FT                   VVRKRAAADAAIAEARKSHERLREAIDILPQGIVFLDAEGRYILWNKKYAEIYNRTADL
FT                   FQPGVKMIDTLRVGVARGDYPEALGHEEEWMAERMAKLFQPGERHEQLISDGRCIQIEE
FT                   RMTADGGIIGLRIDITELKQREASFRLLFDSNPVPMIVCALADERILGVNDAAVEHYGY
FT                   SAAEFSTLTIRNLQAFEAERPWTGDQSTDERAARTWKHVKADGSLIDLAVYSRQLLYGG
FT                   EPAVLLALMDITERKRAEMRLAFMAQHDGLTGLPNRNSLRKRLDEMLVHTRRGNEKAAV
FT                   HFLGIDNFKGVNDSLGHAVGDKLLRGIARRLRSTLREEDVIGRLNSDEFAILQSGVSRP
FT                   EDVVLLAKRLLHAIGEPFLLDGNSVVIGASIGIAMAPGDGDDSEKLLMSADMALARAKT
FT                   ETRGTFSFFEPGMDARAQTRRKIESELRGAIQNDVLRPHYQPLIGLSNGRITGCEALVR
FT                   WPHPERGMVSPSEFIPVAEDTGLINALGAQVLKRACEDAANWPDDVRVAVNLSPLQFRL
FT                   GNLLSLVMDALKQTGLPPKRLELEITETLLLEKSSQVIATLHALRALGVRISMDDFGTG
FT                   YSSLSYLRSFPFDKIKIDQSFVRGLCTNRELQAIVRSIISLGMGLGVTITAEGVETESE
FT                   LSWLRAEGCHEAQGFLFSAARPNSEIIDLLSVQSGADFATPDRASIQVA"
FT   gene            637930..639171
FT                   /locus_tag="RPC_0584"
FT   CDS_pept        637930..639171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0584"
FT                   /product="secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86159"
FT                   /db_xref="GOA:Q21BS7"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS7"
FT                   /protein_id="ABD86159.1"
FT                   /translation="MVLLRKFVVALVGVAAACVVAPVGAASLPVGPAGDAFYLPPQPLP
FT                   PGPRGSVIWVRPLEGTMALPSAATNSLVLYRSTGAAGGTVAVSGTLSIPPGEAPRGGWP
FT                   VIVWTHGTTGLAPICAPSRDTDSGPEHGYIAVIRTLLDGFVKNGYAIVATDYEGLGVPG
FT                   DQPFLQGAPTARNALDLLRAGRAIEPKLGRDYAVLGHSQGGQVDLFAAALGPSYVAEFR
FT                   LRGNVAFAPGSQIMDRLRLVMTSGNNELSLPYVLYTLQSYARSNPNIDLKRILTPTALS
FT                   HLPDLMQGCMTAALTTGYWSTAIAKEQFVAKPDLRAFQTMARRNEPGLLRIKAPTMIVQ
FT                   GKDDVTVMPQATDDVARQLCARGNQLDYLPVAGADHDGSMSKGGADALAFINARFRGVT
FT                   AGSNCKALPKAATK"
FT   sig_peptide     637930..638007
FT                   /locus_tag="RPC_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 26"
FT   gene            complement(639181..640038)
FT                   /locus_tag="RPC_0585"
FT   CDS_pept        complement(639181..640038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0585"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86160"
FT                   /db_xref="GOA:Q21BS6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS6"
FT                   /protein_id="ABD86160.1"
FT                   /translation="MKRAAAVWIATLFLSASTFSSALAEPIAPAGKPIGQDARGNVIYQ
FT                   VAANGISIGYKLIGSGAPMVLIMGLGGTAENWQPQIIDALSQHYQLIMPDNRGMGHSSA
FT                   NATTFSYPLFAADVIGLLDALGVKQSHVLGYSMGSTITQQLLLQYPERFNKALIHATST
FT                   DGSNVAKALHGRVPADPIVARQVEATTHWKTPLEQLPGIHNQVMLVVGTADDVVGDDSS
FT                   KTLAAAIPGAWLVQFKGGTHHLMYEAPAGFAAIARTFFDTEESVTEKAARPDASVAPPT
FT                   AARP"
FT   sig_peptide     complement(639964..640038)
FT                   /locus_tag="RPC_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.945 at
FT                   residue 25"
FT   gene            complement(640148..640492)
FT                   /locus_tag="RPC_0586"
FT   CDS_pept        complement(640148..640492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0586"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86161"
FT                   /db_xref="GOA:Q21BS5"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS5"
FT                   /protein_id="ABD86161.1"
FT                   /translation="MGRLEVRRGDVVLVVAQGDLGKPRPGVIVQADELGNTTTSILICP
FT                   MSSDLSEFRRTRPIVEPSADNGLHVRSQIMVDKVNALRRDRIRGVIGRIDADTAEHLDR
FT                   ALLVVLGLAR"
FT   gene            complement(640474..640710)
FT                   /locus_tag="RPC_0587"
FT   CDS_pept        complement(640474..640710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86162"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS4"
FT                   /protein_id="ABD86162.1"
FT                   /translation="MPTTPKKPPAKTPRERMATRRRRLRAQGLRPVQHWVPDLRDPKVV
FT                   AEIRREGAMMAKHPENDAIDDWIEQVYDWDAWK"
FT   gene            complement(640805..641188)
FT                   /locus_tag="RPC_0588"
FT   CDS_pept        complement(640805..641188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86163"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS3"
FT                   /protein_id="ABD86163.1"
FT                   /translation="MAATSLRPILRDARPLGVLLRMTRPGCGFISALVDSCALPCYKRV
FT                   FQSAREAEAMTDITYDPEAEAVYITIGNGDFDHTEKAGSFIYDVDAQGRVLGIEILFVS
FT                   TVLAPGDWQKARLPGEARFNAAE"
FT   gene            complement(641358..641552)
FT                   /locus_tag="RPC_0589"
FT   CDS_pept        complement(641358..641552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86164"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS2"
FT                   /protein_id="ABD86164.1"
FT                   /translation="MSPIVKYQAEDNAAYIRLSSGNVLESAEVAPNVIFDYDAEGRIVG
FT                   IELLDARAQLSAELLSSAA"
FT   gene            complement(641549..641812)
FT                   /locus_tag="RPC_0590"
FT   CDS_pept        complement(641549..641812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86165"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BS1"
FT                   /protein_id="ABD86165.1"
FT                   /translation="MVARKPLTFTKHARDAVLERTLDLDWIEKTVWEPAWSHPDPTWPG
FT                   VERRFRAIPEFGGRILRVACLENADEVRILTVFFDRDARAPT"
FT   gene            complement(641927..643840)
FT                   /locus_tag="RPC_0591"
FT   CDS_pept        complement(641927..643840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0591"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86166"
FT                   /db_xref="GOA:Q21BS0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BS0"
FT                   /protein_id="ABD86166.1"
FT                   /translation="MISLGFGRQAPAFGPFPAAAAPIVLPLSGPNAIPRLMTTVPISNI
FT                   RNFSIVAHIDHGKSTLADRLIQTTGGLQAREMKEQVLDSMDIERERGITIKAQTVRLNY
FT                   HAQDGRDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDA
FT                   GHEIVPVLNKVDLPAAEPEQVRQQIEDVIGIDASEAVMISAKTGLGIDLVLEAIVHRLP
FT                   PPQGDREAPLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERVGFF
FT                   TPKMTQVDELGPGEIGFITAGIKEVADTRVGDTITDDKKPVTEMLPGFKPAVPVVFCGL
FT                   FPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSRE
FT                   FDLNLIATAPSVIYKMHLTDGTELEIHNPIDMPDVVKIAEIQEPWIEATILTPDEYLGS
FT                   VLKLCQDRRGTQKELTYVGSRAMVKYNLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYQ
FT                   PADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGK
FT                   IIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV
FT                   DS"
FT   gene            643885..645435
FT                   /locus_tag="RPC_0592"
FT   CDS_pept        643885..645435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86167"
FT                   /db_xref="GOA:Q21BR9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR9"
FT                   /protein_id="ABD86167.1"
FT                   /translation="MFSRLVVAPFTRWIDALLDSRRQNRAVIWTLAAYAAIWTGYRALA
FT                   TMPRDLHADVTELYGWSRDLAFGYDKHPPFSAAVAKAWLSVFPATDLSFHLLATVNIAL
FT                   TLYIAFRTMRRYLPAEKTVFGLALLMLIPFFNFIALKYNANAVLLPLWAVTIHCFLRAY
FT                   ERRNALWAALAGLGAGAAMLGKYWSIVLIAGLGLAALIDSRRVSFFRSKAPWIMAGVGL
FT                   VVIAPHLAWLVQHHFPTFAYAAAHSAPSFSENLAATAGYLAGCVGYVAVPLIVAILLLR
FT                   PTPEALLDVVAPKDPSRRLILVIQLLLIVVPAPFALMMGLRIVPLWTMPAWTLLPIVAL
FT                   GSPLIAVGRVALERLVAGTAIGTLAMLALAPVVALTIHLNSPPGSFEYASLLAEKIEQQ
FT                   WRQRSALPIPLVAGTTVLPANTAYYLQTRARSFENADVATLKAAAQAHGAVLVCPAEDA
FT                   GCIAVADQIVAGQSEISRSEVRLSRPLFGFAGDSVRDVFMMVWPPVPPPALPVPLGGK"
FT   gene            complement(645682..646020)
FT                   /locus_tag="RPC_0593"
FT   CDS_pept        complement(645682..646020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0593"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86168"
FT                   /db_xref="GOA:Q21BR8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR8"
FT                   /protein_id="ABD86168.1"
FT                   /translation="MTADTDNAPSTGAANPDAGASSDPVSVEIPIVNKRGLHARASAKF
FT                   VQMVERFNAEVWVTRNGETVGGTSIMGLMMLSAGIGTSVTVSAVGPQAKEAVDALAGLL
FT                   ASKFGEED"
FT   gene            complement(646017..646418)
FT                   /locus_tag="RPC_0594"
FT   CDS_pept        complement(646017..646418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0594"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86169"
FT                   /db_xref="GOA:Q21BR7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR7"
FT                   /protein_id="ABD86169.1"
FT                   /translation="MIGLVLVTHGRLADEFKAALEHVMGPQKQIEAVTIGAEDDADLCR
FT                   SDIIEAVNRVDSGDGVAILTDMFGGTPSNLAISCMSRPKVEVLAGINLPMLVKLAKVRE
FT                   ERPLPDAIALAQEAGRKYVTIASRVLAGK"
FT   gene            complement(646545..647087)
FT                   /locus_tag="RPC_0595"
FT   CDS_pept        complement(646545..647087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0595"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86170"
FT                   /db_xref="GOA:Q21BR6"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR6"
