(data stored in ACNUC7421 zone)

EMBL: CP000302

ID   CP000302; SV 1; circular; genomic DNA; STD; PRO; 4545906 BP.
XX
AC   CP000302; AAIU01000000-AAIU01000084;
XX
PR   Project:PRJNA13390;
XX
DT   03-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Shewanella denitrificans OS217, complete genome.
XX
KW   .
XX
OS   Shewanella denitrificans OS217
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4545906
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Gilna P., Kiss H., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., Richardson P.;
RT   "Complete sequence of Shewanella denitrificans OS217";
RL   Unpublished.
XX
RN   [2]
RP   1-4545906
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Gilna P., Kiss H., Schmutz J.,
RA   Larimer F., Land M., Kyrpides N., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (21-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 6c3945f860d0b43cc15f8e1910c86ef2.
DR   BioSample; SAMN02598300.
DR   EnsemblGenomes-Gn; EBG00001100147.
DR   EnsemblGenomes-Gn; EBG00001100148.
DR   EnsemblGenomes-Gn; EBG00001100149.
DR   EnsemblGenomes-Gn; EBG00001100150.
DR   EnsemblGenomes-Gn; EBG00001100151.
DR   EnsemblGenomes-Gn; EBG00001100152.
DR   EnsemblGenomes-Gn; EBG00001100153.
DR   EnsemblGenomes-Gn; EBG00001100154.
DR   EnsemblGenomes-Gn; EBG00001100155.
DR   EnsemblGenomes-Gn; EBG00001100156.
DR   EnsemblGenomes-Gn; EBG00001100157.
DR   EnsemblGenomes-Gn; EBG00001100158.
DR   EnsemblGenomes-Gn; EBG00001100159.
DR   EnsemblGenomes-Gn; EBG00001100160.
DR   EnsemblGenomes-Gn; EBG00001100161.
DR   EnsemblGenomes-Gn; EBG00001100162.
DR   EnsemblGenomes-Gn; EBG00001100163.
DR   EnsemblGenomes-Gn; EBG00001100164.
DR   EnsemblGenomes-Gn; EBG00001100165.
DR   EnsemblGenomes-Gn; EBG00001100166.
DR   EnsemblGenomes-Gn; EBG00001100167.
DR   EnsemblGenomes-Gn; EBG00001100168.
DR   EnsemblGenomes-Gn; EBG00001100169.
DR   EnsemblGenomes-Gn; EBG00001100170.
DR   EnsemblGenomes-Gn; EBG00001100171.
DR   EnsemblGenomes-Gn; EBG00001100172.
DR   EnsemblGenomes-Gn; EBG00001100173.
DR   EnsemblGenomes-Gn; EBG00001100174.
DR   EnsemblGenomes-Gn; EBG00001100175.
DR   EnsemblGenomes-Gn; EBG00001100176.
DR   EnsemblGenomes-Gn; EBG00001100177.
DR   EnsemblGenomes-Gn; EBG00001100178.
DR   EnsemblGenomes-Gn; EBG00001100179.
DR   EnsemblGenomes-Gn; EBG00001100180.
DR   EnsemblGenomes-Gn; EBG00001100181.
DR   EnsemblGenomes-Gn; EBG00001100182.
DR   EnsemblGenomes-Gn; EBG00001100183.
DR   EnsemblGenomes-Gn; EBG00001100184.
DR   EnsemblGenomes-Gn; EBG00001100185.
DR   EnsemblGenomes-Gn; EBG00001100186.
DR   EnsemblGenomes-Gn; EBG00001100187.
DR   EnsemblGenomes-Gn; EBG00001100188.
DR   EnsemblGenomes-Gn; EBG00001100189.
DR   EnsemblGenomes-Gn; EBG00001100190.
DR   EnsemblGenomes-Gn; EBG00001100191.
DR   EnsemblGenomes-Gn; EBG00001100192.
DR   EnsemblGenomes-Gn; EBG00001100193.
DR   EnsemblGenomes-Gn; EBG00001100194.
DR   EnsemblGenomes-Gn; EBG00001100195.
DR   EnsemblGenomes-Gn; EBG00001100196.
DR   EnsemblGenomes-Gn; EBG00001100197.
DR   EnsemblGenomes-Gn; EBG00001100198.
DR   EnsemblGenomes-Gn; EBG00001100199.
DR   EnsemblGenomes-Gn; EBG00001100200.
DR   EnsemblGenomes-Gn; EBG00001100201.
DR   EnsemblGenomes-Gn; EBG00001100202.
DR   EnsemblGenomes-Gn; EBG00001100203.
DR   EnsemblGenomes-Gn; EBG00001100204.
DR   EnsemblGenomes-Gn; EBG00001100205.
DR   EnsemblGenomes-Gn; EBG00001100206.
DR   EnsemblGenomes-Gn; EBG00001100207.
DR   EnsemblGenomes-Gn; EBG00001100208.
DR   EnsemblGenomes-Gn; EBG00001100209.
DR   EnsemblGenomes-Gn; EBG00001100210.
DR   EnsemblGenomes-Gn; EBG00001100211.
DR   EnsemblGenomes-Gn; EBG00001100212.
DR   EnsemblGenomes-Gn; EBG00001100213.
DR   EnsemblGenomes-Gn; EBG00001100214.
DR   EnsemblGenomes-Gn; EBG00001100215.
DR   EnsemblGenomes-Gn; EBG00001100216.
DR   EnsemblGenomes-Gn; EBG00001100217.
DR   EnsemblGenomes-Gn; EBG00001100218.
DR   EnsemblGenomes-Gn; EBG00001100219.
DR   EnsemblGenomes-Gn; EBG00001100220.
DR   EnsemblGenomes-Gn; EBG00001100221.
DR   EnsemblGenomes-Gn; EBG00001100222.
DR   EnsemblGenomes-Gn; EBG00001100223.
DR   EnsemblGenomes-Gn; EBG00001100224.
DR   EnsemblGenomes-Gn; EBG00001100225.
DR   EnsemblGenomes-Gn; EBG00001100226.
DR   EnsemblGenomes-Gn; EBG00001100227.
DR   EnsemblGenomes-Gn; EBG00001100228.
DR   EnsemblGenomes-Gn; EBG00001100229.
DR   EnsemblGenomes-Gn; EBG00001100230.
DR   EnsemblGenomes-Gn; EBG00001100231.
DR   EnsemblGenomes-Gn; EBG00001100232.
DR   EnsemblGenomes-Gn; EBG00001100233.
DR   EnsemblGenomes-Gn; EBG00001100234.
DR   EnsemblGenomes-Gn; EBG00001100235.
DR   EnsemblGenomes-Gn; EBG00001100236.
DR   EnsemblGenomes-Gn; EBG00001100237.
DR   EnsemblGenomes-Gn; EBG00001100238.
DR   EnsemblGenomes-Gn; EBG00001100239.
DR   EnsemblGenomes-Gn; EBG00001100240.
DR   EnsemblGenomes-Gn; EBG00001100241.
DR   EnsemblGenomes-Gn; EBG00001100242.
DR   EnsemblGenomes-Gn; EBG00001100243.
DR   EnsemblGenomes-Gn; EBG00001100244.
DR   EnsemblGenomes-Gn; EBG00001100245.
DR   EnsemblGenomes-Gn; EBG00001100246.
DR   EnsemblGenomes-Gn; EBG00001100247.
DR   EnsemblGenomes-Gn; EBG00001100248.
DR   EnsemblGenomes-Gn; EBG00001100249.
DR   EnsemblGenomes-Gn; EBG00001100250.
DR   EnsemblGenomes-Gn; EBG00001100251.
DR   EnsemblGenomes-Gn; EBG00001100252.
DR   EnsemblGenomes-Gn; EBG00001100253.
DR   EnsemblGenomes-Gn; EBG00001100254.
DR   EnsemblGenomes-Gn; EBG00001100255.
DR   EnsemblGenomes-Gn; EBG00001100256.
DR   EnsemblGenomes-Gn; EBG00001100257.
DR   EnsemblGenomes-Gn; EBG00001100258.
DR   EnsemblGenomes-Gn; EBG00001100259.
DR   EnsemblGenomes-Gn; EBG00001100260.
DR   EnsemblGenomes-Gn; EBG00001100261.
DR   EnsemblGenomes-Gn; EBG00001100262.
DR   EnsemblGenomes-Gn; EBG00001100263.
DR   EnsemblGenomes-Gn; EBG00001100264.
DR   EnsemblGenomes-Gn; EBG00001100265.
DR   EnsemblGenomes-Gn; EBG00001100266.
DR   EnsemblGenomes-Gn; EBG00001100267.
DR   EnsemblGenomes-Gn; EBG00001100268.
DR   EnsemblGenomes-Gn; EBG00001100269.
DR   EnsemblGenomes-Gn; EBG00001100270.
DR   EnsemblGenomes-Gn; EBG00001100271.
DR   EnsemblGenomes-Gn; EBG00001100272.
DR   EnsemblGenomes-Gn; EBG00001100273.
DR   EnsemblGenomes-Gn; EBG00001100274.
DR   EnsemblGenomes-Gn; EBG00001100275.
DR   EnsemblGenomes-Gn; EBG00001100276.
DR   EnsemblGenomes-Gn; EBG00001100277.
DR   EnsemblGenomes-Gn; EBG00001100278.
DR   EnsemblGenomes-Gn; EBG00001100279.
DR   EnsemblGenomes-Gn; EBG00001100280.
DR   EnsemblGenomes-Gn; EBG00001100281.
DR   EnsemblGenomes-Gn; Sden_R0001.
DR   EnsemblGenomes-Gn; Sden_R0002.
DR   EnsemblGenomes-Gn; Sden_R0003.
DR   EnsemblGenomes-Gn; Sden_R0004.
DR   EnsemblGenomes-Gn; Sden_R0005.
DR   EnsemblGenomes-Gn; Sden_R0006.
DR   EnsemblGenomes-Gn; Sden_R0007.
DR   EnsemblGenomes-Gn; Sden_R0008.
DR   EnsemblGenomes-Gn; Sden_R0009.
DR   EnsemblGenomes-Gn; Sden_R0010.
DR   EnsemblGenomes-Gn; Sden_R0011.
DR   EnsemblGenomes-Gn; Sden_R0012.
DR   EnsemblGenomes-Gn; Sden_R0013.
DR   EnsemblGenomes-Gn; Sden_R0015.
DR   EnsemblGenomes-Gn; Sden_R0016.
DR   EnsemblGenomes-Gn; Sden_R0017.
DR   EnsemblGenomes-Gn; Sden_R0018.
DR   EnsemblGenomes-Gn; Sden_R0019.
DR   EnsemblGenomes-Gn; Sden_R0020.
DR   EnsemblGenomes-Gn; Sden_R0021.
DR   EnsemblGenomes-Gn; Sden_R0022.
DR   EnsemblGenomes-Gn; Sden_R0023.
DR   EnsemblGenomes-Gn; Sden_R0026.
DR   EnsemblGenomes-Gn; Sden_R0027.
DR   EnsemblGenomes-Gn; Sden_R0028.
DR   EnsemblGenomes-Gn; Sden_R0029.
DR   EnsemblGenomes-Gn; Sden_R0030.
DR   EnsemblGenomes-Gn; Sden_R0031.
DR   EnsemblGenomes-Gn; Sden_R0032.
DR   EnsemblGenomes-Gn; Sden_R0033.
DR   EnsemblGenomes-Gn; Sden_R0034.
DR   EnsemblGenomes-Gn; Sden_R0036.
DR   EnsemblGenomes-Gn; Sden_R0037.
DR   EnsemblGenomes-Gn; Sden_R0038.
DR   EnsemblGenomes-Gn; Sden_R0039.
DR   EnsemblGenomes-Gn; Sden_R0040.
DR   EnsemblGenomes-Gn; Sden_R0041.
DR   EnsemblGenomes-Gn; Sden_R0042.
DR   EnsemblGenomes-Gn; Sden_R0043.
DR   EnsemblGenomes-Gn; Sden_R0044.
DR   EnsemblGenomes-Gn; Sden_R0045.
DR   EnsemblGenomes-Gn; Sden_R0046.
DR   EnsemblGenomes-Gn; Sden_R0047.
DR   EnsemblGenomes-Gn; Sden_R0048.
DR   EnsemblGenomes-Gn; Sden_R0049.
DR   EnsemblGenomes-Gn; Sden_R0050.
DR   EnsemblGenomes-Gn; Sden_R0051.
DR   EnsemblGenomes-Gn; Sden_R0052.
DR   EnsemblGenomes-Gn; Sden_R0053.
DR   EnsemblGenomes-Gn; Sden_R0054.
DR   EnsemblGenomes-Gn; Sden_R0055.
DR   EnsemblGenomes-Gn; Sden_R0056.
DR   EnsemblGenomes-Gn; Sden_R0057.
DR   EnsemblGenomes-Gn; Sden_R0059.
DR   EnsemblGenomes-Gn; Sden_R0060.
DR   EnsemblGenomes-Gn; Sden_R0061.
DR   EnsemblGenomes-Gn; Sden_R0062.
DR   EnsemblGenomes-Gn; Sden_R0064.
DR   EnsemblGenomes-Gn; Sden_R0065.
DR   EnsemblGenomes-Gn; Sden_R0066.
DR   EnsemblGenomes-Gn; Sden_R0067.
DR   EnsemblGenomes-Gn; Sden_R0068.
DR   EnsemblGenomes-Gn; Sden_R0069.
DR   EnsemblGenomes-Gn; Sden_R0070.
DR   EnsemblGenomes-Gn; Sden_R0071.
DR   EnsemblGenomes-Gn; Sden_R0072.
DR   EnsemblGenomes-Gn; Sden_R0073.
DR   EnsemblGenomes-Gn; Sden_R0074.
DR   EnsemblGenomes-Gn; Sden_R0075.
DR   EnsemblGenomes-Gn; Sden_R0076.
DR   EnsemblGenomes-Gn; Sden_R0078.
DR   EnsemblGenomes-Gn; Sden_R0079.
DR   EnsemblGenomes-Gn; Sden_R0080.
DR   EnsemblGenomes-Gn; Sden_R0081.
DR   EnsemblGenomes-Gn; Sden_R0082.
DR   EnsemblGenomes-Gn; Sden_R0084.
DR   EnsemblGenomes-Gn; Sden_R0085.
DR   EnsemblGenomes-Gn; Sden_R0086.
DR   EnsemblGenomes-Gn; Sden_R0087.
DR   EnsemblGenomes-Gn; Sden_R0088.
DR   EnsemblGenomes-Gn; Sden_R0089.
DR   EnsemblGenomes-Gn; Sden_R0090.
DR   EnsemblGenomes-Gn; Sden_R0091.
DR   EnsemblGenomes-Gn; Sden_R0092.
DR   EnsemblGenomes-Gn; Sden_R0093.
DR   EnsemblGenomes-Gn; Sden_R0094.
DR   EnsemblGenomes-Gn; Sden_R0095.
DR   EnsemblGenomes-Gn; Sden_R0096.
DR   EnsemblGenomes-Gn; Sden_R0097.
DR   EnsemblGenomes-Gn; Sden_R0098.
DR   EnsemblGenomes-Gn; Sden_R0099.
DR   EnsemblGenomes-Gn; Sden_R0100.
DR   EnsemblGenomes-Gn; Sden_R0101.
DR   EnsemblGenomes-Gn; Sden_R0102.
DR   EnsemblGenomes-Gn; Sden_R0103.
DR   EnsemblGenomes-Gn; Sden_R0104.
DR   EnsemblGenomes-Gn; Sden_R0105.
DR   EnsemblGenomes-Gn; Sden_R0106.
DR   EnsemblGenomes-Gn; Sden_R0107.
DR   EnsemblGenomes-Gn; Sden_R0108.
DR   EnsemblGenomes-Gn; Sden_R0109.
DR   EnsemblGenomes-Gn; Sden_R0110.
DR   EnsemblGenomes-Gn; Sden_R0111.
DR   EnsemblGenomes-Gn; Sden_R0112.
DR   EnsemblGenomes-Gn; Sden_R0113.
DR   EnsemblGenomes-Gn; Sden_R0114.
DR   EnsemblGenomes-Gn; Sden_R0115.
DR   EnsemblGenomes-Gn; Sden_R0116.
DR   EnsemblGenomes-Gn; Sden_R0117.
DR   EnsemblGenomes-Gn; Sden_R0118.
DR   EnsemblGenomes-Gn; Sden_R0119.
DR   EnsemblGenomes-Gn; Sden_R0120.
DR   EnsemblGenomes-Gn; Sden_R0121.
DR   EnsemblGenomes-Gn; Sden_R0122.
DR   EnsemblGenomes-Gn; Sden_R0123.
DR   EnsemblGenomes-Gn; Sden_R0124.
DR   EnsemblGenomes-Gn; Sden_R0125.
DR   EnsemblGenomes-Gn; Sden_R0126.
DR   EnsemblGenomes-Gn; Sden_R0127.
DR   EnsemblGenomes-Tr; EBT00001554080.
DR   EnsemblGenomes-Tr; EBT00001554081.
DR   EnsemblGenomes-Tr; EBT00001554082.
DR   EnsemblGenomes-Tr; EBT00001554083.
DR   EnsemblGenomes-Tr; EBT00001554085.
DR   EnsemblGenomes-Tr; EBT00001554087.
DR   EnsemblGenomes-Tr; EBT00001554089.
DR   EnsemblGenomes-Tr; EBT00001554091.
DR   EnsemblGenomes-Tr; EBT00001554093.
DR   EnsemblGenomes-Tr; EBT00001554094.
DR   EnsemblGenomes-Tr; EBT00001554095.
DR   EnsemblGenomes-Tr; EBT00001554096.
DR   EnsemblGenomes-Tr; EBT00001554098.
DR   EnsemblGenomes-Tr; EBT00001554099.
DR   EnsemblGenomes-Tr; EBT00001554100.
DR   EnsemblGenomes-Tr; EBT00001554102.
DR   EnsemblGenomes-Tr; EBT00001554104.
DR   EnsemblGenomes-Tr; EBT00001554105.
DR   EnsemblGenomes-Tr; EBT00001554107.
DR   EnsemblGenomes-Tr; EBT00001554110.
DR   EnsemblGenomes-Tr; EBT00001554113.
DR   EnsemblGenomes-Tr; EBT00001554115.
DR   EnsemblGenomes-Tr; EBT00001554116.
DR   EnsemblGenomes-Tr; EBT00001554117.
DR   EnsemblGenomes-Tr; EBT00001554118.
DR   EnsemblGenomes-Tr; EBT00001554119.
DR   EnsemblGenomes-Tr; EBT00001554122.
DR   EnsemblGenomes-Tr; EBT00001554124.
DR   EnsemblGenomes-Tr; EBT00001554127.
DR   EnsemblGenomes-Tr; EBT00001554129.
DR   EnsemblGenomes-Tr; EBT00001554132.
DR   EnsemblGenomes-Tr; EBT00001554135.
DR   EnsemblGenomes-Tr; EBT00001554137.
DR   EnsemblGenomes-Tr; EBT00001554138.
DR   EnsemblGenomes-Tr; EBT00001554139.
DR   EnsemblGenomes-Tr; EBT00001554141.
DR   EnsemblGenomes-Tr; EBT00001554142.
DR   EnsemblGenomes-Tr; EBT00001554144.
DR   EnsemblGenomes-Tr; EBT00001554145.
DR   EnsemblGenomes-Tr; EBT00001554147.
DR   EnsemblGenomes-Tr; EBT00001554148.
DR   EnsemblGenomes-Tr; EBT00001554150.
DR   EnsemblGenomes-Tr; EBT00001554151.
DR   EnsemblGenomes-Tr; EBT00001554153.
DR   EnsemblGenomes-Tr; EBT00001554154.
DR   EnsemblGenomes-Tr; EBT00001554156.
DR   EnsemblGenomes-Tr; EBT00001554157.
DR   EnsemblGenomes-Tr; EBT00001554158.
DR   EnsemblGenomes-Tr; EBT00001554160.
DR   EnsemblGenomes-Tr; EBT00001554161.
DR   EnsemblGenomes-Tr; EBT00001554163.
DR   EnsemblGenomes-Tr; EBT00001554164.
DR   EnsemblGenomes-Tr; EBT00001554166.
DR   EnsemblGenomes-Tr; EBT00001554167.
DR   EnsemblGenomes-Tr; EBT00001554169.
DR   EnsemblGenomes-Tr; EBT00001554170.
DR   EnsemblGenomes-Tr; EBT00001554173.
DR   EnsemblGenomes-Tr; EBT00001554175.
DR   EnsemblGenomes-Tr; EBT00001554177.
DR   EnsemblGenomes-Tr; EBT00001554178.
DR   EnsemblGenomes-Tr; EBT00001554179.
DR   EnsemblGenomes-Tr; EBT00001554180.
DR   EnsemblGenomes-Tr; EBT00001554181.
DR   EnsemblGenomes-Tr; EBT00001554182.
DR   EnsemblGenomes-Tr; EBT00001554185.
DR   EnsemblGenomes-Tr; EBT00001554186.
DR   EnsemblGenomes-Tr; EBT00001554187.
DR   EnsemblGenomes-Tr; EBT00001554189.
DR   EnsemblGenomes-Tr; EBT00001554191.
DR   EnsemblGenomes-Tr; EBT00001554192.
DR   EnsemblGenomes-Tr; EBT00001554194.
DR   EnsemblGenomes-Tr; EBT00001554195.
DR   EnsemblGenomes-Tr; EBT00001554196.
DR   EnsemblGenomes-Tr; EBT00001554197.
DR   EnsemblGenomes-Tr; EBT00001554198.
DR   EnsemblGenomes-Tr; EBT00001554200.
DR   EnsemblGenomes-Tr; EBT00001554202.
DR   EnsemblGenomes-Tr; EBT00001554206.
DR   EnsemblGenomes-Tr; EBT00001554211.
DR   EnsemblGenomes-Tr; EBT00001554214.
DR   EnsemblGenomes-Tr; EBT00001554218.
DR   EnsemblGenomes-Tr; EBT00001554220.
DR   EnsemblGenomes-Tr; EBT00001554223.
DR   EnsemblGenomes-Tr; EBT00001554225.
DR   EnsemblGenomes-Tr; EBT00001554226.
DR   EnsemblGenomes-Tr; EBT00001554228.
DR   EnsemblGenomes-Tr; EBT00001554230.
DR   EnsemblGenomes-Tr; EBT00001554233.
DR   EnsemblGenomes-Tr; EBT00001554235.
DR   EnsemblGenomes-Tr; EBT00001554238.
DR   EnsemblGenomes-Tr; EBT00001554240.
DR   EnsemblGenomes-Tr; EBT00001554242.
DR   EnsemblGenomes-Tr; EBT00001554244.
DR   EnsemblGenomes-Tr; EBT00001554245.
DR   EnsemblGenomes-Tr; EBT00001554247.
DR   EnsemblGenomes-Tr; EBT00001554249.
DR   EnsemblGenomes-Tr; EBT00001554251.
DR   EnsemblGenomes-Tr; EBT00001554253.
DR   EnsemblGenomes-Tr; EBT00001554255.
DR   EnsemblGenomes-Tr; EBT00001554257.
DR   EnsemblGenomes-Tr; EBT00001554259.
DR   EnsemblGenomes-Tr; EBT00001554262.
DR   EnsemblGenomes-Tr; EBT00001554264.
DR   EnsemblGenomes-Tr; EBT00001554268.
DR   EnsemblGenomes-Tr; EBT00001554270.
DR   EnsemblGenomes-Tr; EBT00001554273.
DR   EnsemblGenomes-Tr; EBT00001554276.
DR   EnsemblGenomes-Tr; EBT00001554278.
DR   EnsemblGenomes-Tr; EBT00001554279.
DR   EnsemblGenomes-Tr; EBT00001554280.
DR   EnsemblGenomes-Tr; EBT00001554282.
DR   EnsemblGenomes-Tr; EBT00001554285.
DR   EnsemblGenomes-Tr; EBT00001554286.
DR   EnsemblGenomes-Tr; EBT00001554288.
DR   EnsemblGenomes-Tr; EBT00001554290.
DR   EnsemblGenomes-Tr; EBT00001554292.
DR   EnsemblGenomes-Tr; EBT00001554293.
DR   EnsemblGenomes-Tr; EBT00001554296.
DR   EnsemblGenomes-Tr; EBT00001554298.
DR   EnsemblGenomes-Tr; EBT00001554299.
DR   EnsemblGenomes-Tr; EBT00001554301.
DR   EnsemblGenomes-Tr; EBT00001554303.
DR   EnsemblGenomes-Tr; EBT00001554304.
DR   EnsemblGenomes-Tr; EBT00001554305.
DR   EnsemblGenomes-Tr; EBT00001554307.
DR   EnsemblGenomes-Tr; EBT00001554309.
DR   EnsemblGenomes-Tr; EBT00001554312.
DR   EnsemblGenomes-Tr; EBT00001554314.
DR   EnsemblGenomes-Tr; EBT00001554316.
DR   EnsemblGenomes-Tr; EBT00001554317.
DR   EnsemblGenomes-Tr; EBT00001554318.
DR   EnsemblGenomes-Tr; EBT00001554319.
DR   EnsemblGenomes-Tr; EBT00001554320.
DR   EnsemblGenomes-Tr; EBT00001554321.
DR   EnsemblGenomes-Tr; EBT00001554322.
DR   EnsemblGenomes-Tr; Sden_R0001-1.
DR   EnsemblGenomes-Tr; Sden_R0002-1.
DR   EnsemblGenomes-Tr; Sden_R0003-1.
DR   EnsemblGenomes-Tr; Sden_R0004-1.
DR   EnsemblGenomes-Tr; Sden_R0005-1.
DR   EnsemblGenomes-Tr; Sden_R0006-1.
DR   EnsemblGenomes-Tr; Sden_R0007-1.
DR   EnsemblGenomes-Tr; Sden_R0008-1.
DR   EnsemblGenomes-Tr; Sden_R0009-1.
DR   EnsemblGenomes-Tr; Sden_R0010-1.
DR   EnsemblGenomes-Tr; Sden_R0011-1.
DR   EnsemblGenomes-Tr; Sden_R0012-1.
DR   EnsemblGenomes-Tr; Sden_R0013-1.
DR   EnsemblGenomes-Tr; Sden_R0015-1.
DR   EnsemblGenomes-Tr; Sden_R0016-1.
DR   EnsemblGenomes-Tr; Sden_R0017-1.
DR   EnsemblGenomes-Tr; Sden_R0018-1.
DR   EnsemblGenomes-Tr; Sden_R0019-1.
DR   EnsemblGenomes-Tr; Sden_R0020-1.
DR   EnsemblGenomes-Tr; Sden_R0021-1.
DR   EnsemblGenomes-Tr; Sden_R0022-1.
DR   EnsemblGenomes-Tr; Sden_R0023-1.
DR   EnsemblGenomes-Tr; Sden_R0026-1.
DR   EnsemblGenomes-Tr; Sden_R0027-1.
DR   EnsemblGenomes-Tr; Sden_R0028-1.
DR   EnsemblGenomes-Tr; Sden_R0029-1.
DR   EnsemblGenomes-Tr; Sden_R0030-1.
DR   EnsemblGenomes-Tr; Sden_R0031-1.
DR   EnsemblGenomes-Tr; Sden_R0032-1.
DR   EnsemblGenomes-Tr; Sden_R0033-1.
DR   EnsemblGenomes-Tr; Sden_R0034-1.
DR   EnsemblGenomes-Tr; Sden_R0036-1.
DR   EnsemblGenomes-Tr; Sden_R0037-1.
DR   EnsemblGenomes-Tr; Sden_R0038-1.
DR   EnsemblGenomes-Tr; Sden_R0039-1.
DR   EnsemblGenomes-Tr; Sden_R0040-1.
DR   EnsemblGenomes-Tr; Sden_R0041-1.
DR   EnsemblGenomes-Tr; Sden_R0042-1.
DR   EnsemblGenomes-Tr; Sden_R0043-1.
DR   EnsemblGenomes-Tr; Sden_R0044-1.
DR   EnsemblGenomes-Tr; Sden_R0045-1.
DR   EnsemblGenomes-Tr; Sden_R0046-1.
DR   EnsemblGenomes-Tr; Sden_R0047-1.
DR   EnsemblGenomes-Tr; Sden_R0048-1.
DR   EnsemblGenomes-Tr; Sden_R0049-1.
DR   EnsemblGenomes-Tr; Sden_R0050-1.
DR   EnsemblGenomes-Tr; Sden_R0051-1.
DR   EnsemblGenomes-Tr; Sden_R0052-1.
DR   EnsemblGenomes-Tr; Sden_R0053-1.
DR   EnsemblGenomes-Tr; Sden_R0054-1.
DR   EnsemblGenomes-Tr; Sden_R0055-1.
DR   EnsemblGenomes-Tr; Sden_R0056-1.
DR   EnsemblGenomes-Tr; Sden_R0057-1.
DR   EnsemblGenomes-Tr; Sden_R0059-1.
DR   EnsemblGenomes-Tr; Sden_R0060-1.
DR   EnsemblGenomes-Tr; Sden_R0061-1.
DR   EnsemblGenomes-Tr; Sden_R0062-1.
DR   EnsemblGenomes-Tr; Sden_R0064-1.
DR   EnsemblGenomes-Tr; Sden_R0065-1.
DR   EnsemblGenomes-Tr; Sden_R0066-1.
DR   EnsemblGenomes-Tr; Sden_R0067-1.
DR   EnsemblGenomes-Tr; Sden_R0068-1.
DR   EnsemblGenomes-Tr; Sden_R0069-1.
DR   EnsemblGenomes-Tr; Sden_R0070-1.
DR   EnsemblGenomes-Tr; Sden_R0071-1.
DR   EnsemblGenomes-Tr; Sden_R0072-1.
DR   EnsemblGenomes-Tr; Sden_R0073-1.
DR   EnsemblGenomes-Tr; Sden_R0074-1.
DR   EnsemblGenomes-Tr; Sden_R0075-1.
DR   EnsemblGenomes-Tr; Sden_R0076-1.
DR   EnsemblGenomes-Tr; Sden_R0078-1.
DR   EnsemblGenomes-Tr; Sden_R0079-1.
DR   EnsemblGenomes-Tr; Sden_R0080-1.
DR   EnsemblGenomes-Tr; Sden_R0081-1.
DR   EnsemblGenomes-Tr; Sden_R0082-1.
DR   EnsemblGenomes-Tr; Sden_R0084-1.
DR   EnsemblGenomes-Tr; Sden_R0085-1.
DR   EnsemblGenomes-Tr; Sden_R0086-1.
DR   EnsemblGenomes-Tr; Sden_R0087-1.
DR   EnsemblGenomes-Tr; Sden_R0088-1.
DR   EnsemblGenomes-Tr; Sden_R0089-1.
DR   EnsemblGenomes-Tr; Sden_R0090-1.
DR   EnsemblGenomes-Tr; Sden_R0091-1.
DR   EnsemblGenomes-Tr; Sden_R0092-1.
DR   EnsemblGenomes-Tr; Sden_R0093-1.
DR   EnsemblGenomes-Tr; Sden_R0094-1.
DR   EnsemblGenomes-Tr; Sden_R0095-1.
DR   EnsemblGenomes-Tr; Sden_R0096-1.
DR   EnsemblGenomes-Tr; Sden_R0097-1.
DR   EnsemblGenomes-Tr; Sden_R0098-1.
DR   EnsemblGenomes-Tr; Sden_R0099-1.
DR   EnsemblGenomes-Tr; Sden_R0100-1.
DR   EnsemblGenomes-Tr; Sden_R0101-1.
DR   EnsemblGenomes-Tr; Sden_R0102-1.
DR   EnsemblGenomes-Tr; Sden_R0103-1.
DR   EnsemblGenomes-Tr; Sden_R0104-1.
DR   EnsemblGenomes-Tr; Sden_R0105-1.
DR   EnsemblGenomes-Tr; Sden_R0106-1.
DR   EnsemblGenomes-Tr; Sden_R0107-1.
DR   EnsemblGenomes-Tr; Sden_R0108-1.
DR   EnsemblGenomes-Tr; Sden_R0109-1.
DR   EnsemblGenomes-Tr; Sden_R0110-1.
DR   EnsemblGenomes-Tr; Sden_R0111-1.
DR   EnsemblGenomes-Tr; Sden_R0112-1.
DR   EnsemblGenomes-Tr; Sden_R0113-1.
DR   EnsemblGenomes-Tr; Sden_R0114-1.
DR   EnsemblGenomes-Tr; Sden_R0115-1.
DR   EnsemblGenomes-Tr; Sden_R0116-1.
DR   EnsemblGenomes-Tr; Sden_R0117-1.
DR   EnsemblGenomes-Tr; Sden_R0118-1.
DR   EnsemblGenomes-Tr; Sden_R0119-1.
DR   EnsemblGenomes-Tr; Sden_R0120-1.
DR   EnsemblGenomes-Tr; Sden_R0121-1.
DR   EnsemblGenomes-Tr; Sden_R0122-1.
DR   EnsemblGenomes-Tr; Sden_R0123-1.
DR   EnsemblGenomes-Tr; Sden_R0124-1.
DR   EnsemblGenomes-Tr; Sden_R0125-1.
DR   EnsemblGenomes-Tr; Sden_R0126-1.
DR   EnsemblGenomes-Tr; Sden_R0127-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP000302.
DR   SILVA-SSU; CP000302.