FT                   /protein_id="ABD86170.1"
FT                   /translation="MTEPAASSSGSGTVHASAVKVGDRAVLIRGPSGAGKSRLAFDLML
FT                   AGRAGMIPAAMLIGDDRVHLERRADGLVVRAAAAIAGLIEIRGLGLRRCDFVAEAVVGL
FT                   VVDLAAGDAERLPQPAALRTTINGVELPRIPVGESYEPLPLVVAAFTTLEGSGLTTDEG
FT                   DCSKRFDNHIIPTIVTK"
FT   sig_peptide     complement(647037..647087)
FT                   /locus_tag="RPC_0595"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.735) with cleavage site probability 0.702 at
FT                   residue 17"
FT   gene            complement(647084..648784)
FT                   /locus_tag="RPC_0596"
FT   CDS_pept        complement(647084..648784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0596"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86171"
FT                   /db_xref="GOA:Q21BR5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR5"
FT                   /protein_id="ABD86171.1"
FT                   /translation="MAWLRRAGQFFLALSFSSLTRRIVSLNLAGLVLLVASILYLSQFR
FT                   AGLIDARAQSLLVQAEIIAGAIAASATVETNTITIDPDRLLDLKPGETFGPPDELSGLD
FT                   FPINPERVAPVLRRLISPTKTRARIYDRDGVLILDSRSLYGRGDVLRFELPPPTTEKPG
FT                   VAERTMIAIRTWLNRGDLPLYRELGPENGNGYQEVVQSLDGQKSSMVRINDRGEVIVSV
FT                   AVPVQRFRAVHGALMLSTQGDDIDQMVTAERLAILKVGGVASLVMMVLSLLLASTIAGP
FT                   VRRLADSAERVRRRIRTRVEIPDFTGRRDEIGHLSGALRDMTEALYNRIEAIERFAADV
FT                   SHELKNPLTSLRSAVETLPLAKNEKSRSRLLEVIEHDVKRLDRLISDISDASRLDAELQ
FT                   RQDVAPVDLRRLLATLTSVANETKLGTNVGVEVRFEGAGNDAFWVPGHDSRLGQVISNL
FT                   LVNAQSFSSAGGKVRIVCRRRKTEIEIVVDDDGPGIRDDALEKIFERFYTDRPHQGFGQ
FT                   NSGLGLSISKQIVEAHGGKIWAENRPGPVDADGEPSFAGARFVVRLPAT"
FT   gene            complement(649018..649719)
FT                   /locus_tag="RPC_0597"
FT   CDS_pept        complement(649018..649719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0597"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86172"
FT                   /db_xref="GOA:Q21BR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR4"
FT                   /protein_id="ABD86172.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALEAEGYRIMTYTDGASALDGFRTSP
FT                   PDLAILDIKMPRMDGMETLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFS
FT                   QRLLVERVKAVLRRAAPKDPAAVPKETDAKALDRGLLRMDPERHTCTWKNEPVTLTVTE
FT                   FLILQALATRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKVVDDDFEMIET
FT                   LYGVGYRFKET"
FT   gene            649922..650665
FT                   /locus_tag="RPC_0598"
FT   CDS_pept        649922..650665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0598"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86173"
FT                   /db_xref="GOA:Q21BR3"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR3"
FT                   /protein_id="ABD86173.1"
FT                   /translation="MQPTPHFSASELARSLLRRSRQGALATLAVGSGAPYCSLVNLASH
FT                   WDGSPILLISRLALHTQNLLADPRVSLMLDERAPGDPLEGARIMLSGTAQPATSEELPT
FT                   LRRRYLNAHPSAEQFVDFGDFSFFVIRPSGAHLVAGFGRIVDLKPQQLLTDLTDAHAFL
FT                   AEEQGIIAHLNADHLGTMKLYATQLLGARDADATWRCTGCDPDGLDLSDGSTTLRLALP
FT                   QRTLTAAALRSLLKQLADQARRSNA"
FT   gene            650846..652459
FT                   /locus_tag="RPC_0599"
FT   CDS_pept        650846..652459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0599"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86174"
FT                   /db_xref="GOA:Q21BR2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BR2"
FT                   /protein_id="ABD86174.1"
FT                   /translation="MQETGVRNGAYGADKFGLKNLKGVKWNLTAPHLYEDALRAGEGVL
FT                   SGDGSLCVDTGIFTGRSPKDKYTVRDANTENTMWWGGNQSITAEQFENLYQDFLKHAEG
FT                   MSLFAQDLYGGADPSFQIKTRVFTEMAWHSLFIRTLLRRPETAELASFVPELTIIDLAS
FT                   FRADPARHGCKSENVVAIDFTRKIVLIGGTQYAGEMKKSVFTTLNYYLPDKGVLPMHCS
FT                   ANVGPDGDTAIFFGLSGTGKTTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAKCIKLS
FT                   AEAEPEIFAASNRFGAILENCVLDPITRKPDFNDGSKTENTRSAYPLESIPNASPTGRA
FT                   GQPKNVVMLAADAFGVMPPIAKLSPAQAMYHFLSGYTAKVAGTERGVTEPTPVFSTCFG
FT                   SPFLPRDPSVYGNMLRELIAKHGVDCWLVNTGWTGGMYGTGHRMPIKVTRALLTAALDG
FT                   SLRNVEFKTDPYFGFAVPTALPGVPSEILDPVKTWADKAAFDTTARKLVAMFQKNFTQF
FT                   EAQVDAEVRAAQPEAKLAAE"
FT   gene            complement(652605..653006)
FT                   /locus_tag="RPC_0600"
FT   CDS_pept        complement(652605..653006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86175"
FT                   /db_xref="GOA:Q21BR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR1"
FT                   /protein_id="ABD86175.1"
FT                   /translation="MATSDDGEEHLLVEAAYRECPTASEREASDKRDDADGNAHDEDIP
FT                   QINPAVLIGVPPLPGLDAIEVVLIQPAPIWARWSEGLMIHVVGSGIVAVFAFVMGLMFA
FT                   GTTNKAEGASAQPLSCVVAPVSAPGKKTE"
FT   gene            653383..653670
FT                   /locus_tag="RPC_0601"
FT   CDS_pept        653383..653670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86176"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BR0"
FT                   /protein_id="ABD86176.1"
FT                   /translation="MTIIGGSDAAASGERRARGRPKSLEAGNRLHLYIPDSLTNRLQEL
FT                   QRDTHAGSLTEVVKNALMLYAAAVEEHKSGGRVYFKRKDETGERQLALFI"
FT   gene            653812..654051
FT                   /pseudo
FT                   /locus_tag="RPC_0602"
FT   gene            654317..655810
FT                   /locus_tag="RPC_0603"
FT   CDS_pept        654317..655810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0603"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86177"
FT                   /db_xref="GOA:Q20XX3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q20XX3"
FT                   /protein_id="ABD86177.1"
FT                   /translation="MDHRRTHPQHTAAAKAGISERSARRIDRDPTLPSQRKTPRGYRTR
FT                   PNPFDGVWEADIVPLLQSMPSLQAITILRELQRRHPGRFPDSHLRTLQRHMRRWSALAG
FT                   PERDVIFRQEHPPGAQGLSDFTDAGELGVTMVGLAFPHRFYHFALAHSQWEYARVVEGG
FT                   ESFSALAEGLQNALWLLGGAPREHRTDSLSAAFKNLSEEEDFTRAYRELCDHYGMAATR
FT                   NNRGVSHENGSIESPNRHLKKALDQALTLRGSRDFDTRVAYQAFTDDIVGQRNAARDQA
FT                   FAADRAALRALPPRRTTDFSEAAVVVTSSSMFCLRKVFYTVPSRLIGHRLKVHLYDDRL
FT                   DCFLGSTQVLVLPRGRVPRGAQRGHVADYRHVLPSLRRKPQALRNLVWRDALFPRPAFR
FT                   RAWDTLVERGPIDRACRTMVALLDIAYCSGCEAELAAHIDSVLDLGHLPDPNALRAVFS
FT                   RDAAAQNGGAALPTVAVTMPAALIYDVLLSSVHGEVSSC"
FT   gene            655804..656637
FT                   /locus_tag="RPC_0604"
FT   CDS_pept        655804..656637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0604"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86178"
FT                   /db_xref="GOA:Q20XX2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q20XX2"
FT                   /protein_id="ABD86178.1"
FT                   /translation="MLTRDNTPAPITVDLARLPMLLTSLRLPTIGQMWADLAERSDREG
FT                   WPAARYLAALLEHELAERYQRRIQRNMQDAHLPAGKSFATFDFAAVPMINKSQITALAA
FT                   GGSWLDKGANLLAFGPPGVGKSHLGAALGQALIENGYRVLFTRTTDMVQRLQAARRDLT
FT                   LQNVMEKLDKYDLLILDDLSYVRKDQAETSVLFELISARYERRSLLITANQPFGGWEEI
FT                   FPDKAMTVAAIDRLVHHAVILEMNTDSYRRKAAVTRMTDRKASENSKQKPVTKTI"
FT   gene            complement(657026..657925)
FT                   /locus_tag="RPC_0605"
FT   CDS_pept        complement(657026..657925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0605"
FT                   /product="sigma 32 (RpoH)"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86179"
FT                   /db_xref="GOA:Q21BQ7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BQ7"
FT                   /protein_id="ABD86179.1"
FT                   /translation="MARAATLPVLNGESGLSRYLAEIRKFPMLEPQQEYMFAKRWREHD
FT                   DRDAAHHLVTSHLRLVAKIAMGYRGYGLPISEVVSEGNVGLMQAVKRFEPEKGFRLATY
FT                   AMWWIKASIQEYILRSWSLVKMGTTANQKKLFFNLRKAKSKISALDEGDMHPDQVKLIA
FT                   KRLGVTEQDVVDMNRRLGGDASLNAPIRDDGEPGEWQDWLVDHSPNQEAIMAEHEELDH
FT                   RRAALTGAIGVLNPRERRIFEARRLADEPMTLEDLAAEFGVSRERVRQIEVRAFEKVQS
FT                   AVKGTIARQEEAALQAAL"
FT   gene            complement(658142..659317)
FT                   /locus_tag="RPC_0606"
FT   CDS_pept        complement(658142..659317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0606"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86180"
FT                   /db_xref="GOA:Q21BQ6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BQ6"
FT                   /protein_id="ABD86180.1"
FT                   /translation="MATRTAATASAVVRPAISIKRRTRANSAACSGVGSGATVSVMQGS
FT                   ILENPLENTGRLLEVTVAGDEGAVRLDRVLALRAPELSRSRLKALILAGQVRLRPADAS
FT                   AALPTPLRDPAYHVEAGDTITIDVPPAVAAEPAGEAIALDIVYEDDDIIVIDKPKGLVV
FT                   HPAAGHETGTLVNALIAHCGNSLSGIGGVRRPGIVHRLDKDTTGLMVVAKNDKAHKSLS
FT                   EQFADHGRTNEMRRGYKAFIWGAPNRPHGTVDAPIDRHPFAREKMAVRDGGREAVTHWE
FT                   VEDTFLGRGGKPVVSLLACQLETGRTHQIRVHLAHIGHPLLGDGVYGPHFKTKANALNL
FT                   PAQAALAALGRQALHAYLLALEHPVSGEILEWTAELPADLALLRTALKATE"
FT   gene            659625..659699
FT                   /locus_tag="RPC_R0009"
FT                   /note="tRNA-Glu1"
FT   tRNA            659625..659699
FT                   /locus_tag="RPC_R0009"
FT                   /product="tRNA-Glu"
FT   gene            complement(659796..659921)
FT                   /pseudo
FT                   /locus_tag="RPC_0607"
FT   gene            complement(659945..660505)
FT                   /locus_tag="RPC_0608"
FT   CDS_pept        complement(659945..660505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86181"
FT                   /db_xref="GOA:Q21BQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BQ5"
FT                   /protein_id="ABD86181.1"
FT                   /translation="MLKRVTTWLADYAANEDPLAAAGNVVALVLAGNQPFYPLYVVLLA
FT                   GTEGLPWVLLTMVSLPFFFSVPAIARRHPRLGRVALALITTTNTVFCSWMLGEPSGTEL
FT                   FLLPCAALAGLLFWPSERLIMLPLAALPVLSFWLLHGHYSPPPHLYTPEGYGALLTMNA
FT                   VSAGMISIFLGIVFSRLYAAPKR"
FT   gene            complement(660913..662127)
FT                   /locus_tag="RPC_0609"
FT   CDS_pept        complement(660913..662127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86182"
FT                   /db_xref="InterPro:IPR007825"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BQ4"
FT                   /protein_id="ABD86182.1"
FT                   /translation="MTPFTKPALLIGLALTASTLPQIGHAASAEEQITARLNALEKENA
FT                   GLRARLNRLETAKAAKPMPPAPQNTNLAAMPQRPVGEIYGKAPVAIIHPAPRQAFEVSG
FT                   SLLLLQSASGNMEYATLINPLPLVSPHWNNQALEPDFAAAFDLGARYMNGANDIAVQWT
FT                   HLKATTNASFEGTPDQMVGPPYLIGPESALYKVGRGSLQAEFDSVKMDVGHTFCVDCDF
FT                   QMRAFGGVEFARIGQDLTGTAESRDASASSSYTNHSKFTGAGPRIGVKSQYSLGSFDFS
FT                   GEIGGAALIGTMQSRVDYLTVKPALAQPTVQYLASPNATRVIPSVNARLATAYNFAPTA
FT                   YGLFKVEVGYQAAVYFDAVGEYAVTQVPTSLVLPPNGVYLATAQHLTSNFTTHGPFMTA
FT                   KWQFQ"
FT   sig_peptide     complement(662047..662127)
FT                   /locus_tag="RPC_0609"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.653 at
FT                   residue 27"
FT   gene            662479..663525
FT                   /locus_tag="RPC_0610"
FT   CDS_pept        662479..663525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0610"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86183"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BQ3"
FT                   /protein_id="ABD86183.1"
FT                   /translation="MTSGLGNRAAVVPTIERLAVKVREVMSTKVVTVGPEDTARSVAQT
FT                   LLHHGISAVPVVDDGRPIGIVSEGDLMPRNDADRQAGRDWWLRMLSQGQEQSSDYLEFL
FT                   NATDRTAREVMTSPVVSVDEDADLVEVAELLSSKRIKRVPVLRDGKLVGIVSRADLVRA
FT                   FAHPVPAHQAEPVFDDGSRWPVASERLQQISQHAAPPPPPPPQLDIAFSAKAFHDLTLH
FT                   FEEEEDRRRHEEKHRAEEKHHQQADKFLAQHLTEEAWKRMLSGARATAMKGEQEHLLLR
FT                   FPCEVCSDHGRAVNAPDPSWPETLRGMAAEVFMRWKTELRDHGFALHARVVEFPDGVPG
FT                   DIGLFLAW"
FT   gene            663720..664982
FT                   /locus_tag="RPC_0611"
FT   CDS_pept        663720..664982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0611"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86184"
FT                   /db_xref="GOA:Q21BQ2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BQ2"
FT                   /protein_id="ABD86184.1"
FT                   /translation="MSNGVNAPLARHAMAYVLAGGRGSRLMELTDRRAKPAVYFGGKSR
FT                   IIDFALSNALNSGIRRIAVATQYKAHSLIRHLQHGWNFFRPERNESFDILPASQRVSEE
FT                   LWYLGTADAVYQNIDIIESYDPQFIVLLAGDHIYKMDYEQMLQQHVEQGADVTVGCLEV
FT                   PRREASGFGVMAVDADDVIHSFVEKPANPPPMPGKPTMSLASMGIYVFDTKFLFEELRR
FT                   DAADPNSSHDFGKDIIPYIVKHGKAVAHSFDRSCIRSHAEAASYWRDVGTVDAYWAANI
FT                   DLCDIVPELDLYDHNWPIWTYGEIVPPAKFVHDKIGRRGEAISSLVSGGCIISGSTLRQ
FT                   TLLFTGVRVHSYSTIEQAVILPYVDVARSCQLTNVVIDRGVRIPEGLVVGEDPELDAAR
FT                   FHRTDAGICLITQPMIDRLEA"
FT   gene            664979..666448
FT                   /locus_tag="RPC_0612"
FT   CDS_pept        664979..666448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0612"
FT                   /product="Glycogen/starch synthases, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86185"
FT                   /db_xref="GOA:Q21BQ1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q21BQ1"
FT                   /protein_id="ABD86185.1"
FT                   /translation="MTAVTALSVASEIYPLIKTGGLADVAGALPAALLPHGVTMRTLVP
FT                   GYPAVLAGIESAAPVHSFAMLFGGPARLLAARKGGLDLFVLEAPHLYDRPGSPYSGPDG
FT                   KDWPDNAYRFAALARTAAEIGQGLVPSFVPDIIHAHDWQAGLTPAYLRYSGKPQPATVF
FT                   TVHNLAFQGQFPRELLATLGLPPGAFSVDGVEYYGSIGYMKSGLQLSDRITTVSPAYAL
FT                   EIQGPQAGMGLDGLLRQRAAQLTGILNGIDDKVWNPATDKRITATYDLDHLAARRANTQ
FT                   SVRELFDLSLDPDRLLLGVISRLSWQKGLDLLLEALPVLLAEGIQLALLGAGDPELEER
FT                   FKSAAQAYPGQIGVMIGYDEDLAHLIQAGADALLVPSRFEPCGLTQLCALRYGAVPVVA
FT                   RVGGLSDTVVDANEMAIAAGVATGVQFSPVTGDMLAAALSKTRALYADRAAWQALQHNG
FT                   MTADVSWRNPAQHYAQLYRSLLAARQSRATA"
FT   gene            666616..667173
FT                   /locus_tag="RPC_0613"
FT   CDS_pept        666616..667173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0613"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86186"
FT                   /db_xref="GOA:Q21BQ0"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BQ0"
FT                   /protein_id="ABD86186.1"
FT                   /translation="MNAHVSHGGWPVLVLNADFRPLSYYPLSLWSWQDAIKAVFLDRVN
FT                   IVEHYDQAVHSPSFEIQLPSVVSLKSFVKPSTHPAFTRFNVFLRDRFSCQYCGAPEDLT
FT                   FDHIMPRSKGGQTTWENVVAACSPCNLRKGNMTPQQARMFPRQAPFAPTVHQLHRNGRL
FT                   FPPNYLHDSWLDYLYWDTELDP"
FT   gene            667233..667856
FT                   /locus_tag="RPC_0614"
FT   CDS_pept        667233..667856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86187"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP9"
FT                   /protein_id="ABD86187.1"
FT                   /translation="MAPIDVAVIDQHTSRMSGAEFRAFQDNRPDHERWELLGGVAMMMT
FT                   PPTLVHNQIASNLQQLLNDALERHDSSRLAAQRPGLELASGDYKPEPDIAVIDADFKAG
FT                   QRFVEKAYLLAEIVSATDDVAVPGTVRSWIDVKRELYRSHVHCLAVLIVSQDRMKVELD
FT                   LKTESGWVSSVLEGPTAELSIAAFSLRGPVGALYVRTPLAPRRS"
FT   gene            complement(668018..668794)
FT                   /locus_tag="RPC_0615"
FT   CDS_pept        complement(668018..668794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0615"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86188"
FT                   /db_xref="GOA:Q21BP8"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP8"
FT                   /protein_id="ABD86188.1"
FT                   /translation="MFEIDLRPDALDQATQTPPQDILEAENVSLRLLLAQAEINAQELL
FT                   EQAGIDAKQREAAAKLQKLILEELHHRIKNTLATVSAIASQSLRNATSTEHAQQAIEGR
FT                   LLALGRAHDLLLQAQWTSADLGKVIRGATEAFDNRDAAKFSIAGPDIRMNSGAVIAIAM
FT                   TLNELCTNTTKFGALSAPAGHVDIAWALDDAGHRLHLTWSERGGPPVQAPTRRSFGKRL
FT                   IETLGRQLKGEVTLSYPPEGFIYVIDVPLESLTSQP"
FT   gene            complement(668885..669949)
FT                   /locus_tag="RPC_0616"
FT   CDS_pept        complement(668885..669949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0616"
FT                   /product="Bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86189"
FT                   /db_xref="GOA:Q21BP7"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP7"
FT                   /protein_id="ABD86189.1"
FT                   /translation="MSIFERFLTLWVALCIVVGIALGHLLPGVFQTIAAAEIAKVNLPV
FT                   AALIWLMIVPMLIKIDFAALGRVKEHWRGIGVTLFINWAVKPFSMAALGWLFIGYLFRD
FT                   HLPADQIDSYIAGLIILAAAPCTAMVFVWSNLTKGEPHFTLSQVALNDTIMVFAFAPIV
FT                   GLLLGLSSIIVPWGTLLLSVVLYIVVPVIFAQILRRRLLASGGEAALERLLGRLQPLSL
FT                   IALLATLVLLFGFQGEQILAQPLIIGLLAVPILIQVYFNAGLAYLLNRIAGEQHCVAGP
FT                   SALIGASNFFELAVAAAISLFGFQSGAALATVVGVLIEVPVMLTVVWIVNRSKGWYERD
FT                   QPAALTAAAPKQPV"
FT   sig_peptide     complement(669878..669949)
FT                   /locus_tag="RPC_0616"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.913) with cleavage site probability 0.834 at
FT                   residue 24"
FT   gene            complement(669961..670389)
FT                   /locus_tag="RPC_0617"
FT   CDS_pept        complement(669961..670389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0617"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86190"
FT                   /db_xref="GOA:Q21BP6"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP6"
FT                   /protein_id="ABD86190.1"
FT                   /translation="MDVIIYHNPDCGTSRNTLALIRHAGIEPHVVEYLKTPPSRAMLQQ
FT                   LIARIGLGTRALLREKGTPYAELGLDSPALSDDELLDAMLAHPILINRPIVVSPRGVKL
FT                   CRPSEEVLEILPPITAGEFHKEDGELVIDASGRRVATA"
FT   gene            complement(670397..670924)
FT                   /locus_tag="RPC_0618"
FT   CDS_pept        complement(670397..670924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0618"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86191"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP5"
FT                   /protein_id="ABD86191.1"
FT                   /translation="MAERIYNVLFLCTGNSARSILAESILRKDGRGQFRAFSAGSQPKG
FT                   AVNPFALKVLSSLDYPTEGLRSKSWQEFAAPDAPVMDFVFTVCDNAAGESCPVWPGQPM
FT                   TAHWGIEDPAEVAGSDFMKEAAFVTALRYLKNRISIFTALPLKRLDPLSLGSKLREIGQ
FT                   TDGASSRRPDVA"