DR   StrainInfo; 303781; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634607
CC   Source DNA available from Jim Fredrickson (jim.fredrickson@pnl.gov)
CC   Bacteria available from DSMZ: DSM 15013
CC   Contacts: Jim Fredrickson (jim.fredrickson@pnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4545906
FT                   /organism="Shewanella denitrificans OS217"
FT                   /strain="OS217"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:318161"
FT   gene            10..1398
FT                   /locus_tag="Sden_0001"
FT   CDS_pept        10..1398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53298"
FT                   /db_xref="GOA:Q12TC8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TC8"
FT                   /protein_id="ABE53298.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGDTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGSNAPKLRFDIGSRPSARTVQPAPAAPRPTTGHTQTK
FT                   ARVGTAFNIQAEPMANANHRSNINPTYQFDNFVEGKSNQLGKAAAMQVAENPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFVAKRLRSNVRELEGALNRVIA
FT                   NANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVA
FT                   RPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIR
FT                   TLSS"
FT   gene            1418..2518
FT                   /locus_tag="Sden_0002"
FT   CDS_pept        1418..2518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53299"
FT                   /db_xref="GOA:Q12TC7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TC7"
FT                   /protein_id="ABE53299.1"
FT                   /translation="MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVKVSQDVISLT
FT                   GTDLEVELVGQAAIHGDIVPGNTTVPAKKLLDIVKSLPEQSELHVEQQDNRWLLRSGRS
FT                   RFTLATLPASDYPNVEAFQAEIEFTIKQGVLKSIIDSTQFSMANQDVRYYLNGLLFETE
FT                   GNTLKAIATDGHRLALSHRQIDVSLPEKQVIVPRKGVVEMSRLLDSDDKDISIAIGESA
FT                   IRAVTDTAVFTSKLVDGRFPDYRRVLPKGGDKVVVASRQQLKQALTRASILSNEKFRGV
FT                   RIQLEPGLLRITANNPEQEEAEEIIDVDYDSANLEIGFNVSYLLDVLNNLASEDVRITL
FT                   IDGNSSALIENHKEEDSMYVVMPMRL"
FT   gene            2617..3699
FT                   /locus_tag="Sden_0003"
FT   CDS_pept        2617..3699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53300"
FT                   /db_xref="GOA:Q12TC6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TC6"
FT                   /protein_id="ABE53300.1"
FT                   /translation="MSLQRISIESFRNIAAANLLPSEGLNLIYGHNGSGKTSVLEAIYF
FT                   LGMGRSFRSHLSQRVIRHDEDKLTLFAQLSHHNGESKVGLRRHRNGEIEVKIDGDRVKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKARRQFVDWGAFHSDEQFYTAWSNVKRILKQRNQ
FT                   LLRNGSSYGNILFWDKELVRYAEQVTQIRNHYVDSLNELLKGIIEEFLPQVNISISFTR
FT                   GWDSKTDLALLLESQYSRDLATGHTVSGPHKADLRLRVGNLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQKDKQSIYLVDDLPSELDAQHRQLLLKQLTETGAQIFVTAIEPAAIVDS
FT                   LASPPNKVFHVEQGRVTVIE"
FT   gene            3715..6132
FT                   /locus_tag="Sden_0004"
FT   CDS_pept        3715..6132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53301"
FT                   /db_xref="GOA:Q12TC5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TC5"
FT                   /protein_id="ABE53301.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCSDITITIHTDGSVSVQDDGRGIPVAIHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSHKLQLTIRRGGKIYEQFYTMGVPDAPIAAIGDAIK
FT                   TGTEIRFWPSGETFTNLEFHFDILAKRVRELSFLNSGVGIRLIDERDNKNEFFKYEGGI
FT                   SAFVTYLNRNKTPVNKDVFHFAHEREDGITVEVAMQWNDGYQENIYCFTNNIPQRDGGT
FT                   HLAGFRGALTRNLNTYMEREGFNKKGKTSATGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVEQTMGEQLNDYLLENPADAKLIVGKIVDAARAREAARKAREMTRRKGAL
FT                   DLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYDPEKTRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QMPELIERGYIYIAQPPLFKVKKGKQEQYLKDEPALTEYLTTQALDGTRIYPTQGAPGM
FT                   TGEPLERLVAQYREVETIIARLEKRYPSIVLNRMLYHPEVTGAMLADETQMKAWCAEFV
FT                   ADLIELETNGVIYDMVTEFDMERKVYLPKMVIRKHGIDTEYLFGYDFFHSLDYQRIAKL
FT                   GAALDGMVEEGGYVQRGEKVKEVETFLEALDWMISEAKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPETRRMLRVTIEDAVGADQLFTTLMGDQVEPRREFIEANALNVANLDV"
FT   gene            complement(6236..7441)
FT                   /locus_tag="Sden_0005"
FT   CDS_pept        complement(6236..7441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0005"
FT                   /product="Di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53302"
FT                   /db_xref="GOA:Q12TC4"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR023929"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TC4"
FT                   /protein_id="ABE53302.1"
FT                   /translation="MPFKSQKSRLGTLSICLLVITSLAACDQAATVVKHDAYQWSIPAG
FT                   FPKPTVPQDNPMSTAKVSLGRYLFYDKNLSMDQSQSCASCHLQSQAFAEKLVVSIGSTG
FT                   EHHRRNAPALVNIAYNKTLTWAHDGLTELEQQILLPLFGEQPIELGAGGNEAQILSRLQ
FT                   QGPYPKLLQDAFPEHQGPMNFVHVTQALASFVRSLISLNSPFDDYAYRGQDSALSETQL
FT                   AGMGLFFSEKFECHHCHGGFNFTQSTSHEKQPLDRRPFHNTGLYYTKRIGLTTTKEVSI
FT                   HYGYPEIDRGLAEVSTNPKDDGRFRAPSLRNISLTAPYMHDGSVATLAEVIDIYAAGGR
FT                   NVTTGEHQGDGRNNPLKSPFIKGFDISEQEKIQLLAFLESLTDSDFITAPPLSDPWPEA
FT                   EK"
FT   sig_peptide     complement(7364..7441)
FT                   /locus_tag="Sden_0005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.591 at
FT                   residue 26"
FT   gene            complement(7441..8154)
FT                   /locus_tag="Sden_0006"
FT   CDS_pept        complement(7441..8154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53303"
FT                   /db_xref="InterPro:IPR023977"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TC3"
FT                   /protein_id="ABE53303.1"
FT                   /translation="MGCHSSIKPHWQLEQVQLFLSNFSLDGQPQALSKETVGASKYQQA
FT                   SVALLGSDCQGEQNWLLSFDKALKPGLMTFELGVPFELNHGNPLLAETPLNQSDMFWTW
FT                   QQGHKFLRIDLAKTLLTEPAVGKQTGWQFHLGSVACQSASVMRSPTQACKQPNRAKFSL
FT                   DYQGQHQLNLDLAVLLAPLLDDPQLSQQSCMSDSASKTCQLLFSRLGLGQALPFETQQL
FT                   SINAIEPVAPLWWFN"
FT   gene            8431..11172
FT                   /locus_tag="Sden_0007"
FT   CDS_pept        8431..11172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0007"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53304"
FT                   /db_xref="GOA:Q12TC2"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027589"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TC2"
FT                   /protein_id="ABE53304.1"
FT                   /translation="MAFTLLIKPYTFGIGLLSLAGFLSQGAFAHSEHDKARFVSEKGQD
FT                   VGFCDNALRPCQTIAYAVTHANKGDRVLVADGYYQIRDIDELFLLTSEIVPVMGGFNRY
FT                   DHYLSQAPQLNTTVLTGVPSEFAQRLEARGFRVISDGIGQYGTELDEMLATQQGLQQDH
FT                   ASATCTAGKAAGFNCNAIDLVSHIALGSFSSKPNAANDIWGHVDLNTGTEYAIIGLVNG
FT                   TVVMNLSDPANPVEVGTVTGSRTTWRDIKVYQWFDASVSRWKANAYVTSEGSDNIQIID
FT                   LSQLPHSISKLATDTVEGSAHNVYISNLDYTTNTALTGLTPQLHIVGQNSAGGAFKSYS
FT                   LTNPAKLSVSFSHSGATRADYTHDVSSMVVDDARAQASCQTQICTVLMDFNETSMRLWN
FT                   ITTPASSKTLSDVTYANAEYVHSGWWSEDKRYVFVHDELDEQRAGLNTTLRVFNVDDLG
FT                   APDLVKVWSGPTKAIDHNGFVRGNRYYMSNYQRGVTILDISQADDPKEVGYFDTFPASD
FT                   SNAFNGVWGVYPYLPSGLVLASDINSGLYILRDKSLNSAQGSSSFVAAASASNAGDVMN
FT                   ISVQRPQGSGVVSVGFETLSATAVAGRDFEAVNGRLSWAADDHNAKQISITTLDSGQNK
FT                   ALLAFVRLFDPRGGLTLASPSYHQLNIGEDVPQAGSLGFASATASVVEGASLSVAVLRS
FT                   GGSAGELRLAYGLESGTAIVGQDVEALSGELVWGDGDSQVKHIQVNTLEDTDIEADEDF
FT                   LVTLGSLAGSQISTASLTVTLTDNDRLNTAPTVSAGENREVNGGATVTLTAQATDAEND
FT                   AISYAWQQTSGESVTLSNANTASAQFVAPAMDASLVFTVTATDALQSSTQASVTITVKA
FT                   AVVALPEVKVVEPSSGGGSLGSLSLLLLAGLGIRRRCNKIAA"
FT   sig_peptide     8431..8520
FT                   /locus_tag="Sden_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            complement(11263..13347)
FT                   /locus_tag="Sden_0008"
FT   CDS_pept        complement(11263..13347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0008"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53305"
FT                   /db_xref="GOA:Q12TC1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TC1"
FT                   /protein_id="ABE53305.1"
FT                   /translation="MKFENLLIEIGTEELPPKSLRTLADSFLANFSDELVKADLPFTAA
FT                   TWYAAPRRLALSITGLAVAQADKVVEKRGPAVSSAFDADGNPTKAAQGWARGNGITVEQ
FT                   AERLVTDKGEWLVHQAKVVGVQTNSLIAAMAQRALDKLPIPKPMRWGANSTQFIRPVHT
FT                   VTMLLGSELIGGELLGIKSDRIIRGHRFMGQASFQLDHADNYLSALKEQGKVLADYQLR
FT                   KAIIKADAEAAAAKIGGVADIQEDLLEEVASLVEWPIVLTASFEEKFLNVPAEALVYTM
FT                   KGDQKYFPVFDKSGKLLPNFIFVTNIESKDPQQIISGNEKVVRPRLADAEFFFNTDKKH
FT                   SLASRLSSLETVVFQKQLGTLKARAERISQLAGFIATELNNNNLASSSVDAARAGLLSK
FT                   ADLMTNMVMEFTDTQGTMGMHYARLDGETEAVAIAIEEQYKPKFSGDTVPTASVSCAVA
FT                   LAEKLDTLVGIFGIGQAPKGAADPFALRRAAIGILRIIVENKLPLDLVDLIAKAQALHG
FT                   TNLTNGNTSEDVLEFLMARFRSWYQDKGIQVDVILAVLARRPTRPADFDSRVNAVSHFR
FT                   GLEASTALAAANKRVSNILAKVEGELPANVTPSLLTETAEKALAEQLASLQPKLAPLFA
FT                   TGDYQQALTLLAELRESVDQFFEDVMVMADDEALKNNRLALLNNLREQFLHVADISLLQ
FT                   "
FT   gene            complement(13357..14262)
FT                   /locus_tag="Sden_0009"
FT   CDS_pept        complement(13357..14262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0009"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53306"
FT                   /db_xref="GOA:Q12TC0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TC0"
FT                   /protein_id="ABE53306.1"
FT                   /translation="MTMKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQT
FT                   FLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLQ
FT                   ALGIDTQVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECSPVTGE
FT                   ITYGLERLAMYIQEVDSVYDLVWTDGPMGRVTYGDIFHQNEVEQSTYNFEHADVDFMFT
FT                   LFDQCEKMCQHLLSLDKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRAMS
FT                   KGVAESYYQAREALGFPLCK"
FT   gene            14373..14936
FT                   /locus_tag="Sden_0010"
FT   CDS_pept        14373..14936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0010"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53307"
FT                   /db_xref="GOA:Q12TB9"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TB9"
FT                   /protein_id="ABE53307.1"
FT                   /translation="MQVNRCAWVSDDPLYQDYHDKVWGRPEYDSQQLFAKLCLDGQQAG
FT                   LSWITILKKQQNYERLFANFDPRLIAEFDDAKVEELMLDVGIVRNRLKVNSIIRNAKAY
FT                   LAMEQQGINFSQFLWAFVGGAPKLNNFSSMADVPAQTPESEAMSKALKKLGFNFVGPTI
FT                   CYAFMQAVGMVNDHTQDCFCATEK"
FT   gene            complement(15084..18281)
FT                   /locus_tag="Sden_0011"
FT   CDS_pept        complement(15084..18281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0011"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53308"
FT                   /db_xref="GOA:Q12TB8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TB8"
FT                   /protein_id="ABE53308.1"
FT                   /translation="MLMLSIKFTPLYTAIALTLGCSSLVYAEDEAPKWQVNAPEHAPLE
FT                   KASIDVNEGTWMNVSVSPDGEHIVFDLLGDIYQMPISGGDAKPLAKGIAWQMQPVYSPD
FT                   GKYIAFTSDEDGGDNIWVMNADGSNPHPVTKETFRLLNSPAWSPDSQYLVARKHFTASR
FT                   SLGAGEVWLYHVAGGEGVKLTERPNDQKDLGEPAYSPDGRYIYFSQDDTPGKTFHYSKD
FT                   SVSGIYKIKRYDTQTGDIEILVEGTGGAIRPTPSPDGKKLAYIKRDGFQSSLYLLDLQS
FT                   GETNKLYAELDRDMQETWAIHGVYPSMAWTQDNSSIVFWAKGKINKLKLKDLSVSDIPF
FT                   KVKAQLDIQPSVRFTQNLDQDKFDVKMLRMAQVSPDGKKVVFEALGKLWIRDIENDTQE
FT                   RLTRLDDDINELFPQWSRDGKQIVFTTWNDQDQGTVSLISARGGKATRLTSEPGKYVEP
FT                   TFAPNGQFVVYRKANGGNITPRTWSQETGLYKVDVKGKQNTKITAEGYQAQFGADTDRI
FT                   FFMEQGETPQLSSIRIDGFDKRVHYTSEHATEFRVSPDGEHLAFAERFRVYVTPFAKHG
FT                   ETIAIGPKASNLPVIQLSTRAGESISWGNNSDNLYWTLGPELYQAKVDTQYGKKDDKSQ
FT                   AKITNIGFKQDAYVPRGTIAFVGGTVITMEEDKVIDKGVVIIKDNKIIAVGDAATKIPN
FT                   GAQVIDIAGKSIMPGLFDAHAHGPQADEEIIPQQNWTLYSGLSLGVTAIHDPSNDTTEI
FT                   FAASEQQKAGSIVGPRIFSTGTILYGANAPGYTSHVDSLDDAKFHLERLKKVGAFSVKS
FT                   YNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLSMVVDGHTTLEHSLPVGAIYSDIK
FT                   QLWSQTKVSYTPTLVVAYGGISGENYWYDKTDVWAHPRLSAYVPADILQARSMRRPTAP
FT                   DGHYNHFNVAKVAKALNDVGVKANIGAHGQREGLAAHWEMWMFAQGGMSNQEVLKTSTI
FT                   NPATTFGMDHQLGSIKTGKLADLIVIDGNPLEDIRVTDKVVYTMTNGRLFNAETMNELN
FT                   GDKHQRNPFFFEKANKQ"
FT   sig_peptide     complement(18198..18281)
FT                   /locus_tag="Sden_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(18524..18973)
FT                   /locus_tag="Sden_0012"
FT   CDS_pept        complement(18524..18973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0012"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53309"
FT                   /db_xref="GOA:Q12TB7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TB7"
FT                   /protein_id="ABE53309.1"
FT                   /translation="MTVALVSIAYKTVKRGPMNEVITANVTIDKGVENDILGRPSKRQV
FT                   TVLSEQQWDKACAAINADLSWLTRRANLLISGHEFSAADVGKIIQIGDDLRLLVTGETD
FT                   PCRKMEQSHPGLEGALTPDWRGGVTCKVLHSGLIYQNDTIVIGKS"
FT   gene            complement(18976..19221)
FT                   /locus_tag="Sden_0013"
FT   CDS_pept        complement(18976..19221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0013"
FT                   /product="SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53310"
FT                   /db_xref="GOA:Q12TB6"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TB6"
FT                   /protein_id="ABE53310.1"
FT                   /translation="MTDVFSQAQHQLDALGLRCPEPVMMVRKTVRKMADGETLLIIADD
FT                   PATTRDIPSFCEFMDHTLIASDTSKTPYQYLLKKGR"
FT   gene            complement(19738..20901)
FT                   /locus_tag="Sden_0014"
FT   CDS_pept        complement(19738..20901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0014"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53311"
FT                   /db_xref="GOA:Q12TB5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TB5"
FT                   /protein_id="ABE53311.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKALLIRNPQL
FT                   DPSLIEDVIWGCVQQTLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMDAIHQAARA
FT                   IMTGMGDTFIIGGVEHMGHVPMNHGVDFHPGLANRVAKASGMMGLTAEMLGKMHGISRE
FT                   QQDAFAVRSHQRAHAATVEGRFAKEIWAMEGHDANGALIKVMHDEVIRPETTMESLAGL
FT                   RPVFDPANGTVTAGTSSALSDGASAMLVMEESKARALGLPIRARIRSMAVAGCDAAIMG
FT                   YGPVPATQKALARAGLTVADLDVIELNEAFAAQSLPCVKDLGLQDVVEEKINLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEEKDATIGLATMCIGLGQGIATVFERV"
FT   gene            complement(20924..23152)
FT                   /locus_tag="Sden_0015"
FT   CDS_pept        complement(20924..23152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0015"
FT                   /product="short chain enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53312"
FT                   /db_xref="GOA:Q12TB4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TB4"
FT                   /protein_id="ABE53312.1"
FT                   /translation="MMADTAVKQATVYLCGSRFLAIRKQAMIYQSPTIQVELLEDNIAK
FT                   LCFNAPGSVNKFDRETLASLDAALDSIKQNASIQALVLTSAKSTFIVGADITEFLGLFK
FT                   QDDATLLTWVEQANAVFNKLEDLPFPTISAINGFALGGGCETILATDFRVADTNARIGL
FT                   PETKLGLIPGFGGTVRLPRVIGADNALEWITTGKEQRPDDALQVGAIDAVVEPENLLAA
FT                   ALQMLKDALAEKLDWQARRKRKQSPLALPKLEAMMSFTTAKGMVYAVAGKHYPAPMAAV
FT                   SVVEQAATLDRAGALKVENLAFIKLAKTEVATALIGIFLNDQFVKGKAKKAGKLAKDVN
FT                   SAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALELGLNEAAKILATQVARGRSTPEK
FT                   MAKVLNNITPSLDYAAIKHSDIVVEAVVEHPKVKATVLAEVEDYVAEDAIIASNTSTIS
FT                   INLLAKSLKKPERFCGMHFFNPVHKMPLVEIIRGEHSSEETIASVVAYASKMGKTPIVV
FT                   NDCPGFFVNRVLFPYFAGFNGLLADGADFAAVDKVMEKQFGWPMGPAYLLDVVGLDTGH
FT                   HAQAVMAEGFPDRMGKNGTDAIDIMFENKRLGQKNSKGFYAYSVDRRGKPKKDIDATSY
FT                   QLLGAAFGELKAFEADDIIARCMIPMIIETVRCLEEGIIASPAEGDMGLVYGLGFPPFR
FT                   GGVFRYIDTMGVANFVALADKYAHLGGLYQVTDAMRELAANNGSYYQA"
FT   gene            23301..24623
FT                   /locus_tag="Sden_0016"
FT   CDS_pept        23301..24623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0016"
FT                   /product="Xaa-Pro dipeptidase. Metallo peptidase. MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53313"
FT                   /db_xref="GOA:Q12TB3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TB3"
FT                   /protein_id="ABE53313.1"
FT                   /translation="MDQLAHHFSEHIVELNRRVAEIIAREKLSGLVIHSGQHHRQFLDD
FT                   MNYPFKVNPQFKAWVPVIDNPNCWLIVNGRDKPTLVFYRPVDFWHKVSDVPDAFWTEHV
FT                   DIKLLTKADRVAEFLPKDITNWAYLGEHLDVADVLGFTSRNPDAVMNYLHYHRASKTQY
FT                   ELECMRQANKIAVKGHQAAKNAFYNGGSEFEIQQQYLSSVGQTVNEVPYGNIVALNQNA
FT                   AILHYTALEHTKPAQRLSFLLDAGANFHGYASDITRTYAFEKNSFCDLISALNAVELAI
FT                   IDRIKPGVKYTDLHIETHHHIAQLLLDFNLATGDAAGLVDQGITNVFFPHGLGHMLGLQ
FT                   VHDMGGYLHDERGTHIPAPEAHPYLRCTRTLEANQVLTIEPGLYIIDSLLDELKQDSRK
FT                   QQINWDQVAHFRPFGGIRIEDNVIVHQDRNENMTREFGLID"
FT   gene            24620..25246
FT                   /locus_tag="Sden_0017"
FT   CDS_pept        24620..25246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0017"
FT                   /product="protein of unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53314"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TB2"
FT                   /protein_id="ABE53314.1"
FT                   /translation="MSQGLIEQYTVPSQTLVIEEEIKHSRFISLLFHCPDAEVMKQVLA
FT                   QAKIDYPGASHYCYAFIAGMPNNTVDMGSSDDGEPAGSAGRPMLASLQGVELGEIGAVV
FT                   VRYFGGTKLGVGGLVRAYSSGIKQGLSKLTTQVKFIRKAATLKCHYNQLADVEHVIHKY
FT                   QGVIVDRQFTETIELDFELALSHQDNFILELAAMSQGSLIPEFAV"
FT   gene            25312..26769
FT                   /locus_tag="Sden_0018"
FT   CDS_pept        25312..26769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0018"
FT                   /product="K+ transporter Trk"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53315"
FT                   /db_xref="GOA:Q12TB1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TB1"
FT                   /protein_id="ABE53315.1"
FT                   /translation="MQYKTIIRITGLLMGLFSITMLPPALIAVFYGDGGGTAFIKAFVV
FT                   SILLGLMLWYPNRHQKAELRTREGFLIVVLFWTVLGSIGALPFIFSKVPDLSWTDSFFE
FT                   SFSALTTTGATVIVGLDTLPKAVLFYRHLLQWMGGMGIIVLAVAILPLLGIGGMQLYKA
FT                   EVPGPVKDSKMTPRIAETAKALWYIYLLLTVSCATAFYFAGMSVFDAICHSFSTIAIGG
FT                   FSTHDASIGYFNSPMINTICAVFLLIAAVNFSLHFAAFSLRGINFKVYFKDTEFKALIA
FT                   IQLILTAICFVTLYSTGVYDSPEQTLDYAFFQVVSISTTAGFGTESFHTWPLFLPILLI
FT                   FSSFIGGCAGSTGGGMKVIRLILLLLQGSRELKRLVHPKAMYSIRIAGSALPDRIIDAV
FT                   WGFFSAYALVFVVCMLALMMMEMDAITAFSATAASLNNLGPGLGDVANNYASISDGAKW
FT                   VLVTAMLFGRLEVFTLLVLFTPTFWKN"
FT   sig_peptide     25312..25398
FT                   /locus_tag="Sden_0018"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.873) with cleavage site probability 0.862 at
FT                   residue 29"
FT   gene            26769..27296
FT                   /locus_tag="Sden_0019"
FT   CDS_pept        26769..27296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0019"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53316"
FT                   /db_xref="GOA:Q12TB0"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TB0"
FT                   /protein_id="ABE53316.1"
FT                   /translation="MTKTLLLYSTVDGQTLAICQRMQTVMTQAGEQVELLSLNDCSGDA
FT                   LTQVDRVLIGASIRYGKHRPELLSFTNTHQDLLNSKMNGFFTVNVVARKPEKNTPATNP
FT                   YMIKFLQLSAWQPKVLGVFAGKIAYPKYGPFDRFMIRFIMWMTKGPTDTKGTFEFTDWN
FT                   KVDEFAGSFVKQ"
FT   gene            complement(27301..27606)
FT                   /locus_tag="Sden_0020"
FT   CDS_pept        complement(27301..27606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0020"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53317"
FT                   /db_xref="GOA:Q12TA9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TA9"
FT                   /protein_id="ABE53317.1"
FT                   /translation="MQPEIDVDVMLNNAQTAAKWLKAIANPYRLMILCLLLDKELSVTE
FT                   LNETVPLSQSALSQHLAVLRTEDLVATRKSSQIVYYSLKNAEVTDIISILHRRYCS"
FT   gene            complement(27622..29031)
FT                   /locus_tag="Sden_0021"
FT   CDS_pept        complement(27622..29031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0021"
FT                   /product="TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53318"
FT                   /db_xref="GOA:Q12TA8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TA8"
FT                   /protein_id="ABE53318.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITLVDSDRDRLRILQDKFDL
FT                   RVVVGHGAHPSVLRDAGAEDADMLIAVTNSDECNMAACQIAYTLFGTPTKIARIRSEAY
FT                   LDIQDKLFINSEIKNSDAKPRGGFVIDELIAPEQLVTNYIQRLVEYPGALQVLQFAEGK
FT                   LSLVAVKAYYGGPLVGNALATLREHMPNIDTRVAAIFRQGRPIMPRGTTVIEADDEVFF
FT                   LADTRHIRAVMSEMQKLDGTYRNIMIAGGGNIGFGLAKKLQRNHSVKLIEHRQERAEAL
FT                   SEKLEKTTVFCGDASDQELLMEEHIDQIDVFIAVTNDDEANIMSALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SSTSKVIGKQIGEIKLPPGTTIGAVVRNDEVLMGHDRTVIEQGDHVILFLVNKKFISDV
FT                   EKLFQPSAFFF"
FT   gene            complement(29050..30336)
FT                   /locus_tag="Sden_0022"
FT   CDS_pept        complement(29050..30336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0022"
FT                   /product="sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53319"
FT                   /db_xref="GOA:Q12TA7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TA7"
FT                   /protein_id="ABE53319.1"
FT                   /translation="MMNLRALAAKAIFDVLEKGLSLSVALPLQQQHVQNGKDKALLAEL
FT                   CYGVMRQLPQLDKCVSDCLAKPFKGKQRILHQLLLVGCYQLYFTRIPSHAAVSETAEAC
FT                   RQLKFDGLVKVVNGVLRNIQRQEPELNTDSDTLKYNTPAWLIKRLQQAYPQDWQQVIEQ
FT                   SHERPPMWLRNNRLVQTRDAYLASLTNENIEASAGLSPDAILLESPTDVLQLPGFMSGS
FT                   ASVQDGAAQWAATLLAPQANEVVLDACAAPGGKTCHLLEIAPNISLTAVDFDLKRLERV
FT                   QQNLDRLKLTAQVIHGDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNSD
FT                   IDELATLQMQILDHCWQWLKPGGTLLYATCSILPEENSQQINAFLTRTADASLVAISEQ
FT                   KNPADIGWQILPGQDNMDGFYYARLVKAR"
FT   gene            complement(30333..31292)
FT                   /locus_tag="Sden_0023"
FT   CDS_pept        complement(30333..31292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0023"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53320"
FT                   /db_xref="GOA:Q12TA6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TA6"
FT                   /protein_id="ABE53320.1"
FT                   /translation="MKPLNIIFAGTPDFAARHLQALLDSEHNVIAVYSQPDRPAGRGKK
FT                   LSASPVKELALSHDIPVFQPASLRAVEAQAELATLNADIMVVVAYGLILPQIVLDTPRL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDLGLDTGDMLLKTSLPIEDADT
FT                   SASLYEKLAVQGPQALLEALDGLNAGKLKGEPQDPALANYAEKLSKEEARLDWNKSAKQ
FT                   LWQEIRAFNPWPVSYFEYQDSTIKVWQASYNPQPNSALAGSIIKADKHSIEVATAEGSL
FT                   QLEIIQLPNKKPLAVADILNSRADWFAQGLSLLPEASS"
FT   gene            complement(31299..31811)
FT                   /locus_tag="Sden_0024"
FT   CDS_pept        complement(31299..31811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0024"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53321"
FT                   /db_xref="GOA:Q12TA5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TA5"
FT                   /protein_id="ABE53321.1"
FT                   /translation="MPLLNVLRFPDERLRTIAVPVTDFGPQLQAQIDSMIETMYAEKGI
FT                   GLAASQVDFHQQLIVMDLQDDIERPKIFINPEIVAKSGEFSNEEGCLSVPGVYAKVDRA
FT                   EFVTLKALDRDGKPFTVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKTKLEKEA
FT                   RLEAKGN"
FT   gene            31937..33046
FT                   /locus_tag="Sden_0025"
FT   CDS_pept        31937..33046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0025"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53322"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TA4"
FT                   /protein_id="ABE53322.1"
FT                   /translation="MDATMKRILLLLFLTLGVPQLQADTLVLKSGHPDTYVVKKGDTLW
FT                   DISGYFLNDPWRWPTLWGVNPHIANPHLIYPGDQLTLVFIDGQPRLVRNKTLLKKSVEG
FT                   RVKSKNAAIPAVALSLIQPYLAQNRIVEKAWLEALPMVLGGESPSKHHIVGDIVYVDTN
FT                   MPLGEKVAIYVSGREFFQASTNESLGQEIILSASGRVVESGEISKVKLLTNLQETKVGF
FT                   RVAPVEDEALMSALFMPKAAQLAEPTEVLAIEKDIREVGKLDVVYLDRGKVDGVEPGHV
FT                   FAIYRDGERVVIGKDGLPVREIDRSSYDNLVAKFSDDRVYKVPDVFNGNIMVFKVFDKT
FT                   SMALIMSNAHPVRVKDKLMTPDPKALRSF"
FT   sig_peptide     31937..32008
FT                   /locus_tag="Sden_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            33058..34146
FT                   /locus_tag="Sden_0026"
FT   CDS_pept        33058..34146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0026"
FT                   /product="DNA processing protein DprA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53323"
FT                   /db_xref="GOA:Q12TA3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TA3"
FT                   /protein_id="ABE53323.1"
FT                   /translation="MVDWLIVAAVSGLGPTRIQQLLSHMDVGELRQRLEHEKHSLPLPS
FT                   QTLATLHVNFPKVEQALAWLASADNHHILTLSDDQYPTLLTQISDPPSVLFIKGDIHKL
FT                   LLPSLAIVGSRNASPAGLEIAHTLAGQLAYQGLAITSGMATGIDSAAHKGALAQGGTTN
FT                   AVLGTGIEQIYPKRHLDLYHQIQQSGCVLSEYWPDVKAFAANFPRRNRIVSGLSVGTLV
FT                   VEACRKSGSLISARLAMEQNREVFAVPGSVIGGYHQGCHDLIKNGAKLVESAADIMEEL
FT                   VSLIDFHLEDVCSRHHIQADNNCNLPFPPLLASVGYETTSIDAVVEHSGKTIDLVLVQM
FT                   LELELQGWVAAVPGGYVRLKRS"
FT   gene            34149..34622
FT                   /locus_tag="Sden_0027"
FT   CDS_pept        34149..34622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0027"
FT                   /product="protein of unknown function DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53324"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TA2"
FT                   /protein_id="ABE53324.1"
FT                   /translation="MFDILMYLFENYVHSEIELLVDEDELTKELTRAGFHQADILKALS
FT                   WLERLADLQESDKPYLCNHAQQSFRIYTKDEMAKLDVESRGFLLFLEQIQVLSVETREM
FT                   VIDRVMELDEASLILDDLKWVILMVLFNVPGNESAYEQMEDLIFEQPEGRLHS"
FT   gene            34705..35268
FT                   /locus_tag="Sden_0028"
FT   CDS_pept        34705..35268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0028"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53325"
FT                   /db_xref="GOA:Q12TA1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q12TA1"
FT                   /protein_id="ABE53325.1"
FT                   /translation="MSKIDQQLFNAHEHALEKEYEQCPKCGCELSIRHSKHGGFVGCNN
FT                   YPSCDYTRPLVQHEAIDTQLIAGSQCPKCGHELAVKSGRFGIFIGCSHYPECNHIEKTD
FT                   HSVAKAPIECPSCHKGQLESRTSRFGKTFFACNHYPKCKFIVNYPPHDEACPDCGFGIL
FT                   VERKGAAGLRLECPQKACKYKRPI"
FT   gene            35377..35943
FT                   /locus_tag="Sden_0029"
FT   CDS_pept        35377..35943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0029"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53326"
FT                   /db_xref="GOA:Q12TA0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12TA0"
FT                   /protein_id="ABE53326.1"
FT                   /translation="MLQLSSTQVTPVIAQGGVIAYPTEAVYGLGCDPDNDQAIEKLLAV
FT                   KQRPWQKGLILVASSFEQLLPYVDVAQLTQAQLDFAHSKWPGPFTFVMPVKSHVSNKLR
FT                   GEFDSIAVRVSAHPIVRELCDSLNKPLVSTSANLAGQDPVLTSRQILTDFADKIDALVL
FT                   GDLGQQAQPSTIIDARSGLVLRNGQ"
FT   gene            35954..36871
FT                   /locus_tag="Sden_0030"
FT   CDS_pept        35954..36871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0030"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53327"
FT                   /db_xref="GOA:Q12T99"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T99"
FT                   /protein_id="ABE53327.1"
FT                   /translation="MTGPDTHAVKQFLLALQTNICAELEQLDGEASFKAESWQRAEGGG
FT                   GTSRVLTQGKLFEQAGVNFSHVKGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYI
FT                   PTTHANVRFFIASKEGADPVWWFGGGFDLTPYYPFKEDVLSWHQTAADLCAPFGEEVYP
FT                   KYKKWCDDYFFLPHRNETRGVGGLFFDDLNQAGFEQSFAFMRAVGEGFIQAYAPIVERR
FT                   KALSFGEHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWEYGFT
FT                   PAAGSVEAELYEVYLKPQDWLQQA"
FT   gene            complement(36879..37349)
FT                   /locus_tag="Sden_0031"
FT   CDS_pept        complement(36879..37349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0031"
FT                   /product="globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53328"
FT                   /db_xref="GOA:Q12T98"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T98"
FT                   /protein_id="ABE53328.1"
FT                   /translation="MLAIETPQMKTEMNWLKKVFSNPKVDDDRDVSQSNAYDLIGGDKV
FT                   IKAIAHEFYQQMQTREDTQALLAIHKAPIAESEQKLYEFLSGWLGGPQLYQRKHGNPAL
FT                   RARHMPFAIDESMRDQWLTCMQAAIETHIKKPEHRQAIIQAISTLADHMRNQ"
FT   gene            37525..38919
FT                   /locus_tag="Sden_0032"
FT   CDS_pept        37525..38919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0032"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53329"
FT                   /db_xref="GOA:Q12T97"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T97"
FT                   /protein_id="ABE53329.1"
FT                   /translation="MAGSVPSLVFVAVSAAIASCTLVACGPVQQAPKVTINKNPYPSTY
FT                   QAMPSDTLLLKNATVLTATGQKLENTDVLVVEGQITAIGTQLVATDALQVDASGKWLTP
FT                   GIIDVHSHLGVYPSPGVESHNDGNEMTAPVTAEVWAEHSVWPQDPGFNRAREGGVTTMQ
FT                   ILPGSANLIGGRGVTLKNVPTQTMQAMKFPAAPYGLKMACGENPKSLYGSRETLPMTRM
FT                   GNMAGYRQAFIEATEYKRAWDRYETDYNLGKNPQAPKRDLMKDTLVGVLDGDILIHNHC
FT                   YKAEEMAMMIDLGKEFNYHSGTFHHAIEAYKIADLLAQNQNCAAMWPDWWGFKMEAYDM
FT                   VLENVAMVDAVKNSCAIVHSDSAVTIQRLNQEAAKILYRANEQGFKLKEEDAIAWITIN
FT                   AAKSLGINAKTGSIEVGKNADLVLWDNNPFSVYALAEQVFIDGAKVYDRKDPAYQAQSD
FT                   FMLGQE"
FT   sig_peptide     37525..37617
FT                   /locus_tag="Sden_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.492 at
FT                   residue 31"
FT   gene            38937..40229
FT                   /locus_tag="Sden_0033"
FT   CDS_pept        38937..40229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0033"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53330"
FT                   /db_xref="GOA:Q12T96"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T96"
FT                   /protein_id="ABE53330.1"
FT                   /translation="MKTNKRLALSIACALLFTGSLSAQTLAIKNATVHTATAQGVLTGA
FT                   TVLIEDNKIIKINPKEYQADAEFDAEGKILTPGFIGSMNPLGLVEIGMVGSANDSADKK
FT                   ASINFDPSLGFNPKASTIAFARKGGVTTNLVVSSASESIFAGQGFVVSLSGEWDSMISA
FT                   QGPLVVNLGAKDEGSRAMSLQELAEQLDDAQKAQIKANNKASAKHKKDDSDEDEPSRDQ
FT                   LVLIELLKGNKTLIAEAHRGSDILALLKLKQQYQLKLVISGAADAVLVAQQLVDAQVPV
FT                   IINAMDNLPDSFDSLNNAMNNAAKLNQAGVKIILAIPGDSHGLYGLRFTAGNAVANGLP
FT                   AEAALKALTANVADVFQLNSGRIEVGKDANLVLWSGDPFEYSTRVEKLWIDGKEQQLES
FT                   RQDKLRDRYMSQSILPKAYNQGGAARVSREP"
FT   sig_peptide     38937..39008
FT                   /locus_tag="Sden_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 24"
FT   gene            40277..41098
FT                   /locus_tag="Sden_0034"
FT   CDS_pept        40277..41098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0034"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53331"
FT                   /db_xref="GOA:Q12T95"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T95"
FT                   /protein_id="ABE53331.1"
FT                   /translation="MTDKYAVFGNPIAQSKSPMIHTEFAKQTQQNMSYSAVLAPVEGFA
FT                   ASIKSFFASGGRGANVTAPFKEQAFSLCDELSELAQLAGAVNTLVRLEDGRLRGDNTDG
FT                   LGLVADIERRLTSLKDKRVLLVGAGGAARGCILPLLQAGVAQLDITNRTHDKALQLAQL
FT                   FSRYGNIKALTLTELASGYDVIINSSSAGLTGQLISLPSTIIDGTTYCYDMSYGSDTTL
FT                   FNQWALSAGACHCCDGLGMLVGQAAQSFYLWRNVHPDATTVMQQLRDALGR"
FT   gene            41134..41400
FT                   /locus_tag="Sden_0035"
FT   CDS_pept        41134..41400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53332"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T94"
FT                   /protein_id="ABE53332.1"
FT                   /translation="MNQSVIFTDLIDVTDAGVSFYAQLQGQNITCCISFSQLGVLAQEV
FT                   NCHAANAKVLFEQYRFDIEDWAESLIAQEAFNEQGAILLTSKQ"
FT   gene            complement(41465..42019)
FT                   /locus_tag="Sden_0036"
FT   CDS_pept        complement(41465..42019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0036"
FT                   /product="carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53333"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T93"
FT                   /protein_id="ABE53333.1"
FT                   /translation="MSSHLRTYQGICPTLAEGTYVDSAAILVGDIHLDVDSSVWPLVAA
FT                   RGDVNHIRIGKRSNVQDGCILHVTRKSAAKPDGHPLIIGDDVTIGHKAMLHGCQLGHRI
FT                   LIGMGAIILDGAVIEDDVILGAGSLVPPNKVLQSGYLYVGSPCKQSRPLTAAELAFLPQ
FT                   SAENYVVLKNEYLADLASRSD"
FT   gene            42596..44130
FT                   /locus_tag="Sden_R0001"
FT   rRNA            42596..44130
FT                   /locus_tag="Sden_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            44667..47571
FT                   /locus_tag="Sden_R0002"
FT   rRNA            44667..47571
FT                   /locus_tag="Sden_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            47825..47940
FT                   /locus_tag="Sden_R0003"
FT   rRNA            47825..47940
FT                   /locus_tag="Sden_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            48640..49581
FT                   /locus_tag="Sden_0037"
FT   CDS_pept        48640..49581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0037"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53334"
FT                   /db_xref="GOA:Q12T92"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T92"
FT                   /protein_id="ABE53334.1"
FT                   /translation="MSYQQLTEGRRYQISVLLDQGISIALIAKAINCHRATVYRELKRC
FT                   HALQGYCPDSAQASACKMRRHSAKYTIPDTRINFVRFLLQHDWSPEQISRVLSGMNQAV
FT                   SHEWIYRFVARNKRQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRER
FT                   FGDWEIDTVLGKHGTGSIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHT
FT                   ITADNGREFAHHEVIANALDTTFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSD
FT                   AIILFAQNRINYRPKKCLKFKQPTVVFKQLAA"
FT   gene            complement(50191..51132)
FT                   /locus_tag="Sden_0038"
FT   CDS_pept        complement(50191..51132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0038"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53335"
FT                   /db_xref="GOA:Q12LY4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q12LY4"
FT                   /protein_id="ABE53335.1"
FT                   /translation="MSYQQLTEGRRYQISVLLDQGISIALIAKAINCHRATVYRELKRC
FT                   HALQGYCPDSAQASACKMRRHSAKYTIPDTRINFVRFLLQHDWSPEQISRVLSGMNQAV
FT                   SHEWIYRFVARNKRQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRER
FT                   FGDWEIDTVLGKHGTGSIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHT
FT                   ITADNGREFAHHEVIANALDTTFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSD
FT                   AIILFAQNRINYRPKKCLKFKQPAVVFKQLAA"
FT   gene            51134..53167
FT                   /locus_tag="Sden_0039"
FT   CDS_pept        51134..53167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53336"
FT                   /db_xref="GOA:Q12T90"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T90"
FT                   /protein_id="ABE53336.1"
FT                   /translation="MILFFLWRDKAYHFQQLASSTPQLRVSQLLSEFGLKVILPYTRRV
FT                   IVNINVKIFVLIVMLCISMYTPSTTAQAGKYNANAVDDLYNFYAESRGVNWKNTDKYKG
FT                   SWHANGIKEHYQNSLYKYSGPTSTYTAKHAPLAVEKGKFTYFIINGQQEEYPYTPRQAA
FT                   ASYNTSHKISPISMMVGKYDNVTGTLYPPTTVHVKSTTDSHDNASINVDSDGFLYVFVS
FT                   GRSGVRGGLIYKSNSANSIESFKLVYSGKHSIETLDLDCDPNYAPNGWELCRNEYRGFT
FT                   YPQAWWTGNKFVLLHTIYLPLTYDDPAANPSYMRATYISTVTPTSGGVTVSSPSKLVAV
FT                   KGDYTKGHYSISKEKNGTIGLAFNLHVDDETTWKGKAVAPHDSRTNLYFMYSKNGNDWF
FT                   NIKGEEVASGMLDRGTSNRGITKPSQLSSIAVKEYHNPVTGETNETTWCDDRHAVLGKS
FT                   SPSKYVCRRVYLKDIDFTIDAQGKPNRVEILYVANRSVEYSTINNVSKEFGPYPSPEIA
FT                   ENDIYLARAFYNKDNALGWQTERVKDASGKDVVDHNYSSGTLTIVDGASYIITPASQER
FT                   DGYAGQRQVKVLKNTTGAKGSWNEVYSKYSVPLTAGKTANYVRSVHNSTSKFRVLWSEG
FT                   LADVDADGGEEVKVYLGDLTNKKLLLPNTGTLPINGKYVPFN"
FT   gene            53406..54374
FT                   /locus_tag="Sden_0040"
FT   CDS_pept        53406..54374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53337"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T89"
FT                   /protein_id="ABE53337.1"
FT                   /translation="MNNMKRSILPFALLAMIACSFSAVSAVNNQPKYNTTIVDSDYILE
FT                   MSKYQDYRGSLKVSDDHLNSNVYRTHQKLLKSFTDLRALKSQLEPEIKRLFDGTGLHYR
FT                   WFNFDVTGPIEVKLSGTASGAIKLELSKFSLRGQVKAEKSWYLNVYGTLTMNNAYASGE
FT                   IDLATGKVKNLTLHSKFNFDFDSTIKYLMPTSNFFITELGNYLIDIISEKMIASYDGYQ
FT                   TMYSLDKVVPAYKYVYQGIDIGWELRQQLLGMINGEFIKITMKELALAPSTRPYACYEP
FT                   GNVSWNSNFAEINISNKAFFKLSRTDVQKCEWNGSGGHTDY"
FT   sig_peptide     53406..53483
FT                   /locus_tag="Sden_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.682 at
FT                   residue 26"
FT   gene            54704..54952
FT                   /locus_tag="Sden_0041"
FT   CDS_pept        54704..54952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0041"
FT                   /product="export protein FliQ, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53338"
FT                   /db_xref="GOA:Q12T88"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T88"
FT                   /protein_id="ABE53338.1"
FT                   /translation="MLGYLSEFFWVTSKLAMPILATALVVGLLISIFQVVTQIQEMTLT
FT                   FVPKLIVVLIVVGMLSGWLLETIQTYAITTISKIAEF"
FT   gene            54915..55700
FT                   /locus_tag="Sden_0042"
FT   CDS_pept        54915..55700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0042"
FT                   /product="type III secretion system inner membrane R
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53339"
FT                   /db_xref="GOA:Q12T87"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T87"
FT                   /protein_id="ABE53339.1"
FT                   /translation="MPLRLLAKLLSFRDMEQYLKVLGLFYCRVGIVFWLPLVGPMSRIP
FT                   TSIRFIIVNVIVIALFSLQGAPAVIEVDLNTRSYLTLLAIEFITGITFSLILAVPAVVL
FT                   LFFGRAIDMQIGLGASGIFNPTSQTQDSLLGVLFSFAALTLFWSLGLHLDVLKILIESI
FT                   KVLPLGQTRNVEAMVFIEYFSTAFVLGLILFAPVIIMLFIVDICSGIISKSMPQMSIYF
FT                   VIMPLKIMIGFIVLTITLTNLASHFEMLVRFPVKFLVGL"
FT   gene            55703..56761
FT                   /locus_tag="Sden_0043"
FT   CDS_pept        55703..56761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0043"
FT                   /product="type III secretion exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53340"
FT                   /db_xref="GOA:Q12T86"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T86"
FT                   /protein_id="ABE53340.1"
FT                   /translation="MSDEHKSEQASQYKLNEARKRGQLAKSMELNAWVLVLISLAYFYL
FT                   FSESLAKELMSVISRYLQILGSVDIRNNFMLIAFDIFYPLAVLLVPFFSILVVASIVIN
FT                   VLLNGFVFSFEPLSPKFEKLNPVKGLKKIFSKKNLFEFIKQTIKLFLVALCGYLLFYGV
FT                   VERLIIASQSHVSSLLGMALSQETLRLSFYLLLTIFPLIALDVLFTRWDFKKQMMMSHR
FT                   EVREEYKKKEGDPQIKSKRKEVQKELAKKLIALGKVKEADVIINNPTHISVALKFDPLT
FT                   MNSPIVVASGSGVLGKFIRRIAVKHSLLQVTNISLARRLYKQLAIGQPLPAEYFDELAP
FT                   IYRKILGMDSKK"
FT   gene            56758..58800
FT                   /locus_tag="Sden_0044"
FT   CDS_pept        56758..58800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0044"
FT                   /product="type III secretion FHIPEP"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53341"
FT                   /db_xref="GOA:Q12T85"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T85"
FT                   /protein_id="ABE53341.1"
FT                   /translation="MIDKLRDYGLRGDVFFAVGVIAILMLLFVPIPATVLDVLIILNIS
FT                   FALLILLLTFYSERPLDFSTLPSVLLLATLFRLGLNIASTRLILTDGNAGKVISAVGSY
FT                   VVAGNYVIGLVIFFILVVVQFLVVTNGAQRVAEVTARFTLDSMPGKQMSIDADLNMGII
FT                   DEKQAQERRAYIEKEANFYGAMDGATKFVKGDAIASIIIILINIIGGLAIGVAQAGLPW
FT                   QQALHIYTLQTVGDGIVTQIPSLIIAVGTGIIITRAATQGNLADQLFGQIVTHPFTLTL
FT                   VAVVISSAAFLPGLPSLTLILVGITFALFGYFAHKKKQLKLIEKTFREFENTKKTSTQE
FT                   SLLQVAFSSQIWPQILAEETEIQRQFSRFKSEFESKYGLFLPELLLKAESVLKADEYSI
FT                   RLSNIEFASGVLHPDKMMVIDPQNKLDKKMGLAAVEPAYGLNALWVDADKAKDIKQGGM
FT                   TVVEPISVLMTHITEFVKSHSAEFVTRQFVDQLVAEQREINEVLVSEVIPTQLAIADVQ
FT                   QIFTHLVQEKVCLHNANHIFEVLADKARHEKDVQLLTEFVRQRLRNQLTSLLLDNDRTL
FT                   NIISIAPLLERALLNGAANVITKGLQISPTDLDSLVKQAVLFVEKAISLGAEPVLLVNP
FT                   TIRRPLWQLLNRTVPLLHVISVNEVPHHIKLNSLGVIQAYNQQVA"
FT   gene            58803..59450
FT                   /locus_tag="Sden_0045"
FT   CDS_pept        58803..59450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0045"
FT                   /product="Flagellar basal body rod protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53342"
FT                   /db_xref="GOA:Q12T84"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T84"
FT                   /protein_id="ABE53342.1"
FT                   /translation="MIEAVITEGINTQLQSLATTSNNVANANTPGYLRQTSFTQVLDAQ
FT                   IQTQTQVSSKQLSGAIKQTGNVYDFAVLGKSLFVVELLGELRLTQDGRFHLNEAGDLVH
FT                   ISGAMAMTSEGPLAANTETDQIAARLWTVSTSESYTNLQPAEMGLYLANWDDWKTNDDS
FT                   KVLAQALNYTEHNATADVLEMMRIQRSVESLQKAYQTYDAAIGYGISELGRR"
FT   gene            59453..60214
FT                   /locus_tag="Sden_0046"
FT   CDS_pept        59453..60214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0046"
FT                   /product="protein of unknown function DUF1078-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53343"
FT                   /db_xref="GOA:Q12T83"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T83"
FT                   /protein_id="ABE53343.1"
FT                   /translation="MIDALYIAESGLDAKQKQLDAIAHNIANVSTPGYKTSQMSFMTVV
FT                   QEDRDNSGQIVSSQGLGVMAQQSPLDMSVGKMEQTGRPLDVAINGAGFLEVEQGNGKLL
FT                   YSRGGRLITDAQGYLSTENGLRLTSMLQIPPDAEDVRIATDGMLSAKLPGNEVIEIGQV
FT                   QLVNFVDMSAIKAVGNNLFEVDQEALNTAYYGSVGESGMGVLQQGMLESSNVSMNQEMM
FT                   NMMMAQRSYQLNARLVQVSDQILETLNNLRR"
FT   gene            60215..61072
FT                   /locus_tag="Sden_0047"
FT   CDS_pept        60215..61072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0047"
FT                   /product="Flageller protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53344"
FT                   /db_xref="GOA:Q12T82"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T82"
FT                   /protein_id="ABE53344.1"
FT                   /translation="MRLIFLFFILLFHSQTQAVERTVRGYTPLMLSELIPTLEGQDRRV
FT                   LSEPIKQWVRLDEYLTPEELTRYSVPKNTTVWIDKCEQADKKILADNVRAWLLAQPWSK
FT                   GLEVTQVSLADKRICREWLEVSRFSLLNSQYINSALVLINQSEPSQVLALELTAKYRTW
FT                   RASVPLKAGSPLYQSQLTQSWEPLVNSVNLVDLTLDFELDWKARRPIRTEQKISRGMLL
FT                   QASTVEVGDEVMIVLFNGSLTIDTTGRALERGYLGEQVFILVDGAKAPVKGVIVQKGVV
FT                   KIGT"
FT   sig_peptide     60215..60271
FT                   /locus_tag="Sden_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.969 at
FT                   residue 19"
FT   gene            61062..61625
FT                   /locus_tag="Sden_0048"
FT   CDS_pept        61062..61625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0048"
FT                   /product="flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53345"
FT                   /db_xref="GOA:Q12T81"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T81"
FT                   /protein_id="ABE53345.1"
FT                   /translation="MVPRILLLLLFCFTCSATDLVEIDKLRALTADKRAVGIGDVVTLL
FT                   VFEDAKAGSSANLKEQGEFEMSAGARRSDLNWQYGLGGMSSNKGDAATQRNGFIKAHVT
FT                   VLVQGVDDYGLFVVQGIQKLQINGEEQVISVSGKLRKDDIAANNTALSSRLLDASISFT
FT                   GQGTVSTGHDSNLFSRLFRWFGIL"
FT   sig_peptide     61062..61115
FT                   /locus_tag="Sden_0048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.887 at
FT                   residue 18"
FT   gene            61625..62740
FT                   /locus_tag="Sden_0049"
FT   CDS_pept        61625..62740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0049"
FT                   /product="flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53346"
FT                   /db_xref="GOA:Q12T80"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T80"
FT                   /protein_id="ABE53346.1"
FT                   /translation="MINRIKLVLTVLLVLCSVPALSAVSQVTVKDVARINGVRDTALVG
FT                   YGLVTGLAGSGDSARFSSTSQSLKSVLRSFNVNIEDKEVQSRNVAAVIVTASIPAFAEI
FT                   GDKLDVQVSSLGDARSLAGGTLLLSPLKAPNDEVYALAQGQITVGGYRFEQDQNLVAKN
FT                   HATVGSIIRGATTERSVVANIFAEDGSVSLILNTPDFTMLDNITTALRYEFPSLDIRPA
FT                   HAGKLDIHGRDLSFSHLAKIEQVSINVAQSARIVVNERSGIIVSGSDIPVSSVVISHGN
FT                   INLKISSSPRVSQPYNVVFGDQSNIKTVTVRETEIEVNEQQQAVYINKDTTTIAEVVSS
FT                   LQKLNIPTRDMISILEGLKRSGALHAEIVIQ"
FT   sig_peptide     61625..61693
FT                   /locus_tag="Sden_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.806 at
FT                   residue 23"
FT   gene            62751..63086
FT                   /locus_tag="Sden_0050"
FT   CDS_pept        62751..63086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53347"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T79"
FT                   /protein_id="ABE53347.1"
FT                   /translation="MTVNQIVFDAMKVAKAQHHHTAEQIAQYNNPQVEHLERVNFERVL
FT                   QDSLNLDRQNINNLVVNHSELVSRDNISLDQLTAEALDASGKYKVLTEMLNRRFGMMSL
FT                   AVSGQEK"
FT   gene            63086..63469
FT                   /locus_tag="Sden_0051"
FT   CDS_pept        63086..63469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0051"
FT                   /product="putative flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53348"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T78"
FT                   /protein_id="ABE53348.1"
FT                   /translation="MAELDVRAVAQTGMAFERNRIEAASLNIARANVVSSTAAQVEPLF
FT                   MAALSGEELQPGNVKLTGYMKSKAIYQPAHPLADKQGFIYMPDIDLAHEMVTLSSAKRA
FT                   YEANIKVYNSYKEMSAKALEIGK"
FT   gene            63472..63762
FT                   /locus_tag="Sden_0052"
FT   CDS_pept        63472..63762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0052"
FT                   /product="flagellar hook-basal body complex protein (FliE)"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53349"
FT                   /db_xref="GOA:Q12T77"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T77"
FT                   /protein_id="ABE53349.1"
FT                   /translation="MEIEAIRALEVTGNIPLAPSQLPEVSFVEMLGDGVHKVSNDMNVA
FT                   NELVEKFARGEPIAVDEVMVAMEQAQLSLKLAVEVKNKLTAAYQELFRMQV"
FT   gene            63778..65097
FT                   /locus_tag="Sden_0053"
FT   CDS_pept        63778..65097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0053"
FT                   /product="secretory protein YscJ/FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53350"
FT                   /db_xref="GOA:Q12T76"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T76"
FT                   /protein_id="ABE53350.1"
FT                   /translation="MSSMEKITKKMRFFIAGISLMLLTLITLWWVIQDSKQVLFSGLSQ
FT                   ATLTEYTAKLEASGIGYQVEGTSIFVASSDSNQARVVAMEDSIQSNNVTGFELYENSDL
FT                   GATERAQHANYLRALQGEIERTLTGFNYIKKARVHLTLPQKRLFMSQNQLTKASVTLFT
FT                   VDHYQPRTIDIEAIKQLVVSAVEDLTIDQVVVIDGAGQWGVFEPQGDLSSPNLALRRST
FT                   ESYLEQKVLQVLVAYFSASSISAAVAVELNTDTVKIHETKAIKGDGSQGLISSETKFEE
FT                   THLSDDNKPGSKTLRNEVTYAHGALTQETEQAPGQILRLTAAVSINAEVAPELQAQISE
FT                   LIKNTIGFDSQRDDSISVSFFYLPKVEPLPVTPMAVEPVVVKTVESNTWWPFLLIGLGT
FT                   LFSLSTGMFYLANKRDSTEQQLLNQINYLFDNEQKAPENA"
FT   gene            65090..65404
FT                   /locus_tag="Sden_0054"
FT   CDS_pept        65090..65404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53351"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T75"
FT                   /protein_id="ABE53351.1"
FT                   /translation="MHEAACKASILLLSVNKAKRYRLLKKIDAARAAEIEQAFDKLTSL
FT                   GLTLDDFSRLKLPISVFSCESINEVNWLRSHVSDQDHLQTKAKVKTAFLQLLALDEGLR
FT                   "
FT   gene            65404..66117
FT                   /locus_tag="Sden_0055"
FT   CDS_pept        65404..66117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53352"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T74"
FT                   /protein_id="ABE53352.1"
FT                   /translation="MEKIQSFPWAIKPIHKVDSEHHAGKHPEKVNPAHIEVALKQMTPA
FT                   ERKSLLAPFIEDELALHRANLEARLTKEMNSKLDKQLQVEIELAVIKVKEDVEHKEAQR
FT                   KQKIEQLIAHIMSPEITGATSDAEQVLAFALVIVEKILAQKIASKPCYDSWVDSILGTT
FT                   RGHNLPILNINQQDYNLLLEFDLITKLSEKVSEIKIKDVAHFSFELESIYGQSGHDSLA
FT                   ILTQLQAWLSERACD"
FT   gene            66110..67420
FT                   /locus_tag="Sden_0056"
FT   CDS_pept        66110..67420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0056"
FT                   /product="ATPase FliI/YscN"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53353"
FT                   /db_xref="GOA:Q12T73"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T73"
FT                   /protein_id="ABE53353.1"
FT                   /translation="MISLTQLKQVTTKYHYGSVLRSEGLMLVASLPQAFVGELCTIRRA
FT                   DETLPDISAEVISISETQVKLMPFQSASGISFGDKLIGSGTSIRLPMGSGMLGHVVDAF
FT                   GQPLDEQELGVVQTQCVFLASHINPLTRAAIDEPLTTRIKALDSFIPIGKGQRVGILAG
FT                   SGVGKSTLLAMMSDSCAQQNAVIVIVLVGERGREVEEFVNGKMFKRLRSRAVLVAATAE
FT                   EMPVTRVLAVKYGLALAESLSAEGKEVIFVVDSLTRVAMAQREIGLAIGEPPTAKGYTP
FT                   SVFSLLQRIVERCGAFRHRASITALFSVLVETDDFDDPIVDTLRAVLDGHIVLDRALAE
FT                   QGHFPAIDVLRSVSRLTTNLFDAKKIKLSRAGRILLSEYKQKKMMIDLADAEGTLTGQF
FT                   QQLKKKHDLLNLWLQQDELSSKTTQELELQLMDIIEG"
FT   gene            67427..67855
FT                   /locus_tag="Sden_0057"
FT   CDS_pept        67427..67855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53354"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T72"
FT                   /protein_id="ABE53354.1"
FT                   /translation="MTLNQIWQLKKQQQHQRTHVELENLNADIDKNKRELGVLSVQEQS
FT                   LVRFEIQDHASLQLASINLAWLDRLAQEKSDLELTLAEFNLDKRAKEKLLSRNAQVIEK
FT                   VGELITLESKGGAIMRMKIKDKQVQASLCESLARRQND"
FT   gene            67848..68642
FT                   /locus_tag="Sden_0058"
FT   CDS_pept        67848..68642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53355"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T71"
FT                   /protein_id="ABE53355.1"
FT                   /translation="MIEFESIHQSIKLPNKALTEPNENEALFLSHLNGEAFDGTLNSKN
FT                   QLYQEGNKTSESVSPLTTDFLSLWKKSADIASSVISHGLYEEQMVLPQYGGNNHGANGA
FT                   NVIKQTPDWLAIGSYQVQTLNTLNTLNSAQEATSYQGEGFVFSHVHDANLAFQAVQAPM
FT                   LEIGSNNTLSKAVDSGSVRNVVFKLSDQYKMTEIASINAPLWKTAEQTQSRRVTFGEHL
FT                   GTRTMRVRDYFSTDAKLEYAEMLSYSNVDRLMINGYLQWERK"
FT   gene            68643..69050
FT                   /locus_tag="Sden_0059"
FT   CDS_pept        68643..69050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0059"
FT                   /product="flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53356"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T70"
FT                   /protein_id="ABE53356.1"
FT                   /translation="MDIQSIGGNSYATTNPQTNIKLDDFLQLFVAQLNYQDPLEPVNNS
FT                   EFLAQLAQFSSLEINRQSNDNSLSLLAIGSSDQALGLIGRSVEVNTQSGQAFIGDVTGV
FT                   NFTQQGPMLTVKGADDSLLTDIKLGQITVVK"
FT   gene            69065..70243
FT                   /locus_tag="Sden_0060"
FT   CDS_pept        69065..70243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0060"
FT                   /product="protein of unknown function DUF1078-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53357"
FT                   /db_xref="GOA:Q12T69"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T69"
FT                   /protein_id="ABE53357.1"
FT                   /translation="MLQAFYTGLSGLNSYSKNLDNVSNNIANMNTAGYRGMDSFYQALG
FT                   GDSDKPGLGAQISGLGYRFSVGDIRQTGNDFDLAITGTGFFALLDGEKVFYTRTGQFEF
FT                   DQNNVLVDKNTGFKVAGIDSNGQLSEINLLSYQAIKPTATTKLSLTGNLSPLDDVHQIS
FT                   SAKMINSLGEEVDLSIKFTNEKATFPNQWKVEILDDKGIVLHSDSVKFGPDGTPEVGSG
FT                   SFIFNLADSSGNTTPIDITVGTIGDFSAVTQTSATGVDSNVTLHAVDGKGVGQLVKRSF
FT                   DPQGRVTLNYSNGDKVTPFTIAMVDFDDISTLSIESGTVFKASDLESRVLGKAGEGRFK
FT                   QLATSSIEMSNVDLSQEFADMLVIQRGYQASSRILNVANQMIEQLYENTRGR"
FT   gene            70243..70905
FT                   /locus_tag="Sden_0061"
FT   CDS_pept        70243..70905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53358"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T68"
FT                   /protein_id="ABE53358.1"
FT                   /translation="MVGVKLPNCWSELQRIDLETKVTKKVIAWLSEWLLQSADEVNWHW
FT                   NSTLFACAKQKVRMNELQWVELAHFAMTGECSHVQVTKKLSLLAEQMKNELQQLCEIQA
FT                   ADSEQCAAVLEIRLHSNLIVCIPIPIQCMPTQVVVPTEPISSGLIEKMIGDCHLSLQCH
FT                   LDSLPMTLEQIYSLKTGDRVRLKHRFDSEITLSDKSYHTNIKGFLASFMGHRSIVIK"
FT   gene            70914..71225
FT                   /locus_tag="Sden_0062"
FT   CDS_pept        70914..71225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0062"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53359"
FT                   /db_xref="GOA:Q12T67"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T67"
FT                   /protein_id="ABE53359.1"
FT                   /translation="MSEVASFELTEVVDLPRGKSVETPLDLAILEQTKIELNVNIGDVS
FT                   MSISELKELKENSIVKLAQKVDSEFELKWKDVVIAKGRLVAVDEYLALEITQVTSNEQ"
FT   gene            71500..72189
FT                   /locus_tag="Sden_0063"
FT   CDS_pept        71500..72189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0063"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53360"
FT                   /db_xref="GOA:Q12T66"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T66"
FT                   /protein_id="ABE53360.1"
FT                   /translation="MVATQTLNEWLPHLLDKPWLDSLAPELRIVLAVSSLTLIPVFVIA
FT                   MTAFTRIIIVLSLVRQALGLQQTPPNSVLIALSLFLTIFAMSGVFEQINNKALLPYANG
FT                   SIELSAAVSNGIEPLKGFMLSQTDEVHFIRVLDMAKVPVPQSSADVSLTHLVPAFMLSE
FT                   LTLAFKMAFLIFLPFLMIDLLVASCLMALGMIMVPPITVSLPLKIMVFVLIDGWSLITG
FT                   SLVQSFM"
FT   gene            72203..72757
FT                   /locus_tag="Sden_0064"
FT   CDS_pept        72203..72757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53361"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T65"
FT                   /protein_id="ABE53361.1"
FT                   /translation="MNTELISLMDEISSLPPAQVLEKLKNASSTVKLDPDWLFLVACYQ
FT                   VDNQELSEAKKSFFSLLDSNPDNEVARLQLACVHLSLGEFKHILYLLCPYLVWQIAPTC
FT                   ISSIAHALINFVQNDKKKMNSYLNEAKAFEEASELKSIIDVLSRFFVDAAASMGTVADN
FT                   EEELKHDTRSHLLSNLYSKKY"
FT   gene            complement(72832..73098)
FT                   /locus_tag="Sden_0065"
FT   CDS_pept        complement(72832..73098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53362"
FT                   /db_xref="GOA:Q12T64"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T64"
FT                   /protein_id="ABE53362.1"
FT                   /translation="MENDLFKLTLVVVIGVSVMASEMYKQYLRAKRRQPACDGQSHLNT
FT                   TSVDSQLKTELMAQNQALKARIEVLERLVTEDSYELKQQFKHL"
FT   gene            complement(73136..74272)
FT                   /locus_tag="Sden_0066"
FT   CDS_pept        complement(73136..74272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0066"
FT                   /product="transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53363"
FT                   /db_xref="GOA:Q12T63"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T63"
FT                   /protein_id="ABE53363.1"
FT                   /translation="MKNLILSMVRKELIDAGRDKRSVMAGLYYAIGTPIIMCGLFMVLI
FT                   TQLSSPDTLAIKIEQPQNAPDLVRYLEQAGISHSDGDDVKAISLIISDDYAEKMAKAQP
FT                   AVVTLIADKSNEKLQNSIRRVETKLQAYSGEMGSLRLIARGISPQVMRPLKIKVEDQAT
FT                   ADSKGGVILGIAIFTMIYSVFISGMNLAIDTSAGERERNSLALLLSHPITTRQLVMGKV
FT                   IAVTCFALLGLALILLVSKIAYPFVPWQELGFSVNISNSFMALMFVIGIPLAIMAASLQ
FT                   LFVSFMAKSFKEAQSYLTIVLFVPLALSMAASYNIAPDVLEWLPVSGQQQALMDFIKGR
FT                   DMSLLQLAVSSFTTLAISLGLIWGLEKSLKSEKVVFGL"
FT   gene            complement(74272..75006)
FT                   /locus_tag="Sden_0067"
FT   CDS_pept        complement(74272..75006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0067"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53364"
FT                   /db_xref="GOA:Q12T62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T62"
FT                   /protein_id="ABE53364.1"
FT                   /translation="MISVNNLSKKIGTVQALEQLSFSAENGQITGLLGPNGAGKTTCLR
FT                   TLFGLLKPDEGFCEIEGIDVAKNPIAAKQQLGLFPDPFGLYERLSPREYISYFAELSGM
FT                   SRPQAKAATSKVIAQLKLEDIADRRCKGFSQGQKMKTALAQAIVHQPKNIILDEPTRGL
FT                   DVMSTRLLRDILVELKNQGHCVLFSSHVMQEVAALCDKVIVMAQGKVVAVGSPDELCQQ
FT                   TGKDSLEDAFIALIGTDEGIAA"
FT   gene            complement(75009..76574)
FT                   /locus_tag="Sden_0068"
FT   CDS_pept        complement(75009..76574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0068"
FT                   /product="peptidase S33, prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53365"
FT                   /db_xref="GOA:Q12T61"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T61"
FT                   /protein_id="ABE53365.1"
FT                   /translation="MAIRNLAPAQGLVNMLHSSVPAIVTALTVLAVLTVAALAAPKANA
FT                   PDIKLGETHSCYLDDLDENLRCGAIQVPENPNKPEGRKIAIHYAILPAIKNGHEKQALL
FT                   AIAGGPGQSAIEHAAGFNRMLTKVRQNRDILLIDQRGTGQSNPLNCENIGDIFAFDDEQ
FT                   VDFSAETKDCLDKITADGTDVTQYGSVNALNDFEAVRRHLGYDKLHLYGISYGSRMAQL
FT                   YMRHFPEPLLTVTLDGVVPMQQSVLAIGDAIERAQSLLLTECDATLSCQQAFPNLTDDF
FT                   ARLDAKLAQGAIIEQSRDPLTNEVISFRLTRSKYLNSLRMAMYTPSLRALLPHTIHQGA
FT                   IGNYQPLLGLYGLTADSTGIALGMHSSVVCGEDLHRVTETMRQSAKDSYSSRTMLEGLE
FT                   AGCSVWQMPTEPEDFSQAIDSDIPTLLLSGELDPATPPSWGTLAQEKLSNSQHFVAPYA
FT                   THGVAYQSCANDLIAKLVSTGSVKEINGECLNKDVRRSFYLNANTVEPVTQVSSATDTS
FT                   KDEE"
FT   sig_peptide     complement(76455..76574)
FT                   /locus_tag="Sden_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.976 at
FT                   residue 40"
FT   gene            76662..77051
FT                   /locus_tag="Sden_0069"
FT   CDS_pept        76662..77051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0069"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53366"
FT                   /db_xref="GOA:Q12T60"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T60"
FT                   /protein_id="ABE53366.1"
FT                   /translation="MLELINVNPNSGEPIYRQLHEQIVRLIVGGQLQAEAVLPSVRQIA
FT                   EALAVNPMTVSRAIQGLVEQGWLERRRGQATRVAIRTQDDSNATHDLLAPQCQNLIDQA
FT                   TQLGLSLEDVQALLAAHWHQPDDRT"
FT   gene            77058..77900
FT                   /locus_tag="Sden_0070"
FT   CDS_pept        77058..77900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0070"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53367"
FT                   /db_xref="GOA:Q12T59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T59"
FT                   /protein_id="ABE53367.1"
FT                   /translation="MTQEQPILSIKGLLKSFDGKSVLNNLTMDLYPGMVVGLLGLNGAG
FT                   KTTLMHCALGILAMDAGEAHILADNAANLSLQTKAQIGFVPQQPFGYEGFTVGAALALH
FT                   RSFYPSWDLELEQDWLKRFNLTSKLQVQRLSVGQRQSLALIMAMAYRPKLLLLDEPVAS
FT                   LDPIARRKFMADLFDLALESGSAVLFSSHITSDLERVASHLALIKEGELLLFKEIDSLR
FT                   EEVKSLSLAENTPLPASLRVLQRQGNAVLVDNYQGQVIEGVKAVTSLNLEQLFVALHS"
FT   gene            77897..79213
FT                   /locus_tag="Sden_0071"
FT   CDS_pept        77897..79213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53368"
FT                   /db_xref="GOA:Q12T58"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T58"
FT                   /protein_id="ABE53368.1"
FT                   /translation="MNSLSHLATSAPKRNLLQGLWQFWFKDLGSVSFLVTGLLSLPVAL
FT                   AIGLSLEGEKALQVAALMLNMGIVSTSCAIAWQGLRLQASEWAVLVPHYREHIFSQMAL
FT                   IGFSFLGLGLACIYLLDAWQLLASLSLMLAASGTFIALCQKRPNAFNLSILLYLSGIVA
FT                   TDIAAFIPSTLLMVFNVLAGVYLCLSVKGIAWHADAKSVYLNSTETGWMWLPSFAQGKV
FT                   TQAIQKFFMPINFFIGPMFLMPLVLIPLTFLGLHWFGDADPQHSSLFVFIYLNSILCIL
FT                   LHWSRIMRWQGMQTLYLLPIFHGWQGFAQLMYRSQLKLLMLICVTFALVTAVTHSAQAS
FT                   LAAWLTPNLVNVSLCALSLGLGSLCRTVRQIALVFIGIAFGVVLISVCLKEFGYLLSTS
FT                   VDTVFYGYSYTLVASGIFSLLGLALLSWGSASFARVKIT"
FT   gene            79325..81118
FT                   /locus_tag="Sden_0072"
FT   CDS_pept        79325..81118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0072"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53369"
FT                   /db_xref="GOA:Q12T57"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T57"
FT                   /protein_id="ABE53369.1"
FT                   /translation="MSLAQYHLVQLLQQQSQQRADSIALEGFELAAPWDRVSWKAFDSI
FT                   SHQVAKAMIKFGLQAQDTAVILSQNCPQWTCADIGLLKARAIVVPVYPSSTQEQASFII
FT                   NDAGAKVLFVDDAEQYHMACKLQAVCPSVEYLVVFDANVPLLDTPNHLHFDSLITEDLS
FT                   AQDRALTERLQAANLDDLLTLIYTSGTTGDPKGVMLDYRNMASTIRQHDTCLNFNPGDT
FT                   SLAFLPLSHVFERSWSFFALCRGGRNVYLKDTMKIKEAIVAVRPHTLCVVPRFLEKVYS
FT                   AVQDKVSKAPKSRQRLFHWAMAAGQRQFEVNQGRAKTSAILSLQWVVANKLVFSKLQAV
FT                   LGGRLKFMPCGGAALDMTVGNFFHGINLPVLCGYGMTETNATVTMNTLNNRVPGSNGKP
FT                   LPETEVKLGAFDEIMVRGDAVMRGYYKRPDDTAATFEDGWLKTGDAGRFDEQGNLFITD
FT                   RIKELMKTSNGKYIAPQRVEGKVGSCPFIEQVAIIADGRNFVSALIVPSFEALEYWAKE
FT                   QGLVFDSLASLLERAEVLAHFEQRLIHLQHDLAAFEQIKKFSLLPEAFTIEAGLITPTL
FT                   KLRRKAIYQRYAPEITAMYAG"
FT   gene            81233..81640
FT                   /locus_tag="Sden_0073"
FT   CDS_pept        81233..81640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0073"
FT                   /product="thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53370"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T56"
FT                   /protein_id="ABE53370.1"
FT                   /translation="MQKTLLEMDISPRFNETDGLGHINNTVIPVWFEAAREPVFAIFNP
FT                   ELDLNKWNLIVAGFNVAFTSPTQYGQAVRIKTWISRIGNSSFEVAQQSWQGDKLTAEGK
FT                   TTLVHFDYANDKSQPIPTDIKQLLGLLSGQV"
FT   gene            complement(81743..82168)
FT                   /locus_tag="Sden_0074"
FT   CDS_pept        complement(81743..82168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0074"
FT                   /product="thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53371"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T55"
FT                   /protein_id="ABE53371.1"
FT                   /translation="MDKFLQQFPIVTEIPVAWGEMDALQHVNNVVYFRYFETARIDFFR
FT                   QINLLDDLQTTGIGPVISENSARYKRPVTFPDTLLVGVTISDIKSDRFMMHYQAFSKSQ
FT                   QAVTTLGASQVVMFNFKTGQKAQLSEQLLSALRKYDG"
FT   gene            82387..83451
FT                   /locus_tag="Sden_0075"
FT   CDS_pept        82387..83451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53372"
FT                   /db_xref="GOA:Q12T54"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T54"
FT                   /protein_id="ABE53372.1"
FT                   /translation="MLSLSSISLIPRAIKAKSEPVLGLANKLKQGFLNLSTAQKLYSLA
FT                   FVILCFGDQLGWVALLSVIAMGLEFWPLFERVWHSLAGKAVLLLFYAIIANFALSTSAA
FT                   IVNEVVGVSASHLNYTHNFALLLYIPAWFVVMTALVLLAMQIIIPFYLLLLLMLKPLGI
FT                   TAFRFTQHDRFRKSTAFVRLILAAIVLYHLFLLIDVEHVVDMPDGGIVEIAGVEVLNMN
FT                   ASPTRQLGDSLEAAAKDQVSDVLNLKTVETTETPILTAAAKKEVVKEELEQLNLERNYA
FT                   IVRGFYQQKVREMIAIFAFNLEADSRSRCQKAKDSSVVELNDYEILEITKDQEAKFGYH
FT                   FEVKKCVSVAFPLR"
FT   gene            complement(83458..86283)
FT                   /locus_tag="Sden_0076"
FT   CDS_pept        complement(83458..86283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0076"
FT                   /product="periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53373"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T53"
FT                   /protein_id="ABE53373.1"
FT                   /translation="MKNVKLAIALSILLALLATLTLTVTQGIAAKTTQTVAATSTELGV
FT                   QLNAVTLTDMPATHYLPLTKEERLWLDNNQPIRVGVDGNFPPYSFLDENNQPVGIAIDT
FT                   LELIGKKLDIEFVIDKQSSWRKVISNLDAKKIDVILTMVRTPEREVNYLFTSPIVYKSL
FT                   VIINNKDSSAIENRGDIASKTIALVKNYHYVSKILNEFPSVVPFYVDTMREALEAVEAK
FT                   KADAAITFFAGANFLQQKYLFSNLEFAAFYERNSANDAIAIRQDQPMLAAIMQKGLDVL
FT                   SADDKLKINEKWHANITLPTNHQVVIEIALVAGLLISLLLLWLVREKRHNRVLVSAQVD
FT                   TEDANRALNSLREKLEIIVSERTVQLKNSENRYRGLVESLQDEYIFYQHDIQGEIQYVS
FT                   PSITHILGHKALNFRGSYNKYLTSNKNNLAIPELILRCIKGEHVPPFEIEIMDIKGAYH
FT                   TFEVLERPMYNEQNECIGCEGIAHDITERKQHQRKLYRLSHFDKLTNLANRYLFTLSLG
FT                   QAITSAKALNQTFALLFLDLTRFKIINDNLGHSAGDKLLQQAALRLTEQLNSQDILARF
FT                   GGDKFCILLPESDEKQAEAVALTLIKILAQPFEVYEQSFILGCRIGISLFPTNGHDPET
FT                   LLKQADAALYVAKKRPAGFAFCSEEQAVYNQRRLKLEQGLRLALSKSSFDESFELSAVY
FT                   QSLNQLPDAGLAGFEALIRWVHPELGPISPMEFIPIAEETGLIFELSRWMLTKVCRQLK
FT                   EWHQLGFDFKRVSVNLSALDLININLAEEIINLIEEAGAEPRWLKIEITETALMAAPEQ
FT                   SISTLQQLVGNGIHVAIDDFGTGYSSLAYLKSLPATSLKIDQSFIRNIMTSIEDQAVVK
FT                   AVISMAHSLGKKVTAEGVETQEQLDFLITRHCDLAQGYLFAKPLIAQDCVKKYAANNNQ
FT                   NKIVTFKRSLK"
FT   sig_peptide     complement(86194..86283)
FT                   /locus_tag="Sden_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.359 at
FT                   residue 30"
FT   gene            complement(86552..87229)
FT                   /locus_tag="Sden_0077"
FT   CDS_pept        complement(86552..87229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0077"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53374"
FT                   /db_xref="GOA:Q12T52"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T52"
FT                   /protein_id="ABE53374.1"
FT                   /translation="MSIKAIVVDTAGTTTDLNFIQDVLFPYSHQVMASFLAQNQQQVLV
FT                   ESCINDVRDIALEPSATVARVAEILQIWITEDRKLAPLKTLQGLIWKQGYSSLAFQGQI
FT                   YPDFIEAISRYRQQGVAIYSFSSGSVEAQKLLFSHSEVGDLTPMFSGHFDMRMGNKLDK
FT                   QAYLNIHNTLGLPPKQILFVSDTQEELTAAQAAGMMTCLMSRGDAFAPTEHKQVGSFTA
FT                   LNI"
FT   gene            87451..87894
FT                   /locus_tag="Sden_0078"
FT   CDS_pept        87451..87894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0078"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53375"
FT                   /db_xref="GOA:Q12T51"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T51"
FT                   /protein_id="ABE53375.1"
FT                   /translation="MISKWAKRFFQMAELVGSWSKDPSTQVGAVITKHNRIVSVGFNGY
FT                   PHGISDSAETDDRDMKLLKTLHAEENAILFAKRDLDGCDIWVTHFPCPNCAAKIIQTGI
FT                   TGVFCPEQNADFLSRWGDKISISQEMFLQAGVKVTWLPLDELA"
FT   gene            87961..88437
FT                   /locus_tag="Sden_0079"
FT   CDS_pept        87961..88437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53376"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T50"
FT                   /protein_id="ABE53376.1"
FT                   /translation="MLKLKAPKDLIWRSQLFEGSYYMSQPALATIYAIEMFFDDIHKSV
FT                   EPESALGKQGPQAIYEYYQGLSQRYGFEVSAVNSLLSLAKSKADPKQALAVHEFCVAKY
FT                   PNNAHAHHGLATALAAVGQSSAAITELTLAMSLTTHPFYLNRWGQLLGEYKGTL"
FT   gene            88680..89165
FT                   /locus_tag="Sden_0080"
FT   CDS_pept        88680..89165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53377"
FT                   /db_xref="InterPro:IPR016596"
FT                   /db_xref="InterPro:IPR022548"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T49"
FT                   /protein_id="ABE53377.1"
FT                   /translation="MKNIYLALSLIAVSFFSGCASVPMASSEQDSALKQFQQPKNGNAG
FT                   LYIYRNSFVGQALKKNVYVNGQLLGETANKVYFYKELAPGNHSISTESEFSENDINLPV
FT                   EAGQLYFVEQHIKMGVFVGGASLEHVDNAKGMDNIKQCKLAKATDQVVYLKTPANKL"
FT   sig_peptide     88680..88757
FT                   /locus_tag="Sden_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.798 at
FT                   residue 26"
FT   gene            complement(89268..90512)
FT                   /locus_tag="Sden_0081"
FT   CDS_pept        complement(89268..90512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0081"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53378"
FT                   /db_xref="GOA:Q12T48"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T48"
FT                   /protein_id="ABE53378.1"
FT                   /translation="MSWDQVWIDINIATMDANIGEPYGAITQAAMAVKDGKIAWLGPRS
FT                   ELPEFDVLATPVYRGKGNWVTPGLIDAHTHLVFAGSRANEFELRLKGASYEEIARAGGG