FT   gene            complement(670932..671273)
FT                   /locus_tag="RPC_0619"
FT   CDS_pept        complement(670932..671273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0619"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86192"
FT                   /db_xref="GOA:Q21BP4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP4"
FT                   /protein_id="ABD86192.1"
FT                   /translation="MESEQVILALAALAQSTRLEVFRLLVKHEPAGLPAGEIGRTLAVP
FT                   QNTMSSHLAILTRAGLVSSARRSRSIVYRADLARFQSLALFLLQDCCGSRPEVCAPLVA
FT                   NLTPCCPTE"
FT   gene            complement(671305..671766)
FT                   /locus_tag="RPC_0620"
FT   CDS_pept        complement(671305..671766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86193"
FT                   /db_xref="GOA:Q21BP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP3"
FT                   /protein_id="ABD86193.1"
FT                   /translation="MTDASLPAPIAAAASFEARTALPRRASVALIIAGAALAAAFVTPA
FT                   DSVAAAKAQSGDELVMLLRFMAAVKALLALGAAAAVVWRLGHPASAALTLAYTAAAALM
FT                   ATAPALIWHLADVGFGAAMFHAGVVTLLAALYADRHLVARHVPRLARRA"
FT   gene            671929..672135
FT                   /locus_tag="RPC_0621"
FT   CDS_pept        671929..672135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86194"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP2"
FT                   /protein_id="ABD86194.1"
FT                   /translation="MRMFVGMILGALLLVAGVYIYDSMQTSSVANGEVAQANRTIVNWD
FT                   VAQTDWEALKARVQRDWVKLSEK"
FT   sig_peptide     671929..672027
FT                   /locus_tag="RPC_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.740) with cleavage site probability 0.350 at
FT                   residue 33"
FT   gene            complement(672154..672855)
FT                   /locus_tag="RPC_0622"
FT   CDS_pept        complement(672154..672855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0622"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86195"
FT                   /db_xref="GOA:Q21BP1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP1"
FT                   /protein_id="ABD86195.1"
FT                   /translation="MTDGPDARPLPPAAKLDGTRRRVLGALGTGTLLLGMGLLLPDAAL
FT                   AAKSDDDNNVLSETAVLRDPEIPVAGNADGDISIVEFFDFQCPYCRKVAPDLRALAKED
FT                   GKIRLVFKDWPVLGGASIYAARLTLASKFQDKYIVAHEALIGLTSRLSEAGIRDALSAA
FT                   GVDVARATADLAGKGKVIDAILARNNAQAKAFGFQGTPSFIVGKFRVPGVLTKEQFTLA
FT                   IADARKAAAQK"
FT   gene            complement(672968..673693)
FT                   /locus_tag="RPC_0623"
FT   CDS_pept        complement(672968..673693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0623"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86196"
FT                   /db_xref="GOA:Q21BP0"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BP0"
FT                   /protein_id="ABD86196.1"
FT                   /translation="MIDNPFALWVYLSQSPLLWLTTTLVVYAMTDAVSQASRRNPLANP
FT                   VLHAMWVIGIFLWLTGTSYQTYFEGAQFVHFLLGPVTVALAVPLYENRNAVMAAIVPML
FT                   LALVVGSVTAIGSVVGLAKAFGLPDIVMLSMTPKSVTAPVAMGIAESIHADPSLAAVAV
FT                   ILTGIIGAIIVTPLMNLVKVTDFRARGFAVGLASHGIGTAQAFQINPVAGAFAGIAMSL
FT                   NALLTSLLVPLAATLLFHG"
FT   gene            complement(673690..674076)
FT                   /locus_tag="RPC_0624"
FT   CDS_pept        complement(673690..674076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0624"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86197"
FT                   /db_xref="GOA:Q21BN9"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN9"
FT                   /protein_id="ABD86197.1"
FT                   /translation="MIASLGLILLCQLAGEVLVRGLGLALPGPVVGLLLLLTLLLARDK
FT                   LSLLEVGPLRNDGVEKAAKVLLANMSLMFVPAGVGVVQKLDLIGEHGLAIAGVLIGSVI
FT                   ITLLVTVATFVVSARLVARWRGSR"
FT   gene            complement(674138..674635)
FT                   /locus_tag="RPC_0625"
FT   CDS_pept        complement(674138..674635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86198"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN8"
FT                   /protein_id="ABD86198.1"
FT                   /translation="MTKQAHFTALFSAVAVCGATLFAATWPAQALTSQQCSAKYQAAKT
FT                   AGTLNGQSWNDFRKEQCGADAAAAPAAGSAEPKAAEAKPATEKSAAAKTSGAAAAAPAT
FT                   PAVFPSTVDAKYAKETASRARLHTCADQWKLNKASNATGGLRWIQKGGGYWSECNKKLK
FT                   GA"
FT   sig_peptide     complement(674564..674635)
FT                   /locus_tag="RPC_0625"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.507 at
FT                   residue 24"
FT   gene            674906..675970
FT                   /locus_tag="RPC_0626"
FT   CDS_pept        674906..675970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0626"
FT                   /product="putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86199"
FT                   /db_xref="GOA:Q21BN7"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN7"
FT                   /protein_id="ABD86199.1"
FT                   /translation="MPIAMPSRAQVLQVLETLAIGAAGGALFYWAELPGGLITGAMIAV
FT                   ASVGMAGRPLGLPQPMAHAILMTLGLSLGAMVSPQLIKNLSAYPMTIALLALATACSTL
FT                   VSSLYLQRIHGWDRTSALLAGSPGALSQIVMLASERKADVPGIAVVQIMRVIILTAGVP
FT                   LFLTATGMMAHGPLPSRGIAATPLALAELAAVGVAAALLLRLVNFPASWMFGAMLGSAV
FT                   LHGAGWVDGTLPQWAYVAALTGIGTLIGARFSKIRTRTIVSHIGAALGSFAVAMTISAC
FT                   FVAAIAFTMPVRIGDVVVAFSPGAMDAMMALALTLHVDPVFVGAHHLARFIFVSLVTPG
FT                   IIHLFGKGPDDLDD"
FT   gene            complement(675967..676533)
FT                   /locus_tag="RPC_0627"
FT   CDS_pept        complement(675967..676533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0627"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86200"
FT                   /db_xref="GOA:Q21BN6"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN6"
FT                   /protein_id="ABD86200.1"
FT                   /translation="MFAVALNNLAAETPGTARPAGARRNPARIAAWLVAAIGAAAMAGA
FT                   LFFQLVLNIVPCPLCLEQRYAYYLAVPLAVVIAIAAGRGAARALLVGGLAVLALLMLGN
FT                   AGLGVYHAGVEWGFWPGPSDCSGPIVDFSRGGLLDQLDTVKVIRCDEVQWRFLGLSLAG
FT                   YNVLISLTMAALAGGGAVAATKRQA"
FT   gene            676742..676826
FT                   /locus_tag="RPC_R0010"
FT                   /note="tRNA-Leu4"
FT   tRNA            676742..676826
FT                   /locus_tag="RPC_R0010"
FT                   /product="tRNA-Leu"
FT   gene            677004..678221
FT                   /locus_tag="RPC_0628"
FT   CDS_pept        677004..678221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0628"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86201"
FT                   /db_xref="GOA:Q21BN5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN5"
FT                   /protein_id="ABD86201.1"
FT                   /translation="MPVKNDTYFRHLKPAEKDYKRSDSGGLFMLVTKTGSKLWRYGYNF
FT                   DAKQKLLALGQYPLISLADARTKRDDAKRLLAEGIDPSVERKAERRDARIARSHTFEAV
FT                   AKELMDKFEAEGDAPTTLKKKQWLLDFANKEFGKRPIAEIKAPEILDALRKIEKRGRHE
FT                   TATRVRSTVGAVFRYGIATGRAEQDPAADLRGALITPTVTHRATIVEPDAVGALLRAID
FT                   GFEGNAAIRYALRLAPLFFVRPGELRKAEWAEFKLENAEWRIPAAKMKMRRPHRVPLAH
FT                   QALSILRELQGITGGSKYLFPSVRSWHRPISDNTLNAVLRRLGYDKTELTVHGLRSTAS
FT                   VLLNESGKWHADAIERQLAHQEQNEVRGAYIHAAEFWDERVRMMCWWADELDRLRDHGR
FT                   VVKIRA"
FT   gene            678593..680959
FT                   /locus_tag="RPC_0629"
FT   CDS_pept        678593..680959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86202"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN4"
FT                   /protein_id="ABD86202.1"
FT                   /translation="MPDTSHTKLFARKISDFCRLRIDPVLPPQESARIRTFLLHLIAGS
FT                   VTPPRKLRGYDWEEIALQCGLDEKALWNVKATIEPALDAITRNTKPLAVRPAIAAPSRK
FT                   NPTSVPRRGRPSKQLSKDERSEGRRGVADPSKRKAAMDRQKPGQKPRAIEEFPEPLFQQ
FT                   WIEPTSFPEALELHMRRHGDSYWHLHRAVVRDDENLDRSTIRHWLQGSKAPRSAASMEV
FT                   LARIERRYRLPAEYFKAKLPHQTRSTTGHMLEDISAAERRRLAWHLPDDFNMRSRESQE
FT                   EILEWVRRVIINGSTDYRRYQAAAMKQRYAIRFPGIAYGQSETTKESCQDRYERYDDDG
FT                   ASFTDPDLMSGVIDAPPALAMEMAELIRFKTATLTAFGLQRNGVWDEETASQKVEHLGL
FT                   MFGALAAHPQGPVRGYGVPHKHLTFGLLVFPSIWDWYVQWRERRRGFYTAWEVDMLRIS
FT                   LALTRKDTGWLRQHPHLASRVRPIEGLVSQRDIERAQADWDDACDIYFKHASSRAKEIQ
FT                   RVARVHRDPFEPIMPVLEADSPVGEYRKITEEILRLMPDERLYRRSAAEAVRSFLMLRF
FT                   GLHLGLRQKNLRQLMVCERGKLARSERQFADMKRGELRWSERDCGWEVLIPAVAFKNAN
FT                   SSFFGSKPFRLILPNLGGLYDHIEAYIGRHRETLLKGAPDPGTFFIKTVKATSRDASYD
FT                   QNTFYEAWRLTIQRYGIYNPYTGRGAISGILPQGPHNVRDVLATHILKQTGSYEQASYA
FT                   IQDTPDMVAHHYGRFLPQDKAALAARILNQVWEAA"
FT   gene            complement(681646..682389)
FT                   /locus_tag="RPC_0630"
FT   CDS_pept        complement(681646..682389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0630"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86203"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN3"
FT                   /protein_id="ABD86203.1"
FT                   /translation="MTAPRVVTGPILLTGIATCAGCGGAMTLRTGTSSTGKVHKYYTCS
FT                   TCARLGKTGCKGRSVPMAKLDAIVVENLPERLFQPERLALILGKLADRRSEQAAEVDQR