FT                   IISTVKACREADEAELFELGRQRLNALAKEGVTTVEIKSGYGLDIETELKLLRVARELG
FT                   KHHHVDIKTTFLGAHAIPSEYKDAANSTERSDAYVDLVVNEMLPAVMAENLADAVDVFC
FT                   EGIAFNLAQTKRVFTAAKQAGLDIKLHAEQLSNIGGSQLAAQMGALSVDHIEYLDEAGV
FT                   KALSESGTCAVLLPGAFYFLRETKLPPIDLLRQYKVPMVVASDYNPGSSPICSSLLMLN
FT                   MACTLFRLTPEEALAGMTVNAAKALGIGDNVGHLAVGMQADFCLWNISSAAELAYSYGV
FT                   DRLIDVVKTGKLVHQ"
FT   gene            90669..91376
FT                   /locus_tag="Sden_0082"
FT   CDS_pept        90669..91376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0082"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53379"
FT                   /db_xref="GOA:Q12T47"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T47"
FT                   /protein_id="ABE53379.1"
FT                   /translation="MTAPIFAQIKQHIIANIENGAWQEDDKVPSENQLASQFSCSRMTA
FT                   RRAVTELVEQGILERSQGLGTFVSGLKSQSSLLTIRNIADEIKERGHGYSVQQLALTEI
FT                   AAAASIANALDLEVGSPVFYSVLVHCEQGLPLQLEQRFVNPKLVPDYLAQDFSLQTPHE
FT                   YLSKVAPLTEAKHTVEAISANSQFQQQLNIEASEPCLQVLRRTWSRQGVVSFSRLIHPG
FT                   SRFRLGGHLKFSK"
FT   gene            91505..93199
FT                   /locus_tag="Sden_0083"
FT   CDS_pept        91505..93199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0083"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53380"
FT                   /db_xref="GOA:Q12T46"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T46"
FT                   /protein_id="ABE53380.1"
FT                   /translation="MDTNNNRHDPSRRIIAPHGSKLSCKSWLTEAPMRMLMNNLHPDVA
FT                   ERPEDLVVYGGIGRAARDWQSYDKIIEVLQRLEDDETLLVQSGKPVGVFRTHADAPRVL
FT                   IANSNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIVQGTYETFVSVAKQHF
FT                   DGVAKGKWVLTGGLGGMGGAQPLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKANTLD
FT                   EALAMIDEANKAGKPVSVGLLANAADVFAELVERGITPDVVTDQTSAHDPLNGYLPQGW
FT                   SLAQAAAMRKSDEAAVVKAAKASMAVQVKAMLDLQAAGAATFDYGNNIRQMAQDVGLVN
FT                   AFDFPGFVPAYIRPLFCEGIGPFRWVALSGDPEDIYKTDAKVKELIPDDKHLHNWLDMA
FT                   RECIAFQGLPARICWVGLKDRARLAAAFNEMVKNGELSAPVVIGRDHLDSGSVASPNRE
FT                   TESMMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGVVIVCDGTDAAA
FT                   KRVERVLWNDPATGVMRHADAGYEIAKNCAREQGLDLPMLDVPKKGL"
FT   gene            93202..94734
FT                   /locus_tag="Sden_0084"
FT   CDS_pept        93202..94734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0084"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53381"
FT                   /db_xref="GOA:Q12T45"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T45"
FT                   /protein_id="ABE53381.1"
FT                   /translation="MMSFELVPGTLSLAQLRQISRNKVNLHLADSAIAEINQSAAIVQQ
FT                   VLSEGRTVYGINTGFGLLANTKIAPEDLQLLQRSIVLSHAAGFGQYMQDASVRLMMVLK
FT                   INSLSRGFSGIRLEVINFLIQLVNAGVYPCVPEKGSVGASGDLAPLAHMCLPLLGEGEM
FT                   SYEGQIISAKEGLEIAGLEPLELAAKEGLALLNGTQASTALALEGLFNAEDLFAASSVI
FT                   GSMSVEAAMGSRSPFDARIHAARGQKGQIDSAAVFRHLLGETSEISLSHVNCTKVQDPY
FT                   SLRCQPQVLGACLTQIRHAADVLGVEANGVTDNPLVFQDTGDIISGGNFHAEPVAMAAD
FT                   NLAIAIAELGSIAERRIALLIDSSLSHLPPFLVNNGGVNSGFMIAQVTAAALASENKTY
FT                   AHPASVDSLPTSANQEDHVSMATFAARRLRDMSENTRGVLAIELLAAAQGLDFRAPLAP
FT                   SEAVASAKAELRELVTFYDKDRFFAPDIESAAELLYSASFNAYLPAGLMPSF"
FT   gene            complement(94806..95330)
FT                   /locus_tag="Sden_0085"
FT   CDS_pept        complement(94806..95330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53382"
FT                   /db_xref="InterPro:IPR021501"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T44"
FT                   /protein_id="ABE53382.1"
FT                   /translation="MTTLLRLGAASLLALAMTAQAADIGKFTLENGAEVLLKDDFTWEY
FT                   IVVEQASQTLAPIVLAQPELLTTTAKDGIKISLASSTWDGDRLGLTLNLSSSSSDHIVF
FT                   VEVAAKFFSDSGQVLKTETLEAWKATFRQPETYLRKGEQRQSRTLWVEGIDKSQWQKQL
FT                   LQLSISELKSR"
FT   sig_peptide     complement(95265..95330)
FT                   /locus_tag="Sden_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            95589..96869
FT                   /locus_tag="Sden_0086"
FT   CDS_pept        95589..96869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0086"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53383"
FT                   /db_xref="GOA:Q12T43"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T43"
FT                   /protein_id="ABE53383.1"
FT                   /translation="MDQDLRMQIVSWLQEIGINSQPTDGLATSLLLSLCFLAAMLAYFI
FT                   VKRVVIEGVNIIILRSKATWDDVFVRFRVLEKLAILVPAVVLNLFIPVAIKEQAVLAHL
FT                   FDRILSMVLAILIIRAIYAALDAINEIADINLVNRRLPIKSFVQLTKLFLFFIGLIICI
FT                   SILADQSPVYFLSGLGVATGFVMLVFRDTILGFVAGIQLAANRMVSKGDWIQMDKYGAD
FT                   GAVEEVSLNTVKVRNWDNTITMIPAYALVSDAFKNWRGMSESGGRRIKRSVNIDVNSIK
FT                   FLTDDERIRLGKVNHLKEYLPKIFSEISEANASVSDIDMPVNGRRLTNVGTFRAYLQQY
FT                   LNHHERVHKDMTLMVRQLAPTTEGLPIELYIFTNDVRWTHYEAIQADIFDHVFAILPEF
FT                   GLRAFQNPTGNDIRSLKSVSLGLDGGK"
FT   gene            complement(97393..97764)
FT                   /locus_tag="Sden_0087"
FT   CDS_pept        complement(97393..97764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0087"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53384"
FT                   /db_xref="GOA:Q12T42"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T42"
FT                   /protein_id="ABE53384.1"
FT                   /translation="MELGAFSVSLSVSNIEKSKVFYQKLGFEIVGGDQSQNWLILRNGD
FT                   HSIGLFQGMFEGNIMTFNPGWSSKCQPLESYTDVRELLKEFEAQGVNIIQESISGESGP
FT                   SSFSIKDPDGNSILIDQHV"
FT   gene            complement(99618..100172)
FT                   /locus_tag="Sden_0088"
FT   CDS_pept        complement(99618..100172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0088"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53385"
FT                   /db_xref="GOA:Q12T41"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T41"
FT                   /protein_id="ABE53385.1"
FT                   /translation="MFNRFCTFLFARFGWQLEGELPSSAQFIMIVGPHTSNWDFVLGIV
FT                   ARGAMGINIHFLGKHQLFLPPWGWIFRALGGSPVDRRKHNNLVDAAVQLFKQDANYKLA
FT                   LAPEGTRSPVKRWKTGFYHIAKKAHVAIVPVGFDFSRKRVVFHPELMPTDDIQQDMQYI
FT                   IDFYRSINGRHPKTIPDFKQD"
FT   gene            100347..100769
FT                   /locus_tag="Sden_0089"
FT   CDS_pept        100347..100769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53386"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T40"
FT                   /protein_id="ABE53386.1"
FT                   /translation="MMKNWLWVLLLCTSFSLMATPKDEINLLLNQQEVDWNNGDIQAYL
FT                   QGYWQDDKLTFVSKGKFNHGWANLLKSYQRSYPDVASMGKLDFNQLDIKVLSDNAALVS
FT                   GRWELKRAKDNPNGIFTVLVQRINDRWQITHDHSTD"
FT   sig_peptide     100347..100406
FT                   /locus_tag="Sden_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(100744..101520)
FT                   /locus_tag="Sden_0090"
FT   CDS_pept        complement(100744..101520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0090"
FT                   /product="protein of unknown function DUF833"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53387"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T39"
FT                   /protein_id="ABE53387.1"
FT                   /translation="MCILFLAVNVHPQFPVIVCANRDEFHHRPTMPAHIWQDNAIIAGK
FT                   DLQAGGTWLGLAQDGKFAGLTNLRTQTSNQDGVRSRGELVVKALSVEGLTPDWLKSHAH
FT                   NYNPFNLVFSFQGRLHCFNSLQGQSLQLSDGFHAISNGALDEVWPKMAKGQQALEAHLS
FT                   QPSEPEVSKLIAIMSDESQASDDLLPATGLSLEWERRLSAIFIRHDEYGTRSTSIVLQD
FT                   LQGKTHFTEVRFDGKGRNLGQQDFEIVVTNPSSDHG"
FT   gene            complement(101563..103224)
FT                   /locus_tag="Sden_0091"
FT   CDS_pept        complement(101563..103224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53388"
FT                   /db_xref="GOA:Q12T38"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T38"
FT                   /protein_id="ABE53388.1"
FT                   /translation="MLYLIASCIALLFGPLFYRFFSTGNGLQKGLDGFIFVSLGGLVLI
FT                   HILPELLEHGGFLTLIFVMLGLWGPTASERIFHRYSEITHNVTLTLGIAGLLLHTVTDG
FT                   GAMVLAQQEGNSILLALGVVMHRLPVGFAVWWLLKPHLGARWTCVILGAIMFFTGVGYF
FT                   AGEQLLDQLSLDNTVYLQAFVTGSILHVVLHQPHGHQKQDKQGRYEYQAGIGSLVGLAL
FT                   LAVLLLMDTGGQDHAHHEHSTEQLITWLLTLSPILLLSYAVATLRFKLGLQPEHKNLSL
FT                   RWLQRLTGPESLILTFFLLGPNYALFQVASQLLIGLVMSLNKVEITDPHHQVPSSPLRF
FT                   GFAHLVDRSAPWIILSLILANLIGHPSMALDHPAIQLLVLILVFLPMRFCNLGAAVLAL
FT                   ALAYSGWHPMAVALTLIAAPVLSISQLRLMKPLALALLTISLTLSLGAAAWLLTPGHAL
FT                   FTMNEPLQMSALVIISLLFAASLLRLGPRKFLRRLLINLPAAHAHEHNHGHSHNHQQDH
FT                   SHGHTRQGHAHNQDHTDSHSHSHSHAHKHKNDDSNQ"
FT   gene            103529..104122
FT                   /locus_tag="Sden_0092"
FT   CDS_pept        103529..104122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0092"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53389"
FT                   /db_xref="GOA:Q12T37"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T37"
FT                   /protein_id="ABE53389.1"
FT                   /translation="MDIFSAAVMLFLIMDPLGNLPIFASILRHIDPKKRRKVLIRELIF
FT                   ALIIMLMFLYAGEAILNFLNLRSESVSIAGGIILFLIAIKMIFPQPGGVAGLAAGEEPF
FT                   IVPMAIPLMAGPSILAALILLAHTDPSRMTDWTIALVSAWGLSAVILMFYKIFTKILGE
FT                   KGLIAVERLMGMVLVMISVQMLLDGISNYIKTAQ"
FT   gene            104304..104666
FT                   /locus_tag="Sden_0093"
FT   CDS_pept        104304..104666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T36"
FT                   /protein_id="ABE53390.1"
FT                   /translation="MKPSIVSLSVLLMLSFQACSHQTVSPVQAEMSSQDANQETISQTK
FT                   TPIAEPTAGITTIKGKKITLVCSAPPPLKDTTKLKQNLLEKGYINAQMTEQEADAKVDE
FT                   YIYQRQQAFKNCNKGQ"
FT   sig_peptide     104304..104366
FT                   /locus_tag="Sden_0093"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.936 at
FT                   residue 21"
FT   gene            104720..107317
FT                   /locus_tag="Sden_0094"
FT   CDS_pept        104720..107317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0094"
FT                   /product="peptidase M6, immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53391"
FT                   /db_xref="GOA:Q12T35"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T35"
FT                   /protein_id="ABE53391.1"
FT                   /translation="MFCGLTSATCLSAPINGSPADGAIVNKERVLYWLIHHGDVSLDDS
FT                   DEVKQAAVQAFIERSGRHQFKLPRVEAQAEHNRAKRVNAAKSSARPEHEILAQVVADSE
FT                   ITKTVKVLAVLIDFPDLPYNANGLKAGDTDMFYSSYPPSHYKNLLFSTTGFSGPQSQNL
FT                   QSGYQYFQAASGGSFFFNGDVKGWYRANNNAAFYGGNDAANDDSDKAVPDLIKEAVTQA
FT                   VASMTSAELNSYDIEDPYDLDGDQNFDESDGIIDHVMVFHSSIGEEAGGGVLKDDAIWS
FT                   HRHFLDQGSGGYTIPGKSKKLFGYTIQPIDAATGVCTHEFGHDLGLPDEYDTSKDTQGA
FT                   PVGLWSLMAGGSWVGTLAGTKPLAGTQPSGFSPYAKSYLQQRYKGKWVNEQSISFDSLN
FT                   ATGVDLPLNRAVDSDDVNQISIALPPSQVAFKAPFSGQYQYYSGQGNLLNNAMSFDLTL
FT                   PITSPLTLNFKAHWNIEQDYDYMQLKVDGVAIAGNHTKASNSKYSGINNYISGASAAIA
FT                   GATGTDAWVELSYDLTPYAGQTKRISLVYVTDEASIEYGMAIDDIRLLNNTNQLYMDGA
FT                   ESSTSSNDLLLNGFSRVTDTRPGKARRYLIQLRNHSGIDSGLKNRGYEPGVLLWLENLD
FT                   QSDNNVFNHEGEALIAVIDADQEIIGDATTTDTNVQIRDAAFSLYNQKTYSGDAHLAGS
FT                   SLFDDSHDYSAPLKPMAGIKLDELGFTMEVINQTADSSSALIRLKKTDGTIPEPAAIVA
FT                   SFSTTITDNKVNFVANVSGGSGVYSYLWEFGTANATSVLMNPEYTYAVTGTYTVNLTVT
FT                   DSLGKSHSSTQTVTVTRPTPIVTPVADAGGGGGSLTWLSLVGLGLLAWRRRFV"
FT   gene            complement(107359..107928)
FT                   /locus_tag="Sden_0095"
FT   CDS_pept        complement(107359..107928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0095"
FT                   /product="chorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53392"
FT                   /db_xref="GOA:Q12T34"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T34"
FT                   /protein_id="ABE53392.1"
FT                   /translation="MKVTSLSFPYGESIQWFSPERADSIQNAQLKDWLLATGSLTLKLK
FT                   NLCNDFEVKVLGEQLTSPLATDTMIEETVWMREVLLCLDGTPWVFARTLVPQSLLDFKS
FT                   QAFTQLGNKPLGELLYTSPEIIPGKIELAKFDTCSRLAKLATSLKQEISDPLWGRRRHF
FT                   SIDTRHLTVSEIFLPAAVAHMKLHNK"
FT   gene            108069..108470
FT                   /locus_tag="Sden_0096"
FT   CDS_pept        108069..108470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0096"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53393"
FT                   /db_xref="GOA:Q12T33"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T33"
FT                   /protein_id="ABE53393.1"
FT                   /translation="MKRIATVLLVLLTLAFDTEGAGKDAVPDYAYYGFEPEIVTNYISS
FT                   KKKMGFVRISVELMVKNPDDLIALEHHDPLLRAAMVEILGNQAENKVKSLTGREEIRRE
FT                   CYEMINRLMEQETGRGFVVNLLFTRYLYD"
FT   sig_peptide     108069..108131
FT                   /locus_tag="Sden_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.893) with cleavage site probability 0.628 at
FT                   residue 21"
FT   gene            108476..109558
FT                   /locus_tag="Sden_0097"
FT   CDS_pept        108476..109558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0097"
FT                   /product="protein of unknown function DUF890"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53394"
FT                   /db_xref="GOA:Q12T32"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR016909"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T32"
FT                   /protein_id="ABE53394.1"
FT                   /translation="MSKLISKQGKRPALSQSGLAKPSTSKKSSASKNANTETAKLLTKA
FT                   LHPRNVHKYGYDFAALSKTLPALTPFVGPNAYGNISIDFANPDAVKQLNAALLLHHYSI
FT                   RDWDIPHGYLCPPIPGRVDYLHYLADLLSAPHKGKANRNIRALDIGTGANGIYPLLGIE
FT                   SYSWQFVASDIDKVSLDNVDEILAKNPQLAAKLSLRLQLNPKAIFNGVIEKDEYFDVSL
FT                   CNPPFHRSLADANAGTQRKLSNLAKNRGQSQQQAVQAKVALNFGGQKAELWCEGGEAAF
FT                   LANMISESKGFAAQCLWFTSLVSKSENLKPCYAQLAKQGTSEVKTIEMHQGNKITRILA
FT                   WSYLSLSQRQAWAKLRDQSR"
FT   gene            109632..110480
FT                   /locus_tag="Sden_0098"
FT   CDS_pept        109632..110480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0098"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53395"
FT                   /db_xref="GOA:Q12T31"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T31"
FT                   /protein_id="ABE53395.1"
FT                   /translation="MANILILANLNCDRILRLDKPLKTGGRFHYQDGGLRLGGGGANTG
FT                   IGLVWAQHQVAIVSQVGSDDIGDWILAKASTYGLDCRLVQRFEGNTCEMLLVMTPDGER
FT                   TIIRPQRPTFTLTSSPKWDDWQAFYINSSAQGAELWAESALARTLVVAQLAKDDRPRPC
FT                   HVLIASKSDLSGRSELSPWEFALQLAGESLKYFIVTDGDAGALVYSHEEVQQVAAVSAN
FT                   VVDTTGAGDAYAAGVIHGLCSGDNILKAMEAGARWAAFAVETPSSIPGMGLKAYLGAKP
FT                   A"
FT   gene            complement(110599..112518)
FT                   /locus_tag="Sden_0099"
FT   CDS_pept        complement(110599..112518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0099"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53396"
FT                   /db_xref="GOA:Q12T30"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T30"
FT                   /protein_id="ABE53396.1"
FT                   /translation="MNYFNSLTIKQKILMTVAFAVLLSTILVGVLSQRSAKNVIEQRML
FT                   GSELPSLLVQIRNKVEMDISSLMNAAEQLASSRMLLRWLQDGRPSGQEALVTSQLKDLT
FT                   LQYGLAQASYADRETAAYYTQDGFLRILNPEQDGWFFGYRDSRQERMLNVFTEANGEVK
FT                   LFVNYQQPNGRGLVGLAKSLDDMVTLLASFKIEKSGFVYLVDKTGAVTLHQNKSLIGKA
FT                   KLNLLYPNIQTNQLLSQNNFNLVKADVDGQHMLVASSYIPSMDWYLIAQVPEAEVFALL
FT                   EESSYQILILTMLVAGAFIFLALFVASSVSRPITVVAEMFRNIGEGEGDLRQRLPVKGD
FT                   DELAQLAKGFNSFISKIQESVIEVAQTSEELGLSAKDVSAQAHQTLDDSQIQKDRTMMV
FT                   VTAINEMGATVNEIASNAAQAAVTAREADKGSSEGQSVVIRARTTINQLSKDVESVGEV
FT                   IESLATHTKSIGSILDVIRAISEQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLASR
FT                   TAASTNEVQTMIDKLQSEASRAVDAMTQSRSRSREGVAAVDEASQSLSGISEQIGMISD
FT                   MNIQVAAATEEQSTVVEDINRNVTEINDITQRTAETAEAAAKASQSLNQLALRLDTLVA
FT                   RFKV"
FT   sig_peptide     complement(112408..112518)
FT                   /locus_tag="Sden_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.558 at
FT                   residue 37"
FT   gene            complement(112745..114391)
FT                   /locus_tag="Sden_0100"
FT   CDS_pept        complement(112745..114391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0100"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53397"
FT                   /db_xref="GOA:Q12T29"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T29"
FT                   /protein_id="ABE53397.1"
FT                   /translation="MERESMEFDVVIVGAGPAGLATACRLMQISKDANKEITVCVVEKG
FT                   SEVGAHILSGAVFEPHVLDELFSDWRNDAPLKTKVTDDEIYLLNSDAHSLHIPNAFVPK
FT                   TMHNHGNYIISVGNLARWMAERAEALGVEIFPGFAASEMLFNEDNSVKGILIGDMGVGA
FT                   DGKPKDSYMPGMELHAKYTVLSEGCRGHLGKQLIEKYQLDAGKTPQHYGLGFKEIWKIP
FT                   AEQHTEGKVVHTGGWPLNEGSSGGGFLYHMEDNQVAVGLIIDLNYKNPHLSPFDEFQRY
FT                   KTHPLIARILTGGERLSYGARAIAKGGLNALPKMSFPGGLLIGCDAGTLNFAKIKGTHT
FT                   AIKSGLVAASTLGEALIAGVEGGKDLDCFGQRISESWLHEELYQSRNFGPALHKFGTWM
FT                   GGAFNYIDQNWFGGNMPITLKDETADHAQMGLAKDFKVINYPKADGKLSFDKLSSVYLS
FT                   NTFHEEDQLCHLRLKDAGIPISVNLAKFDEPAQRYCPAGVYEVVEEAGEKKFVINGQNC
FT                   IHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
FT   gene            114686..115699
FT                   /locus_tag="Sden_0101"
FT   CDS_pept        114686..115699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0101"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53398"
FT                   /db_xref="GOA:Q12T28"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T28"
FT                   /protein_id="ABE53398.1"
FT                   /translation="MHSPPALGKVNMSQLQDNFGRRFHYLRLSITDACNFKCTYCLPDG
FT                   YQSQGNSPFLSLSEIELLLGAFSQMGTQKVRITGGEPSLRKDFIDIIGLAANTPNIKTV
FT                   ATTTNGYRLAKNAQAWYDAGLRRINVSIDSLDPKMFYQITGENRFDQVMRGVDAALESG
FT                   FERVKINAVLLKGLNSQDLPRFLHWIKHMPVDLRFIELMETGLGREYFKAHHLAGTQVK
FT                   QQLIRDGWQLDKADILDGPAQNFSHSDYQGRIGLIMPYEKNFCVSCNRLRVSAKGQLHL
FT                   CLFTENGVNLKDLLQDKSQTPELMARLQQQLGFKTAAHSLHQGITGVTTHLASIGG"
FT   gene            115800..116279
FT                   /locus_tag="Sden_0102"
FT   CDS_pept        115800..116279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0102"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53399"
FT                   /db_xref="GOA:Q12T27"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T27"
FT                   /protein_id="ABE53399.1"
FT                   /translation="MSDFTHINAQGHAHMVDVTTKTVTEREARAQAFVEMAPETLLMII
FT                   NGQHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVELELIAEPEFNRVRVTSLCK
FT                   LAGKTGVEMEALTAASVAALTIYDMCKAVQKDITITGISLLEKRGGKSGYFKAKA"
FT   gene            116301..116552
FT                   /locus_tag="Sden_0103"
FT   CDS_pept        116301..116552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0103"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53400"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T26"
FT                   /protein_id="ABE53400.1"
FT                   /translation="MVKILFFAQIRELLGASSLELAVESGSITAEGLRALLASTDEKWA
FT                   KVMASDKLLVAINQTMSTWDACITDGDEVAFFPPVTGG"
FT   gene            116555..117025
FT                   /locus_tag="Sden_0104"
FT   CDS_pept        116555..117025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0104"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53401"
FT                   /db_xref="GOA:Q12T25"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T25"
FT                   /protein_id="ABE53401.1"
FT                   /translation="MTAKVKIAVQEADFDHAQEYARIAQDNNDGAVVTFCGKVRDFNEG
FT                   NEITRLTLEHYPGMTESVLAQICQQALQRWSINHLTVIHRVGSLDLGEQIVFIGVSSAH
FT                   RGDAFAACEYLIDFLKTKAPFWKLEATHQGERWLDARDTDEVAANTWQQGEA"
FT   gene            117025..117906
FT                   /locus_tag="Sden_0105"
FT   CDS_pept        117025..117906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0105"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53402"
FT                   /db_xref="GOA:Q12T24"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T24"
FT                   /protein_id="ABE53402.1"
FT                   /translation="MGSRFVGSQAVVRRALICQMGHGVSVSISRKWLVMSICLLLLSLS
FT                   LGITTQAMANDKGPLIAAAANVKLVLDKIIADYHNDTGANVRVSYGSSGNFVAQIQQGA
FT                   PYELILSADEFYVNKLAALGLIQGQGRIYAIGRLALVAPHHSPMSLDADLHGLKQLLAT
FT                   GGLTHFAIANPKHAPYGERAVEVLTASGNWPQIKHKLILGENVSQALQFALSGSTQGGI
FT                   VALSLAQHAEFKEHGRYIALPETWHQPLKQRMALIKHASIQAKDFYEYLLLPSTQQTFT
FT                   EFGFAAAVTGDN"
FT   sig_peptide     117025..117189
FT                   /locus_tag="Sden_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.828) with cleavage site probability 0.826 at
FT                   residue 55"
FT   gene            117906..118577
FT                   /locus_tag="Sden_0106"
FT   CDS_pept        117906..118577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0106"
FT                   /product="Molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53403"
FT                   /db_xref="GOA:Q12T23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T23"
FT                   /protein_id="ABE53403.1"
FT                   /translation="MDWQAFWLSIKLSSMTVVILIPLAMFAAKFFAYHDFKAKPWLEAL
FT                   VMVPLVLPPTVVGYYLLVGLGSQSLVGQWLATYLGTSLVFNFSGLVLASVLINIPFALQ
FT                   PIQRAFEAIPMDVRDAALCCGMSPWARLYKIELPMVWPGVLTAIVLCFSHVLGEFGVVL
FT                   MLGGNIAGETKTLSIAIYDSVQAFDLAAAGSMSLFLLVFAVSVLALTSHLSRRMVAANG
FT                   Q"
FT   gene            118567..119694
FT                   /locus_tag="Sden_0107"
FT   CDS_pept        118567..119694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0107"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53404"
FT                   /db_xref="GOA:Q12T22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T22"
FT                   /protein_id="ABE53404.1"
FT                   /translation="MANNPDEFRCQISQQTPIPLQLDFSCQGGEILAIVGPSGGGKTSL
FT                   LRMLAGLSQPQEGEISLGEEVWFDSEKHLCLSPQQRHIGYVPQHFGLFPRLTALENVLA
FT                   GLDHLPKSQRREHGLTWLQRVGLGDYGHRLPRQLSGGQKQRVALARALSREPKVLLLDE
FT                   PFSALDVQTRDGLYQHLIQLIDELAIPIILVTHDIQEAFLLADKMLLLHQGKMLQSGAP
FT                   AEIWAKPVNELVARQMGHKNILPVECIGLTQSDAEFSLAGQTLRLPSATGIELGTQFGC
FT                   IFNQASLRLMPLEVNQLGDTAEHWLWVRVIQVRVIAGAVRVELMLEQSECMLELILEPG
FT                   LNLEFGLPGSRLLNIQPNQRRQLAVDPWRLILIPS"
FT   gene            119777..120307
FT                   /locus_tag="Sden_0108"
FT   CDS_pept        119777..120307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53405"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T21"
FT                   /protein_id="ABE53405.1"
FT                   /translation="MFRNLFIFLAFSINSFNVLAAPSMYQVLSEGEYQTPISVMKQLEA
FT                   NKGDMIVAFDMEIEADELIYEFVIVNLVKQQLIETRIRAKDGAKLKDSSKTIAADDLDQ
FT                   VQAVKMLQRKQLSFSDLVSMAMKDKPGFLLEAELDHDLAISYLELKLLTEMSKHTVAFD
FT                   IDNLRPLPLLKWD"
FT   sig_peptide     119777..119839
FT                   /locus_tag="Sden_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            120323..121000
FT                   /locus_tag="Sden_0109"
FT   CDS_pept        120323..121000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0109"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53406"
FT                   /db_xref="GOA:Q12T20"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T20"
FT                   /protein_id="ABE53406.1"
FT                   /translation="MKILIIEDDATTQSYLVEGFAAQNIATDTASDGQEGLHLARHNSY
FT                   DLIVLDRMLPKLDGLTLLGALRSSGNSTPVLILSALNHVDERVKGLRAGGDDYMTKPFA
FT                   FAELLVRVEKLTQRNQGIAAPAELVVGQLRMELLTRVVTLAEHELMLQPKEFQLLKYLM
FT                   EHPNKVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEEIGFPEMIETVRGAGYRLS
FT                   KGH"
FT   gene            121059..122306
FT                   /locus_tag="Sden_0110"
FT   CDS_pept        121059..122306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0110"
FT                   /product="ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53407"
FT                   /db_xref="GOA:Q12T19"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T19"
FT                   /protein_id="ABE53407.1"
FT                   /translation="MIVLLVASLYRQLIIEQQNQVASHLASENQRYQQLSLTVNRRSFA
FT                   AQIRAADPKTAFIAWRSSVDMVGALTFVPDNMPVLPETKDFPIFTGGPDKLHILTGGLV
FT                   MTRYGPVLIATRTDHLATLIDKFISAALWAVGLTLGLTLALGYIFSKAILRRLVHYNRL
FT                   SEQIELGQYDTRLPLSNKNDEFDMLAKQFNRVLDTLEHNLMAVRGVTDNIAHDLRTPLS
FT                   HLRIGIERLEAKPSAELAGASADLLEELDHCLATFDAMLSLTRIEEGQQSLDLQQVSLQ
FT                   GLCEDLFEMAEAMAEAKSQRLSLHLAEDISIAGDKHLLFQALFNLVDNAIHYSPIGADI
FT                   ELRQQGKLISISDNGPGIDDSDKERVFERLVRLDPSRHLKGTGLGLSMVKAILMRHQAR
FT                   ITLLDNHPGLRAEIQF"
FT   gene            122366..123046
FT                   /locus_tag="Sden_0111"
FT   CDS_pept        122366..123046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0111"
FT                   /product="Pseudouridine synthase RluA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53408"
FT                   /db_xref="GOA:Q12T18"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T18"
FT                   /protein_id="ABE53408.1"
FT                   /translation="MYQIISDESDFIVIDKYAGVHFHSQDGSAGVVAQLEADLGIKLFA
FT                   VHRLDTPTSGLLILAKNPLAARRFTEMFTEHKVQKYYLAIAQGKPKKKQGWVIGDMAKA
FT                   RRSMFKLLRSTENPAVTQFFSHSIVEGLRLYLLKPHSGKTHQLRVALASIGVPILGDKL
FT                   YGVNSAEHDRCYLHAYCLDFSYQGKAFHYLCMPTQGNIFEMQAVQQQLTQQWSHPELLS
FT                   WAAR"
FT   gene            123178..123360
FT                   /locus_tag="Sden_0112"
FT   CDS_pept        123178..123360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53409"
FT                   /db_xref="InterPro:IPR021677"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T17"
FT                   /protein_id="ABE53409.1"
FT                   /translation="MNRKKKINQTLKAKAKKANAKKAGIPANKPKYIAKADREQANASV
FT                   EANDSVGVEVGSEVD"
FT   gene            complement(123425..124192)
FT                   /locus_tag="Sden_0113"
FT   CDS_pept        complement(123425..124192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0113"
FT                   /product="[molybdopterin synthase] sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53410"
FT                   /db_xref="GOA:Q12T16"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T16"
FT                   /protein_id="ABE53410.1"
FT                   /translation="MFEAEILSHTEMMRYSRQISIKGVDLEGQEALKQAKILMIGLGGL
FT                   GCAASQYLAVAGVGELTLVDFDTVELSNLQRQVLHHDENIGQNKVDSAKQSLQQLNPHI
FT                   KLNSINGKLNQNQLTELIQSHDLVLDCTDNLAIRQDLNLSCFNHKTPLVSAAAIRMEGT
FT                   VTVFDYQASSPCYHCYSSLFGEQALSCVEAGILAPVVGIVGAIQATEAIKYITQLGQGL
FT                   QAKVLLIDAMTMEFRQMKLLKNPACPVCGASRN"
FT   gene            complement(124244..125491)
FT                   /locus_tag="Sden_0114"
FT   CDS_pept        complement(124244..125491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0114"
FT                   /product="molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53411"
FT                   /db_xref="GOA:Q12T15"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T15"
FT                   /protein_id="ABE53411.1"
FT                   /translation="MTNPIDACAQPALLHPVDAIKLLLAQVKPVADTEVLSLSQAVGRV
FT                   LAEDLVSCIDLPPFDNSAMDGYAFRFDELSGQDTHRLTLAGRSFAGHPFQGQAGANTCI
FT                   RIMTGAPMPAGFDTVQMQEKTQQEGDKVYIQPPKMRGANVRLRAEELTSGTKVLKKGIT
FT                   LRAAELGVLATIGVSHVRVSRRLKVAFFSTGDELRPVGSELAAGQIYDSNRYSIHGLLH
FT                   RANVELVDLGVISDDKEAIRAAFRTAASADMILTSGGVSVGDADYIKQVLAEEGEINFW
FT                   KLAIKPGKPFAFGKIGSAVFCGLPGNPVSSMVTFYKLVWPLLQKMQGLELVPSLTFPAK
FT                   LTSPIRKQPGRVEYQRGILSYDAGNQPCVAITGGQGSGMLTSMSLANCFVLLEQEQGDL
FT                   DAGTMVRVEPFNSVLS"
FT   gene            125646..125918
FT                   /locus_tag="Sden_0115"
FT   CDS_pept        125646..125918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0115"
FT                   /product="Excinuclease ABC, C subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53412"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T14"
FT                   /protein_id="ABE53412.1"
FT                   /translation="MENEKQSPWYLYLVQCANSHLYTGITKDVARRFSEHQQGGIKAAK
FT                   FLKGKGPLTLVYQELVGSQSQALKRELMIKKLTRAQKLQLINGHQ"
FT   gene            125905..126948
FT                   /locus_tag="Sden_0116"
FT   CDS_pept        125905..126948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53413"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T13"
FT                   /protein_id="ABE53413.1"
FT                   /translation="MDINNLMQLVSHTQASSSPRKSRGYLCLPSWLWLTLLSSFSLTET
FT                   KASTITSVEQSAKAAPQELIEGGHEHQHIPLASQRIRLPPPPLNMASSYDYFYDLLELI
FT                   LIKTQAEYGPVILETLPSALSQSRGLSSLNSGLIDIIWAGTNIEREQRYTPIRIPLVGG
FT                   LLGMRVPVIKRVRLAEFQAIRMPEQLKKLTACQGSQWPDSDILEANGYKVERIIMFELM
FT                   YTMLNHDRCDYFPRGINEVFSELDGPERDELMAFEGILLRYSMPMYFFVSQENVQLEQR
FT                   LTSGLEAMVASGELKKYILSHKVTQGIFPLSRYHNSRIFELVNPSLPASLVDRPELWIK
FT                   LKKTSKQ"
FT   gene            complement(127004..128545)
FT                   /locus_tag="Sden_0117"
FT   CDS_pept        complement(127004..128545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0117"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53414"
FT                   /db_xref="GOA:Q12T12"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T12"
FT                   /protein_id="ABE53414.1"
FT                   /translation="MTDGAPRTFLNPTSAELVEIALQRGEGRLTANGALVALTGARTGR
FT                   SPADRFIVKEPSSEADIEWGPVNKPFDAGAFDALWGRVEAYLSEKELFVSELEVGADDE
FT                   HYLPVRVTTEYAWHQLFARNLFITPEHFNRGDKGVWQIINAPGFVCDPSRDGTHSDAVV
FT                   ILNFAERKVLLAGLKYAGEMKKSMFSVQNFLLPAKGVLPMHCSANVGQDGDTTLFFGLS
FT                   GTGKTTLSADPKRFLIGDDEHGWAKGGVFNIEGGCYAKCIDLSQKNEPVIWDAIRFGTV
FT                   LENVMLDENRVPNYKDSSLTENSRAAYPLEHIAQRKVENRGNEPHAVVFLTCDVSGVLP
FT                   PVSILTKEQAAYHFLSGYTAKVGSTEMGSTSAIQSTFSTCFGAPFFPRPAGVYAELLIE
FT                   RIESFNSQVYLVNTGWTGGPHGVGKRFDIPTTRAIVDAIVSGSLKDAPTEHLATLNLAV
FT                   PLAIEGVDSTLLNPINTWADKDMYAKYAKQLAQEFNSNFAKYQVSEAIKQAGPKA"
FT   gene            complement(128791..129657)
FT                   /locus_tag="Sden_0118"
FT   CDS_pept        complement(128791..129657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0118"
FT                   /product="Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53415"
FT                   /db_xref="GOA:Q12T11"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12T11"
FT                   /protein_id="ABE53415.1"
FT                   /translation="MSRDILHRYLFDNADVRGQLVQLEDSFQAMLAAQDYPKALQVLLG
FT                   ELMAATSLLTATIKFSGDISVQLQGDGPVSLAVINGNNELQLRGVARWKGELAKDASLP
FT                   TLLGKGYMVITLTPDEGERYQGIVSLEHGTLAACLEEYFNQSEQLPTQIHLFATNAQAA
FT                   GMLLQVLPSKQEQNDDFSHLSVLTQTIKPQELFDLGAEEVLHRLYHEEEVRLFEPMDVS
FT                   FKCTCSRERSAGALKTLSLVELETILAEEGKIDMGCEYCTASYSFDAIDIAALFSDNAD
FT                   TSQTKTQ"
FT   gene            complement(129718..130116)
FT                   /locus_tag="Sden_0119"
FT   CDS_pept        complement(129718..130116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0119"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53416"
FT                   /db_xref="GOA:Q12T10"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T10"
FT                   /protein_id="ABE53416.1"
FT                   /translation="MSDDQDENNKIRLDKWLWAARFYKTRAIAKEMINGGKVHYNGQRA
FT                   KSSRNVELGAHLRIRQGMEDKHIVILGLSEHRQGAALAQTLYQETQESQQKRAVNAEAR
FT                   RLNILLNPAPVHKPDKKQRRQLLKVKQY"
FT   gene            130359..131270
FT                   /locus_tag="Sden_0120"
FT   CDS_pept        130359..131270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0120"
FT                   /product="type II secretion system protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53417"
FT                   /db_xref="GOA:Q12T09"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T09"
FT                   /protein_id="ABE53417.1"
FT                   /translation="MDVLDNLLAKAARIPHKQLSLFVFWFLFVIVSLLAAQVTWKLIPA
FT                   NAPLATWQASAIASTTAKSINLQGVHNLHLFGNHDASQVSRAPVVETITDAPKTSLSIL
FT                   LTGVVASTTETQGLAVIDSRGVQDTYSLGDKISGTSASLKEVYADRIIITNAGRYETLM
FT                   LDGLPYTTNGQVNQQLQQAKQSQDVSRVDQRNNQQVSQELRQSRDELLADPSKITDFLA
FT                   ISPVRNGDSLAGYRLNAGRDAALFKQAGFQANDLAKSINGFDLTEMSQALEVMAGLSEL
FT                   TEIAVMVERDGQLVEIMFSLPE"
FT   gene            131297..133414
FT                   /locus_tag="Sden_0121"
FT   CDS_pept        131297..133414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0121"
FT                   /product="type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53418"
FT                   /db_xref="GOA:Q12T08"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T08"
FT                   /protein_id="ABE53418.1"
FT                   /translation="MNNKGIRRKLLLSALTGAALLTSQLAWSEQYAANFKGTDIQEFIN
FT                   IVGKNLNKTIVVDPTIRGKINVRSYDLLNDDQYYRFFLNVLQVYGYAVVEMENNIIKVI
FT                   KDKDAKVSAIRIADDKVPGVGDEMVTRIVALYNTEAKQLAPLLRQLNDNAGGGNVVNYD
FT                   PSNVMMITGRAAVVNKIVEIIRRVDKQGDTEVQVVPLEYASAGEMVRIIDTLYRATANQ
FT                   SQMPGQSPKVVADERLNAVIVSGDEKSRLRVVSLIRKLDAEQASTGNTKVRYLHYAKAE
FT                   DLVEVLTGFAERLQEGGDKGAQQGGAKRRNDINIMAHVDTNALVISAEPDQMRTIESVI
FT                   NQLDIRRAQVLVEAIIVEVAENDDVGFGIQWASMAGGGTQFNNLGATIGEVGAGVWAAR
FT                   EKDVAQVTTIDANNKPVVSNNPKTEGDYTLLAQALGKVNGMAWGVASGDFGALIQAVSS
FT                   DTNSNVLATPSITTLDNQEASFIVGDEVPILTGSQNSSNGNANPFQTVERKEVGVKLKV
FT                   TPQINEGTAVKLTIEQEVSGINGKTGVDVTFATRRLTTTVMADSGQIVVLGGLINEEVQ
FT                   ESIQKVPFLGDIPFIGHLFKSSSSSKKKKNLMVFIKPTIIRDGVIMEGIAGRKYNYFRA
FT                   LQLEQQVRGVNLMPNTEVPVLEEWNQDAYIPEDVNRVLDRYKDGKGLDTDLRNSDAALK
FT                   AISDNKASADE"
FT   sig_peptide     131297..131383
FT                   /locus_tag="Sden_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 29"
FT   gene            133422..134966
FT                   /locus_tag="Sden_0122"
FT   CDS_pept        133422..134966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0122"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53419"
FT                   /db_xref="GOA:Q12T07"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T07"
FT                   /protein_id="ABE53419.1"
FT                   /translation="MTDQLAQVSNDLTLELEDADEVFHSNSKERLPFAFSQRFQLVLAK
FT                   ELGVLSLFYTDNTPLNAMLEVRRYTAAELPLIKLEVNKFESKLTQAYQANSSEAQQLME
FT                   DIGNEMDLFTLAEEMPQTEDLLEGDDDAPIIKLINALLSEAIKEEASDIHIETYEKQLI
FT                   VRFRIDGVLKEVLKPNRKLSSLLVSRIKVMARLDIAEKRVPQDGRISLRIAGRAVDVRV
FT                   STMPSSHGERVVLRLLDKNTGNLDLKQLGMTQGIREKFDALIRRPHGIILVTGPTGSGK
FT                   STTLYAGLTEINSKDTNILTVEDPIEYELHGVGQTQVNIKADMTFARGLRAILRQDPDV
FT                   VMIGEIRDLETAQIAVQASLTGHLVISTLHTNTASGAITRLQDMGVEPFLVSSSLLGVL
FT                   AQRLIRTLCPSCKVEHEPDMRERELLGISDSDPRHIYRANGCKACGNNGYRGRTGIHEL
FT                   LTVDDSVRELIHGGKGELAIERYIRQSVPSIRHDGMSKVLAGVTTLEEVLRVTREE"
FT   gene            134969..136192
FT                   /locus_tag="Sden_0123"
FT   CDS_pept        134969..136192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0123"
FT                   /product="General secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53420"
FT                   /db_xref="GOA:Q12T06"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T06"
FT                   /protein_id="ABE53420.1"
FT                   /translation="MAAFEYKALDKQGKQQKGVIEADTARHARSQLRDQQLMPLELSQV
FT                   NEKESKAGGQGFSLFKRGIPVADLALITRQIATLVAAGLPIEEALKAVGQQSEKDRLGS
FT                   MIMAVRSRVVEGYSLADSLAEFPHIFDDLYRAMVASGEKSGHLEVVLNRLADYTERRQQ
FT                   LKSKLTQAMIYPVVLTLVAIGVIGVLLAAVVPKVVGQFEHMGQELPGTTQFLILASDFV
FT                   QSYGVLVIGLIVLLSIGLQRLLTKPLYRMKWDTLLLSMPVIGKVSKGLNTARFARTLSI
FT                   LSASSVPLLDGMRIASEVLQNVKVRAAVDEATARVREGTSLGAALTQTKLFPAMMLYMI
FT                   ASGEKSGQLENMLERAADNQDREFEANVNIALGVFEPMLVVSMAAVVLFIVMAILQPIL
FT                   ELNNLISG"
FT   gene            136274..136708
FT                   /locus_tag="Sden_0124"
FT   CDS_pept        136274..136708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0124"
FT                   /product="General secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53421"
FT                   /db_xref="GOA:Q12T05"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T05"
FT                   /protein_id="ABE53421.1"
FT                   /translation="MKQNRKQQGFTLLEVMVVIVILGILASMVVPNLMGNKDKADQQKA
FT                   VSDIVALENALDMYKLDNSYYPTTDQGLDALVNAPTSSPEARNYREGGYVKRLPQDPWD
FT                   NAYLLLSPGEQGKIDIFSAGPDRQPGTEDDIGSWNLQDFQ"
FT   gene            136732..137319
FT                   /locus_tag="Sden_0125"
FT   CDS_pept        136732..137319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0125"
FT                   /product="General secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53422"
FT                   /db_xref="GOA:Q12T04"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T04"
FT                   /protein_id="ABE53422.1"
FT                   /translation="MQHSRQRGFTLLEVLLVALLMGLTAAAVTMTMGDAGPEKELKRAA
FT                   QQFIAATEVVLDETVLSGQFVGIVVEENSYEFVYYKEEKWLPIEDDRLLALRQLPEFVT
FT                   LDLTIDGLPLVQEDELEDESWFDEPFIEAETELTKTQRQRPDPQILLFPSGEITAFELR
FT                   VSAKNDKLEVVDVFISGDAMGRLHLGRADETY"
FT   sig_peptide     136732..136815
FT                   /locus_tag="Sden_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.392 at
FT                   residue 28"
FT   gene            137306..137671
FT                   /locus_tag="Sden_0126"
FT   CDS_pept        137306..137671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0126"
FT                   /product="General secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53423"
FT                   /db_xref="GOA:Q12T03"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T03"
FT                   /protein_id="ABE53423.1"
FT                   /translation="MKRTKGMTLLEVIVALAVFSIAAVAVTKSLGEQMANMPILEERTL
FT                   AQWVASNQMVEARLTSEFPDIGQKEGQVELAGKQWYWRQNVVKTTDDKFRQIRISVSDD
FT                   DRYKRIQAQLSSYVHQK"
FT   sig_peptide     137306..137383
FT                   /locus_tag="Sden_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.758 at
FT                   residue 26"
FT   gene            137655..138410
FT                   /locus_tag="Sden_0127"
FT   CDS_pept        137655..138410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0127"
FT                   /product="General secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53424"
FT                   /db_xref="GOA:Q12T02"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T02"
FT                   /protein_id="ABE53424.1"
FT                   /translation="MYIKSNLGSRGFTLLEMLIAVAIFAMLGVAANSVLSTVMRNDEVT
FT                   ADFAKRLKSLQQGFGAIERDLGQIVARTPRLLDGSRATAVFQYGSDILDSESESLVFYR
FT                   LGWLNPAGILPRGTLQSVAYVVQEGRLERWYHPYPEPDSGAEPLKSVIIDNVLSVEYAF
FT                   FSSDKWQKQVANTQLPEGIAIKVEVEGLGFIERKFLLPKGAAVVDSASGSPNDPNDPKN
FT                   PDNGQDIKPGDGDGRDKRDDGDEDQRKRD"
FT   sig_peptide     137655..137750
FT                   /locus_tag="Sden_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.909) with cleavage site probability 0.486 at
FT                   residue 32"
FT   gene            138410..139498
FT                   /locus_tag="Sden_0128"
FT   CDS_pept        138410..139498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0128"
FT                   /product="General secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53425"
FT                   /db_xref="GOA:Q12T01"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T01"
FT                   /protein_id="ABE53425.1"
FT                   /translation="MGPSKQRGVALITVILIVAMVVIIATNISARNQLSMRRTMNLTQY
FT                   DQAYWYALSAEELTKKVLKQDLDDSKGIVHRQQFWALADVVFPAEYGEIVGQVSDMRAC
FT                   FNLNALAAVSKSNDNGQPKLPLAAKQFKALLVGLGMDDFAAERLTHTLKDYVDADSINS
FT                   PYGAEDAEYESRNVPYRAANTLMNHKSELRAVLGFTKEVYRHLGPLVCAIPGNDRQLLN
FT                   VNTLEIEQAPLLMAMFDNQISLGEAENIIGQVPASGYEKIDEFWQNSSIVGLKVDADAK
FT                   SSFVIDSDYFLLKAGAKVNEAIFRMESVLKKGSGNSMDVLTRQYGNQDFYASPNASSST
FT                   NSSSERSTNNNSNNTNENNNKR"
FT   sig_peptide     138410..138502
FT                   /locus_tag="Sden_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.619) with cleavage site probability 0.467 at
FT                   residue 31"
FT   gene            139544..140746
FT                   /locus_tag="Sden_0129"
FT   CDS_pept        139544..140746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0129"
FT                   /product="General secretion pathway L"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53426"
FT                   /db_xref="GOA:Q12T00"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q12T00"
FT                   /protein_id="ABE53426.1"
FT                   /translation="MSERLFIRLGSHQEQACSWLVWSEQEQEIIASGELSDAASLASLK
FT                   DRVGNRPVDILVPTSSMMLTDINLPEKGQRQALRALPFLMEESLATSIEDMHFVVGPRT
FT                   GEKLSVIAVAHQQMQDWLTWLSDAGLKAKRLVPDCLALPLDECQWAAIRCGDELVIRTG
FT                   QGTGVSLPEAWQSFALPKLMASTPTGDESINVASYSQELAFASANIEHKPLELPMLVFA
FT                   KGILNAPVNLLSGVYKPKREYSKQLLLWKNSAIICVLAIVLALVNKGLDIRQLNQATME
FT                   LNQQSESIFKSVSPSTQRVVNIHSQMGAMLKSMQGQGGGVAFFEMLSGLQTAFKQIPDL
FT                   KPNSLRFDANRNEIRMQITANSYGQIEQFKDLVSKDFEIDTGAMNSNEDKVTSTVTVRS
FT                   K"
FT   gene            140748..141224
FT                   /locus_tag="Sden_0130"
FT   CDS_pept        140748..141224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0130"
FT                   /product="General secretion pathway M protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53427"
FT                   /db_xref="GOA:Q12SZ9"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ9"
FT                   /protein_id="ABE53427.1"
FT                   /translation="MENLRIWWQGLAQREQQLVSVAGVCLVIGLLYWGIWSPISQAQQD
FT                   AERNHNAAVKTLNYVKQSANKLVGLQQAGATAKVSGSLSAVVNQSASQFGLVITRMQPQ
FT                   GDKVQLWMDDVPFEALLSYLHFLVQDKGLTLDSLDLAESDAQGIVKVRRIQLSQ"
FT   gene            141236..141997
FT                   /locus_tag="Sden_0131"
FT   CDS_pept        141236..141997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0131"
FT                   /product="type II secretion system protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53428"
FT                   /db_xref="GOA:Q12SZ8"
FT                   /db_xref="InterPro:IPR000645"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ8"
FT                   /protein_id="ABE53428.1"
FT                   /translation="MSLSKKIILAVLLYLVFLLAYMPVKWLASILPMPANISLAGVSGT
FT                   LWEGQADLVQFGPRQLEQVNWSLNPWALLLGQANVDINIGNRATAVSAKADISWSLSGI
FT                   KVQGLRFDAPDSFLIAGAKLPFATQVQGEISLMVPDFVQGKPLCEQLSGKLFLNHTDMR
FT                   NQFGEYPLGNMALTLSCQGGEVAISMLEADNKLGISGIILLGSDNSIKVTAKVKATDGQ
FT                   PQDMRNSLAYLGKPDSQGYYPVNYQGRIPGL"
FT   sig_peptide     141236..141298
FT                   /locus_tag="Sden_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.713) with cleavage site probability 0.674 at
FT                   residue 21"
FT   gene            142525..146793
FT                   /locus_tag="Sden_0132"
FT   CDS_pept        142525..146793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0132"
FT                   /product="YD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53429"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ7"
FT                   /protein_id="ABE53429.1"
FT                   /translation="MEMIKGFCLFSVFFITFGLNGAEFKEAIKGENEKIHSLESGGTNS
FT                   ALDSFGVRHDINSGQVYLSHTDVDIPGNSKLPVRFTRIRSELEPSRNSGNQMRDWDVDV
FT                   PVIMMRTVTSRENSYSGNYKYAERWYVYPDNACSENFPIGYNAEEYLGMYRAIKWPTLR
FT                   VNGISKPLYKIEEGTAPFPADTKFVTKDNWVSKCIFDENNPNKNIGFLVQSPNGDKYTF
FT                   DVRWRDKDHPYTRYYASKVEDSFGNWVKYEFNNGILKRIESNDGRVITIASSRKGGVYP
FT                   YIFSDFSGFNIFSIDSITANDKTWSYGYESKKIIISGSLGRVSWSVSDFLNYLTSAKDP
FT                   EGLTYSYLPSEELVDDTKRIKDTVPFYEVTNPLGAKLRMDFSKYDMCNGVFVELGVMLE
FT                   FSDCIYNFSGSYSDFDFNLGKKNIPFLSKVKISVSENQSYDWSYKITDGLVNSENAPSR
FT                   WNWSKSNWWQGPEFRVIKTTSPSGIYQNKYNQRQGKSYGELVESKVYYGNSWSVVSTFV
FT                   YDDQGMAGNHCPFSEKRCDQIYVVSGNDLDVEKTFRQLSEVKQEQDSVSYSQKFTYDSY
FT                   HNLSVKEESTSEDESVRYSQYTYHYDPLNWYVGRLKNISISSDNISWSKIYNLNFNDLN
FT                   LPEEQFSYGKKVMAYSYHPDGNVKKITYTGSNNYVLFDDYFRGEPKKVTMPCSIANACN
FT                   KVNGSTVNTIVASKEINWDGTIKAEKDFNGNSTAFSYNSIGWLTGVEYSDPKVTKQVIT
FT                   FDKVTNADDGVLGSGIVLGQLRKVITRGNYEQRSYFDGLFRREFTSVKDKSSENSVVYK
FT                   MFEYDSDNRIVLESFPSAIASNNLGVFTEFDSLGRTESITRTTDNAKLTHEYLAMNQVV
FT                   VKDPEGNNVTTKYLSYGKPSYDKPILIQANDAEDTVISYSLFDQVDTITQGNITEKRYY
FT                   DSQNKLCKQVRPETGQTAFKYNSQNQLVWRAEATAGDLNACDADSVLESHKTRLNYDNL
FT                   GQLRTEVFPDNTPSKTYSYDANGNLIFLQAGSVSWNYLYDSQNRLKNEILSLDGKSFEL
FT                   DWTYDGLGSASSLKYPSGIIIDYAPNALGQPTKAGSYASNVSYHANGQIKQFTYGNGIV
FT                   RNVTLDSTGRMDLLKDSKSGVLKTSLAPSYDYNDNLASLIDGVDTANNISNLAYDGLDR
FT                   LKSADGRWGKGSYSYDGLGNITSRSISGAAINYSYDNLNRLNKLNGAYGYSYQYDSRGN
FT                   VSHNGRYGLTFNRANQVSEAKGIPYVYDGHNRRVKQTKPEGSHYSVYSSAGQLLHRKVE
FT                   HGSHTDSVYLGKQLIAEVENGDSSLVTSDPSVAKPSINFNITQYTVGSSCPPKMVCATN
FT                   GITYHNIRWTTENATSCTGNVVRNPDAFPLGSISISGTASKLSYPANGTVYTINLTCVG
FT                   AGGQSTAQRILSGVGLPNEM"
FT   sig_peptide     142525..142590
FT                   /locus_tag="Sden_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.876) with cleavage site probability 0.872 at
FT                   residue 22"
FT   gene            146783..148345
FT                   /locus_tag="Sden_0133"
FT   CDS_pept        146783..148345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53430"
FT                   /db_xref="GOA:Q12SZ6"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ6"
FT                   /protein_id="ABE53430.1"
FT                   /translation="MKCKGVQLVDTLIRFGLRLKLILSKATHAKTTAVLDWNKHFLAFA
FT                   VEGTRVMNPTPKMGFTQNPRTIKSVFGANAHAFKQGCEKVAMTLIARSQFIIRLVATLL
FT                   LVVGLTSMPAQAAQGSTVFIPIAVGDITTFIPIMPTASTAQISTTGGSHNLSWSAVSNA
FT                   SYYQIIITDEHGLQRIFQTTDTDYVLAGLPLGNNKVEVQACNAYNQCGIRYLAGTVTIT
FT                   TRVIYQHTDILGSVVAESDEAGNIISRSHYEPFGKRLGGDKAGIGYTGHLQDKDLGLTY
FT                   MQARYYDPLIGRFYSNDPISYRGVHSFNRYAYANNNPYKYIDPTGNNEEYVAGISVGIG
FT                   FNAEDVNLIATFENSVYNYNFLEGVSLGQRIVEEQMFQQLQLGELSSLSMLLGIARSNG
FT                   KFGVVKGGYHATHPEAAEAILQGGFRKGTKPGRLGSGGTYVNNTPEGAIAEFAHHNPGV
FT                   TPKVLKVNYNPGTNANAVVAPQNYVDQLPLNVNSISAPSVRAPGTINTNVLNGSARATE
FT                   ILP"
FT   gene            149091..149201
FT                   /locus_tag="Sden_0134"
FT   CDS_pept        149091..149201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53431"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ5"
FT                   /protein_id="ABE53431.1"
FT                   /translation="MGESGKNFDHRRGWVESRLFELEAVFAIDVAAFALL"
FT   gene            149292..150269
FT                   /locus_tag="Sden_0135"
FT   CDS_pept        149292..150269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0135"
FT                   /product="protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53432"
FT                   /db_xref="GOA:Q12SZ4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ4"
FT                   /protein_id="ABE53432.1"
FT                   /translation="MPRPRRSQVSVEDTPMYHCCSRVVRRAFLCGDDMFSGKNYDHRRA
FT                   WVEAQLLKLSEVFAIDVAAYAVMSNHLHVVLRIDIYQANSWSDVEVISHWHQLFKGTDI
FT                   TRKFAQGETLEDYEQLQLSHTVALYRSRLSDISWFMRCLNEPIARQANQEDNCTGRFWE
FT                   GRFKSQALLDEAAVLACMAYVDLNPIRAKMASTPEQSDHTSIQLRIQAALKGEQPNSLL
FT                   PFIGNERKNQPKGIAFSVQDYLELVDDTGRIIRNDKRGSISANSAKLLTRLNIPQDNWL
FT                   KLTTEFGKLFHGPVGTLQELTSYCEHLEKRRRHFASCCQHLMAS"
FT   gene            150507..151472
FT                   /locus_tag="Sden_0136"
FT   CDS_pept        150507..151472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53433"
FT                   /db_xref="GOA:Q12SZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ3"
FT                   /protein_id="ABE53433.1"
FT                   /translation="MDNIKPFVGVIVGVALGAFCGGCTAPMIGALAGAAGAAANGGNIV
FT                   IGAFVGAFSAVAFGQIGSSLPFDSSPIANVFAKGIVGAFTNGIQGGELGHGFLSAGFGG
FT                   VVSGNIMGIGGGAEAYIPVRTLIAAIAGGTISRLTGGKFANGATTAGFAHLFNAERVGS
FT                   NKTESQSEKNWDKYFANNWNKFKDMISKQNYSSSSRGGMPRRTAEGLLAEAAGATSVPD
FT                   YNITTDAEWNRALAIASLVVAPISAPFSLGLGAGAGYHGYRGSGDVNAFSGTAFDTVIM
FT                   GASFTPIAPVSNILGAFGTIIQAGDLSSDMMTKCYSPYKC"
FT   sig_peptide     150507..150620
FT                   /locus_tag="Sden_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.602 at
FT                   residue 38"
FT   gene            153873..161366
FT                   /locus_tag="Sden_0137"
FT   CDS_pept        153873..161366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0137"
FT                   /product="Integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53434"
FT                   /db_xref="GOA:Q12SZ2"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ2"
FT                   /protein_id="ABE53434.1"
FT                   /translation="MFKKLAFISVCFLLEAISFKANAISDGGISKVYMGEGKFSLSIYS
FT                   DPFTNQPMAVAPCDVETQSNKLVSTSISINRAVPLPIDGNYPIDNCGTTKWYRTKVATL
FT                   TPIPGELLAGSNNSITQGLLDLGEYQYRYQSCTASGYCQGYSTPLTITVQPITKPEQLL
FT                   LQTPSNSSVELTWSLPNRISLRDQDSVVEQSVNGAAWTKVYVGKQTSIILPTSVGQYQF
FT                   RIKTCSFASCSDYALSNSINRSGGTIEQLNYSIHKDANGNIYLVRPATFIPISGDIFIP
FT                   LFIADKGNVIVMTKNGASWSLTEITYEEFIALQTNIVREASVRYENLTGNTSLDLIISL
FT                   SGNFADSIVVNDINATTHEATYWDCSESVCVVAGSPEAVPAVQVAPIPSINVASSSVGI
FT                   TSGDFRVDESGAATFNMPLSFPVGIASVTPQMSLSYNSNSGNGELGIGSSIVGLSSITR
FT                   CRSTFEQDGVSGTLTLTKADRFCINGRKLVLKKNTGEYGAAGSEYATEVDSFISVVAVG
FT                   SSGNGPDHFEVTHKDGRFETYGQAGNSQLFGFDGDTIETWYLSSQQDNLKLDDNKISYC
FT                   YINGGLNCRSTSMLAGNNEILIDTISYSGNTVEFNYQHRTDVSQGYSLGTLKEQTLRLE
FT                   DVLVKNHNNVPLTKYLTSYDYNVASGFSQLLSLVQCNGSGNSCLQPIRFNWKPANPYLM
FT                   STGRCFSTDPNPYVSDTGTCKLPKTDGTFYGAKPIDFNADGFVDLSYLVAEGSYYYLNF
FT                   LLNNNGVLTGENAPHSNSSERLYFSNDNTPEWHIIDANGDGYQDVLLKRKRTTKYTSQA
FT                   NPEQWFLYQNSGKTDHRERLFTPVEFDLPTFENKALVVAVYDYDGDGLADVIAGRKDGT
FT                   TYGYRKNNGNGFDAFVTLHVNGSSRNQVEFDKSIYGDFNGDGKVDRIYKSRPNYTQCDP
FT                   GRTCTVDWRLNGSFISTNMINVVVGDINGDGLSDLVYEYGVHNKIRTRYATGKGFTDGE
FT                   TLSLEEGFKHVQLVDINADSRADLVYYIPSTRRFKYHLSTANGFSDSELLDASVSAGTN
FT                   VDQVFVVDINGDGLNDISYVDISAKSLKIIRGQSQPDNEVNKVSSIVDGYGQSTAIKYR
FT                   TMLDKTVYQVSQAQDSPFYTPENLNLLNWGRGSRIFNLLSPMSLVASTENRQQRVNYKY
FT                   YKALLQGGGRGFLGFGHIESRYYKSGSEFKTTTSYRQDFPFTGMAEVTFRYYGDISLGS
FT                   VINKLKLERTIAPFQPVIEKVTENNSSISSASLLQSLSKKITQRQYDLFGNITQEQVTT
FT                   TDYANSNQVTTQVVDNEYGSTDEYKRFGRLTKTTVTHGVTGQNTIMRESEFTYLSNLLL
FT                   ENEIIEPNGGNELYLQTHYNYDSLGNVIKTSVCSKHFETTCGAGQQNTNDPLSIHRSTV
FT                   NNYDAQGRYLISSGNDLFIEARFKNFNAFGQPQTILDANNKAADVRYDDFGNEYFKRDG
FT                   TGSSQHTTKAWSSDSASIAAPSIAEDYFYVIGISAQGAPSKWQYINDNGQMIAEVSQGF
FT                   SEDIYQGHKYDAYGRKTHESIPSTLSVALYGPVWVRTGYDVFDRVISTTTPERVTQFTY
FT                   DNRVTSSTVSNAAGAIHTFSQSSSKQIDAQGRLLYVIDNDNQRLDYTYDAMGNLLTVTG
FT                   VDQQVTTNQYDAKGYQKEWMNDPDSGEWHYSYNALGELVSQTDAKQQSISYTYDALGRT
FT                   LSRTDAEGTAQWRFIDTRPHLLKQETTTGYVKQYQYDDFGRQIQTQLVLNAEQQFFVES
FT                   QTYDQFGRVFQKFDASGDFQGIRYHYNDRGYVFKHQEAREGMNGEVYYTINAINALGQI
FT                   TDESLGNGAHVVKNYSNLTGKLNGLAGSHQNQTYSFDGLGNLKQRINYNRTVNGQALTE
FT                   EFDYDSLNRLETVQLNGIETLGLTYEGNGNILSKSNVEAGARYQYATQAAQCNATTDVV
FT                   AGPHALTQVGQLSYCYDANGNQTRTFSGTNQTRAVSYTSFDKVSAITANNETTRFTYGA
FT                   DRNRYKRENIKEGKTRTSFYFGNIELNQNELGTGYDLKRYIAGYGLQTHYASTGVKQLQ
FT                   YLLKDHLGSIDVVLNDSNAIVGAMSFGAFGERRAAENWSPWSAAQFSNKISELRAISIR
FT                   GFTGHEHVDHANIIHMNGRIYDSYTGRFMQADPMVQAPENGQNLNRYSYVLNNPLSYTD
FT                   PSGYFFSKLWDNIKPFVGVIVGVALGAFCGGCTAPMIGALAGAAGAAANGGNIVIGAFV
FT                   GAFSAGAFGEIGSSLPFDSSPVANVFAKGVVGAFTNGIQGGELGHGFLSAGFGGVVSGN
FT                   IMGIGGGAEAYMPVRTLIAAIAGGTISRLTGGKFANGATTAGFAHLFNAESAKTVTSDS
FT                   DYDGESELIGEKRAAFESEFKEMQKEVRNLKSFSGKGGLDKATKFLEKRVHQLAVKYDV
FT                   EINANLSQATNGLWAIDGIGTSYNRHGVNVIAANIGTAKGWTWKANWHSHGAGYNTNIK
FT                   ADTYVSNQMAQAGYNLRWFYTTQSGFSAVTKEF"
FT   sig_peptide     153873..153944
FT                   /locus_tag="Sden_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.921) with cleavage site probability 0.758 at
FT                   residue 24"
FT   gene            161368..161853
FT                   /locus_tag="Sden_0138"
FT   CDS_pept        161368..161853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53435"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ1"
FT                   /protein_id="ABE53435.1"
FT                   /translation="MRVNHYLCKIITFLFVFYISQSTAEAIKHPNRYMVGDILDDSEND
FT                   LSGQYIVVDGFILFESGMSEVAYLYENISDFILGRKFVYVELTKSDYNEYKHLDFCGVG
FT                   VLGYAGRNGLSNNLLITKIKKITASETVLALAEGSFNYKTRAPKPDYQCYLKRILHK"
FT   gene            162751..163077
FT                   /locus_tag="Sden_0139"
FT   CDS_pept        162751..163077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53436"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SZ0"
FT                   /protein_id="ABE53436.1"
FT                   /translation="MKYLILLAVVCLLLPSFASAGELTKGATILEVANHATGSGKNFAI
FT                   QVEGGIGPCNGWIYFLEDSAASAATYSQAFSIALTAFSSDKKVRVHNFTDDACTGARFI
FT                   SISK"
FT   sig_peptide     162751..162813
FT                   /locus_tag="Sden_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            163270..163581
FT                   /locus_tag="Sden_0140"
FT   CDS_pept        163270..163581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53437"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY9"
FT                   /protein_id="ABE53437.1"
FT                   /translation="MFKFVTILLLSLLLTSYSASAAVTCTGTVDQIYKWNSMERVSIML
FT                   SSTNKWINMPTKTDEAMALMAFAANKPVSLYWAATDVTTCKDGWEHNRSLEGYWVIMK"
FT   sig_peptide     163270..163335
FT                   /locus_tag="Sden_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.558 at
FT                   residue 22"
FT   gene            163641..164006
FT                   /locus_tag="Sden_0141"
FT   CDS_pept        163641..164006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53438"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY8"
FT                   /protein_id="ABE53438.1"
FT                   /translation="MKDHFKEIVVRVTILLSLCGLLVSSFSAFSATETTATTSINRLIS
FT                   YNQYGGGDVAFTVVHPSAGCDGYWINKADPGFDANMSMILAAYHAKAPVRVHGLNDQKW
FT                   QGTGSFWCKLYAIEHIQ"
FT   sig_peptide     163641..163733
FT                   /locus_tag="Sden_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            164021..164746
FT                   /locus_tag="Sden_0142"
FT   CDS_pept        164021..164746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53439"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY7"
FT                   /protein_id="ABE53439.1"
FT                   /translation="MINSFKAIKRLGLGCTFVFGAVLVSGCQSAPELAKASAQTQPKIE
FT                   IGFTEPKQIVFQGKGAGAGIALMSAMGPVGIAVGVAIDAGIAKDIGTVSMQQGFDIDAM
FT                   LQQGLSAATTQDYQLKISAAEPSSVSENEPAVELSTEHTTEPSTELSIEDAAKVPKLQL
FT                   VRFGYKIVPGENDATSAELIIQWHDNNHALQQIHYPNDFELSPNAPLAQLRTDGKLANK
FT                   LMQAAIQAMWQRYFEQTTP"
FT   sig_peptide     164021..164110
FT                   /locus_tag="Sden_0142"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.709 at
FT                   residue 30"
FT   gene            164781..164996
FT                   /locus_tag="Sden_0143"
FT   CDS_pept        164781..164996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53440"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY6"
FT                   /protein_id="ABE53440.1"
FT                   /translation="MKKLLIVLLLGFCVNANADHYYRNVTITGAGIYGSGGKSILFVDF
FT                   IGDKAGMTACATTKRLAIDSSTPQFK"
FT   sig_peptide     164781..164837
FT                   /locus_tag="Sden_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.984 at
FT                   residue 19"
FT   gene            165174..165551
FT                   /locus_tag="Sden_0144"
FT   CDS_pept        165174..165551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53441"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY5"
FT                   /protein_id="ABE53441.1"
FT                   /translation="MDGFLKDETMIKKMKCLSTLLLVSAVGLMAPTTVLASNQTGIVKK
FT                   VLVRTDGLHWFYLEGARSERPACSAQHEYWMIKDENSVYGKSQFSMLLTAYASKSKVTI
FT                   NGNGTCSRWGDGEDINTIILE"
FT   sig_peptide     165174..165284
FT                   /locus_tag="Sden_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 37"
FT   gene            167067..167405
FT                   /locus_tag="Sden_0145"
FT   CDS_pept        167067..167405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53442"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY4"
FT                   /protein_id="ABE53442.1"
FT                   /translation="MRKIIATLMLSALILSSHQSIAAGPEWITYAKVTKVVVTANGGVN
FT                   IALSPALSGCTSQSGYGERYASLYPDHPGLDKIHSIVLAAFMADKPIAVWLSDSTCRIG
FT                   EVELGGRQ"
FT   sig_peptide     167067..167135
FT                   /locus_tag="Sden_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            167447..167779
FT                   /locus_tag="Sden_0146"
FT   CDS_pept        167447..167779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53443"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY3"
FT                   /protein_id="ABE53443.1"
FT                   /translation="MYMEYTVNLRMMLLTISLFFSTFSHGAESYLTGNIVNITAVEQGM
FT                   LIMLDTGVPGNCEGTPYNWMLIKQEHTVMISVTLAMWMSGKKTFTVYTKERASSFCEVG
FT                   QIDPAE"
FT   sig_peptide     167447..167527
FT                   /locus_tag="Sden_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            complement(167832..168176)
FT                   /locus_tag="Sden_0147"
FT   CDS_pept        complement(167832..168176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53444"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY2"
FT                   /protein_id="ABE53444.1"
FT                   /translation="MIKGLSVAIALLISTSALSQEWVEVEDASKLLWQMSANGTVWFRN
FT                   LNEFDAKQAGCCYSYALDTTTAGGKSIWSTILAKMAAHKRITLGFPAVGTNANLQLLNY
FT                   IGRHSHASNE"
FT   sig_peptide     complement(168117..168176)
FT                   /locus_tag="Sden_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            168388..168732
FT                   /locus_tag="Sden_0148"
FT   CDS_pept        168388..168732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53445"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY1"
FT                   /protein_id="ABE53445.1"
FT                   /translation="MKKIKVLLGLALLACSAAALAEDKCTSWGCISTVSTLYTNADGAI
FT                   YVGTPLDESLANCTSVSGAFFTLNPTAGNAKEMYASVLAAHMSNKKIMLRVKEGHPTCE
FT                   LAYVTLDTSY"
FT   sig_peptide     168388..168453
FT                   /locus_tag="Sden_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 22"
FT   gene            169214..170710
FT                   /locus_tag="Sden_0149"
FT   CDS_pept        169214..170710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0149"
FT                   /product="Sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53446"
FT                   /db_xref="GOA:Q12SY0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SY0"
FT                   /protein_id="ABE53446.1"
FT                   /translation="MPMLTYVSLGLYFVVMLAIGLFAYRRSTSDVSGYILGGRQVSPQV
FT                   TALSAGASDMSGWMLMGLPGAMFLVGFETIYIAVGLLIGALVNYLIVAPKLRVYTEVAH
FT                   NSLTIPEFFAKRFNAPNSNIRIVAAVIIVVFFTLYTSAGLVAGGKLFESAFNLNYELGL
FT                   IVTLGVVVSYTLLGGFLAVSLTDFVQGCIMFVALILVPVVAFQEFSSADKMMDFAYQSI
FT                   PHFSEGMQNVTMLGLISSLSWGLGYFGQPHIIVRFMAIRSVSDVKIARRIGMSWMTVTI
FT                   VGALATGLVGIAYANKFEMTLTDPETIFIVFSELLFHPLISGFLLAAILAAIMSTISSQ
FT                   LLVSSSSLTEDIYRVMSNKEASEKDMVKLGRFGVAGVGIVASLLALDRSNSILSLVSNA
FT                   WAGFGAAFGPLVLFSLYKANLTHKAAMAGIISGAVTVLFWIYAPVLADGNSLTSIMYEM
FT                   IPGFVVSSVVIWVVSYLDSAPCEQTTELFHEAGRVMAEQK"
FT   gene            170727..171836
FT                   /locus_tag="Sden_0150"
FT   CDS_pept        170727..171836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0150"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53447"
FT                   /db_xref="GOA:Q12SX9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SX9"
FT                   /protein_id="ABE53447.1"
FT                   /translation="MSKLNWKRIVVKVGSALIAPNKQGCSSHYLLGIAQFIANCRAQGI
FT                   QVVLVSSGSVAAGRHHFSEVAEPNVTLKKAMAAAGQADMMAIWDRLFDFPSAQLLVTHG
FT                   DLRDRERYVSIKDTILTLLEHGLLPIINENDAVTTDKLRVGDNDNLSAMVAAAADADAL
FT                   IICSDVAGLYTKNPQQHDDAKLIKQVNHIDAEIYAMAGGATAGGVGTGGMHTKIQAAEK
FT                   AISHGIETVIVNGFEADNFNRLLKGENPGTLFTPFDKPMQEHLHWMTHTSQVQGELVVE
FT                   NDFDGALDGLPNQLTSDDVMAVNGEFSVGDTILVRRDDGTKLAKAQSNYSSCLLNFIAD
FT                   QDDGAFADEFQQKTGSIISDKHIAILENT"
FT   gene            171849..173111
FT                   /locus_tag="Sden_0151"
FT   CDS_pept        171849..173111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0151"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53448"
FT                   /db_xref="GOA:Q12SX8"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SX8"
FT                   /protein_id="ABE53448.1"
FT                   /translation="MNNQSLSLIETLSRDAATAAQTLAVLDEQTKNTVLLDMAKSLRAS
FT                   TAEILAANQQDLTRAEEDNLGSAMLDRLLLTPERIEAMAQGIETIVSLPDPVGITRDLS
FT                   ERPNGIKIRKMRIPLGVVCMIYEARPNVTADAGALCFKSGNAVVLRGGKEALQSSLVIA
FT                   KVLQAVLQQHKLPKALITVIPDPDRGLMMELMQQRAYIDVIIPRGGEGLINFVTDNSKI
FT                   PVIQHFKGVCHLYVDKDADLDNAMALLLNGKTQRTGVCNALEGLIVHQDVAEAFLSKAA
FT                   VELASHKVKINACSRAAKYFTGCTVLDDSEFGQEYLDLEIAIRIVDDFDHAIDHIRAFG
FT                   SHHTEVISTKNDATAMRFQRTVDASVVMVNASSRFSDGGELGLGAEIGIATSKLHAYGP
FT                   MGLESLTAEKYLVNGTGQVRS"
FT   gene            173414..174934
FT                   /locus_tag="Sden_0152"
FT   CDS_pept        173414..174934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0152"
FT                   /product="PKD"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53449"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SX7"
FT                   /protein_id="ABE53449.1"
FT                   /translation="MKITSYLVFPFISLSLIACGGGSSDSTPAVSIAENNAPTARVSLD
FT                   NTSVNMGDLVLVQGGQSSDPDSDSLSYLWQVTDPQGATLALNDASNKQLSFNVVMAGEY
FT                   QVSLTVSDGKGANDKASLVLKVAGAKAITAVISAAATVKQGNSVTLSGESSRLKTDTRF
FT                   SWSLLEKPAASEAVLTSIDTVETYFTADKLGEYKVQLSLKDQDNNTDVAQSVITATSVT
FT                   SNTAPVASITAASTVLKVNEELTLSAAQSTDADGDTLSFSWQVIQKPDNANVKLEQATT
FT                   QLAKFSASSLGEYHVELTVSDGKLQGKKQLKLQVTSTNRAPVVSINLNQNSPKQGETIN
FT                   LQGVGVDPDNDSLRYTWSLVSKPSDSSSEFSSPTQQNTQLYLDAKGDYLVSLIATDNEL
FT                   TSEPATKKISVAVNHPPVITKVLYDIQVTAGSPTKLEALATDPEGQPMTFEWRLVDKDP
FT                   GTNGTFSAPTQPVTEFTPDLPGWYTLQVSVSDGIQKSLLPTTLLIMAK"
FT   sig_peptide     173414..173488
FT                   /locus_tag="Sden_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.470 at
FT                   residue 25"
FT   gene            175058..176086
FT                   /locus_tag="Sden_0153"
FT   CDS_pept        175058..176086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0153"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53450"
FT                   /db_xref="GOA:Q12SX6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SX6"
FT                   /protein_id="ABE53450.1"
FT                   /translation="MTVSEPWHSLKMHNTLGLAQTCHTLLEARTTEQLIQLSQQAFDGA
FT                   KPMLVLGGGSNLVFTDDFDGVVIQVLSKGIAVTQDEDYFYLSVQAGESWHGLVEYCLAH
FT                   NMPGLENLALIPGTVGAAPIQNVGAYGVEFNQVCDWVEYQDLTTATLIRLDNAACEFDY
FT                   RESIFKQQLKNRAVITQLQIKLAKHWQPVLNYGPLQHLVADSVTPQDVFDCVCQVRQEK
FT                   LPDPQVIGNVGSFFKNPLISAQQYLELMKQHSDIVGYAQEDGQIKLAAAWLIDQAGLKG
FT                   MSVGGAAVHKAQALVLINQDNATGEHICDLAKKVMAEVEAKFGVKLAAEPRIMGRQGEI
FT                   SL"
FT   gene            176083..177054
FT                   /locus_tag="Sden_0154"
FT   CDS_pept        176083..177054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0154"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53451"
FT                   /db_xref="GOA:Q12SX5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SX5"
FT                   /protein_id="ABE53451.1"
FT                   /translation="MSIQWHNKRQILALLSSDHFVSGEQLAQELAISRSAIQQQIEAMG
FT                   EFGIDIYSVKGKGYKLATPICLLDETQLLQQLSNRCFYFNDIPSTNAFMLTHGQELKSG
FT                   DICLAEYQSAGRGRRGRQWLSPYGHHIYASLYWRLEQGMPQAMGLSLVVACSIVTVLKQ
FT                   MGVSGLGLKWPNDIYLNDKKLAGILIELINSAEQACQLVIGFGINMSMSASQGELIDQP
FT                   WSDLSTLESMPDKTELVIAVHKQLKQDLKRFEAAGLKDFIDAWQADDIFMGREVSLLMA
FT                   PNEVTGIYKGIDEQGAVLLQTAQGLQAFVGGEISLRATNKMA"
FT   gene            complement(177071..177616)
FT                   /locus_tag="Sden_0155"
FT   CDS_pept        complement(177071..177616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53452"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SX4"
FT                   /protein_id="ABE53452.1"
FT                   /translation="MNTILVTDIFGKTAALDEIAANIAHEVEVLDPYNAKIMNFNDEAE
FT                   AYRYFASEIGLEAYAALLLETITAKTGPIMLIGFSVGAAAIWKISDLAAASNIASAIGF
FT                   YGSQIRYSADIVPLFPVKLIFPAAEPYFSISELIATLSNTDNVQIQQVTSLHGFMNRHS
FT                   QNFDTADYEQFMKELSAI"
FT   gene            complement(177642..178586)
FT                   /locus_tag="Sden_0156"
FT   CDS_pept        complement(177642..178586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0156"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53453"
FT                   /db_xref="GOA:Q12SX3"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SX3"
FT                   /protein_id="ABE53453.1"
FT                   /translation="MANSIQDALYLSFEREQWAELRKSVPLTLSEAELTQLKGMNEKLS
FT                   LDEVTDIYLPLSRLLNLIVGAKQQRGLVIDKFLSQQAPKSPYIISIAGSVAVGKSTTAR
FT                   ILQTLLQRWPEHPKVDLVTTDGFLYPLAELKRKGLLQRKGFPESYDTKLLGEFISAVKS
FT                   GDNNVKVPLYSHITYDRLTDQHQVIAQPDIIILEGLNVLQTGLDTLVETRRPFVSDFVD
FT                   FSIYVDADESLLKDWYQQRFLQFRHGAFNDPRSFFHHYATLSDGEANAIAANIWDTING
FT                   PNLQLNIQPTRERAKLILKKGKDHLISQVLMRR"
FT   gene            178816..178891
FT                   /locus_tag="Sden_R0004"
FT                   /note="tRNA-Thr1"
FT   tRNA            178816..178891
FT                   /locus_tag="Sden_R0004"
FT                   /product="tRNA-Thr"
FT   gene            178901..178985
FT                   /locus_tag="Sden_R0005"
FT                   /note="tRNA-Tyr1"
FT   tRNA            178901..178985
FT                   /locus_tag="Sden_R0005"
FT                   /product="tRNA-Tyr"
FT   gene            179022..179095
FT                   /locus_tag="Sden_R0006"
FT                   /note="tRNA-Gly1"
FT   tRNA            179022..179095
FT                   /locus_tag="Sden_R0006"
FT                   /product="tRNA-Gly"
FT   gene            179455..179826
FT                   /locus_tag="Sden_0157"
FT   CDS_pept        179455..179826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0157"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53454"
FT                   /db_xref="GOA:Q12SX2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SX2"
FT                   /protein_id="ABE53454.1"
FT                   /translation="MTTNTENQTNSLDIVKWGIVIVLLAAAIIGNQMFGEASVVVRALG
FT                   VIVAFVIAGLIALQTVKGKIALAFAQEAHIEVRKVVWPTRQEALNTTFIVLVATAIVAL
FT                   ILWGFDAVLLRLVNLITGV"
FT   gene            179836..180387
FT                   /locus_tag="Sden_0158"
FT   CDS_pept        179836..180387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0158"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53455"
FT                   /db_xref="GOA:Q12SX1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SX1"
FT                   /protein_id="ABE53455.1"
FT                   /translation="MTEAKEVKKRWYVIQAFSGYEGRVSKTLLEHIKMHNMEDYFGEIL
FT                   VPTEEVVEMRAGQRRKSERKFFPGYVLVQMEMNDDSWHLVKSIPRVMGFIGGTSDRPAP
FT                   ISDKEADAILQRLQDTVESPTHRIIYEPGEVVRVCDGPFADFNGTVEEVDYEKNRVKVS
FT                   VMIFGRSTPVELDFHQVEKS"
FT   gene            180516..180944
FT                   /locus_tag="Sden_0159"
FT   CDS_pept        180516..180944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0159"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53456"
FT                   /db_xref="GOA:Q12SX0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SX0"
FT                   /protein_id="ABE53456.1"
FT                   /translation="MAKKIEAYIKLQVKSGSANPSPPVGPALGQKGVNIMEFCKAFNAR
FT                   TEKMEKGMPIPVVITVYSDRSFTFETKTPPASYLLLKAANLKSGSARPNTVKVGTIKRN
FT                   AVQEIAELKAADMTGADVEAMTRTIEGTARSMGLVVED"
FT   gene            180949..181650
FT                   /locus_tag="Sden_0160"