FT                   VSNLRSELTAAEDKLKRLYTMVENGLTELDDILKERMAALKTDRDRAKEALDRIKLRPK
FT                   SHTFDAQAIERFGRLMRENITSGPIPFRKAYIKSVVDRVEVDDHAIRIVGDKATLEQVI
FT                   AGDQNANPNVRSFVRKWRARRDSNS"
FT   gene            complement(682684..683685)
FT                   /locus_tag="RPC_0631"
FT   CDS_pept        complement(682684..683685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0631"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86204"
FT                   /db_xref="GOA:Q21BN2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN2"
FT                   /protein_id="ABD86204.1"
FT                   /translation="MVIKANYPSDHARSKRSVDAHHGYGVVPHMSFAEYSEKLKHCFTM
FT                   KRTNGILEARLHTDGDSMQWGAQAHQGLHLFFDWAGRDPENEIIILGGTGKDFTKGIGR
FT                   VDKEGVWHPATEFTSNPAESWKMYDFQYYDGTNDIEGQVFDVEVPTIGVWNGAAFHTDL
FT                   VMFSDITLCTENAWTTEMHFRTNMVPGDGIQIAWRELMGRKRYAYAELTGEIITARKAL
FT                   QLGMVNEILPDTEAAYARAWEIAELIMHTGTRTTRRITTQVLRQKWKEDIARELRSAFA
FT                   TEMFVTATEHSPHDADYWLRAHEEAALVMAAEKKGKIVRPRLDGGQEEDEIK"
FT   gene            684488..685438
FT                   /locus_tag="RPC_0632"
FT   CDS_pept        684488..685438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0632"
FT                   /product="Protein involved in meta-pathway of phenol
FT                   degradation-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86205"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN1"
FT                   /protein_id="ABD86205.1"
FT                   /translation="MTYSRRISAIATALGLALAASAAANAAESITPLQPGATTGVPNAA
FT                   LPPPGLYFSSDVDYAWGTMRNNSGAVSHVPADNNPNIKAANVEAVAALMWSTPWEVFGA
FT                   NYGMAIAQPIKFAHNTITDPLAASDWHAAGLVGTVVTPIILSWNMKNGFFIGAGFSIAT
FT                   TDGKVSDVWDAQRGKYVLSKSNIADNYWTFQPNFAISYIKDGWTLSANNVFDFNTKNTT
FT                   TDYQTGKTYYLDVTVAKRFGKWNIGAVANYTQQYENDSQFGVSLANTKVQHVMVGPMVA
FT                   YDFDRFTVMARYLANVHTENDVGISFLHLGIAMKL"
FT   sig_peptide     684488..684568
FT                   /locus_tag="RPC_0632"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(685654..686625)
FT                   /locus_tag="RPC_0633"
FT   CDS_pept        complement(685654..686625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0633"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86206"
FT                   /db_xref="GOA:Q21BN0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BN0"
FT                   /protein_id="ABD86206.1"
FT                   /translation="MDLRLLLEFLVLSESLNFTRAARRLNMTQPVLSRHIKFLELHFGA
FT                   QLLTRNTHRVDLTDVGRVFAGECAKINAQYEQSLAMIRTCPGVSRHSLSIGILGEATRS
FT                   FLSAFLIGYNDRHPQVAIDCVDGDVDTIMPRVERGESDLGFVIRPRGAVTPPHLANFTI
FT                   ASDPLCLVINRNHALAVKERVSISDVAQWPMIGLNRQISPMSFEFNSHFFSRHGYEYKT
FT                   WKECANLETVCFNVEFNDRAVILLPLHRRYLVGANARLIMFAESDCMFEVEMLWNPENS
FT                   NPSLKGFLTEFKEFSRTWDWSSDVCLGNNEGAQVILEGVAVV"
FT   gene            686956..687330
FT                   /locus_tag="RPC_0634"
FT   CDS_pept        686956..687330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86207"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM9"
FT                   /protein_id="ABD86207.1"
FT                   /translation="MLAVTNKCCRTHRATHGCCSTVAAPHRTVWRRLRLRNDELFFGRL
FT                   AEAAADLFRDWHDRDRRGSVPRHGIRPTSAFRSMLAAGEGYGRANAVLMHSSYHGRMRK
FT                   NWAISGYSIIVHRKSTVDLW"
FT   gene            687476..688321
FT                   /locus_tag="RPC_0635"
FT   CDS_pept        687476..688321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0635"
FT                   /product="3-keto-5-aminohexanoate cleavage enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86208"
FT                   /db_xref="GOA:Q21BM8"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM8"
FT                   /protein_id="ABD86208.1"
FT                   /translation="MNHPERTVITAALTGAMTPKDINEFIPLTPQEIASDAYACWKAGA
FT                   AVVHIHMRDDAGHGTMSAAKFAETIELIRDHKDCDVIINCTTSGDNRASDAERMIHVAT
FT                   VDGVEMASYDAGSFNWMPGGVFMNSPKFLDELGQLLIARGIKSEIEIFDSGMLGIADYF
FT                   MKKGKLSTPGHYQFCLGVLGGMPATVENLIYLKSKLPADATWSAFGVGKDHLPILFAAI
FT                   ALGGNVRVGLEDNVYFAKGVKATNVGLVERAVQAIRLYGKRPASPAEAREILGIPALNI
FT                   "
FT   gene            688336..689505
FT                   /locus_tag="RPC_0636"
FT   CDS_pept        688336..689505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0636"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86209"
FT                   /db_xref="GOA:Q21BM7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM7"
FT                   /protein_id="ABD86209.1"
FT                   /translation="MRDAVIISAVRTPVGRCRGALASVPAHVLAAAAIREAVRRAEIDP
FT                   ERIDDVVFANLMNNEINNMGRMAALEAGLPVSVGGITLDRQCAASLNALAYGAMQIMAG
FT                   FADVIVAGGVESDSRRTYSMEKSEIAYSVAPPKWVDIHTSPDSIGNPPMGITAENVAER
FT                   WKLTRQELDEFSVRSHVLASAAWEAGRFQDEVVPIEVKGPKGKKTVVDRDESVRPDCTL
FT                   ESLSGLRAVFKPNGVVTAGNSSPMSDGGGAIVIVDRDTATSLGVEPLAMFRGYAVAGVD
FT                   PNVMGIGPIAATAKLLKQTGLKVADIDLWELNEAFASQALACIREIGMDLDKVNPNGGA
FT                   IAIGHPLAGSGAVLVARTVRELKRRDLHRAVVTFCVGGGQGVAVLLERN"
FT   gene            689510..690160
FT                   /locus_tag="RPC_0637"
FT   CDS_pept        689510..690160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0637"
FT                   /product="3-oxoacid CoA-transferase, subunit A"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86210"
FT                   /db_xref="GOA:Q21BM6"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM6"
FT                   /protein_id="ABD86210.1"
FT                   /translation="MSGKIRNQDEIIALFKDGQTIVVGGFANHGVPDALVSCVLESGAR
FT                   HLTLISNDTGDANLTVGRLIHNGRVGRMIGSHIGMNSEMVEMVAQGKIEVTLSPQGSFA
FT                   ERLRCGGAGLGGVLTKTGLGTIAENGKQVLEMNSERWILETPLRGDVALVRAHGADPLG
FT                   NLTYRGTSRNFNPLAARAADLTVVEADCFLELGELEPDRIITPGVYVDMILAH"
FT   gene            690171..690812
FT                   /locus_tag="RPC_0638"
FT   CDS_pept        690171..690812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0638"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86211"
FT                   /db_xref="GOA:Q21BM5"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM5"
FT                   /protein_id="ABD86211.1"
FT                   /translation="MDIRHRMAKRAAAYFAAGDIVNLGIGVPSMCNNYAVPGVMFHTEN
FT                   GLIGVGPLAEGLQRVESFSNANAMRFVPVVGASAFDSAESFAIVRSGRLAATVLGGLQV
FT                   SREGDLANWARPGKMLGMGGAMDLVNGARKVIVTMELTAKGAPKILNKCTYPLTGVACV
FT                   DHIVTEQCVIDVTPEGLVLRELLEGLVPDDIRRQIEPELMVFDTLITMVA"
FT   gene            690864..692177
FT                   /locus_tag="RPC_0639"
FT   CDS_pept        690864..692177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0639"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86212"
FT                   /db_xref="GOA:Q21BM4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM4"
FT                   /protein_id="ABD86212.1"
FT                   /translation="MSEIAVNRSVLETTLSGAFERRSNFGAHGWSIILIEAALLWISSG
FT                   SVVHGLNIILPALTATYSLDNTRLLALATPASWASILAGLVGAWVCAHMGPKFLILLSL
FT                   TGGGIAFGLLGTWGSTTGFFILFSIVCFFDTCLAYIGGPTLVTSWFPRKKGLAFGWATM
FT                   GQTFSTATYVPYVAFCFATFGIQRGFWGITFLMAVMAVVVWRFAADTPEALGCAPDNMP
FT                   MSPEEIDRSRRDQEAFVDPITVRQLLGMRDVWFMGLAFGGLYIIIVGLLSQFVARLIAM
FT                   GYPLNTAILYMSIAAIIGVPGAYMWGWLSQKLGVKACAMLYLGWYAVALAINIFELNTV
FT                   TMWISLVMIGEALGGATNLSMSIVAEKFPRGAFVKAWGVVNPIQSIVRCCAFAILAFGL
FT                   TYLGGFRGAYSILLGIALISMFLLWLIDTTPVRTTAMT"
FT   gene            692332..693609
FT                   /locus_tag="RPC_0640"
FT   CDS_pept        692332..693609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0640"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86213"
FT                   /db_xref="GOA:Q21BM3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM3"
FT                   /protein_id="ABD86213.1"
FT                   /translation="MSQTISIPIDVSDTRSNFGKWGWSVVTIEGLMLWIAAGVQVHGLN
FT                   IMVPVLSEYFDIPKTTLLFWATPASWGSVVAAYVLAKVVEWKGAKFTIIFSLIACALCF
FT                   GLIGTWNSVAAFVVLFSGVCFFGSGYAYIAGMALIANWFPKKKSLALGWVTMGQTMSTA
FT                   LFVPMLAAFFGFFGVQYGFWAVSAIMVVLLILVMSFVVDTPEERGCTPDNVPMTAAEIA
FT                   QSREEQENYVVPFSSLQLLGMRDVWLIALGSGGIYVVLVGVLSQLVPRLMALGYSLQTA
FT                   ILFLSIAAFIGVPGAYIWGWLGQKVSTRTSLIIYSLWWLVAVMLNMFEFNTFTLYASLG
FT                   MIGLSFGGATNLTTSIVAEKFPRAAFITAFGVIQPIQSIIRCCAFAILAFGLTYLGGYT
FT                   GAYALLAGVAVLNALLFWATDPTPVA"
FT   gene            693743..694915
FT                   /locus_tag="RPC_0641"
FT   CDS_pept        693743..694915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0641"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86214"
FT                   /db_xref="GOA:Q21BM2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM2"
FT                   /protein_id="ABD86214.1"
FT                   /translation="MSDVVIVSAVRTAIGSFNGALASLAAHELGAIVIRAALERAAVAP
FT                   QEVDEVVFGQVLVAGHGQNPVRRAALAAGLPVASTAFGLSQVCGSGLRSVLIGAQIIAA
FT                   GDADILVVGGQESMSQARHAIHLRSGVKMGPAQLVDTMVVDGLWDAFADYHMGQTAENI
FT                   AEQWGLSRAELDAFAVASQQRAAVARTAGRFDDEIVPVKVAGRRGDVIVAEDEYIKPET
FT                   TPEGLAKLKPAFSKTGKVTAGNASGLNDGAAALVLMTAAAAQKRGLIPLARIAGGAVAG