FT   CDS_pept        180949..181650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0160"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53457"
FT                   /db_xref="GOA:Q12SW9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW9"
FT                   /protein_id="ABE53457.1"
FT                   /translation="MAKLTKRMRVIRDKVDGMKSYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDPRKSDQNVRGATVLPHGTGRDVRVAVFTQGANAEAAKAAGAELVGMEELAEQI
FT                   KAGEMNFDVVIASPDAMRVVGMLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFTTEQLKENLEALVSALKKAKPAVAKGVFVKKISISTTMGAGV
FT                   AVDQATLETAN"
FT   gene            181935..182435
FT                   /locus_tag="Sden_0161"
FT   CDS_pept        181935..182435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0161"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53458"
FT                   /db_xref="GOA:Q12SW8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW8"
FT                   /protein_id="ABE53458.1"
FT                   /translation="MALRLEDKKAIVAEVNEAAKGALSAVVADSRGVTVGAMTVLRKAA
FT                   RANGVYVRVVRNTLAKRAVEGTAFECLAETFTGPTLIAFSNEHPGAAARLLKDFAKGNA
FT                   KFEVKGAAFEGMFIPAVDIDRLAKLPTYDEALAQLMMTMKEASAGKFVRTLAALRDQKQ
FT                   EAA"
FT   gene            182490..182858
FT                   /locus_tag="Sden_0162"
FT   CDS_pept        182490..182858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0162"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53459"
FT                   /db_xref="GOA:Q12SW7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW7"
FT                   /protein_id="ABE53459.1"
FT                   /translation="MSITKDQILEAFAAMSVMDVVELIEAMEEKFGVSAAAATVAVGGD
FT                   AGAAAEEQTEFDVVMTSHGDNKVAVIKAVRGATGLGLKEAKTMAESSPIAIKEGVSKEE
FT                   AEALKKDLEAAGAVVEIK"
FT   gene            183091..187122
FT                   /locus_tag="Sden_0163"
FT   CDS_pept        183091..187122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0163"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53460"
FT                   /db_xref="GOA:Q12SW6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW6"
FT                   /protein_id="ABE53460.1"
FT                   /translation="MVYSYSEKKRIRKDFGKRPQVLDIPYLLSIQLDSFKKFTDQDPTG
FT                   ERGFEAAFRSVFPIKSFSGYSELQYVSYKLGEPVFDVKECQIRGVTYSAPLRVKLRMVL
FT                   FDREAAAGTVKDIKEQEVYMGDIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDHDRGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDALFVRIDRRRKLPATIMLRALEYSTQDILD
FT                   LFFERIQFKIKKDSLVMALVPDRLRGETASYDIKAADGSVLVEAGRRITARHIKQLEQS
FT                   NTTELEVPVDYIVGKYAAQDYIDEDTGEVLVSANNEISLEDLAKLSIAGIKEIDTLFIN
FT                   DLDHGAYISDTLRIDSTTNRLEALVEIYRMMRPGEPPTKDAAEALFQNLFFSEERYDLS
FT                   KVGRMKFNRRLEIAEDEGNGVLSKDDIVCVMKKIIEIRNGYDEVDDIDHLGNRRIRSVG
FT                   EMAENQFRVGLVRVERAVRERLSLGDLNELMPQDLINAKPISAAVKEFFGSSQLSQFMD
FT                   QNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLINSL
FT                   ASFARTNSYGFLETPYRKVVEGVITDEVEYLSAIEEGRYVIAQANIEVDSTGRMVEEQI
FT                   ACRHKGESTFMRAADIQYMDVSPQQIISVAASLIPFLEHDDANRALMGANMQRQAVPTL
FT                   RADKPLVGTGIERTLAVDSGVVVVAKRGGVVDYVDASRIVVKVNEDELRPGEAGIDIYN
FT                   LTKYTRSNQNTCINQRPCCFVGEPVVRGDVLADGPSTDLGELALGQNMRIAFMPWNGYN
FT                   FEDSILISERVAQEDRFTTIHIQELSCIARDTKLGSEEITADIPNVGESALSKLDESGI
FT                   VYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVKGTII
FT                   DVQVFTRDGVEKDKRALEIEEMHVAQARKDLGEEFKILEEGVLSRARNLLLSAGYSEAK
FT                   LAELPRKDVLIQVIDDEAKQTELEQLAEQHEELKADFDKKFEIKRRKITQGDDLAPGVL
FT                   KIVKVYLAVKRTIQPGDKMAGRHGNKGVISKICPVEDMPYDEEGNPVDIVLNPLGVPSR
FT                   MNIGQVLEVHMGAAAKGIGNKITAMLEEQREIAELRGYIKQVYELGDDVLQRVDIDSFS
FT                   DDEVVRLATHLKGGIPIATPAFDGAKEKEIKQMLALAGLPESGQLTLCDGRTGNEFERK
FT                   VTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGA
FT                   AYTLQEMLTVKSDDVNGRTQMYKNIVDGNHQMQPGMPESFNVLLKEIRSLGINIELDQE
FT                   "
FT   gene            187204..191436
FT                   /locus_tag="Sden_0164"
FT   CDS_pept        187204..191436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0164"
FT                   /product="DNA-directed RNA polymerase, subunit beta-prime"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53461"
FT                   /db_xref="GOA:Q12SW5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW5"
FT                   /protein_id="ABE53461.1"
FT                   /translation="MKDLLKFLKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETIN
FT                   YRTFKPEREGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVIEPGMTTLERGQMLTEE
FT                   TYLDALEEYGDEFEAKMGAEAVLELLRAINLEEQIEQMREELPSINSETRRKKVTKRLK
FT                   LMEAFFTSGNKPEWMILKVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLEGRGLATTIKAAKK
FT                   MVEREQAEVWDVLDEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPVITPSQDVVLGLYYTSRER
FT                   INGRGEGMVFADVSEVEKAYATGVAEIHARVKVRITETSIDADGEKTKATRIVDTTIGR
FT                   ALLSLILPEGLSYDLVNQNMGKKQISKLLNTCYRQLGLKDTVIFADQLMYTGFRFATIS
FT                   GASVGIDDMVIPDEKYTLVADAEAEVLEIQEQFQSGLVTAGERYNKVIDIWASANEKVS
FT                   KAMMENLSVETVINRDGVEEKQASFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGAEHGLTMKPLIEGGDVVEPLRERVLGRVVAIDVIKPGSEEILAPRNTLLDEAWCDI
FT                   LEEHSVDEVIVRSVITCETDFGVCAACYGRDLARGHIINHGEAIGVVAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKNAGSLKLHNAKHVSNIDGKLVIVSRSSELAIIDELG
FT                   REKERYKVPYGTVLEKLEDSEVTAGEIIANWDPHTHPIISEVAGSVKFVDMIDGVTMTR
FT                   QTDELTGLSSVVVLDVGARTSAGKELRPAIRLVGADGNDLMIPGTDVPAQYFLPGNAIV
FT                   AKDDNAKINVGDALARIPQESSKTRDITGGLPRVADLFEARKPKEPAILAEISGTISFG
FT                   KETKGKRRLVITPADGSEHYEEMIPKWRNLNVFEGEKVERGEVIADGPEAAHDILRLRG
FT                   IHNVANYIVNEVQDVYRLQGVKINDKHIEVIIRQMLRKCLITSAGDTEFLEGEQAEVAR
FT                   VKIANRELIAQGKTPATFERELLGITKASLATESFISAASFQETTRVLTEAAVGGKSDQ
FT                   LRGLKENVIVGRLIPAGTGYAYHKKRNALRATEDAKKAAAKIAPAVTTASEAEQNLADL
FT                   LNLAGGEE"
FT   gene            191615..191989
FT                   /locus_tag="Sden_0165"
FT   CDS_pept        191615..191989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0165"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53462"
FT                   /db_xref="GOA:Q12SW4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW4"
FT                   /protein_id="ABE53462.1"
FT                   /translation="MATVNQLVRKPRAPKVEKTNVPALNACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVNTRRQGRSKYGAKRPKS"
FT   gene            192070..192540
FT                   /locus_tag="Sden_0166"
FT   CDS_pept        192070..192540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0166"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53463"
FT                   /db_xref="GOA:Q12SW3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW3"
FT                   /protein_id="ABE53463.1"
FT                   /translation="MPRRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYK
FT                   ALDVVAEKKSEAHLSILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWL
FT                   VEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            192619..194715
FT                   /locus_tag="Sden_0167"
FT   CDS_pept        192619..194715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0167"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53464"
FT                   /db_xref="GOA:Q12SW2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW2"
FT                   /protein_id="ABE53464.1"
FT                   /translation="MARTTPIERYRNIGIVAHVDAGKTTTTERVLFYTGLSHKIGEVHD
FT                   GAATTDWMVQEQERGITITSAAVTTFWRGMDAQFTEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQADKYRVPRMVFVNKMDRAGANFDRVVDQIRTRLG
FT                   ATCVPIQMNIGAEEEFKGVIDLIKMKAINWSEEDQGMTFSYEEIPAHLAAKAAEMHEYL
FT                   VEAAAEASEELMDKYLETGNLSELEIKQALRQRTIDNEIVLATCGSAFKNKGVQAVLDA
FT                   VVDYLPAPIDVPAIKGIDEHDAEVERPSDDNAPFAALAFKIATDPFVGTLTFIRVYSGV
FT                   LQSGSGVYNSVKEKRERVGRIVQMHANDRTELKEVRAGDIAAAIGLKDVTTGDTLCDND
FT                   HRVILERMEFPEPVITIAVEPRSQADQDKMAIALQKLAAEDPSFRVETDEDSAQTLISG
FT                   MGELHLDIIVDRMRREFGVECNVGKPQVSYRETIRSTVEVEGKFVRQSGGRGQFGHVWL
FT                   RLEPLEEGAGYEFVNEVVGGVIPREYIPAVDKGIQEQMKNGVLASFPVLDVKVTLFDGS
FT                   YHDVDSNEMAFKIAGSMGFKKGALLANPSLLEPCMKVEVTTPADYMGDVVGDLNRRRGL
FT                   IDGMDDGIGGVKLIHAVVPLAEMFGYATDLRSATQGRASYSMEFLKYSDAPQNIAKAII
FT                   ESRS"
FT   gene            194785..195969
FT                   /locus_tag="Sden_0168"
FT   CDS_pept        194785..195969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0168"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53465"
FT                   /db_xref="GOA:Q12SW1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW1"
FT                   /protein_id="ABE53465.1"
FT                   /translation="MAKAKFERKKPHVNVGTIGHVDHGKTTLTAAISAVLSKTYGGEVR
FT                   NFAQIDNAPEERERGITINTSHIEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGQPEWEAKILELAEALDTYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVRVGDEVEIVGVKATTKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKRDDVERGQVLAKPASINPHTTFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIYPIAMDDGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            196309..196620
FT                   /locus_tag="Sden_0169"
FT   CDS_pept        196309..196620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0169"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53466"
FT                   /db_xref="GOA:Q12SW0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SW0"
FT                   /protein_id="ABE53466.1"
FT                   /translation="MQNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            196648..197286
FT                   /locus_tag="Sden_0170"
FT   CDS_pept        196648..197286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0170"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53467"
FT                   /db_xref="GOA:Q12SV9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV9"
FT                   /protein_id="ABE53467.1"
FT                   /translation="MAIGLIGRKVGMTRIFTEDGVSIPVTVIEVAGNRVTQVKTLETDG
FT                   YRALQVTTGTKKANRITKAEAGHFAKGGVEAGRGLWEMRLADGEGEGIEVGAELNVDIF
FT                   AETVKVDVTGQSKGKGFQGGVKRWNFRTQDMTHGNSLAHRSNGSIGQNQTPGRVFKGKK
FT                   MSGHMGAEQVTTQNLHVVRVDSERNLILVRGAVPGATNGDLIIKPAVKA"
FT   gene            197304..197909
FT                   /locus_tag="Sden_0171"
FT   CDS_pept        197304..197909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0171"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53468"
FT                   /db_xref="GOA:Q12SV8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV8"
FT                   /protein_id="ABE53468.1"
FT                   /translation="MELVLKDAQSALEVSETTFGRDFNEALVHQVVVAYAANARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKGPIWRGGGVTFAAKTQDHSQKVNKKMYRGA
FT                   LKSILSELVRQERLVVVESFGVEAPKTKELKAKLKAMNLEDVLIVTAEVDENLFLAARN
FT                   LYKVDVRDVAGLDPVSLIAFNTVLVTADAVKQIEEMLA"
FT   gene            197906..198208
FT                   /locus_tag="Sden_0172"
FT   CDS_pept        197906..198208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0172"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53469"
FT                   /db_xref="GOA:Q12SV7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV7"
FT                   /protein_id="ABE53469.1"
FT                   /translation="MIREERLLKVILAPHISEKSTVVAEKTNTVVFRVAIDATKAEIKA
FT                   AVAKLFEVEVDSVRTLVNKGKTKRTGGRVGRRSDWKKAYVTLAAGADIDFVGGAE"
FT   gene            198225..199049
FT                   /locus_tag="Sden_0173"
FT   CDS_pept        198225..199049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0173"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53470"
FT                   /db_xref="GOA:Q12SV6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV6"
FT                   /protein_id="ABE53470.1"
FT                   /translation="MAVIKCKPTSPGRRHVVKVVNTDLHKGKPFAALLAKKSKSGGRNN
FT                   TGRITVRHVGGGHKQHYRLIDFKRNKDGIPAKVERIEYDPNRTAHIALVLYADGERRYI
FT                   LAAKGMKSGDPIQSGVGSEIKTGNSMPLRNIPVGSVVHAVEMKPGKGAQIARSAGAYVQ
FT                   VIARDGAYATLRLRSGEMRKVPVDCRATFGEVGNAEHMLRQLGKAGAKRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGVPTKGYKTRSNKRTDKYIVRRRNK"
FT   gene            199065..199343
FT                   /locus_tag="Sden_0174"
FT   CDS_pept        199065..199343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0174"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53471"
FT                   /db_xref="GOA:Q12SV5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV5"
FT                   /protein_id="ABE53471.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAMEAGDKKPIKTWSRRSMIIPNMI
FT                   GLTIAVHNGRQHVPVFVTDEMIGHKLGEFSPTRTYRGHAADKKAKKR"
FT   gene            199359..199691
FT                   /locus_tag="Sden_0175"
FT   CDS_pept        199359..199691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0175"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53472"
FT                   /db_xref="GOA:Q12SV4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV4"
FT                   /protein_id="ABE53472.1"
FT                   /translation="MEVLAKHRFARTSAQKARLVADQIRGLPVSKALEILTFSPKKAAV
FT                   LVKKVLDSAIANAEHNEGADIDELRVGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHIT
FT                   VVVADR"
FT   gene            199704..200393
FT                   /locus_tag="Sden_0176"
FT   CDS_pept        199704..200393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0176"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53473"
FT                   /db_xref="GOA:Q12SV3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV3"
FT                   /protein_id="ABE53473.1"
FT                   /translation="MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRQYLTE
FT                   KLKAASVSKIVIERPAKSIRVTIHTARPGVVIGKKGEDVEVLRAQVAKITGTTAQINIA
FT                   EIRKPELDAKLVADSIAQQLERRVMFRRAMKRAVQNAMRIGAQGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYSTSESHTQYGVIGVKVWIFKGEVLDGLVPQIEEPKQQP
FT                   KRKPRAK"
FT   gene            200405..200815
FT                   /locus_tag="Sden_0177"
FT   CDS_pept        200405..200815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0177"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53474"
FT                   /db_xref="GOA:Q12SV2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV2"
FT                   /protein_id="ABE53474.1"
FT                   /translation="MLQPKRMKFRKMFKGRNRGLANGTEVSFGTFGLKAVGRGRLTARQ
FT                   IESARRAMTRHVKRQGQIWIRVFPDKPITSKPLEVRMGKGKGNVEYWVCQIQPGKVLYE
FT                   MDGVPESLAREAFALASAKLPIKTTFVTKTVM"
FT   gene            200815..201006
FT                   /locus_tag="Sden_0178"
FT   CDS_pept        200815..201006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0178"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53475"
FT                   /db_xref="GOA:Q12SV1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV1"
FT                   /protein_id="ABE53475.1"
FT                   /translation="MKASELREKSVEELNTELLGLLREQFNLRMQHATGQLTQTNQLKL
FT                   VRRNIARVKTIITSKAGA"
FT   gene            201006..201254
FT                   /locus_tag="Sden_0179"
FT   CDS_pept        201006..201254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0179"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53476"
FT                   /db_xref="GOA:Q12SV0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SV0"
FT                   /protein_id="ABE53476.1"
FT                   /translation="MSDKIRTLQGRVTSNKMDKSITVAIERQVKHPLYGKYIKRTTKIH
FT                   AHDETNQCNEGDVVTISQCRPLSKTKSWALVEVVTKA"
FT   gene            201434..201802
FT                   /locus_tag="Sden_0180"
FT   CDS_pept        201434..201802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0180"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53477"
FT                   /db_xref="GOA:Q12SU9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU9"
FT                   /protein_id="ABE53477.1"
FT                   /translation="MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKE
FT                   AIPRAKAKKGDVYNAVVVRTKKGVRRPDGSVIRFDRNAAVLLNANLAPIGTRIFGPVTR
FT                   ELRTEQFMKIVSLAPEVL"
FT   gene            201814..202128
FT                   /locus_tag="Sden_0181"
FT   CDS_pept        201814..202128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0181"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53478"
FT                   /db_xref="GOA:Q12SU8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU8"
FT                   /protein_id="ABE53478.1"
FT                   /translation="MAAKIRREDEIIVLAGKDKGKRAKVSQVLPTGKLIVEGINLVKKH
FT                   QKPNPQLGVTGGVIEKEAPIQTSNVAIFNQATGKADRVGFRFEDGKKVRFFKSNSELIK
FT                   "
FT   gene            202141..202680
FT                   /locus_tag="Sden_0182"
FT   CDS_pept        202141..202680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0182"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53479"
FT                   /db_xref="GOA:Q12SU7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU7"
FT                   /protein_id="ABE53479.1"
FT                   /translation="MAKLHDKYQETVVAELAKKFGYSSVMQVPRIEKITLNMGVGEAVA
FT                   DKKVMEHALRDMTAIAGQKPIVTVARKSVAGFKIREGYPIGCKVTLRGERMWEFLERLV
FT                   DIAIPRIRDFRGLSAKAFDGRGNYAMGVREQIIFPEIDYDKIDKIRGMDIVITTSAKTD
FT                   EEGHALLTAFNFPFKK"
FT   gene            202691..202996
FT                   /locus_tag="Sden_0183"
FT   CDS_pept        202691..202996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0183"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53480"
FT                   /db_xref="GOA:Q12SU6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU6"
FT                   /protein_id="ABE53480.1"
FT                   /translation="MAKTSMKAREAKRAQLVTKYAEKRLALKAIISAPATSEEDRWDAV
FT                   LKLQALPRDSSLSRKRNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW"
FT   gene            203021..203413
FT                   /locus_tag="Sden_0184"
FT   CDS_pept        203021..203413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0184"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53481"
FT                   /db_xref="GOA:Q12SU5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU5"
FT                   /protein_id="ABE53481.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANHVSVKMPSAKLKVAIAKLLQDEGF
FT                   ITGYAVADEAKPELEITLKYFQGKPVVETIQRVSRPGLRIYKGKDELPKVMGGLGIAIV
FT                   STSQGLMTDRAARQNGTGGEVICYVA"
FT   gene            203425..203958
FT                   /locus_tag="Sden_0185"
FT   CDS_pept        203425..203958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0185"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53482"
FT                   /db_xref="GOA:Q12SU4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU4"
FT                   /protein_id="ABE53482.1"
FT                   /translation="MSRVAKAPVTIPAGVEVTLNEQTLTVKGSKGSLTRVINSAVNVVI
FT                   EDAQVKFLPVEGVDGAWAQAGTARALVNNMVVGVSQGFVKKLKLVGVGYRAKIAGSDLD
FT                   LTLGFSHPLVHKLPAGVTAECPSQTEIVLSGVDKQLIGQVAAEIRGYRPPEPYKGKGVR
FT                   YDDEVVRRKEAKKK"
FT   gene            203969..204319
FT                   /locus_tag="Sden_0186"
FT   CDS_pept        203969..204319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0186"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53483"
FT                   /db_xref="GOA:Q12SU3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU3"
FT                   /protein_id="ABE53483.1"
FT                   /translation="MDKKTSRLRRALRARKKIQELGVNRLVVHRTPRHIYAQVISPEAQ
FT                   VLAAASTVEKTVKELLKSTGNVDAAKAVGKIVAERAIEKGVAIVAFDRSGFKYHGRVAA
FT                   LADAAREAGLKF"
FT   gene            204331..204834
FT                   /locus_tag="Sden_0187"
FT   CDS_pept        204331..204834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0187"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53484"
FT                   /db_xref="GOA:Q12SU2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU2"
FT                   /protein_id="ABE53484.1"
FT                   /translation="MAKLEAQQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNG
FT                   KIGYGYGKAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSKVYMQPASQGT
FT                   GIIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATVDALVHMKSPAQIAAKRGLNVD
FT                   EIRG"
FT   gene            204841..205023
FT                   /locus_tag="Sden_0188"
FT   CDS_pept        204841..205023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0188"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53485"
FT                   /db_xref="GOA:Q12SU1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU1"
FT                   /protein_id="ABE53485.1"
FT                   /translation="MATKTLKVTQTKSGIGRLPKHRATLTGLGLRRIGHTVELEDTPSV
FT                   RGMINKVYYMVSVEG"
FT   gene            205028..205462
FT                   /locus_tag="Sden_0189"
FT   CDS_pept        205028..205462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0189"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53486"
FT                   /db_xref="GOA:Q12SU0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SU0"
FT                   /protein_id="ABE53486.1"
FT                   /translation="MRLNTLSPAAGSKSAPKRVGRGIGSGLGKTAGRGHKGQKSRSGGG
FT                   VRVGFEGGQMPLKIRLPKFGFTSRRALVTAEVRLLELAKVNGDVIDLNTLKDANVLTRN
FT                   IQFAKIVLSGTIERPVTVKGLKVTKGARAAIEAAGGKIEE"
FT   gene            205470..206810
FT                   /locus_tag="Sden_0190"
FT   CDS_pept        205470..206810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0190"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53487"
FT                   /db_xref="GOA:Q12ST9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q12ST9"
FT                   /protein_id="ABE53487.1"
FT                   /translation="MAKPGLDLKSAKGGLSELKTRLLFVIGAIIVFRAGSFVPIPGIDA
FT                   AVLAELFAQQKDTILGMFNMFSGGALERASIFALGIMPYISASIIMQLLTVVHPALAEL
FT                   KKEGESGRKKISQYTRYGTLVLGTLQSIGIATGLPNLMPGLVANAGFGFYFVAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISILIFAGIVAGLPSAIGSTAEQARQGDLNVLVLLLLAV
FT                   IVFAVTYLVVFVERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKVNMAGVIPPIFASSII
FT                   LFPGTLAQWFGANESMSWLSDFALAVSPGQPLYSLLYATAIIFFCFFYTALVFNPRETA
FT                   DNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGALYITFICLIPEFMLIAWKVQFYFG
FT                   GTSLLIIVVVIMDFMAQVQTHMMSHQYESVMKKANLVNKANLDRFGR"
FT   gene            206800..206946
FT                   /locus_tag="Sden_0191"
FT   CDS_pept        206800..206946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0191"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53488"
FT                   /db_xref="GOA:Q12ST8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12ST8"
FT                   /protein_id="ABE53488.1"
FT                   /translation="MVDKLALRSDEMKVRASVKKICRNCKIVKRSGVVRVICVEPKHKQ
FT                   RQG"
FT   gene            207061..207417
FT                   /locus_tag="Sden_0192"
FT   CDS_pept        207061..207417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0192"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53489"
FT                   /db_xref="GOA:Q12ST7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12ST7"
FT                   /protein_id="ABE53489.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGRTRARAICASTAIAETAKI
FT                   KELSEAQIDILREEVAKYSVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   gene            207435..207827
FT                   /locus_tag="Sden_0193"
FT   CDS_pept        207435..207827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0193"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53490"
FT                   /db_xref="GOA:Q12ST6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12ST6"
FT                   /protein_id="ABE53490.1"
FT                   /translation="MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSW
FT                   ATSGGSGFRGSRKSTPFAAQVAAERAGIAAQDYGLKNLEVFVKGPGPGRESAIRALNAV
FT                   GYKITNITDVTPIPHNGCRPPKKRRV"
FT   gene            207859..208479
FT                   /locus_tag="Sden_0194"
FT   CDS_pept        207859..208479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0194"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53491"
FT                   /db_xref="GOA:Q12ST5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12ST5"
FT                   /protein_id="ABE53491.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKLETAPGQHGARK
FT                   PRLSEYGTQLREKQKVRRIYGVLEKQFRNYYKEAARLKGNTGENLLQLLETRLDNVVYR
FT                   MGFGATRAESRQLVSHKTVLVNGRVVNIPSFKVSANDVVSIREKSRTQARIKASLEVAA
FT                   QREKPTWVEVDNTKMEGAFKRLPERSDLSADINEQLIVELYSK"
FT   gene            208504..209493
FT                   /locus_tag="Sden_0195"
FT   CDS_pept        208504..209493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0195"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53492"
FT                   /db_xref="GOA:Q12ST4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12ST4"
FT                   /protein_id="ABE53492.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVNPTRAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEILLNLKGLAVTIEGKDEAMLTLSK
FT                   SGTGPVTAADITHDGDVTIMNPDHVICHLTGNNDISMRIRVERGRGYVPASARAQTEDD
FT                   DRPIGRLLVDASFSPVARIAYNVEAARVEQRTDLDKLVIDMTTNGTIDPEEAIRRSATI
FT                   LAEQLDAFVELRDVTEPEQKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLV
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLVDDL"
FT   gene            209537..209932
FT                   /locus_tag="Sden_0196"
FT   CDS_pept        209537..209932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0196"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53493"
FT                   /db_xref="GOA:Q12ST3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12ST3"
FT                   /protein_id="ABE53493.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMACSIVRHEIIKTTVAKAKELR
FT                   RVVEPLITLAKVDSVANRRLAFARTRDAEVVGKLFTELGPRFQERPGGYTRILKCGLRA
FT                   GDKAPMAYIELVGRPEAAEAVDVEAAE"
FT   gene            210339..217580
FT                   /locus_tag="Sden_0197"
FT   CDS_pept        210339..217580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0197"
FT                   /product="Rhs family protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53494"
FT                   /db_xref="GOA:Q12ST2"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q12ST2"
FT                   /protein_id="ABE53494.1"
FT                   /translation="MCKQWTVFITALFLLFSSFTKADLNSDYRNYQVFTDQAGNLVLRV
FT                   PATFVLIASDINIPLNITPKNGVFKLIQNGNTWSLIPMTQGEFDNLSLTAASHIRLEFQ
FT                   DIDGDGVNDLIVRDVSGNRDSFIVSNLTGTANVDAYSLARNGIDLSQGSALSFKDINGD
FT                   GIKDIIKDENTSSATTYLGSRSGRLIDTSGTDAFTNPGNVIGLTAGQFKVTESGAATYS
FT                   IPLNLPPATAGVMPQVGLSYNSQGGEGILGMGWNISGLSAIARCPKSIAIDGKIEGIKY
FT                   NTSDALCFNGQRLMLNANSTNEYHTEIDNFSVITAFNGTNGPEYFTVTTQSNETHYYGK
FT                   APNNISTSEDAYVERGGYAAKSAAKLWALKAIVDNKGNYIRYDYIKNVTKGSHILNSIA
FT                   YGGNETLATAPYNRIEFIYTDVARSLEGYSDGGILTNNKRLKQVIVKQDSDVFRSYNFT
FT                   WLLTSIPEERNYVTGIQECFNESNTDCLPATKFEFEQPARKIPTSTYKMCRINAPAEQA
FT                   ICTSVNYCDATSNGSGGWCEVNYNTPDIAPFESASYGAAASNADRYYAQVLDFNGDGYA
FT                   DMLFPKDGKWHYYTTDWQVTTTESLINIPERFKKNYLSSDPTTRSIKTSTISNSTQVIS
FT                   GASIGEKGYARVIDYNGDGKQELLIPIASGYWHILSSDSSTSEQTTCEPQPYPAPPICD
FT                   THTITNKFTYTSLGILAKDYENAVVADVDGDGLQDIVFNSGSSLSYYHNLGGSFSAAKS
FT                   ISLDMPASFSGATAYEAYGNDIVRTSANIKNSAMIDVNGDGLTDIVIKMRKITTNPPPP
FT                   GCYDPRMLAVAAVEDDEAAERCRETITVDYGTYAFIASVNAGQVSYTATDNSYLGATLK
FT                   AMRVADFNGDGLTDIAYIASDRWYYRLSKGNGIFTSPKALNGIDAKTESIYNRHQFVDL
FT                   DADGRSDILAATTSKNYTIFLSGPSETTESANFIKRGTLPVGTSTTPEETALRLADVDG
FT                   DAKLDLLTASSSTGTWKVQKATRPYIKEHVLTKITNAFGVQTKIAYAPLNSGVPLINLE
FT                   SSQKPNDKDYITPIAGMYVVTEAATQSTSTESVLVQYAYGGPLAHKKGRGFLGFETVKT
FT                   TDPQSGVVTTTQYHQLHPLTGMPKTTTRKYQDNLLSSATNTYAQGTSANGGRHVYLKSS
FT                   TEASYSIDLSTDGITATDHKKVAETITTNTHDSWNNLTQSIVDVKDAAGSLVHKTQTDN
FT                   TYSSSAYGIISTDAIALERSHSQQDVQAGTQPDAKQFGRLYTTQVKKTRYKDTASGTAE
FT                   SQTRNTKFSYYPNGMLRESFVDGLNTAFFYDKYGNKVAEQSYAKHNAVSYQKRGQYWFY
FT                   DSRGQYLARQMNQNGESETYLLNGKSASTATLGLIYSKTTTGPNKLASTSYFDIQGQVV
FT                   RQLLADGNYSETSKTLCESCVENYITETNSSSNKPQTVNYFDKFGRQRQQRVKGFDGAW
FT                   IVTASSYDKLGRVTHSSVPNYDTASAVKSQQYYDALGRVYKQTKLTETGTVTVYSKIDG
FT                   LETTSIDEKGLQYKDIHSADGQLITRIDPQDQTISYYYDAFGNARKVTTKAKDKNNAWK
FT                   TQSITTNFDAYGRKMATNDPDKGSWSYGYNGFGELISQTDAKSQTTTTEYDAMGRMLWR
FT                   RDNSDLSCWSYGSDATKGNVGKPTGVKQWAAQTSCTTTSAVQSSETYHYDAFGRPAQVD
FT                   YTIDGASYSTRSEYNTKGQLSRQHYPSNNGVFYVNFYYNANHYLYLQKDSADRELRRIT
FT                   AMDALGNITAQSFANGTSEARRFNQRTGRIDSIDLKKGNSYIHQLSYGLFDAKGNVEYR
FT                   SHSYYNGSGIQTLGFSENFTYDSLNRIETRDLSIGTGSLTGYGYDEQYSYDGFGNINSR
FT                   KGYAGGSYSVNLASYNYLQSTSVNRLDSANVDGKSYSKFIYDANGNITSDGSRSFSYNA
FT                   FDKASRIQLGSQYSAYRYDSSRAVLSRSDYRQEAGEWKTFNTDYIGQLYQQERRYKGSA
FT                   AIGSNLENTRHKYMLGNIMVVRNQNATLGNSEQVQYQHGDHQGSTLSITDERGNILEQY
FT                   FYSAFGKPMKLAGSSLVQAITPMERGYTGHEMLPNLDVIQMGGRIYDPNLARFLQADPN
FT                   IQAPTNLQNYNRYSYVLNNPLTYTDPSGYFFDKIFDFVKKYWKVIVAVVVVVVTYGAAT
FT                   SWVASWGTTGAFGSAATAATSATLTTAGAVATGAIAGAAGGFVGGALATGSLKGAFRGA
FT                   LTGAISGAAGGYANAGAVSGWGDAAKRIAVAAAGGCGAGKASGGSCSQGAKLAAVSQAI
FT                   TMGAGELYRKVSSQYNKTGEPHLLQEGISDVGKQARVIHEPHFWGQSDQAGLMKSIAKG
FT                   PYMDAFAEFHDGLHEYLHDSLGSYAFLSDNSASLILTMPPSYVLTVAAAARPYSHLYSL
FT                   DLMREGKR"
FT   sig_peptide     210339..210407
FT                   /locus_tag="Sden_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.987 at
FT                   residue 23"
FT   gene            complement(218186..218548)
FT                   /locus_tag="Sden_0198"
FT   CDS_pept        complement(218186..218548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53495"
FT                   /db_xref="UniProtKB/TrEMBL:Q12ST1"
FT                   /protein_id="ABE53495.1"
FT                   /translation="MAVQPLLAEMSRINNNGRSKAVEQKTKAQKALGEQIIALTHRERP
FT                   YMAEFFSEPSLTYNHWVTPAGMGFILKYSVFCPSIVVRSTVTVPELTSALTAKLTANST
FT                   IAVSIILIKFIYIVTF"
FT   gene            complement(218807..219850)
FT                   /locus_tag="Sden_0199"
FT   CDS_pept        complement(218807..219850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0199"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53496"
FT                   /db_xref="GOA:Q12IY9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q12IY9"
FT                   /protein_id="ABE53496.1"
FT                   /translation="MKVSTISIDLAKNVFQLLGMDKHAKQVFSKRLNRTQLSEFMSQQP
FT                   VCDVVFEACYSSHYWGRKFLAMGHNVKLIPAQHVTPFVRGSKNDKNDAMAIYEANFRPN
FT                   IRFVPIKTEAQQEILMLHRVRERLVKQRTACTNQIRGVLVDFGICFPQGHSAFERAMWD
FT                   IINDESQRPIIKLMANDFWDEYQTVSTRLDRINRLIKQLVEQDPNGKILLSIPGVGPII
FT                   ASAFAAAIGAGQAFNSAKELAVWLGLTPQQFASGNKSINGSITKRGDGYLRKQLIHGAR
FT                   TVVSHASKKNDDLNQWITQLRNRKSICTTVVATAHRLARLMWILLHKQVPYAPQYGAYQ
FT                   GISHEAN"
FT   gene            220138..221019
FT                   /locus_tag="Sden_0200"
FT   CDS_pept        220138..221019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0200"
FT                   /product="protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53497"
FT                   /db_xref="GOA:Q12SS9"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS9"
FT                   /protein_id="ABE53497.1"
FT                   /translation="MGESGKNFDHRRGWVESRLFELEAVFAIDVAAFAVMSNHLHVVLR
FT                   IDIETANCWTDREVLEQWHKLFNGDEITQKFVKGEVVETHEVLRLKHSIATYRSRLCDI
FT                   SWFMRCLNEPIARQANQEDSCTGRFWEGRFKSQALLDEAAVLACMAYVDLNPIRAKMAS
FT                   TPEQSDHTSIQLRIQAALRGEQPISLLPFIGNERKNQPKGIAFSLQDYLELVDDTGRII
FT                   RNDKHGAISTNSAKLLTRLNIFQENWLKLTTEFGKLFHGPVGTLQELTSYCEHLEKRRR
FT                   HFASCCQHLMAS"
FT   gene            221336..223504
FT                   /locus_tag="Sden_0201"
FT   CDS_pept        221336..223504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53498"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS8"
FT                   /protein_id="ABE53498.1"
FT                   /translation="MFYVNFYYNANHYLYLQKDSADRELRRITAMDALGNITAQSFANG
FT                   TSEARRFNQRTGRIDSIDLKKGNSYIHQLSYGLFDAKGNVEYRSHSYYNGSGIQTLGFS
FT                   ENFTYDSLNRIETRDLSIGTGSLTGYGYDEQYSYDGFGNINSRKGYAGGSYSVNLASYN
FT                   YLQSTSVNRLDSANVDGKSYSKFIYDANGNITSDGSRSFSYNAFDKASRIQLGSQYSAY
FT                   RYDSSRAVLSRSDYRQEAGEWKTFNTDYIGQLYQQERRYKGSAAIGSNLENTRHKYMLG
FT                   NIMVVRNQNATLGNSEQVQYQHGDHQGSTLSITDERGNILEQYFYSAFGKPMKLAGSSL
FT                   VQAITPMERGYTGHEMLPNLDVIQMGGRIYDPNLARFLQADPNIQAPTNLQNYNRYSYV
FT                   LNNPLTYTDPSGYFFKGLFRAIADIPILNAVISVVFAVYCQACLVAYNAMSTYSVTGSL
FT                   KSTFTSGLTTAIMPGGGSAGGVLASAAIGGLSSKLQGGDFGHGFISAGIGAAFGGRIEV
FT                   GNQYANVIVAAVIGGTISKLTGGKFANGAVTAGFARAVFGGASNQDSAAVASDSQSQLS
FT                   GITKALGVVGDVMGRIWSLPNTLIGLGYGGIGMMFGATPVWDGSEGILHFTNMPEWMMP
FT                   SAMSFGHVHVYGQNSYKNPNGSYVVNRFDSPIVTEETLHTRQSEILGPLYLPLHGMAMG
FT                   VSQLTGGGTHNKNLLEMGPESGKNPWPW"
FT   gene            223511..223936
FT                   /locus_tag="Sden_0202"
FT   CDS_pept        223511..223936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53499"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS7"
FT                   /protein_id="ABE53499.1"
FT                   /translation="MIYMNLLQQFRMFIFLVITLALSGCPRFAYVEIYNYSGTTIEVSS
FT                   SGITKIIAPANSDRFRMTGEQFEISSELGNWVYPRNIPNGGVDGPYFDGTLRVQLNKNG
FT                   DLYVLNEDQEPPIEAFGEQPTGYPISVKDNSRYFKEN"
FT   sig_peptide     223511..223600
FT                   /locus_tag="Sden_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.727 at
FT                   residue 30"
FT   gene            224154..224504
FT                   /locus_tag="Sden_0203"
FT   CDS_pept        224154..224504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53500"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS6"
FT                   /protein_id="ABE53500.1"
FT                   /translation="MNFIKIILSAIVLFATSIAVNAEVSSGTVTVLRTTMDGQKTLYFK
FT                   MNPMPAGVTQWLYVREGSGNAAGCQLITDDTMLQLAYSSLLAAKTAAQRITVGYCADSN
FT                   GYGLVNQYIELD"
FT   sig_peptide     224154..224222
FT                   /locus_tag="Sden_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.916 at