FT                   VDPSIMGIGPVPASRKALGRAGWSIADLDLIEANEAFAAQAIAVVHDLDLDPARVNVNG
FT                   GAIALGHPVGASGARILVTLLHELRRRDGRKGLATLCVGGGMGVSLCVER"
FT   gene            694963..696312
FT                   /locus_tag="RPC_0642"
FT   CDS_pept        694963..696312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0642"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86215"
FT                   /db_xref="GOA:Q21BM1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM1"
FT                   /protein_id="ABD86215.1"
FT                   /translation="MTDTSPLVLVINCGSSSLKFALFDLDESDAFLTGLAENLGEADAS
FT                   IRITIDGERTSTSIPGADHTRALAGLVAFLEGRCLLPRIAAVGHRVVHGGERFTHSVEI
FT                   SSEVLDGIEDCSALAPLHNPAHLIGIRAAQAALPGARHVAVFDTAFHQTLLPAAYLYAL
FT                   PQRYRRELGVRRYGFHGTSHRYVAGRTVDLLGLDPLDHGIVVAHLGNGASATALCNGAS
FT                   VDTSMGMTPAEGLVMGTRSGDVDVGAVLHIARAEGLDLDGIDKMVNETSGLLGLSELSN
FT                   DCRTLEKAAANGHAGAAEALSVFVHRVARTIGGLAMSLKRLDAIVFTGGIGENSVHVRA
FT                   AVLSHLSVLGIEVDEAANAAVPHGGIGIVSRARHPVALVVPTDEERMIASDAAAIVLER
FT                   GLKAPQSIHIRAAILSPPVALAAPTNEERTIAHDVVAIVSDRGLTASRAI"
FT   gene            696325..698388
FT                   /locus_tag="RPC_0643"
FT   CDS_pept        696325..698388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0643"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86216"
FT                   /db_xref="GOA:Q21BM0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BM0"
FT                   /protein_id="ABD86216.1"
FT                   /translation="MTKIKHPRGLFVAPASSDFEVSAISLGLVDSLRARGLAVGYVKPI
FT                   GDPGAMLNDRSSAFARRMFGLKTPEAIPAERAEQMIIAGRSATLLEEVVALVSELGDDL
FT                   DIVVVEGAALADGHGLLAEFGFAVARNLSADVIPVISGRDSGAARIGGALIDAVHRAGG
FT                   AESCAGAIVIRCPDGELAPLRDLSLPVRLLGVLPEDPGLAAPRLSDVVADLGFEVLHSG
FT                   QLADARMRDVIVAARGPEHIVDLLRPGTLVVTPGDRHDVVITTALASTSGMPIAGLLLT
FT                   CAAAPTDSLNAFLMPRFGGLTVLKTELQTFEAAMKLGEFDRGVRSDDARRMERLIAHAS
FT                   ENLDLSLMSTASKRSSGEAMPPPVFRHKLIRAARAAARRIVLPEGDEPRTLAAAADCTR
FT                   RGIAHCVLLGECSEVRNVAARYGVDLPGDIEILDPASLRASYVEPMVRLRKSKGLTPEE
FT                   ALSQLEDNVVLATMMLAEGHVDGLVSGAVHTTASTVRPALQLIKTAAGSSLVSSVFFML
FT                   MPDQVLVYGDCAVNPDPTAEQLAEIAVQSADSAAAFGIEPRVAMISYSTGESGTGGDVD
FT                   KVRAATEIVRKLRPELAVDGPIQYDAATVESVGRQKAPGSPVAGRANVFVFPDLNTGNT
FT                   TYKAVQRSADVISIGPMLQGLRKPVNDLSRGALVDDIIYTIAITAMQAAQAK"
FT   gene            698504..699262
FT                   /locus_tag="RPC_0644"
FT   CDS_pept        698504..699262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0644"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86217"
FT                   /db_xref="GOA:Q21BL9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL9"
FT                   /protein_id="ABD86217.1"
FT                   /translation="MGRLKGKIAIVTGSSSGIGKTTAEVFAREGATVVLVARRENRLSD
FT                   LRAGIEANGGEAEYIVADLALRSECEKVVDDVIAKFGRIDILVNNAGIPDRHMPTSRTS
FT                   DELWDSVIAVDLTSVFYLCRATLKHMEERGSGSIVNISSIGARGLAGAAYSSAKAGLLS
FT                   LTRNIAIQYAGKNIRCNATLPGPTPTELNTPEALATFDPEMPAITARHFDLSVPECSTE
FT                   DQANAILFFASDESKGLTGQCLTVDNGGTL"
FT   gene            699364..700026
FT                   /locus_tag="RPC_0645"
FT   CDS_pept        699364..700026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0645"
FT                   /product="Epoxide hydrolase-like phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86218"
FT                   /db_xref="GOA:Q21BL8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011945"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL8"
FT                   /protein_id="ABD86218.1"
FT                   /translation="MTIKAIIWDFGGVFTSSPFDGFRAFEQARGLPRDFLRGVNATNPH
FT                   ENAWAQFERAEIGAEAFDSAFAEESAALGYRVRGAEVLSLLCCDIRPAMVAALKACKGR
FT                   YKLGCITNNVPSGFAPGMSDDAEVAAAIADIFAQFDHVTESSKVGLRKPEPRIYQLMCD
FT                   ALQIAPRSCVYLDDLGVNCKQAAALGMIAIKVQTGEQALADLSRTLGHELGRTTITA"
FT   gene            700223..701221
FT                   /locus_tag="RPC_0646"
FT   CDS_pept        700223..701221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0646"
FT                   /product="CBS"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86219"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL7"
FT                   /protein_id="ABD86219.1"
FT                   /translation="MLARDVMTTDVSVVGPNSSSAEVARILLATRVSALPVVDHDGAPI
FT                   GVVSEWDLVGQHATDRVAKRERWLSHLAEGQPLAADFLQSVDPTNRTTAEIMHQPVIAV
FT                   PETTPIAEVARLIAEHRIKRVFVTRGDRLVGVVSRIDLVRAHLLEATPVALHPRRVPVG
FT                   EESSDVSTARSGPPPVPNPSTSAPTIASGPSAAEFDLLVAAAEQAEQMQRTAAERIASD
FT                   ARRALVTALQQKVLSHAAWQSLIERARHVAKRGGREFLLIRFPSELCSDRGRAINAADP
FT                   KWPESLCGEAADVFERWQRELKPQGFGLTAQILDFPGGFPGDAGLTLRWGR"
FT   gene            701377..701612
FT                   /pseudo
FT                   /locus_tag="RPC_0647"
FT   gene            701738..702193
FT                   /locus_tag="RPC_0648"
FT   CDS_pept        701738..702193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0648"
FT                   /product="transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86220"
FT                   /db_xref="GOA:Q21BL6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL6"
FT                   /protein_id="ABD86220.1"
FT                   /translation="MVSTARLRMDTEDSAITKPVRRLEVFTGAGRRRTWSDEDKARVVA
FT                   EIETSGDSVSGVARRHGLSPQQLFGWRRQVRESQTLASRDDEPRFVPAVVDPALSDTAA
FT                   PRRRKTTRRDRDEPLAGMIEVAIDGVRDGAHRPRRPGRVASPRCCGH"
FT   gene            702234..702629
FT                   /locus_tag="RPC_0649"
FT   CDS_pept        702234..702629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0649"
FT                   /product="IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86221"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL5"
FT                   /protein_id="ABD86221.1"
FT                   /translation="MVATKPVDFRKGADGLAALVRESLAADPFSGAIYVFRAKRADRIK
FT                   LVFWDGTGLCLFAKRLEDGIFRWPKSKRRDAFDRRAIVGAAGRAGLAACPCVARDGDAG
FT                   AAGLILGLCGEVNQPRWNRRKVPENMI"
FT   gene            702637..702990
FT                   /locus_tag="RPC_0650"
FT   CDS_pept        702637..702990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86222"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL4"
FT                   /protein_id="ABD86222.1"
FT                   /translation="MPSDGLPDDSETLKAMLLAERAQNERLRQIIKDLQRHQFGRRAET
FT                   LPEDQMLLGLEDVEQAAASDAAGAEQATPAARQATVAKRRANRGALPAHLPRIETTLDI
FT                   DDKTCRCCQGDCG"
FT   gene            complement(703253..704392)
FT                   /locus_tag="RPC_0651"
FT   CDS_pept        complement(703253..704392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0651"
FT                   /product="putative ATP-dependent exoDNAse (exonuclease V)
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86223"
FT                   /db_xref="GOA:Q21BL3"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL3"
FT                   /protein_id="ABD86223.1"
FT                   /translation="MVASISARGNAASALRYYAHLQRDDYYSREGEPPGRWAGRGAERL
FT                   SLVEPVTQGEFDAALQGVDPKTGERLAQIGGRGREHSAGWDMTFSAPKSVSVLWALSDA
FT                   HDREGIEQGHRSAVLAATARLEATAGWARRGRGGATRERTAGLLMAQFDHHTSRESDPQ
FT                   LHTHAFIFNLAPRRDGSWGAILSRELYKAQKHAGATYRQALASELERRGIRLERQKDTF
FT                   RVAAIPRDVERAFSKRRQAIEEAARIHGYSTPKGMELATLRTRRPKQDARLGDLIKHWQ
FT                   AEAKALGFELDQDRQHTRAMATSSARPLRALLADLSNAASPIQSAAAPTAVAAAAASTD
FT                   QQRAAQLGSRLGQAIRALDQPAAMAGVRIKLRYREREHE"
FT   gene            complement(704396..706204)
FT                   /locus_tag="RPC_0652"
FT   CDS_pept        complement(704396..706204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0652"
FT                   /product="putative type IV secretory pathway VirD4
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86224"
FT                   /db_xref="GOA:Q21BL2"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL2"
FT                   /protein_id="ABD86224.1"
FT                   /translation="MTRHLRIITFVAAMSCFAFAAGSYQLGFEVWPLGVTVADGTTVPY
FT                   RSAQVHACVSQRILGWFGDRNGEAYWLLCRQQLSQSRALDGFEIRFWTVFGSSIAALVA
FT                   LFGFALSLRLDSPALKIIRGARLHAGGPGLKAFARAAAVECRIHGEGVALVPAIPIGRE
FT                   REARHFLILGSVGGGKTQTMLNLIDGANARGDGILVLDTKGDMMGGLPAQGDPLLVAPH
FT                   DRRSLVWDVAADCSIKQDARELAARFIPPSSDPMWSQAAQEIFVACIVHLQATRGQDWG
FT                   WADLEAVVTADVDQLTVFAKDHNPNALRLLNQPDSKTTQSILTTFQTHMRIVSVLAEAW
FT                   PDRSAERFSIRAWLHKPIPYRPLILQHDPGYPELSRIWIGSMLGLLASAVGSPTLSESR
FT                   QRRVWLFLDEFPQLPPIKQFATFLELGRSKGVAVVIGAQDTAQIRAVYGQDQAKSWFGM
FT                   TGTKIITRINASEAAEDISRLIGDQEVERSTQSATRTSGKTSVTESIQREIRRVVTASE
FT                   LASHLGPTKGGVRVLFIGLGEDVYELELPYLSLPKLREPIMPADWTQPSVARASKTDSG
FT                   ETIPEPSPPPSRLTKDLADKILKTRR"
FT   sig_peptide     complement(706142..706204)
FT                   /locus_tag="RPC_0652"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.918 at
FT                   residue 21"
FT   gene            complement(706201..706533)
FT                   /locus_tag="RPC_0653"
FT   CDS_pept        complement(706201..706533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86225"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL1"
FT                   /protein_id="ABD86225.1"
FT                   /translation="MRHFMTDKTKPVSIRLAKSEIDQLHARAYTLSASITGVARDLIRT
FT                   GLAGGDNRALADRLMLIERRLVALEQQDQEISAVVQSIDRTARDLLAMFEALLKALTGE
FT                   STGRAA"
FT   gene            707723..710527
FT                   /locus_tag="RPC_0654"
FT   CDS_pept        707723..710527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0654"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86226"
FT                   /db_xref="GOA:Q21BL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BL0"
FT                   /protein_id="ABD86226.1"
FT                   /translation="MFRRSVFPNSVARSVLMLSWIAVLVILGTSLQFAVSAWRNDFRAR
FT                   QVVDLVTLDRTVFQSTAEVRLEIGSVGVALLRDDDPSAGVQLGLGAMLDAWQRAEAALA
FT                   ASSLPDRDRLIGRLSRAGEAFQTARRYVDAEAALPRAERDANRIEPWRMAVYDLAAAID
FT                   ALGTSVGRELRAHDLQLGELVAIRQMSFTIRDRYSRQCSAFRPAVQLDTPLTPAERDRW
FT                   REDIGAYAALWAQMQRIALQLPEETGFAPLVAEGLRRTEAAQSVMTRTLDGLSGSGRPA
FT                   FDAAAWSENCVSAYSSILGVGSHALDLETRRADNSRAEAFRTGAVSTAVLLLVGVLGFI
FT                   SLSFVRTRLSAPMRNIEAALATLRAGDLDTPIQVPRWNDEPSAIIRALEGFRLEALEAR
FT                   RMRLRIDQTRDEMVKHSEKLGRTKSQFLANMSHEIRTPLHGILGTVQLLAQSRVSDEQR
FT                   SWVQALDQSGRLLRDILDDILDFTRLESGRIRVDTAMFSLTERIAMVNATIRASMERKG
FT                   LDFTVEIDPELPEVLCGDAGKLGQILLNLLGNAAKFTKQGGVRLTVAGDAGRPDRLRIT
FT                   VADTGIGIAPEALAHIFEPFSQADGSVARRFGGSGLGLAVCRGLLDALGGDIDLQTEVG
FT                   RGTSFTVLFPVSRGDHDAAPVAGVADELVDELPNLHVLVAEDNPVNALIVRTMLERDGH
FT                   RVRHVETGGDAVAAAVAEDFDVVLMDLAMPGLDGTSACRQIRACGHPTRAVVPVLAVSA
FT                   GGASADDIDAGFDGRLEKPFHREDLFSALATAIGLRSVRRATRRESLGAIGEQARDLGV
FT                   EGARKLVSLYLTSQPPLLAKTVASVRLGDHDQARVLAHRLRGAAAHIGADDMAAAAATL
FT                   ERAAADDGAIVVAAEVLAKLGQTHFTAFAAYAEDELAGVWSNAAAKDRAAIDRAYQATF
FT                   SANT"
FT   sig_peptide     707723..707827
FT                   /locus_tag="RPC_0654"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.847 at
FT                   residue 35"
FT   gene            complement(710500..711228)
FT                   /locus_tag="RPC_0655"
FT   CDS_pept        complement(710500..711228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0655"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86227"
FT                   /db_xref="GOA:Q21BK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK9"
FT                   /protein_id="ABD86227.1"
FT                   /translation="MRNEGALQSSDVVIAIVDDEPLIQSTLVSYFQNAGFAVRSAETAD
FT                   QLRRLMARERIDFILLDIRLPDGDGLTLMRDIRADSDVPVILITSRAEEADRIIGLELG
FT                   ADDYVTKPFSPREVLARVKTVLRRTRAVADPGRGKRLRRFAGWCLDLENHRLTSASGEP
FT                   MRLTSAEFELLAALVRHPGRIMSRNDLLDVMSSREWDSNDRTVDVLVGRLRRKIEADPG
FT                   KPQIIVTEYGLGYVFAEKVA"
FT   gene            711352..712521
FT                   /locus_tag="RPC_0656"
FT   CDS_pept        711352..712521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0656"
FT                   /product="NapC/NirT cytochrome c-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86228"
FT                   /db_xref="GOA:Q21BK8"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR009154"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK8"
FT                   /protein_id="ABD86228.1"
FT                   /translation="MANPFIAVVRFMKKPVGLGVGALIGVVVGVVGWGGFNTAMEATSS
FT                   LEFCTSCHEMRDNVFQEYKKTIHYSNPAGVRAVCSDCHVPKDWSHKIIRKVQASKEVWG
FT                   KITGVIDTPEKFESKRLELAKHEWARMKASDSRECRNCHSFEAMDFTHQRPKASKQMQK
FT                   AFKEGGTCIDCHKGIAHKLPDMSGGFRSKMKDLKAEGLKNGGKAEKSWALTTSPAWGDL
FT                   DKAAAGGSGEGRILPAAPVTVLKLSGDLAQVRIDGWQQAGAERLIVALPGKRIMLAAVS
FT                   AALAETAQVKSTRHDDETDLDWKEASIVLWMPKANLTADQKALWAYGEEMFDASCGACH
FT                   SPAPPGHFPANQWVGIVNDMKANTSLEEDEVRFLQAYLQNHAQDVVGGH"
FT   gene            712586..713221
FT                   /locus_tag="RPC_0657"
FT   CDS_pept        712586..713221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0657"
FT                   /product="DMSO-membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86229"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK7"
FT                   /protein_id="ABD86229.1"
FT                   /translation="MKFKSADPFLSADCFAELARLFGAPLDEAEIAALFERGHFDALQA
FT                   LDCDPRHAVDLRGAIAAVKSAGDAAAATSRLNSVYCRLFLGLGRTPATLPIESAHRGEG
FT                   RLFQEPAAVMSEMLAAHGLRLTESCAEPPDHLAVELSLLEQFIRLQASLVDIDERPAIA
FT                   TLRRRLVEWTPGFAEAVALHDPTGFYAALARILVRLLDDVALDSVSVA"
FT   gene            713377..715830
FT                   /locus_tag="RPC_0658"
FT   CDS_pept        713377..715830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0658"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86230"
FT                   /db_xref="GOA:Q21BK6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK6"
FT                   /protein_id="ABD86230.1"
FT                   /translation="MFPHSPYSLSRRRFLTAASTLAASSALSPLFGINPAGAATPDGEV
FT                   LSCSNFGAFWAKVQAGRVVGVRPWEGDPHPIATIEGAVDLAYSPSRIRYPMVRRSWLEK
FT                   GPGAEPETRGRDDFVRVSWDKALDLVAAEIKRCAAIGPWSIYTGSYGWGHFGRLFNSQT
FT                   GLRRLFNLVGGSVSSSSNYSKAGLEAIMPYVLGQIDAEGPQTSHQTILENTDLMVFWAC
FT                   DPLKDNHISTNVPDHGEYGWFEAMKKAGKKAIFIDPIKTEGCKLLNGEWLPVRPHSDVA
FT                   LALGIAHVLITENLADKKFLADYTTGWEVFFDYVTGKPDGTPKTPEWAAEKTEIPAETI
FT                   RDLARRFAKGRTMLVSGWTPQRQQHGEQFPWVFVTLAAMIGQIGLPGGGFCQRYHLDNA
FT                   GAPQADSPALSTTMQAGKRKETMPWPKEKGAETIPVARIVDMLMNPGKPYEHNGKTFTY
FT                   PDVKMTYWVGGNPLHHHQDRNRQIAAWKKFDTVIVQDFQWTASARFADIVLPAATGLER
FT                   EDIEGLGVVTRKAYFAVRKVIEPLYEAKSDYVIFQMLAEKLGLEPEFSDGKTELDRVKQ
FT                   VYAAALEQATAKKIPMPDFDTFWKAGIVEFATPEKNLRRTKYAQFREDPLLNPLPTPSG
FT                   KIEIFSKTIAKFGYDDCPPHPTWLEPVEWLGAKEKKYPLHVNSNHPDYRLHSQLNGTKV
FT                   RSNYAVAGREPCTINSKDAAARGIKAGDVVRVFNDRGQCLAGAVVSDDIRPGVIQLQEG
FT                   GWYDPVKANEPNALCKYGDVNVLTLDIPTSRLAQATSAHTCMANVELFKGELPKVTVFD
FT                   QPKNG"
FT   sig_peptide     713377..713493
FT                   /locus_tag="RPC_0658"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 39"
FT   gene            715893..716402
FT                   /locus_tag="RPC_0659"
FT   CDS_pept        715893..716402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86231"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK5"
FT                   /protein_id="ABD86231.1"
FT                   /translation="MPSTGQAASVRLRHFLAVLVVGAVIGLEAMPAAEAARLRLRATME
FT                   RYSGNPAYLAVYLTDAKGHFVATVQIFGDKVQYYPHLSHWMRAVGPQSVPLDGITGASV
FT                   GSGRGLDVTVEVADTLIGAGLQLRVDAAAENIADNPAEIILPLEKAADGRDAIGRGLIA
FT                   RFHFEM"
FT   gene            716421..718823
FT                   /locus_tag="RPC_0660"
FT   CDS_pept        716421..718823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0660"
FT                   /product="ApbE-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86232"
FT                   /db_xref="GOA:Q21BK4"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK4"
FT                   /protein_id="ABD86232.1"
FT                   /translation="MPARRYHLWLGCLAGPFLVVLAVTGVLLAVDALWARATQPAAAPA
FT                   SLSVAELAAGLAGHGTLERLAVTPVGTIVAQFAAPRRRAAVDPTDLSLRPVAETGDTIR
FT                   TATEIHRTLMIGDRGRLILALATCAGLLLAATGLARIWRGERGGGALRRLHRGLGLTFA
FT                   LPFVVSAATGLGLAVATIFPLQIDGIRPAFPAAFAEGDRLPVGAVAALASVAVGDLEEL
FT                   VLPRADDANDGYFLATADRFAWIDPVSGGVAAASERPVMHRLAAAVLRFHAGRSMTALA
FT                   VIFGLAAAAVGLLGLTGLAVGGIAIAIRRRRPVVSGAAAKADTIILVGSQGGTTWGFAE
FT                   RLAARLIEAGHLVDLAAMNNLASEYPKAQQLIVLTATHGIGEPPDSADRFLARLPQATL
FT                   PPAFAVLGFGDREAKAFCGFAEAVDAALLATGAKPMLSLERIHRRSETDYAAWVERLLA
FT                   ALGHGRQASLPTDASTARQWPAPVVRGSPTRRVLSGTAMGSRWSVQLWLPQDHDLSDLT
FT                   ARLSARIARIETSLSRFRGDSEVMAFDRAPCDVWQSVSRDLAEVLAVGLDIGRRSGGAF
FT                   DVGLAAEVAACGFGSGWSGSGVARDRIVAAHETIELDRGARRIRKRAAVSLDLAGIAKG
FT                   WAVDELSRLVAEAGFPAHLVALDGELRAGAVQPDGRPWAIGLEAPAVGRRAVIGHIDLI
FT                   KRSVATSGNNRRFAANGGHTLDPATGRSVAAGPASVSVFASTCIVADAWATALMVRGRD
FT                   GLAAARAAGVEALFVAREPLAMPPATRAARWLGAQLSNHRRCRDAQP"
FT   sig_peptide     716421..716510
FT                   /locus_tag="RPC_0660"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.910 at
FT                   residue 30"
FT   gene            718945..721323
FT                   /locus_tag="RPC_0661"
FT   CDS_pept        718945..721323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0661"
FT                   /product="Trimethylamine-N-oxide reductase (cytochrome c)"
FT                   /EC_number="1.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86233"
FT                   /db_xref="GOA:Q21BK3"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK3"
FT                   /protein_id="ABD86233.1"
FT                   /translation="MSITRSTFIRSVIPGAVGLAMFPHLARGASGAGGVVDGRVLVNTS
FT                   IGPMFLVKKGGKVVGVEQLKQDGEPWKLLGDMPDRLYNKARVKAPMIRREFLKNREKSD
FT                   RTDRGSRDFVEVSWDDALKIVSEEMQRIKTKFGNASLHRGKSSWASNHAHFYRTEALLQ