FT                   residue 23"
FT   gene            224727..225053
FT                   /locus_tag="Sden_0204"
FT   CDS_pept        224727..225053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53501"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS5"
FT                   /protein_id="ABE53501.1"
FT                   /translation="MKYLKLLAVTCLLLPSFASAGELTIGATVLEVATNATGSGKNFAI
FT                   KVEGGVGPCNGWIYFLEDSAASAATYSQAFSIALTALSSDKKVRVHNFTDDACTGARFI
FT                   SISK"
FT   sig_peptide     224727..224789
FT                   /locus_tag="Sden_0204"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            225295..226050
FT                   /locus_tag="Sden_0205"
FT   CDS_pept        225295..226050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0205"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53502"
FT                   /db_xref="GOA:Q12SS4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS4"
FT                   /protein_id="ABE53502.1"
FT                   /translation="METKSVSFVLTSCNRFDLLEETLISFFKFNTYPIAQYIIIEDSHN
FT                   LDKLNKVLAKFPDVDFVVLNNEPQLGQMKSIDRAYSKVTSDYIFHCEDDWEFYRKSFIE
FT                   DSFKVLDTDEKVVTVWLREQDDTNEHPVEAELFECKDPEGRSYQIMQRNHQRRANSALW
FT                   HGFTLNPGLRRTKDYQLIAPIGEMGGEHAMNEIYFQHGFKGAIFPTGYVRHIGYHRGIR
FT                   YKVGQSKLAKDFSVGWKRIKAKACQLLGI"
FT   gene            complement(226115..226870)
FT                   /locus_tag="Sden_0206"
FT   CDS_pept        complement(226115..226870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0206"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53503"
FT                   /db_xref="GOA:Q12SS3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS3"
FT                   /protein_id="ABE53503.1"
FT                   /translation="MTLPISVFIITKNEEKHIAKTLASVKDMDEVILVDSGSTDKTLSI
FT                   AQQFGATIFSHEWQGYAKQKQYAMSLCRNEWVLNLDGDEAINPQLIAAFKEIIEQDKAD
FT                   SVRFWRNDIFIGKPLSSLSKKPNNHRLYKKSKSFFDDSRLAHESATVDGKEIFINQVFD
FT                   HYGYDSIAAITNKNNTYSTLKADEKFVKGKSFSHLKLFLIFPLVFIKEYLLQRKLFSGR
FT                   RGFILAVMEAYYAFLKEAKLFENHQNKPN"
FT   gene            227056..227826
FT                   /locus_tag="Sden_0207"
FT   CDS_pept        227056..227826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0207"
FT                   /product="glycosyl transferase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53504"
FT                   /db_xref="GOA:Q12SS2"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS2"
FT                   /protein_id="ABE53504.1"
FT                   /translation="MSFKIFVINLDSSVDRIENMQAQCSKLGIEFERVSAVRGKNLSSA
FT                   EKAAVYNRDVNLAKYDKELNDGEIGCYMSHARCWEQILIQKLDYSLILEDDAILTPEIT
FT                   AYIAKLADSTSEWDYIKLSHGRKPKNILNAIDLGDGLSLGQCIKLPSTTTGQFVSQTGA
FT                   KKLLQHAYPIARPIDIDIQFWYEKSLRSFVVRPFPILNGDFGSEINQVTDRRQVDKRQF
FT                   ARIWQKAKFELNLLLHRGRLGALPQSLVKQAKTK"
FT   gene            227843..228349
FT                   /locus_tag="Sden_0208"
FT   CDS_pept        227843..228349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0208"
FT                   /product="Coenzyme A biosynthesis protein"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53505"
FT                   /db_xref="GOA:Q12SS1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SS1"
FT                   /protein_id="ABE53505.1"
FT                   /translation="MHRRAIYPGTFDPVTNGHADLIERAAKLFKHVIIGIAANPSKQPR
FT                   FTLEERVEQLTLVTAHLDNVEVVGFSGLLVDFARDQKASVLVRGLRAVSDFEYEFQLAN
FT                   MNRRLSPDLESVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPQVALALKEKIAAMKA
FT                   NKGNK"
FT   gene            228351..229835
FT                   /locus_tag="Sden_0209"
FT   CDS_pept        228351..229835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53506"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SS0"
FT                   /protein_id="ABE53506.1"
FT                   /translation="MKKGFLVTSLLAALGMVSSAQAAPWVDASDIYLRADIQALADAGF
FT                   IKVPVNTYPLMWSGIGENLAKVEPSLMSPALMDAFARVNFYYQNAINNRGNRSMKLATA
FT                   SESARFQHFGSDYREKAALSGSTEYLGERFAFKASASMNYHPDDDKNLRLDNSYIAMIL
FT                   GNWVFTAGAIEQWWGPGFDTALHKSTNARPMPSLMMSRNNANAFETPWLSWMGSWNLTA
FT                   GISVAEKERFAPRMLLWNMRASVKPVQQLEIGLSWTTQFCGKGQECDWDVALKSITGQR
FT                   DCRADSADVFGCTNYGNQMAGFDVRYGDIWFDVPVGIYLERTCEDSLGDPWQITDCGKM
FT                   VGVDTRFNFAKQQYKLFAEYTDTLVYCGADANSFNCFYEHSTYLSGNRHYGRALGSTYD
FT                   SDANTYVLGLIGQFANSQGFTALLRYAKLNDDGSNRGGNWAPQPLKEDLTMAEVSYRLP
FT                   MLKGMVTVGGTVSQSKFVTEKDETNASIFGTYEYKF"
FT   sig_peptide     228351..228419
FT                   /locus_tag="Sden_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(229919..230734)
FT                   /locus_tag="Sden_0210"
FT   CDS_pept        complement(229919..230734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0210"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53507"
FT                   /db_xref="GOA:Q12SR9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SR9"
FT                   /protein_id="ABE53507.1"
FT                   /translation="MPELPEVEVTRQGIAPYLVDQTVVELIVRNASLRWPVPDLAHNIV
FT                   GQTILSVRRRAKYLLIDTEAGITIVHLGMSGSLRILPRNTPVEKHDHIDLVLANGRMLR
FT                   FNDPRRFGAWLWYELPEEAHPLLAKLGPEPLSEAFNPLQLLTALKGKKKAIKLCLMDNH
FT                   IVVGVGNIYANEALFAAGIHPESEAGKIDIEKLTLLVVEVKQILAQAIKQGGTTLKDFT
FT                   NADGKPGYFAQKLHVYGRGSKSCTHCGNLLSEIRLGQRTTVFCGLCQTK"
FT   gene            complement(230735..231229)
FT                   /locus_tag="Sden_0211"
FT   CDS_pept        complement(230735..231229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53508"
FT                   /db_xref="GOA:Q12SR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR8"
FT                   /protein_id="ABE53508.1"
FT                   /translation="MALSRKQWNNIIIGACVFMVLVLSFMNKQTSDVPADVAPLFDEQN
FT                   RLTQLQLSGIWLARVPLSQGQLNQDEHVTQEWQCDERVLNCQIWAEAWSQVQVSALTEK
FT                   PQSSTKPQELLLSINQSNEPQLWLYYAPEGWLVSPSSQWYLVPPSLRGSLNPSLILETQ
FT                   P"
FT   sig_peptide     complement(231134..231229)
FT                   /locus_tag="Sden_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.647) with cleavage site probability 0.618 at
FT                   residue 32"
FT   gene            complement(231355..231900)
FT                   /locus_tag="Sden_0212"
FT   CDS_pept        complement(231355..231900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0212"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53509"
FT                   /db_xref="GOA:Q12SR7"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR7"
FT                   /protein_id="ABE53509.1"
FT                   /translation="MTIAFINPLTIPVLGFCAYSGTGKTTLLTQLIPELNRRGLRLAVL
FT                   KHAHHDFDVDTPGKDSYEMRKAGAQQVLVASHVRWALMTEAPTEGDPDLAHLLRQLDAS
FT                   KADIVLVEGFKKLALPKIELHRAAHNKPFIHTQDEHIIAIACCADTQTPSALTRLDINN
FT                   ISQIADFVIEYQSGYNKQ"
FT   gene            complement(231897..232523)
FT                   /locus_tag="Sden_0213"
FT   CDS_pept        complement(231897..232523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0213"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53510"
FT                   /db_xref="GOA:Q12SR6"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR6"
FT                   /protein_id="ABE53510.1"
FT                   /translation="MRQTAINSQEKALIVVNAVILAGGRASRMGGQDKGLVRFNGQSMV
FT                   AHTLGRIRPQVDSLVINANRNLDAYQALGYDVIPDENQEFMGPLAGILSALNHLNDSIL
FT                   LVVPCDCPWLPLDLVSRMQACMGDSQTDIVVASDGEQEQPVVLLLKANLAQSIQDYLDA
FT                   GERKLGAWYRNQHFSVCAFTDNPDAFMNINTHEQIAQLSTRSHLS"
FT   gene            complement(232836..233495)
FT                   /locus_tag="Sden_0214"
FT   CDS_pept        complement(232836..233495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0214"
FT                   /product="protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53511"
FT                   /db_xref="GOA:Q12SR5"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR5"
FT                   /protein_id="ABE53511.1"
FT                   /translation="MLLLTPTQFKRALILLVSFHILIICASNYLVQLPFQIFGYHTTWG
FT                   AFSFPFVYLATDLTVRIFGQQAARGIIFKAMLPALVISYLMGVLFHQGHFQGLETITQW
FT                   NTFVFRIAFASFVAYLVGQLLDISVFAQLRRVKAWWVAPAASTLFGNFIDTLVFFSVAF
FT                   YASSDSFMAANWPEIASVDYGFKLIVSLGLFLPVYGVLLKVLSDKILTETSDTAKV"
FT   gene            233966..235168
FT                   /locus_tag="Sden_0215"
FT   CDS_pept        233966..235168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0215"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53512"
FT                   /db_xref="GOA:Q12SR4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR4"
FT                   /protein_id="ABE53512.1"
FT                   /translation="MSNELESNDVIKISVSHLALGMFVTAIDNAKGALSITNPGQIKTQ
FT                   DAINKLLKSGIKSVWVDVERSADNCGLKKTSAESFEPTKGNPLARKAKPSRDSKQAQVK
FT                   VILNEAKNLVRKVLSETYEGKAVEVAPFEEIADRMIESVMDDADAMKCISALRTKDAYL
FT                   LEHSVNVAFLLVTFGKHLGLDKTMLKEMAVGGILHDIGKIKVDNEVLHKPGKLTPEEFA
FT                   HIKLHQVYAVEIMEQTQGLAQVSKDVCLMHHEKLDGRGYPKGLKGDEIPLHGRMSCIVD
FT                   IFDALTATRCYKEAMSPAAAFKILISLTPFHLDQALVYEFIRCVGIYPVGSLVQLSDER
FT                   IGIVWEAKDRDALHPVVKCFYSLKHKRYTEVTMVDLRKAEVNIERGVSPGTLDVDPTPF
FT                   Y"
FT   gene            complement(235482..236429)
FT                   /locus_tag="Sden_0216"
FT   CDS_pept        complement(235482..236429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0216"
FT                   /product="conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53513"
FT                   /db_xref="GOA:Q12SR3"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR3"
FT                   /protein_id="ABE53513.1"
FT                   /translation="MNQFNPIKHNVSLPWVMFLLLASLCLTPLISSPIALVLGFSLASL
FT                   NLVPAKVNLTLITKKLLAVSIVGLGFGINVTEAISASLGNLGLIVGSIFFTLGLSFYLT
FT                   KALNLDRKTGHLIGAGTAICGGSAIAAVAPAINAKGEQIAVALACVFMLNSVALFIFPA
FT                   IGHSLSLSQYEFGVWSAIAIHDTSSVVGAAAAFGDEALKTATTIKLARALWIIPIALFS
FT                   ALLFGGSKSKLNVPYFIVFYCVAIAIAHYFPSEHYQILFLISKQLLILCLFFIGASITL
FT                   KKMQTAGPKPLLLGVLLWLAIGSLSLGYILLMRN"
FT   sig_peptide     complement(236316..236429)
FT                   /locus_tag="Sden_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.336 at
FT                   residue 38"
FT   gene            complement(236607..237116)
FT                   /locus_tag="Sden_0217"
FT   CDS_pept        complement(236607..237116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0217"
FT                   /product="malate synthase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53514"
FT                   /db_xref="GOA:Q12SR2"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR2"
FT                   /protein_id="ABE53514.1"
FT                   /translation="MNMSLMNNVQTNQYLDSNTETNNVAALTQGVVATSTPSAKAKQFL
FT                   DRHFPLSQGSHLEVMSYLVYYTHLIAFMADGSQSGLKRPRQFVALSGHKSEPSCLVLKD
FT                   GKTHLAINIDRQGPLGSQDLAGVNDVLLQTMPHTKLTQEWTSLLNQDMLTRPLSVTAKD
FT                   GSDYCL"
FT   gene            237282..238808
FT                   /locus_tag="Sden_0218"
FT   CDS_pept        237282..238808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0218"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53515"
FT                   /db_xref="GOA:Q12SR1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022055"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR1"
FT                   /protein_id="ABE53515.1"
FT                   /translation="MRNDQSLMRKSHFLGTKIRNLRKRNHLTMEDLSARCVRMDAGSAP
FT                   SVSYLSMIERGKRVPSAAMLSVIAAVFQKEVEWFLDDVPEEAAITPDKGRHGGISGMAL
FT                   EPSFLFSNDILQIAIPEMLSQTGTTGRQFAHLLIRAHQEHHQNHFPDLERAAEEIGQKR
FT                   MPLSADDMLDIAKGMGLRIKWIDATPQEVIDEMGLSSRQLVTSFFEPPSTIYVNKALKN
FT                   RPYRLKYDLAVHIGHCVLHNKDGLKSVMTSGRREDSADDGTQSNSLNAQDILHAWRDFE
FT                   SSFFAGALLCPKVPFRQLLDRCGYEIDVHKQLQVSASVAMRRMTVVSPYPHWHYFDAYA
FT                   QGKLQAVYRGNGIPLPWGNMRLVQDPCQHWAVFRMINEPTVGTSAQISILNVGNEPRIY
FT                   CCESIKVEDSAGNAHVLCAGIDLNPAIEAQGKDALTIAQDLKQACVDSGGSVVIPKNIK
FT                   QDLTSVAKILNINWIERGIKNEARLICSRGGVCPRQPSCYAAGRPQCDDE"
FT   gene            239052..239615
FT                   /locus_tag="Sden_0219"
FT   CDS_pept        239052..239615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0219"
FT                   /product="Haem oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53516"
FT                   /db_xref="GOA:Q12SR0"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SR0"
FT                   /protein_id="ABE53516.1"
FT                   /translation="MATDYLKQHTRALHVQLDNLPLLVALASRQLDREQYHQCLSCFYQ
FT                   AYSVIETTLISSPQNKQPALAYQARLSNLRHELMQLGMPIPGSHDVPQLQISTAAHYWG
FT                   ARYVLEGSALGAKFLLPKIQLSLELSSPETLIFFSQLSQLANSWPEVITHINQIIILDN
FT                   QKKEALAAAKKTFEIFHSHFSIKE"
FT   gene            239621..240121
FT                   /locus_tag="Sden_0220"
FT   CDS_pept        239621..240121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0220"
FT                   /product="Bacteriophytochrome (light-regulated signal
FT                   transduction histidine kinase)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53517"
FT                   /db_xref="GOA:Q12SQ9"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ9"
FT                   /protein_id="ABE53517.1"
FT                   /translation="MANGPFGNCKIAELHKTDKIQSYGCMLVIDRQTNTLIACSDNVER
FT                   FLSLTSDNILGRHWDTVLQGIVLAQMREINRGQDLTMSRMSEAKINGKSCIIAHHSVNE
FT                   CCIVEIEWAKDTQELAASHEKAEFINKLKKATKARDCARILMDKVATLIDFDRVLFEAG
FT                   LHP"
FT   gene            240144..242276
FT                   /locus_tag="Sden_0221"
FT   CDS_pept        240144..242276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0221"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   Phytochrome (GAF) sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53518"
FT                   /db_xref="GOA:Q12SQ8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ8"
FT                   /protein_id="ABE53518.1"
FT                   /translation="MVEPTSSLVFVNNNIELDLTWSQLRAVHPVHIQYLKNLAVEASFS
FT                   VSLVCNGQLWGLLACHNMTAKYLSFETRQLCEELSQITSLHMSGLLRAEIDFQRYHYKV
FT                   EFAEIRGAMQSSIDAFKAIKSQISEIKTLLNADGIWHHIDGEDYYHGQVPDELSLSLLG
FT                   NWLAQFDRHQVMSRHTVVEDFKQNKALVKFASGLLFLPLNQQNFIVLFRREEIETVNWA
FT                   GKPQSHNEQDMSTSALTPRNSFLTWAEVMGGQAKPWNLIDIEMAEDIRCELVRLIEKNQ
FT                   LEIIALKDPLTGIANRLMFERKLKSALQQALEANQQFAIYMIDLDRFKPVNDTYGHAVG
FT                   DELLIQVTQRLQALLRCEDMVARLGGDEFAVIQLGISNKGDIERIAKLMVEEVKRPFLI
FT                   EGKNIEIGASIGITICPLDAISQTELLLGADLALYEVKKSGRNGFKHFEPSMLLEKTND
FT                   ESIRNQLLRAFENKELEMVYQPIIDSRSKKIVGLEAFTRWQHPVLGFIAAQEFVSAIDK
FT                   NHLNPEFVDWMLMTTFSDYQQWQRQGIASIPVSINLRSDQFLSLDIENKCRALSQQYQV
FT                   ATTWLRIDLDEPTLAIDANRSEIKINALAQHGILCNIDHFGQGLLSLKQLTKLKVNSLK
FT                   IDSRLLMDDKKNIKTQALATILKAIGEVMNVPVVATRVEKQEVMAKAKSMGINLVQGFA
FT                   IIEPMSVADVSAYMTK"
FT   gene            complement(243070..243744)
FT                   /locus_tag="Sden_0222"
FT   CDS_pept        complement(243070..243744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0222"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53519"
FT                   /db_xref="GOA:Q12SQ7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ7"
FT                   /protein_id="ABE53519.1"
FT                   /translation="MFDWNTIDTVLLDMDGTLLDLHFDTHFWLTLVPQQLSQQRNIHLH
FT                   AAKTLVEQAYKKVQGTLEWYCLDYWQQALGLDILTLHYSIAERIQLRQDSMPFLQALGA
FT                   ANKKRILFTNAHPKSLSLKLEHTELASGLDAILSSHETGYPKEHPEFWRHGLAKFNLDP
FT                   ARCLFIDDSEVILAASRRAGIGHQLGIMNPDSKKPNKRFSDFPAIDDYHLLLMDSRSTP
FT                   LS"
FT   gene            244271..250006
FT                   /locus_tag="Sden_0223"
FT   CDS_pept        244271..250006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0223"
FT                   /product="Fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53520"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ6"
FT                   /protein_id="ABE53520.1"
FT                   /translation="MNILLKNLYRSCFERFCKRSNVLIEKRPFTLFFRWLLILPLLLCS
FT                   NQLMAAKFTMSIYTGGGTPTVMTTADDGTTTLTATRSDGGNLAGVSSGFLDPSVMNGAD
FT                   TYTVTFNVPITISSIQIAEFTNNSTGNHYVLTPNVGTPFSIADNDGALAGSVTTHAPSN
FT                   WIGVTSLTYSYSASGWRNGLDNLVFTVTAPPSITSANYDASTGVLAVTAPSMTTGDTID
FT                   VSKLTLTGRNDATHTLTSSNVTASSSSAFSVTLNAADKLAINGLLNQNGFDAINGTAYN
FT                   LAAAANWNITKSAPADLTGNSITVSNVSAPTITSATYDSSTHVLTATGTNLVGLPGANN
FT                   DISVSLLTLTAEGGATYTLTSPDVEATSSSSFFVTLNATDYGVVETIFNKNGTSSTSGT
FT                   TYNLAAADDWNSEITGGNIADASNAITVSNVSLPSISSATYDASTGVLVVTGSGLVSKT
FT                   GGTNDIDISKFTLSGDASSYSLTSSSVEITNGSSFSVPLNSTDKNELISRLNKNGTSSN
FT                   GAVTYNIAAADDWNTGADPALNIADLTGNGITVSNAATIPGAPIIGSATSGDGQASVSF
FT                   SAPVSNGGAAITAYTVTSSPGGFTATGTASPLTVTGLTNGTAYSFNVTATNLVGESSAS
FT                   SASNSVTPMGSQTITFANPGAQNFGTTPTLTATSSSGLVPVFTSSTAGVCSITSGGALT
FT                   LVTAGTCTINANQGGNSAYLPAAQVSQSFTVNAVVASSPTIGTATAGDASASVSFSAPA
FT                   SNGGVAITAYTVTSSPGGLTATGAASPLTVTGLSNGTAYSFSVTATNSAGVSAASAASN
FT                   SVTPQSANSAPVATNASVSLDEDTSLSISFTATDAEDDVLSFEVVTPPTSGKLVKHGSV
FT                   WLYTPDADFNGDDSVRFIAKDAELSSTPGVVSIKVNPVNDEPKAVDDSISQSLSTDNSY
FT                   TLAVLDNDTDVDGDTLTIDGAAADVGSVQIVSSQLKYQAPTGFVGPVALRYSISDGHKG
FT                   RSNAKVQLLITGENSAGAPVITVPADITANATGLFTKLKLGVATAVDASGKKLAVSLVN
FT                   TKQLFAPGEHVAYWQATDSQGRSAIKSQKVTVKPLISISRNQVVSEGSEAKVSVFLNGP
FT                   SPQYPVSVPYTVSGSSDGNDHDLVDGVVEITSGLSASFSVNVFDDGVTEADEELVISLD
FT                   SGLNLSGQRETRLLITEANIAPQASIVVTQSNEQRTQVSKAEGKVYIKAKSRDVNPQDS
FT                   LTEVWSTGALVLDTDADGSYFDPSTLDAGSYPISLVVTDDGTPQLSTKVQLTLLVKDSL
FT                   PVLTGADSDGDLIPDNQEGFADTDGDGIADYLDAINECNVLQEQASSQQTFLAESQSGV
FT                   CLRLGNTAQLNGSQGIQVPDSALIKDTLADNLGGLFDFELTAIPRLGASVAVVIPQARP
FT                   VPTNAVYRKFVRGNWQDFVLNTNNSVMSSAGNSGYCPPPGAAQWQPGLTEGHWCVQLSI
FT                   EDGGPNDDDGIANGTIVDPGGVAVMLNNNSLPVAVADAVIVPVNQSTEVDVLANDTDAD
FT                   GDTLTVRQVSSQFGTAVVLDNQQISYTPAADFIGTDVLVYSISDGKGGTASSELTVTVV
FT                   ANRAPVAVDDMASTDDKTVLILNVLANDSDPDNQALSIIAASAEQGSVMIENNQLRYTP
FT                   KTGFEGIDTVSYRISDGLDGEATANVMVSVKAYKAQVVDNQSGGSLGWAWVAALLMALM
FT                   LRVSNRLNLRLKGKLLLAGLLSMAGVMQVQAAPSPWYLDASLSVSETDKTQMELQQEVT
FT                   AGTISGFDNSDTGVGLSLGYQVTPLLAFELGYLDLGEGSAQISGESLDAGQYHELMKLV
FT                   SPVLPQGVTVGARFTLMEHQGWRFSVPVGVFIWESELHSDSQGQRLTTKLDDTDWYAGM
FT                   RFDYALAQHWSMGLGINYYALAPNDVLSYQLSVRYQF"
FT   sig_peptide     244271..244423
FT                   /locus_tag="Sden_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.998 at
FT                   residue 51"
FT   gene            250237..250791
FT                   /locus_tag="Sden_0224"
FT   CDS_pept        250237..250791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0224"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53521"
FT                   /db_xref="GOA:Q12SQ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ5"
FT                   /protein_id="ABE53521.1"
FT                   /translation="MTQGPIKPEILHTELIAKSRLFQIEQIHLKFSNGVERQYERMRGS
FT                   GRGAVMVVPIHQGNMLLAREYAAGTDNYELGFPKGLIDPGETAEQAANRELQEEIGFGS
FT                   HKLTLLKELSLAPGYFSSKMQVFIAEDLFPSRLEGDEPEPIEVIPWKLTAWQSLLDTAD
FT                   FSESRSVSALFLAQQYLASKL"
FT   gene            250894..251703
FT                   /locus_tag="Sden_0225"
FT   CDS_pept        250894..251703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0225"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53522"
FT                   /db_xref="GOA:Q12SQ4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ4"
FT                   /protein_id="ABE53522.1"
FT                   /translation="MKPEDIIEAVIKIAQMGGIAIRNIFLQGEYDRELKSDNTPVTSAD
FT                   LASNEIICQQLALLTPDIPILSEEAADIPLSVRSQWQRYWLVDPLDGTGEFIAGSDDFS
FT                   VIIALVENNRPVMGVVYAPMTQTCYYAMIGKGAFKRDHEGERQIHSKALTSFQSDRLRF
FT                   AVSRRQDPFSVLNLFDSQADAELVIMGGAALKSCLVAEGKADCYVRLGPTGEWDTGAAQ
FT                   IIIQEAGGNLMDLTQQPLSYNLRESLENPNFMVVGSPQLGWGELFKI"
FT   gene            251800..253110
FT                   /locus_tag="Sden_0226"
FT   CDS_pept        251800..253110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53523"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ3"
FT                   /protein_id="ABE53523.1"
FT                   /translation="MRVKIVILLSFVMQLIACGGGSSGSEDSAATAKPTPTAKLTLELQ
FT                   YQAYKCDITSPVSGADIIFHRQDGSILSQIKSAADGKVNIDWPAEAKHISIAVDVNGET
FT                   KINTYTDAVASDFGVLRYREASLDNSCSCETFTFDVSEVKAVYGGFTPLINSNESITQT
FT                   YCKNNERYAPVTIVLMPSQAGVSGFAAELDLNGKDASQTILISSSLFGNSNNVGVLLTA
FT                   SVVPFQPFNTRFRTYSETEYGRINWLGWQHEPQIFPNLYANNFVSSYFDENMGGNQYGD
FT                   LYYFSSVQKRVTNPTVEQFLELPQNQFQLLEQTDVILSSMVNDGPTNYDFSTIGKGKIL
FT                   LSVRLGENGIADWSVEAPLTGVMPELSLPSEIELKFERMTNPKMYVMIYGYNTHLPSQF
FT                   NEYRQQRAKRSREQSGVRSSQIDNYVYELIDIRLLRQ"
FT   sig_peptide     251800..251877
FT                   /locus_tag="Sden_0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.402 at
FT                   residue 26"
FT   gene            complement(253148..254251)
FT                   /locus_tag="Sden_0227"
FT   CDS_pept        complement(253148..254251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0227"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53524"
FT                   /db_xref="GOA:Q12SQ2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SQ2"
FT                   /protein_id="ABE53524.1"
FT                   /translation="MTRQIIPSSEFASLFLQARPLIDVRAPIEFTKGAFPSAINLPLMK
FT                   DSEREKVGTCYKQQGQESAIKLGHALVSGTVKEQRIAAWRKAIEANPSSYLYCFRGGLR
FT                   SQLSQQWIKEAGFDIPYIQGGYKALRTFLIQILESSAALNSMLILSGRTGSGKTDFLQL
FT                   RDEAVDLEQLANHRGSSFGKNLDPQPSQINFENQLAIAVLQHQTKHHRHLLLEDESFLI
FT                   GRSALPKAFYNSMQHADIVLLEEDDEQRLQRLLFDYVDNKLASFVSRLGDEAGLKAFGD
FT                   YLNASLNGIKKRLGGKFLQELLDSVARALAHQISQNDTSLHLDWISQLLTRYYDPMYDY
FT                   QLSQKQQRVLFKGDHASMHAWLDELRK"
FT   gene            complement(254248..255291)
FT                   /locus_tag="Sden_0228"
FT   CDS_pept        complement(254248..255291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0228"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53525"
FT                   /db_xref="GOA:Q12SQ1"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ1"
FT                   /protein_id="ABE53525.1"
FT                   /translation="MTDTKIKLTEYSHGAGCGCKISPQVLSTILASKLPVFTDKNLLVG
FT                   NQTHDDAAVYKLNDDTGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPIMAIA
FT                   ILGWPVNKLAPEVAQQVVDGGRQACADAGIMLAGGHSIDAPEPIFGLAVTGQIPLSQLK
FT                   QNSTAKAGDKLYLTKPLGIGILTTAQKQKKLQAEDEHIAVDAMCTLNKIGVDIAKIAGV
FT                   NALTDVTGFGLAGHLIEVCQGAELSAQIDVDALPLLAKVKQYLALGCVPGGTHRNFDSY
FT                   SAYLPELNDEQKAILCDPQTSGGLLVCVSEASENSLIQLLESQGITASCIGSLQAVSSD
FT                   KLVEIIQ"
FT   gene            complement(255388..256494)
FT                   /locus_tag="Sden_0229"
FT   CDS_pept        complement(255388..256494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0229"
FT                   /product="Delta-9 acyl-phospholipid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53526"
FT                   /db_xref="GOA:Q12SQ0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SQ0"
FT                   /protein_id="ABE53526.1"
FT                   /translation="MKNPPIIWLNTLLFALTLLGALVLVPWRGLAHGFDAIEWVAFVIL
FT                   AYASGLSITAGYHRLWSHKAYKAHPAMRFLFALGGALALQNSALHWSSDHRIHHKHVDN
FT                   NDKDPYSAKLGFWYSHIGWMLREYQASRYSNYNNVRDLQNDRIVMWQHKHYLVLVILMN
FT                   IGLPVFLGWLNGDILSMLLIAGLLRLVVVHHCTFFINSLAHIWGSQPYTDKNTARDNAF
FT                   LALLTYGEGYHNFHHIFENDYRNGIKWWDYDPTKWLIKLLSWFGLAKDLRKVPQERIES
FT                   ARLQMQLLRVQNKVAHLPNYDEVVAKLEAEYELMKQHLIAYYQAKKALIEARAKPLAYQ
FT                   QLKSQVDELKANLLAQQQNWYALTASYR"
FT   sig_peptide     complement(256393..256494)
FT                   /locus_tag="Sden_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.541 at
FT                   residue 34"
FT   gene            256639..257256
FT                   /locus_tag="Sden_0230"
FT   CDS_pept        256639..257256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0230"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53527"
FT                   /db_xref="GOA:Q12SP9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP9"
FT                   /protein_id="ABE53527.1"
FT                   /translation="MGVRAQQKEKTRRALVDAAFNQLSAERSFSSLSLREVAREAGIAP
FT                   TSFYRHFKDMNELGLTMVDEGGLTLRQMMRKGRQRAEAGGSVIRISVDTFMEVLESNPN
FT                   VFRILLHERSGTSAAFRAAVEREIEHFISELAHYTEANAKRNPLLARAQAEALVILVFN
FT                   AGATALDLKRSERKLLADQLVLQLRMVATGAEALQHKMDSRG"
FT   gene            complement(257337..258434)
FT                   /locus_tag="Sden_0231"
FT   CDS_pept        complement(257337..258434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0231"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53528"
FT                   /db_xref="GOA:Q12SP8"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SP8"
FT                   /protein_id="ABE53528.1"
FT                   /translation="MNLAAMDPSNYDAQLAEKKRKLSEGFAEFAPPELEVFASEPAHYR
FT                   MRAEFRVWHEGDDLYYYMFDKVLDAKVRCEQYLPASTLINAIMTSLVEELRPNHSLRHR
FT                   LFQVDFLSTLSGEILVSLLYHRQLDEQWQVEAAALKQRLSSQFNVNIIGRARKQKIDLD
FT                   KDFVVETIKVNGQDLHYKQIENSFTQPNAKVSIKMLEWAIDATKQSQGDLLELYCGNGN
FT                   FTIALAQNFNRVLATELAKPSVGAAQYNIAINNVDNVQIIRMSAEDFSDAMAKKRSFRR
FT                   LEGIDLDSYNCNTIFVDPPRAGIDDETLKLIQGYERILYISCNPETLKDNLQTLSSSHK
FT                   ITRFALFDQFPYTHHMESGVLLERK"
FT   gene            258675..259508
FT                   /locus_tag="Sden_0232"
FT   CDS_pept        258675..259508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0232"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53529"
FT                   /db_xref="GOA:Q12SP7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SP7"
FT                   /protein_id="ABE53529.1"
FT                   /translation="MSGPILVFDSGIGGLSVLAEIRKRLPAENYCYLFDNARLPYGDLS
FT                   ESELIRGCVELICQQVQQVEAKIVVVACNTASTLVLPVLRQRLTIPVVGVVPAIKPAAL
FT                   LSKRKHIGVLATPGTVSRDYTHGLISQFAEDCQVDLFGSSELVMLAEQKAAKLPVNNQQ
FT                   LAKILAPIKASKLDVLVLGCTHFPMIKEELSQYLGESVLLLDSGEAIANRVASLLEPAA
FT                   LSEALHSGTTLHGGANSGTKGIGVIHAAYTQAITAGLNITLQEYGISDSSLIVTK"
FT   gene            complement(259690..260139)
FT                   /locus_tag="Sden_0233"
FT   CDS_pept        complement(259690..260139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0233"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53530"
FT                   /db_xref="GOA:Q12SP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP6"
FT                   /protein_id="ABE53530.1"
FT                   /translation="MQKSFVIVLIATLVGAFAIFQFAADVPAYITFVAGAVLASLILTF
FT                   VSDTSSHSDEPYVGPTMTLYVGNLPYRVHEGEVKELFGEYGPVNSVRLVRDRKTGRRKG
FT                   FGFVEMSESGAQKAMTKLNDFSFQERTLKVREAKSQDNEASEANA"
FT   sig_peptide     complement(260068..260139)
FT                   /locus_tag="Sden_0233"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            260843..262377
FT                   /locus_tag="Sden_R0007"
FT   rRNA            260843..262377
FT                   /locus_tag="Sden_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            262528..262604
FT                   /locus_tag="Sden_R0008"
FT                   /note="tRNA-Ile1"
FT   tRNA            262528..262604
FT                   /locus_tag="Sden_R0008"
FT                   /product="tRNA-Ile"
FT   gene            262736..262811
FT                   /locus_tag="Sden_R0009"
FT                   /note="tRNA-Ala1"
FT   tRNA            262736..262811
FT                   /locus_tag="Sden_R0009"
FT                   /product="tRNA-Ala"
FT   gene            263308..266212
FT                   /locus_tag="Sden_R0010"
FT   rRNA            263308..266212
FT                   /locus_tag="Sden_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            266395..266510
FT                   /locus_tag="Sden_R0011"
FT   rRNA            266395..266510
FT                   /locus_tag="Sden_R0011"
FT                   /product="5S ribosomal RNA"
FT   gene            266570..266645
FT                   /locus_tag="Sden_R0012"
FT                   /note="tRNA-Thr2"
FT   tRNA            266570..266645
FT                   /locus_tag="Sden_R0012"
FT                   /product="tRNA-Thr"
FT   gene            266682..266797
FT                   /locus_tag="Sden_R0013"
FT   rRNA            266682..266797
FT                   /locus_tag="Sden_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(267196..267861)
FT                   /locus_tag="Sden_0234"
FT   CDS_pept        complement(267196..267861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0234"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53531"
FT                   /db_xref="GOA:Q12SP5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP5"
FT                   /protein_id="ABE53531.1"
FT                   /translation="MSQSILIVEDEIKLANLLADYFKQTEYQPHLIHHGDEVISWVKTH
FT                   QPQAILLDIMLPGKNGIDLCKEIRQFSNVPILMVTAKVEEIDRLLGLELGADDYICKPF
FT                   SPREVVARVKAVLRRGLVIENRDDTLQLDEHRFMVSFHQRGVSLTAVEFQLLKPLATKP
FT                   ERIFTREQLMQNMYSDHRIVNYRTIDSHIKKLRKKLADISQGKDWIQSVYGAGYRLVL"
FT   gene            complement(267896..269383)
FT                   /locus_tag="Sden_0235"
FT   CDS_pept        complement(267896..269383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0235"
FT                   /product="ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53532"
FT                   /db_xref="GOA:Q12SP4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP4"
FT                   /protein_id="ABE53532.1"
FT                   /translation="MKIHNKLFLILFSFSLILVIMLVVLMQWSIAKGMVDYVNTKEVEA
FT                   LKPVITELAQIYKEDHGWQAMTGSHPRFRQLIETQLQGDEFAPRRHNFPPPRRPLRDRP
FT                   PKDGPHALHKGPKDKHPAGRLPPPEHEARYALLDENDGLVVGKYLDNLKYSKTPIVLDG
FT                   VTVGYFAVSKRERLTQGYEVEFIEQQQQYLWLIALLAIALVLLITRPLARHLVEPIKVI
FT                   TRGMHKLTQGDYQHTVDLKRQDEFGQLSRDYNELAIILAANDSARKRWLANISHELRTP
FT                   VAILRGELEAMIDEVRPLTMDNVGSAHDEVKHLQRLIEDLHLLTSADIGAMHYRKQEEE
FT                   LTQVLANELDKYRSYLASAGITLNIEPTIESKASQHPILIYADTTRLYQLFENIINNAV
FT                   KYSSATVLTLSVKQEISSSNIVLITFEDNGVGVEEKHLAHLFEHLYRVDDSRNRQTGGS
FT                   GLGLSICRHIVAAHQGEIWAEKSSLGGLAIHIRLKII"
FT   sig_peptide     complement(269288..269383)
FT                   /locus_tag="Sden_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.343 at
FT                   residue 32"
FT   gene            269671..270681
FT                   /locus_tag="Sden_0236"
FT   CDS_pept        269671..270681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53533"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR025924"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP3"
FT                   /protein_id="ABE53533.1"
FT                   /translation="MKYRHASNRLTPQQLLCLLVTCALAGCGGDSADSPAEVPVDSVLT
FT                   IDTGSTTGTDTGAATTVGFTAGVLCDYFNDTYNNSASVDAYSTAQWSCTDTSRELSANG
FT                   LPDHEVGTFPNAHNPNAISGQSVSASLALAPTQTSTVRILGGPRGATGYVLNGVKIDAG
FT                   TAGSCDDSGAVCSLSDNSGGWSIEALGQTSFNFGTDDNNAHVQPGGSYHYHGMPEGFIT
FT                   KQGGNSSSMTLIGWAADGFPIYARYGYSQADDASSAVKSMTGSYQLVSTISASRPSTDT
FT                   YPLGTFKQDWVYVAGSGDLDECNGRIGVTPEFPEGIYHYYATDSYPFFQRCVKGE"
FT   sig_peptide     269671..269769
FT                   /locus_tag="Sden_0236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.793 at
FT                   residue 33"
FT   gene            270684..271238
FT                   /locus_tag="Sden_0237"
FT   CDS_pept        270684..271238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53534"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP2"
FT                   /protein_id="ABE53534.1"
FT                   /translation="MSSRYNTLSTALLGCSLSLFVPSTATAHLMVAQHGTLNIVNNDVF
FT                   MVLSLPLSAFEGLDTNLDGEVSMLEFNHQRAVITEAINAQIQLTDKDGKREIQGLIMSP
FT                   QLHGAEELSHHDALAQPQLIVMGKFTLQATKEAVEFYFGLYGTNPTEQQIQITVTSVTK
FT                   NATKKQQVELTALAPKMVILP"
FT   sig_peptide     270684..270767
FT                   /locus_tag="Sden_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.965 at
FT                   residue 28"
FT   gene            complement(271412..272353)
FT                   /locus_tag="Sden_0238"
FT   CDS_pept        complement(271412..272353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0238"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53535"
FT                   /db_xref="GOA:Q12SP1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP1"
FT                   /protein_id="ABE53535.1"
FT                   /translation="MSYQQLTEGRRYQISVLLDQGISITLIAKAINCHRATVYRELKRC
FT                   HALQGYCPDSAQASACKMRRHSAKYKIPDTRINVVRFLLQHDWSPEQISRVLSGMNQAV
FT                   SHEWIYRFVARNKRQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRER
FT                   FGDWEIDTVLGKHGTGSIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHT
FT                   ITADNGREFAHHEVIANALDTSFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSD
FT                   DIILFAQNRINYRPKKCLKFKQPAVVFKQLAA"
FT   gene            272495..273274
FT                   /locus_tag="Sden_0239"
FT   CDS_pept        272495..273274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0239"
FT                   /product="Thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53536"
FT                   /db_xref="GOA:Q12SP0"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SP0"
FT                   /protein_id="ABE53536.1"
FT                   /translation="MVKAKIFTIPKPRIAPKLRVFCFPFAGGSFTTYIPWVHCLNDDVE
FT                   LVLITLPGRASRVSELSHDQMASIISELLEQKSIFADVPYIFFGHSLGSRIAFELAVNL
FT                   QYLGITSPQYFIASGSRAPHLASRRESIHHLPKSEFIQKLGELNGTPKEVLSNSELIDF
FT                   FIPALRADFKVAHDYRAKKIPIESPILVLGGKDDIDVTHLELLAWRELSQRETKITLIP
FT                   GGHFFINEHKSVVIEQVDFVVNLVLTCNEMKHVDEIF"
FT   gene            complement(273401..273901)
FT                   /locus_tag="Sden_0240"
FT   CDS_pept        complement(273401..273901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0240"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53537"
FT                   /db_xref="GOA:Q12SN9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN9"
FT                   /protein_id="ABE53537.1"
FT                   /translation="MTSRVSVKTNLITAEGLAKLTHELNYLWREYRPEITKKVAWAASL
FT                   GDRSENADYKENKRLLRQIDGRVRFLRKRIEALKVVPYAAEQEGKVFFGAWVEIENDEG
FT                   VKKRFRIVGPDEIYGDAKGYISIDSPMARALLKKEVDDDASVLTPTGEQFWYINKIFYQ