FT                   RFLNGFGGSSTFFGNYSNQAISEILPAVAWSSPAAATDWPVIHQNAKLIVLWGCNPVAT
FT                   TRILSGRYATHAWYEAKKRGIEIIAIDPMRSESVKELGCEWLPIRPNTDVALALGLMHT
FT                   LLTENLQDKAFIEGYTKGFKDFEPYLTGAKDGTPKTAEWASGITGIPAETIRGLARKMA
FT                   GTRTTIAGGWSTQRQHHGEQAPWALVALGAMLGQMGLPGGGVSFGLHYADGGYPRPTMP
FT                   VVGGISPGSNAVPNPFPIACLSDAYLNPGKTIECKGRKITYPDIRLVYTSGGNQLTHHQ
FT                   DTNRVIEAFRKPEVVIVQDPWWSPSARFADIVLPASSDLERNDLGQTLNLITAAHAAVD
FT                   PLFKSRTDYDILTELADRLGHRQAFTEGRSEMEWVQFFYDAAKAQSKAVKMPDFDEFWA
FT                   GEGIIEFPAGKGEFVHLADFRNDPLLQPLSTASGLIEFVSPYVGKLGYDDCPAHPTWIE
FT                   PVEWKGSKGADKFPLQLISPHPPLRLHSQMCNTETRKSYTVADREPVVINADDAAKRGI
FT                   KSGDIVRLFNDRGQTLAGAIVTPDILQGTICLHEGGWYDPAKPGEKGALDKYGSPNLLT
FT                   LDVPLSSRFAQATIAGTAICDVEKWKGEALPVTAFDAVG"
FT   sig_peptide     718945..719031
FT                   /locus_tag="RPC_0661"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.913 at
FT                   residue 29"
FT   gene            721622..721969
FT                   /locus_tag="RPC_0662"
FT   CDS_pept        721622..721969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86234"
FT                   /db_xref="GOA:Q21BK2"
FT                   /db_xref="InterPro:IPR017015"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK2"
FT                   /protein_id="ABD86234.1"
FT                   /translation="MGMRYLRILAYACAAALLLLTIVPADQRPVSGLPHDIEHFGAFML
FT                   PGLLFGFAFEKKTPLLLLGAIWFCLLLEAVQIPLSTRHARLEDALVDSLAMCIGVLAGR
FT                   IAKTQFLRFQA"
FT   sig_peptide     721622..721705
FT                   /locus_tag="RPC_0662"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.731) with cleavage site probability 0.713 at
FT                   residue 28"
FT   gene            complement(722084..723004)
FT                   /locus_tag="RPC_0663"
FT   CDS_pept        complement(722084..723004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0663"
FT                   /product="L-proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86235"
FT                   /db_xref="GOA:Q21BK1"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK1"
FT                   /protein_id="ABD86235.1"
FT                   /translation="MNVKQQVFDTAPPPSTEQSPWQGWKRGLRDRLSASILPLVEHAAR
FT                   PYLGGDTVEDALCVARRLALENAASTLGFWDTADYAGREVADIYLASIARLSDGSLDSY
FT                   VSVKPPALRFDPSLAIELAAAAAASGVRLHCDSHGIEVADRSNAMLQAMLTRVGAGCVG
FT                   TTLPGRWARSVADADWAVANGLNVRVVKGQWPDPGDPQRDMGKGFLDVIDRLAGRARHI
FT                   AVATHDLPLASEAIRRIRATGTSYELELLFGMPLQPLRRWAADHQVKTRIYVPFGKGFI
FT                   PNALNVLRQNPGLMWRIAKRRLTGR"
FT   gene            complement(723072..724052)
FT                   /locus_tag="RPC_0664"
FT   CDS_pept        complement(723072..724052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0664"
FT                   /product="Protein involved in cellulose biosynthesis
FT                   (CelD)-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86236"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BK0"
FT                   /protein_id="ABD86236.1"
FT                   /translation="MNFYASEHYLDAVAAVYFKGQRARIEDVQIGDEVLRLLVVNDKRV
FT                   ITRHQFLDFHQPLLETETRGATRNGRYAPAVARRVIERTQWDPAQFPGLELAPYVDWSQ
FT                   FPEYDDYKAYLLKHHKSLVRDRERRGRSLAAAHGELVFTMNDTQADVFDAAQRWKSRQL
FT                   RDSGLADYFAAPHTMEFLEALRSRGQLVASTLRASGQLLSLWIGFVHDRTWSGWIFTYD
FT                   PAFRKYSVGHQLLSFMLSESHRLGHREFDFSIGSEDYKMIYATHGRVLGSIGQPPLGQR
FT                   LIGYAKDELRDRTPKLFDAARNLKKRIDGTLPTQLVAGQTGPAKA"
FT   gene            724375..725685
FT                   /locus_tag="RPC_0665"
FT   CDS_pept        724375..725685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0665"
FT                   /product="O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86237"
FT                   /db_xref="GOA:Q21BJ9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BJ9"
FT                   /protein_id="ABD86237.1"
FT                   /translation="MIDIRRFEVVAVVQAALDGLDVLASARCLAVVASLLLVWVTLEPF
FT                   EDLRIATLPGAPAGKLAFTYLAFGALALLTVLLSASDNIPALKSLWTPLHLCLLGWMAF
FT                   NIALSQSPGVSLQRFVLTASVISLALMIPLLPPTQAAFKWCFAVAALLLLALCYFGLVA
FT                   APALAIHSAADVTEPDLAGDWRGSFAHKNAAAAVMAILVYLGLYLATNGLRLWGGSIAA
FT                   LAALFLVGSGGKSALALCIGVGLLAQLIATIRSLWLKMLVCLVPVVLMNLLSVGSAINT
FT                   GLAAIVGLLPIDTSFTGRTDIWKYAFAAFLDHPFRGYGYAAFWENANRTSAEDLGWAST
FT                   SPHSHNSYLDLALTIGLPGLVLVILVFVVAPLRNFHVIQSADRSSGLARLFLVIWMFGV
FT                   YFATMETFLLDRQNPTWFSFVIAAAGLHYLARFGVKA"
FT   gene            complement(725697..726701)
FT                   /locus_tag="RPC_0666"
FT   CDS_pept        complement(725697..726701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86238"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BJ8"
FT                   /protein_id="ABD86238.1"
FT                   /translation="MILNLFYEEKDDRWFPGDRHVRSLLRHLLLGKPQPAGHTRVFLNL
FT                   CAGLDRLGIRYRVNDYRYIQKHPNELACIIGRRFLLDKIAWKNPILLGVAGYDHPVDAP
FT                   GLFDRLPIKMVLVPGDWYVDMCRPYWKQVKSWPVGIDTELWAPSPQDRKSVDVLLYDKV
FT                   RWEHDRIAPALIDPIRARLEAEGRSVLELRYGSYEEDDFREALARCRSMIFLCEHESQG
FT                   IAYQQALSCGVPIFAWDRGGAWQDPNYFPHKVVYEPVTSVPYWDARCGLTFKDIEAFRS
FT                   QWPEFWRRSQNGGFAPRDYVLQSLTLEQRAQQYYDIAKSVADDQVARRPVSMT"
FT   gene            727109..728539
FT                   /locus_tag="RPC_0667"
FT   CDS_pept        727109..728539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0667"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86239"
FT                   /db_xref="GOA:Q21BJ7"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BJ7"
FT                   /protein_id="ABD86239.1"
FT                   /translation="MLNRYFSIYLGAHLVPAVIGFIAITAYTRLLNPAEYGVYVVGMSI
FT                   AGIVGAVFFVWIRLSVSRYQASSADVDFRGTAMVAYGLTLAAMGCVAPAAILLLSPDVN
FT                   VYLLVGGVFTALAVGAFDIAQEFARATLRPYRYAAIGITRAVLGLALGWLAIELGWGGL
FT                   GLLCAVGLSFLIGAVLNAIDGKAPRISRYRRDQLMQFARYGLPLSLGGLSMALYSTSDR
FT                   LVVAYLLGPDAAGKFGVAADLPRQFMVMLASSVAAATFPIVFRTFSGEGLAATRERLNE
FT                   NIELLLAVILPVAVWLALAADQVAGTLVGQDFRASVTLLLPIVALARVLGVINQFYLQI
FT                   SFQLAERPMLPVIQSIITLVLSITLMFPLVAAFDLLGAAYATLVTEAAGVVITIVLTRK
FT                   AFVLPFEPRRLAGVLLASAVMGVAIYATRSAVGGTGLISLMTVSAAGGVAYAAAAWLLN
FT                   VVRIRTSMSSFLRLRMAH"
FT   gene            728539..729645
FT                   /locus_tag="RPC_0668"
FT   CDS_pept        728539..729645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0668"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="3.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86240"
FT                   /db_xref="GOA:Q21BJ6"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BJ6"
FT                   /protein_id="ABD86240.1"
FT                   /translation="MTAPRHIPTSSKRGVTRRQLLRTAPAAALLALASPGARAAAIRPR
FT                   RKIPYGAAVALDDLRGDPRLGAALAGTCSQIVPVSELKWSELRPAPGQFAFEKADALAG
FT                   FAADNGLAMRGHTLVWYAALPDWTKEIDSEAAAERALREHIETVVSRYRGRIRSWDVVN
FT                   EVIPDEAHQPTDRRPSLWSRYLGERYIPLAFRIAAEADPKAQLVLNDYDIEFGDPRCRR
FT                   KRAAFRHLIRQLQDADVPIHAVGLQCHLHGEMAVDRAGLESFVAELHGNGLKCLVTELD
FT                   VMDQHLPAPVQRRDALVAAQVGELLAAVTAPGPLDALLTWGISDRYSWIPYAAPRADKR
FT                   PNRPLPLDREFQRKPFMDVIDQFTGREA"
FT   sig_peptide     728539..728658
FT                   /locus_tag="RPC_0668"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.887 at
FT                   residue 40"
FT   gene            729642..730676
FT                   /locus_tag="RPC_0669"
FT   CDS_pept        729642..730676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86241"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BJ5"
FT                   /protein_id="ABD86241.1"
FT                   /translation="MTMQVRTALQINLHPLDERHAVHTLPHQLEVWGGQVDRVVLTVDT
FT                   KQSASGRYGGDAYEDSRGRLFGLLETIANQASNVEIVEVDYAPAALEAVRQRYFASSAA
FT                   HPEKAFDGGPFHAYFYGLLRSRADYVVHMDSDMLFGGGSQAWLDEAIGWLQRTPDALFA
FT                   GPLPGPPRADGTLPDLHRSFPGLACVEPPQRLEADYPAYRFESVSTRIFVLDQGRFDAA
FT                   VGALDLVRPNFKRRLRARLFHQSPLSMPAEEVITAAMMRKRLARIDFLGSGAGMYSLHP
FT                   PFRSEKFYRELPNLIGRIVAGAIPDAQRGDYDINSSLFDWSEALRQKTKARRLVRAARA
FT                   LLPS"
FT   gene            730657..731625
FT                   /locus_tag="RPC_0670"
FT   CDS_pept        730657..731625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPC_0670"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:RPC_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABD86242"
FT                   /db_xref="GOA:Q21BJ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q21BJ4"
FT                   /protein_id="ABD86242.1"
FT                   /translation="MPCSRVDDAPLARPAGAVTGKPATVSVVMPAKNAAAHIGEAIASV
FT                   LLQGHGVEDLIVIDDGSTDATRVIVGGFDDPRVRLLSNPGRGVSSARNHGASAAGGDWL
FT                   MFLDSDDRLRPGAIATLLQAANAAQRAVAIYGDYDRIDGNGAPIGRRGWLQRRSKPSGE
FT                   VLQRLAAGNFIVNGGVMIVRADAFAAVGGFDAALKYCEDWHCWCRLAALGEFQAVKHQL
FT                   LDYRVHGDSTMSPSIRSPADFLPAVDRVFGDAIILAKLPPASMSGLRRAAEIHMMTYAA
FT                   TQAVRFGRYRQAGRYALAAIRRSPRATPAVALRLGLAWLRI"
FT   gene            complement(731667..732593)
FT                   /locus_tag="RPC_0671"
FT   CDS_