FT                   GGL"
FT   gene            complement(274231..274722)
FT                   /pseudo
FT                   /locus_tag="Sden_0241"
FT   gene            275231..276163
FT                   /locus_tag="Sden_0242"
FT   CDS_pept        275231..276163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0242"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53538"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN8"
FT                   /protein_id="ABE53538.1"
FT                   /translation="MMNHFLKITKKISLKTSILISVLLGFFTSYAVIAGTAVNNEFSRA
FT                   GVLSHVYSSNLLARDYVIDVILPPGFNPQDQDKKYPVIYILDGYVHFPMTGFNMYLEQL
FT                   VGDDGASKTPKAIVVGIEQPIMKYDWKIRTLDMTPTEIEKNGNVIGGGADKFLSFLNDE
FT                   LKPFINSTYSGDVNDQTILGHSLGGLFTLYTLFSQPESFDRYVIGSPTTWWDDDYIFEL
FT                   EDDFSEGNVDLKKHVYLFVGGDEVCNSDGELCGVAGVRKMTRKLKSRGYASLNVTKKVF
FT                   KNEHHNSVVAPGYDQGLKFVMGRLTRKSK"
FT   sig_peptide     275231..275326
FT                   /locus_tag="Sden_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.664 at
FT                   residue 32"
FT   gene            276435..278834
FT                   /locus_tag="Sden_0243"
FT   CDS_pept        276435..278834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0243"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53539"
FT                   /db_xref="GOA:Q12SN7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN7"
FT                   /protein_id="ABE53539.1"
FT                   /translation="MHSTSQTIAQIIAQELNVREQQVMATIALLDEGSTVPFIARYRKE
FT                   ATGGLDDTQLRNLYSRLGYLRELNDRRQVVLSSIKAQDKLTPALEHEINQADSKTRLED
FT                   LYLPFKPKRRTKGMIAIEAGLEPLADFLLANRNADIDAKAAEFINSAAGFSDEKAVLEG
FT                   ARYILMERFAEDAELIRKVRSHLAQHAVLESKVMKGKEKEGSKFRDYFEHTEALHKVPS
FT                   HRALAMLRGRNESMLSLSMNADPDTQAIDGSYCEVIIADHFNLKLSDTSVDAWLKTVVT
FT                   ATWRIKIALQMENEMISQMRERAEEEAIKVFARNLGDLLMAPPAGAKATMGLDPGLRTG
FT                   VKVAIVDNTGKFVAHTVIYPHAPQNVWDKSIRTLANLVNMHKVELIAIGNGTASRETDK
FT                   LAGEVIASLKDTHPNLTKIMVSEAGASVYSASELAAEEFPNLDVSIRGAVSIARRLQDP
FT                   LAELVKIEPKSIGVGQYQHDVSQSQLSSSLDAVIEDCVNGVGVDLNMASAPLLAQVAGL
FT                   NKTLAKNLVDYRDEHGQFTNRKQLLKVARLGPKAFEQAAGFLRIRGGDNPLDASSVHPE
FT                   AYKLVETIAQKTQQAIDSLIGNSGLLSSIKAEDFVSDEFGLPTINDILAELDKPGRDPR
FT                   GEFKTASFKEGVEELKDLKPEMILEGVVTNVTNFGAFVDVGVHQDGLVHISSLTDKFVS
FT                   DPHTIVKAGDVVKVKVMEVDIERRRIGLSMRLDEAINTSASSVKPKQDNRGSAANKTST
FT                   NTGITNKGASANNGKPTGRKAPAPKAAPANAAMGNAFADAFAKMKK"
FT   gene            278944..279738
FT                   /locus_tag="Sden_0244"
FT   CDS_pept        278944..279738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0244"
FT                   /product="SMC protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53540"
FT                   /db_xref="GOA:Q12SN6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN6"
FT                   /protein_id="ABE53540.1"
FT                   /translation="MNFDEKPYLRSIALKHQGLAEAKVTLIDGEFHDESAVRVQDCYPF
FT                   TIPALAGFDSLDFDADVTFFVGENGSGKSTLLEAIAVAMGLNAEGGNKNTHFATKVSHS
FT                   NLGYYLKTIKSFKKPKDSYFLRAESFYNLASYMEEDGREAYLGSYGGTSLHQQSHGESF
FT                   MATLLHKFRGQGLYLMDEPEAALSPSRQLAALSAIHQLVENKSQFIIATHSPILLAYPR
FT                   AKIYQFSNQGIVQITYQETEHYQITKAFLNQPEKLLASLGVG"
FT   gene            complement(279756..281009)
FT                   /locus_tag="Sden_0245"
FT   CDS_pept        complement(279756..281009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0245"
FT                   /product="GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53541"
FT                   /db_xref="GOA:Q12SN5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN5"
FT                   /protein_id="ABE53541.1"
FT                   /translation="MSASILTLAIAFFWRTFLSSFYHSCRYLVMPILLTAVLLGLIEHF
FT                   QNQWLNWQQTIEQMPYWLLGCATIIALQFNRSRLSYIGVLLLSFYALSQNSGFDPKENE
FT                   LILISGGLIIAVFSFIKDRGLISVHSLLRLGVILGCFLTAYLWILVLSHFSQQMLSLHQ
FT                   NYLPFLSASHFSRLPLYPIGLILLIKLSLQSSLLQTSLGVTFLLWVLHFSAPNWLPLAV
FT                   QLNVIALFFLATVIIDSYFLAYRDELTGLPSRRALFNLSLSLGRKYSVAMVDIDHFKKF
FT                   NDTYGHDVGDQVLKLVAAKLAQVTGGGKAFRYGGEEFTIVFPRKEVKRVFPHLDDVRES
FT                   VEEYEIVLREEKRKGKEDKQASKKRTKKAPAKQRTVSVTVSIGCAQHQADQSFEQCMKE
FT                   ADKALYKAKERGRNQVCS"
FT   gene            281303..282577
FT                   /locus_tag="Sden_0246"
FT   CDS_pept        281303..282577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0246"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53542"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SN4"
FT                   /protein_id="ABE53542.1"
FT                   /translation="MKLEMICTGEEVLSGQILDTNAAWFANVMMDMGVETQYRVTVGDR
FT                   LEDLVAVFRERSLHADVILVNGGLGPTSDDMSAQAMAMAKGEPLVENALWRHTLEEWFA
FT                   RYNREMPRSNLKQAMLPASAIMVDNPVGTACGFRVKLNNAWLFFTPGVPSELKHMVHEQ
FT                   FIPFIRSEYELDEQSSVEKLLTLGQGESAIGDILSEVLLPEGISFGYRSFMPYIEVKIF
FT                   ARGQKAMAQLGSITSQVKHALGAVVVAEGKTSLAAEIHARLFQSGFSLSVAESCTGGMI
FT                   ASQLTDFPGSSSYFQQGLVTYSNESKVKLLGVLPQTLDDHGAVSIATVEAMAIGARNIL
FT                   DSDFALATSGIAGPDGGTEDKPVGTVAIALATKFGTYSQMVKLPRRSRELVRNLTAAIA
FT                   LDMLRRALLDEAVIVDYPSVQRLAK"
FT   gene            complement(282677..283216)
FT                   /locus_tag="Sden_0247"
FT   CDS_pept        complement(282677..283216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0247"
FT                   /product="protein of unknown function DUF1439"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53543"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN3"
FT                   /protein_id="ABE53543.1"
FT                   /translation="MMKPLTLIGVMLLLLLTGCASQYSITESDIEQYLNKDMHFEVKQG
FT                   NQLIGVSLKLNEIQVVLGQKPNTMAVTAATVIRVNNPLLPIQARLKTTFEAEPWYDSKT
FT                   KSVYLRQLNLVKVESEPKDIERYIAQATPQLMGFLRNYLQTQPVYTLDVNDSNQALMAK
FT                   MTKALEVHQGKLVVKF"
FT   sig_peptide     complement(283148..283216)
FT                   /locus_tag="Sden_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.435 at
FT                   residue 23"
FT   gene            complement(283213..285876)
FT                   /locus_tag="Sden_0248"
FT   CDS_pept        complement(283213..285876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0248"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53544"
FT                   /db_xref="GOA:Q12SN2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN2"
FT                   /protein_id="ABE53544.1"
FT                   /translation="MSVQSKAEDATDVYASLRANVGQLGQILGDTMRSHLGDAFLEKVE
FT                   QIRILAKKSRQGDDGAREQMLALLTALPDEELIPFAKAFNQFLNLANIAEQFHTISRNC
FT                   DELVCVPDPVEQLLGRLLKHDLDKSQLHQCLTELDIDLVLTAHPTEISRRTLIQKYASV
FT                   VDCLTSLENPLLTEREHSQLQLRLRQLIAQIWHTNEIRHERPTPVDEARWGLSTIETSL
FT                   WQAVPDFLRQLNDQFEQKTGLQLAKDVSPVRFSSWMGGDRDGNPFVTARVTQEVLDRNR
FT                   HAAARLYLKDIVTLMNELSMEEANAELKALTNNSNEPYRDVLKGLRQKLRNTIDYLNER
FT                   LEGHQPDIDFNSIIWEQSDLQAPLECLYQSLCDSGMRLIAHGLLLDILRRLACFGIHML
FT                   KLDIRQDAERHSDVIAELTRYLGLGDYHHWDEDEKQAFLLRELTNRRPLLPPNWKPSPD
FT                   VAEVLSTCALISKQSPKALGSYVISMASKPSDVLTVLLLLKESGCTYPMRVVPLFETLK
FT                   DLTGAAACIKELLQIDWYRGYTKGMQEVMIGYSDSAKDAGVMAAAWAQYRAQEELVAVC
FT                   KQAGVKLTLFHGRGGTVGRGGGPAHQAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLA
FT                   VQSLALYTSAVMEATLMPPPEPKKAWRECMQAIADESVLAYRGIVREEPDFVAYFRAAT
FT                   PEVELGKLPLGSRPAKRKVGGGIESLRAIPWIFAWSQNRLMLPAWLGAGEALSSAIEQS
FT                   QLNLLQEMEREWPFFETRISMLEMVYTKAEPNLARYYERCLVPTELHHLGDKLRARLQL
FT                   GIDTVLSLTQSDELMSHTPWSRESVKLRNPYIDPLNFLQTELLARTRNEDQASEKVQLA
FT                   LMLTIAGVAAGMRNTG"
FT   gene            complement(286030..286323)
FT                   /locus_tag="Sden_0249"
FT   CDS_pept        complement(286030..286323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53545"
FT                   /db_xref="GOA:Q12SN1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SN1"
FT                   /protein_id="ABE53545.1"
FT                   /translation="MSNHAVIELLQNWFSEPFAGKADNPWTQLVAELAGSEAEVVKYST
FT                   EAPYINKLGCQTLVLGPGSINQAHQPDEFIATEFLTPTVELLKKLVHHACIK"
FT   gene            286666..287646
FT                   /locus_tag="Sden_0250"
FT   CDS_pept        286666..287646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0250"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53546"
FT                   /db_xref="GOA:Q12SN0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SN0"
FT                   /protein_id="ABE53546.1"
FT                   /translation="MKNIAIIGASGYTGAQITSLIHADAGLSVQGLYVSENSLDKGREL
FT                   SELYPLYSHLPYVLNPLSDDVKAKIVAESDAVVLATEHSVSLELAAWFYQQGLAVFDLS
FT                   GAYRFADVAQYPKWYGFEHTHPDVLAEAVYGLAEWNAAEIAKTRMIAVPGCYPTASLTA
FT                   LKPLKSLLTSAYPVINAVSGVTGAGRKAHLHTSFCEVSLTPYGVLGHRHQPEIATQLGQ
FT                   EVIFTPHLGNFKRGILATITVQLQPGTTEEQVKQAYEVYDNSPLVTVKHNAFPKVDDVV
FT                   HTPNCHLGWKYDANSGYLVVASAIDNLMKGAASQGLQCIKIHFNL"
FT   gene            287671..288453
FT                   /locus_tag="Sden_0251"
FT   CDS_pept        287671..288453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0251"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53547"
FT                   /db_xref="GOA:Q12SM9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SM9"
FT                   /protein_id="ABE53547.1"
FT                   /translation="MSDNKSVLVLKVGGALLQCEMGMSRLMTAAAQMIATGQKVLLVHG
FT                   GGCLVDEQLTANGKETIKLDGLRVTPEDQIPIVVGALAGTSNKILQAAAAKAGLVSVGM
FT                   SLGDGNTVHAKIKDERLGLVGEVSPNDATYLNFILDQGWLPICSSIAVSADGLMLNVNA
FT                   DQAATALAKLVNGNLVLLSDVSGVLDGKGQLIASLNKTEIETLVKQGVIEKGMKVKVEA
FT                   ALEVAQWMGKPVQVASWRDAEQLKKLVLGQSVGTQIQP"
FT   gene            288504..289409
FT                   /locus_tag="Sden_0252"
FT   CDS_pept        288504..289409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0252"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53548"
FT                   /db_xref="GOA:Q12SM8"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SM8"
FT                   /protein_id="ABE53548.1"
FT                   /translation="MKHLLSIKEFTQPQLLALLKLAKEIKAQPAQYRHALAGKSIVMLF
FT                   EKPSLRTRVSFDIGINKLGGHCLYLDQQNGDIGKRESVADFAANLSCWADAIVARTYRH
FT                   STIEKLAKYGSVPVINALSDLYHPCQALADYLTLAEQFDDLSQVKLAYVGDGNNVTHSL
FT                   LYGAAILGMTMTVVCPEGHFPDGLIVSEAQALAEQHGGKIILSTNIAELSDQDAIYTDT
FT                   WISMGDSTNLDDIKQKFAKFQVNKALMSKAGARYFMHCLPAHRGVEVTDEVLDGEGSLI
FT                   LVQAENRMHAQNALLVSLLT"
FT   gene            289500..290723
FT                   /locus_tag="Sden_0253"
FT   CDS_pept        289500..290723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0253"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53549"
FT                   /db_xref="GOA:Q12SM7"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SM7"
FT                   /protein_id="ABE53549.1"
FT                   /translation="MSSTVKKTGVKKVVLAYSGGLDTSAIIPWLKETYDDCEIVAFCAD
FT                   VGQGEEELVGLTEKALASGASECHIVDLKEEFVKDYIYPTIATGAIYEGTYLLGTSMAR
FT                   PIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWEMRSRE
FT                   DLLAYLAARDIQTSASATKIYSRDANAWHISHEGGELEDPWNEPSKGVWTLTVAPEDAP
FT                   DEAEYVALSIKHGRVTHVNEQVLSPYNALMKLNDIASKHGVGRIDITENRLVGMKSRGC
FT                   YETPGGTVMFAGLRAIEELVLDKTSRTWREQVAAQMAHLVYDGRWFTPLCNSLLAASES
FT                   LAEAVNGDVVIKLYKGQATAVKKRSPNSLYSESFATFGEDDVYDQKHAEGFIRLYSLAS
FT                   RIRAMNSN"
FT   gene            290820..292187
FT                   /locus_tag="Sden_0254"
FT   CDS_pept        290820..292187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0254"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53550"
FT                   /db_xref="GOA:Q12SM6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SM6"
FT                   /protein_id="ABE53550.1"
FT                   /translation="MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVIGSIAWADAIA
FT                   SVGVISAAECTELKAALKELLAEVGDDPQVIISTGAEDIHSFVEQKLIAKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKREGAALLARLNTLRSELIALAEREVDAVMPGYTHLQRAQPI
FT                   TFGHWCLAYVEMFERDLSRLTDALKRADTCPLGSGALAGTAYPIDRHALASALNFARPT
FT                   LNSLDSVSDRDHVVELCSSASISMMHLSRMAEDLIFFNSGEANFISLADDVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVYGSLMGILTTMKALPLAYNKDMQEDKEGLFDVVDSWAICLD
FT                   MAALVLSGLKVNREPALQAAQQGYANATELADYLVAKGMPFREAHHVVGEVVVFAITQQ
FT                   QPIEDLTLTQLQAFAKEISDDVYPNLTIAACLSKRNVLGGTAVNQVSAAIAVKKQD"
FT   gene            complement(292281..294878)
FT                   /locus_tag="Sden_0255"
FT   CDS_pept        complement(292281..294878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0255"
FT                   /product="Penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53551"
FT                   /db_xref="GOA:Q12SM5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SM5"
FT                   /protein_id="ABE53551.1"
FT                   /translation="MFLLHLLHSRLYTNASIFCFWDFRLKWFKRFIIALFSLALLGIGT
FT                   ITAAYFYVLPELPDVTTLKDIQLQTPLRIYSSDGKLISQFGEKRRIPLKLEEVPKPLIQ
FT                   GFLAIEDTRFYEHKGIDPIGVLRAAFVMIATGEKKQGASTITMQVARNFFLTRDKTIIR
FT                   KVKEIFISLHIEQLLSKDEILELYVNRIYLGQRAYGVGAAAQVYFGKEVQNLTLAEMAV
FT                   IAGLPKAPSTLNPITSATRALARRNLVLMRMHEVGFINQFEYQDALSQPITASYHGAEI
FT                   DLYAPYISEMARDYMVQKYGEEAAYTNGYNVYTTISSDLQLMAQDALRDNVFAYDERHG
FT                   YRGPAATLWATQQPSTEEITSVLNKTASVQGIIPAAVLSVTEQQAKVIDAQGQEITLEW
FT                   QGLKWARKFINDKRQGNPPKTAAEILTPGQQVWIRNNGEFWQLSQLPEVSSATVSLDPK
FT                   NGAIRTLVGGFSFSQSQYNRVTQAKRQLGSNIKPFIYAATLEKGYTLATLINNAPINKP
FT                   DTRQGTAWRPKNSPDIYGGPTRLRVGLAQSINVMSVRAMRHVGIPATIKKLTEFGFDAS
FT                   DLPSNESLALGSPSVTPLQVAAAFNVFANGGYLVEPYFIDKVTDAFSTVIEEANPTLAC
FT                   TPAAPTSDANPAYDEFGAQTSTMNQVDGQSQCGNDTSRFAPQVISEQTAFLITEALKSV
FT                   IWGGGDWKHGTGWQGTAWRAARLIKRHDIAGKTGTTNEARDTWFSGFGPTLTSTFWVGF
FT                   DDHRRQLGRTSWLANGPSDQISAGEAGAKTAGPGWNDFMNKALKGVPEVAVVPPKGIVS
FT                   ARIDLATGKLTRKTDHTTAFEYFAAGTEPKEYVADTPQHDTNFTDNPAEDLFQ"
FT   sig_peptide     complement(294732..294878)
FT                   /locus_tag="Sden_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.846 at
FT                   residue 49"
FT   gene            294990..296069
FT                   /locus_tag="Sden_0256"
FT   CDS_pept        294990..296069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0256"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53552"
FT                   /db_xref="GOA:Q12SM4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SM4"
FT                   /protein_id="ABE53552.1"
FT                   /translation="MLSKFWRPQAPQMIGVDIGSYEIKAILLGKTADGYKIQAHSCVPI
FT                   KKGAVVDHDIRDSAAVIEALKQVKRGLPKSAKFAAVSVSGSAVMTKVIYMDSSLTEEEM
FT                   EAQIEIEADNLIPYSLDEVSIDFETLKTNKTDPTKVDVLLSACRTENIDSRVDALDAID
FT                   IDAKVVDVEGYALGRSAELIMAQLPPGAEEKSVALVDIGANMTTFAVVERGETIFTREQ
FT                   AFGGELFTQAILSTYGMSYDEAENAKIKGELPRNYTFEVLSPFQTQLLQQVKRTLQIYA
FT                   TASGKEKVDYIVLCGGTAKLEGMEALLLNELGINTVVANPFLGCLHGDELIKSQLQPNV
FT                   NKYMVACGLALRSYAQWRI"
FT   gene            296057..296650
FT                   /locus_tag="Sden_0257"
FT   CDS_pept        296057..296650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0257"
FT                   /product="Fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53553"
FT                   /db_xref="GOA:Q12SM3"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SM3"
FT                   /protein_id="ABE53553.1"
FT                   /translation="MANINLLPWREEAREKQKRDYMGTLALVFLMSSLVAYLSLSLIEG
FT                   MTENQRSRNAYLKSEISLLDAQIEEISKITERKKDIERRTEIILNLQQSRNLPTHVLDE
FT                   LVRIVPPGIYLSSIDKKGSVLWIEGRSESNNNVANMMRKVKTSEYLDDPSMQSIVAQNE
FT                   ELRLLQRFKLRIAIRETSSFELDAGGNTAQGAKK"
FT   gene            296647..297267
FT                   /locus_tag="Sden_0258"
FT   CDS_pept        296647..297267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0258"
FT                   /product="Pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53554"
FT                   /db_xref="GOA:Q12SM2"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SM2"
FT                   /protein_id="ABE53554.1"
FT                   /translation="MNFDLEQFNDIDFENIGGWPKLVKLVFAAILSVVVLAGSYYLFIS
FT                   DAIDTLSYEQNEEIKLRQDFENKYRLAANLKLYREQLVVMEAQFAELLKMLPSENEMPG
FT                   LLDDLTFVATDAGLKITSLDWEAEIERDFYIEFPIKMTVNGNYHEIGDMVSAVAKLPRI
FT                   VSLHDFSIVKDESGELSMNILAKTYRFKEGAELPKELPKAKGK"
FT   gene            297267..297785
FT                   /locus_tag="Sden_0259"
FT   CDS_pept        297267..297785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0259"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53555"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SM1"
FT                   /protein_id="ABE53555.1"
FT                   /translation="MMKHLSLLALVFLLTACVGDRSDLELFVTTTKAQHVARIPPLKEP
FT                   PKFEHFVYQAQLMRSPFVPPSRELTEEVVDTSKDCLQPDLQRRKGRLETYALDNLKMRG
FT                   TLSEGDTIWALLESTDGNVYRLGVGEFVGLYHGRIAKVTLQFIEILELIPDGSGCWTER
FT                   SSNLELSGK"
FT   sig_peptide     297267..297326
FT                   /locus_tag="Sden_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.380 at
FT                   residue 20"
FT   gene            297804..299855
FT                   /locus_tag="Sden_0260"
FT   CDS_pept        297804..299855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0260"
FT                   /product="type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53556"
FT                   /db_xref="GOA:Q12SM0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SM0"
FT                   /protein_id="ABE53556.1"
FT                   /translation="MMKSSAAITTVKKSQSVMKYLFAIILSIGILPNALAANRLMDVKY
FT                   HSLVDHQLELELVFESDIMSPQVDLSAEPAQIMLNFADTVSELSSDKVVINSVGVDSLI
FT                   TEQDDSALRVTLNLNSVKPYQGKIVGNSYRLTINDAQAGPQQADDPFVNAVSNIDFRRS
FT                   KTGGGQLSIQLNNRSVAANVEQVGSKLEIKLYNTDIKSELLYVMDVQDFATPVVSFETF
FT                   KDDLTTRIIVDVDGNYDYDYRQEGNVFKIDIDKVERISIAKEDKKYSGKTLSLNFQNIS
FT                   VRTVLQIIADYNNFNLVTSDTVEGNITLRLDDVPWDQALDLILQAKGLDKRIEGNILMV
FT                   APSEELAIRESQDLKNKQEVKELAPLYSEFLQINYAKAIDIAELLKSEDSSLLSTRGSV
FT                   AVDQRTNTLLVKDTADIIDNIHRLIEVLDIPIKQVLIESRMVTVKDDVSEDLGIRWGIT
FT                   DQQGTKGTSGSLTGSQNIANGVVPSIDDRLNVNLPAAASNHTSIAFHVAKLADGTILDL
FT                   ELSALEQENKGEIIASPRITTSNQKAAYIEQGVEIPYVQSTSSGATSVTFKKAVLSLRV
FT                   TPQITPDNRVILDLEITQDSQGKTVDTPTGPAVAIDTQRIGTQVLVDNGETIVLGGIYQ
FT                   QNLISRVSKVPILGDIPYVGFLFRNTTDKNERQELLIFVTPKIVTEKL"
FT   sig_peptide     297804..297914
FT                   /locus_tag="Sden_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.990 at
FT                   residue 37"
FT   gene            300156..300671
FT                   /locus_tag="Sden_0261"
FT   CDS_pept        300156..300671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0261"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53557"
FT                   /db_xref="GOA:Q12SL9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SL9"
FT                   /protein_id="ABE53557.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRHLAQLLHLEFHDSDHEIEQRTGA
FT                   DIAWVFDVEGEEGFRRREAQVIADLSEKQGIVLATGGGSVQSKDIRNHLSARGIVVYLE
FT                   TTIDKQVARTQRDKRRPLLQVDDPREVLENLAETRNPLYEEIADVIVKTDEQSAKIVAN
FT                   QIIEQLGF"
FT   gene            300680..301753
FT                   /locus_tag="Sden_0262"
FT   CDS_pept        300680..301753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0262"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53558"
FT                   /db_xref="GOA:Q12SL8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SL8"
FT                   /protein_id="ABE53558.1"
FT                   /translation="MQQIQVNLGDRSYPIHIGLDLLKQQQTFQSLQSKKVFIVTNDVVA
FT                   PLYLTQVKAALADCASVDVFVLPDGEKNKDLAHLEQIFSALLEKNYARDTTLLALGGGV
FT                   IGDMTGFAAACYQRGVPFVQVPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPQCVII
FT                   DTQCLHSLPKAEFDAGMAEVIKYGIIWDAEFFLWLENNIAALKALDTQALTYAIAKCCA
FT                   IKADIVSQDETEQGVRALLNLGHTFGHAIEAQMGYGNWLHGQAVAAGSVLAAKTALALG
FT                   LLDALSVQRIENLFRAFDLPIDGPQSMAFSDYMRHMRRDKKVLASKIRLILPQAIGQAG
FT                   IYSDVDEALLAQVINPS"
FT   gene            301785..303320
FT                   /locus_tag="Sden_0263"
FT   CDS_pept        301785..303320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0263"
FT                   /product="Sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53559"
FT                   /db_xref="GOA:Q12SL7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL7"
FT                   /protein_id="ABE53559.1"
FT                   /translation="MLLLPTQEMLVQRLQHMASYSEQLLVLCGAKGSGKSTLAAALASE
FT                   LEEINSALVVCPQHVDSNEIRRKILIQLISDPIFDDELPLTDTLLRIQSYLTKPLHIII
FT                   DDAHLLPKVLWAECILLSQMSCGGKHVSVTFTIENKFWQPLLAELGKAVDDSVLQVIIE
FT                   PLPIAEREALYQSLLLRSEQDAFTPRNIVSGLLEKQAGTPAEVVSLLATALETKNANKH
FT                   SPKRHSRLISFMGILAAILAWWLFTNPSLWNEGKSLGFSKVKFASEVERLQDNWLIDYG
FT                   QQLLSHYWWQRNSPLNLHLSPGELLQTELVNANQNDDEPLTSTLNQTDNGGVSIGRPDR
FT                   AQPLGLQEKATQQDKDIAQAQELAQRQLNSETSPPLAKLAPVSVVGNVSVAAENTKAVP
FT                   ASRIQNNVAAVKSQSPTAKVKPEANLGKAPYKNGYTLQLANVTQRASLRPILTQIPRSE
FT                   LVIHASQTGHFLLFVGNFSSEAQARNKAAELKRLGLGDPWLRRWADLQQYSFE"
FT   gene            303394..304233
FT                   /locus_tag="Sden_0264"
FT   CDS_pept        303394..304233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0264"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53560"
FT                   /db_xref="GOA:Q12SL6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL6"
FT                   /protein_id="ABE53560.1"
FT                   /translation="MTKKHRAFLKWAGGKFKLVDELAKQLPKGKRLIEPFVGAGSVFLN
FT                   TDYDDYLLCDINPDLINLYNIIKQTPEAYITAAKALFIPEMNDKQAYLDVREKFNQTQD
FT                   PFARSVYFLYMNRHGFNGLCRYNRKGGFNVPFGTYKKPYFPENEIRYFSEKAQRAEFKC
FT                   IGYEEAFALAEKDDVIYCDPPYAPLSTTASFTTYVGPGFSLDDQAILARESRHTALVKG
FT                   IPVLISNHDIPLTRELYRGAKLGSISVQRNISQNGGSRKKVDEIMALYDHHYREDEE"
FT   gene            complement(304306..304488)
FT                   /locus_tag="Sden_0265"
FT   CDS_pept        complement(304306..304488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53561"
FT                   /db_xref="GOA:Q12SL5"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL5"
FT                   /protein_id="ABE53561.1"
FT                   /translation="MRVLWQVFTSTLAAFFGVQSNDNRQRDFQNHSPLAYIAMGIIMAV
FT                   LLVVSLILLVNQVLA"
FT   gene            complement(304489..304872)
FT                   /locus_tag="Sden_0266"
FT   CDS_pept        complement(304489..304872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53562"
FT                   /db_xref="GOA:Q12SL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL4"
FT                   /protein_id="ABE53562.1"
FT                   /translation="MSNQINNLSQIPTHGRRAAGFVFIKPLLALAVLGLTIIATQYSLT
FT                   VQASLAANNACQCSENASYNALLPSSHPNNRCATENTDVSWKNWLTGKSRSNQFHFLDL
FT                   LELLHGHKSNTTDDIPTNSDTPL"
FT   sig_peptide     complement(304726..304872)
FT                   /locus_tag="Sden_0266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.837) with cleavage site probability 0.577 at
FT                   residue 49"
FT   gene            305182..305850
FT                   /locus_tag="Sden_0267"
FT   CDS_pept        305182..305850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0267"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53563"
FT                   /db_xref="GOA:Q12SL3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL3"
FT                   /protein_id="ABE53563.1"
FT                   /translation="MRPFLIAPSILSADFARLGDDVKAVLDAGTDVVHFDVMDNHYVPN
FT                   LTIGPMVCTALRNYGITADIDVHLMVKPVDRIIPDFAKAGASIITFHPEASEHIDRTLQ
FT                   LIKESGCKAGLVFNPATPLHYLDHVMDKLDVILLMSVNPGFGGQSFIPATLDKLRQVRA
FT                   RIDASGFDIRLEVDGGVKVDNIAEIAAAGADMFVAGSAIFNQPDYKVVVDKMRAELAKA
FT                   "
FT   gene            305861..306547
FT                   /locus_tag="Sden_0268"
FT   CDS_pept        305861..306547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0268"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53564"
FT                   /db_xref="GOA:Q12SL2"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL2"
FT                   /protein_id="ABE53564.1"
FT                   /translation="MTKWNSIKAIAFDLDGTLIDSVPDLAAATNATLAELGLAEVSQAQ
FT                   VRSWVGNGTQALMERAISYALGREVSKDELKQAMVPFLIHYEYHLEKHSSLYPNVIETL
FT                   TALTQAGFKLALVTNKPHKFTVPLLRAFGLIEFFDLVLGGDSLAKMKPDPLPLAHVLAT
FT                   WQMQPDELLMIGDSKNDILAARAAKVSSIGLTYGYNYGEHISLSEPNAVCDDLAQISEY
FT                   LPSACV"
FT   gene            306596..307594
FT                   /locus_tag="Sden_0269"
FT   CDS_pept        306596..307594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0269"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53565"
FT                   /db_xref="GOA:Q12SL1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL1"
FT                   /protein_id="ABE53565.1"
FT                   /translation="MSKPIVLSGAQPSGELTIGNYMGALRQWVAMQDSHDCLYCVVDLH
FT                   AITVRQDPKALREACLDTLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGEL
FT                   SRMTQFKDKSQKHASNINVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATR
FT                   FNNAYGDTFTIPEPFIPEHGAKVMSLQEPLKKMSKSDDNRNNVIGLLEDPKAILKKVKK
FT                   AMTDSEEPPVVRFDMEQKPGVSNLLSLMSGVTGQSIASLEAEFEGKMYGHLKGATGEAV
FT                   VAMLEPLQARYREFRADQSLLNQVMHDGAERAQARAEVTLKKVYEKIGLLV"
FT   gene            complement(307665..308240)
FT                   /locus_tag="Sden_0270"
FT   CDS_pept        complement(307665..308240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0270"
FT                   /product="transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53566"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SL0"
FT                   /protein_id="ABE53566.1"
FT                   /translation="MKYALILLTLALLQGCAGAVVLGAVSGAKMANDERSVGTQLSDTN
FT                   ADFQISSALSKHNDISNQTNITAVVMNNNVLMIGQSPNSMLRDKAINAVQGLQLGGKIH
FT                   NQIRIGNPTSFTTRSNDTWVTTKVKGRMLNENGIDVTRIKVITENGEVFLLGLVDRKQA
FT                   DLAVDIARNTAGVRKVVKVFEYVDVSKD"
FT   sig_peptide     complement(308181..308240)
FT                   /locus_tag="Sden_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.565 at
FT                   residue 20"
FT   gene            complement(308240..308830)
FT                   /locus_tag="Sden_0271"
FT   CDS_pept        complement(308240..308830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0271"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53567"
FT                   /db_xref="GOA:Q12SK9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SK9"
FT                   /protein_id="ABE53567.1"
FT                   /translation="MLERIKDSFTESIQTKIDAAEALPESIEKAAEMMVQCLLGGKKIL
FT                   ACGNGGSAGDAQHFSAELLNRYEIERPPLPAIALSTDTSTITAIANDYSYDEIFSKQIF
FT                   ALGQPGDILLAISTSGNSGNIIKAMEAALSRDMTIVALTGKDGGAMAGLMSAGDVEIRV
FT                   PSNVTARIQEVHLLVIHCLCDNIDRTLFPQDEA"
FT   gene            complement(308904..309230)
FT                   /locus_tag="Sden_0272"
FT   CDS_pept        complement(308904..309230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0272"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53568"
FT                   /db_xref="GOA:Q12SK8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SK8"
FT                   /protein_id="ABE53568.1"
FT                   /translation="MTTGQEAEQLARTYLEKQGLEYVAHNVRYPFGELDLVMRHQDFWV
FT                   FVEVKFRTNTQFGGALQAIRPKQIQRIRKAANHYLQLNKINAPCRFDVLAIDGLQINWL
FT                   QGCF"
FT   gene            complement(309227..311038)
FT                   /locus_tag="Sden_0273"
FT   CDS_pept        complement(309227..311038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0273"
FT                   /product="LppC putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53569"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK7"
FT                   /protein_id="ABE53569.1"
FT                   /translation="MNSAKIIGAVILATVLFGCASQTQVKQPALSASLGSATHKPTAYL
FT                   AEASNAKLPEKRDRYRLLAAHAYINDGNYVAAEKVLNAMLKDRVQEHTLLAEHIYLSAR
FT                   IAEQIAGHDAALALLDYPPHWQLPQSQKITYHRYKARLYKQANLPIDQVRQLSLLSTFL
FT                   PSFEAAKVSDTIWNILQPLHEDTVKGFAKDALNPTFAGWLQLAYIAKHYAVDPNQLVLH
FT                   LGQWQRNNPYHTAAVKLPSDLEKALNAKPFRPKNIAVLLPLSGPRAAVAEPIRLGILSS
FT                   YQSQFDSKASVNFYDTQLGIEQAYQQAVSAGAEFVIGPLLPEEVEKLQNLNDKGKLLLP
FT                   QLFLNQTDNFTPKAHQFYFSLSPAQEASDAARKLFQDGINLPLLLVSNDPVGKRMAESF
FT                   NQAWFGLTQSNAEIHYYNPGDQMKLTVQEALGVKDSVARIDRMKALLGNKLEADFRSRR
FT                   DIDAIYMVSAAQDLSLLKAFLDVNFSVFAKPVALYTTSRSRLENDSGQAVQELNKLMIS
FT                   DIPWLMRDSSETRMVNELWAQWSYSQKRLYIMGFDALDLVNRLAQMRAFPGFQFNGRSG
FT                   ALSVKPNGVIERQLSWGRYQQGVLTPQ"
FT   sig_peptide     complement(310967..311038)
FT                   /locus_tag="Sden_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.432 at
FT                   residue 24"
FT   gene            311154..311996
FT                   /locus_tag="Sden_0274"
FT   CDS_pept        311154..311996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0274"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53570"
FT                   /db_xref="GOA:Q12SK6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK6"
FT                   /protein_id="ABE53570.1"
FT                   /translation="MDQRVALYVVPTPIGNFGDMSSRAIEVLNQVALIACEDTRHSGKL
FT                   LSHFGIATRKIALHDHNERDRAQWIVEKLQAGESIALISDAGTPLISDPGYHLVKHVRE
FT                   AGFDVIPLPGPCAAITALSASGLPSDRFSFEGFLPAKEKGRCDKLEALREDPRTLIFYE
FT                   SPHRIEQSLASIVQVLGEDRQMVMAREVTKTFETFLSGTAQEILDIVRHDPNQQKGEIV
FT                   LMCHGFVTQDEEAIPTVALNTLTLLCEELPLKKAAAIAAQIHGLKKNALYKYGLSIDL"
FT   gene            312089..312419
FT                   /gene="rnpB"
FT                   /locus_tag="Sden_R0014"
FT   misc_RNA        312089..312419
FT                   /gene="rnpB"
FT                   /locus_tag="Sden_R0014"
FT                   /product="RNA component of RNaseP"
FT   gene            313011..313502
FT                   /locus_tag="Sden_0275"
FT   CDS_pept        313011..313502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53571"
FT                   /db_xref="GOA:Q12SK5"
FT                   /db_xref="InterPro:IPR022584"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK5"
FT                   /protein_id="ABE53571.1"
FT                   /translation="MIKNVIDKLVFGIALIFALQLPLLADHYQQYLSGQYQATKWQVDG
FT                   YEMTAKMHQFPNARAMIARHLQLDEPSVKTDAKQKLATLELFDELSLGMDIFNRGNLFE
FT                   QLVFMFNPKRVDALIETSKNFTLGIPLDPAGLSFGLVLGLLLNLLIMLPATLLFSKRKA
FT                   "
FT   sig_peptide     313011..313088
FT                   /locus_tag="Sden_0275"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.794) with cleavage site probability 0.793 at
FT                   residue 26"
FT   gene            complement(313518..313748)
FT                   /locus_tag="Sden_0276"
FT   CDS_pept        complement(313518..313748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53572"
FT                   /db_xref="GOA:Q12SK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK4"
FT                   /protein_id="ABE53572.1"
FT                   /translation="MNAGTLALLIPILAIVGSFIVSIMKLREKQLNASTEHNKHNQALH
FT                   DELNKLRERVEVLERLVTDDSFQLKRELDKF"
FT   gene            complement(313887..314087)
FT                   /locus_tag="Sden_0277"
FT   CDS_pept        complement(313887..314087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0277"
FT                   /product="protein of unknown function DUF528"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53573"
FT                   /db_xref="GOA:Q12SK3"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK3"
FT                   /protein_id="ABE53573.1"
FT                   /translation="MSLRWIDSQEIALALIDKHPEVDPTALHFPELMQWILALEDFDDD
FT                   PKHCGEKVLEAVQMAWIDEAD"
FT   gene            314329..314865
FT                   /locus_tag="Sden_0278"
FT   CDS_pept        314329..314865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53574"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK2"
FT                   /protein_id="ABE53574.1"
FT                   /translation="MSSSVTAQTVQDDFFADLASHCGKAFVGKVVSNDSADKAMSEQRL
FT                   VMHVRECSDTELKVPFHVGDDSSRTWVITKTAGGLRLKHDHRHKDGSPDAVTFYGGDTP
FT                   AGFLGSAIAQSFPVDAESIENFMANGLDKSVTNVWHLYLSPEVFTYRLSREDREFRVDF
FT                   DLSNPVEVPAAPRGH"
FT   gene            complement(314994..315566)
FT                   /locus_tag="Sden_0279"
FT   CDS_pept        complement(314994..315566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53575"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK1"
FT                   /protein_id="ABE53575.1"
FT                   /translation="MRNFKVLVNTTLALFALVMGSQAAAEPYSNAMANFKQAAESKAFF
FT                   NTAYGYAIFPTVGKGGFGIGAAYGEGRVYRGGQFTGESTMTQVSIGFQIGGQAYSEIIF
FT                   FKNAEAYNNFTSGSFEFSAQASAVALNAGASAQVGTTGNSANAGQSGGNQSTKASYVNG
FT                   MAIFTSAKGGLMYEAAIAGQSFSFKPK"
FT   sig_peptide     complement(315489..315566)
FT                   /locus_tag="Sden_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.654 at
FT                   residue 26"
FT   gene            complement(315663..317738)
FT                   /locus_tag="Sden_0280"
FT   CDS_pept        complement(315663..317738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0280"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53576"
FT                   /db_xref="GOA:Q12SK0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SK0"
FT                   /protein_id="ABE53576.1"
FT                   /translation="MSRLYISHKARLLSLLLFLPLVAMSLSAHSAQRDHQITIDDFFGL
FT                   STLTQSQLSQDGKQAVWVESRWDKALDRTQTELWHIDTNSRKTTRLTFSDENESNPAWS
FT                   PDGRYVYFIAKIGEKDPLHPYQGIAQIYRIAATGGQPQMITKSITGINAFELNKSGDSI
FT                   YFSTNKEVTDKDHFASLRADHSKVNYAQGKKTTNPIYRLNLQHFSQELLLDDDKVVWQF
FT                   SVNDNETKIARITTTDNELIFLEGRSNIEVFDIKQANNILLADDKWREKAPSAYGWLLG
FT                   LDWHHDNQRLAFRIDFDGFPGQLFVANTAAKQAVINRVTPPSQVTFFGDDLLWRGNSND
FT                   ICYRGAYKARVKLYCTEMKAMTQGKSRAVIEGDLVIGNYSFTASGKQVGVSHDGLDHVS
FT                   DLFIADADSPRAQLKRLTNINPQIDSWKLPQISIVKWQATDGTQVEGILELPFGYNKAQ
FT                   GKLPLVVQLHGGPTAATPYALQHRSYGRSTFSAQGWALFSPNYRGSIGYGDKFLTDLIG
FT                   REHDIEVQDILSGVDKLISDGLVDADKLAVMGWSNGGYLTNALISSSERFKAASSGAGV
FT                   FDQRLEWMLEDTPGHVINFMQGLPWEQAEAYTKASSLTHANKITTPTLIHIGENDERVP
FT                   LGHAQGLYRALNHYLNVPVELIVYPGEGHGLNQYQHRKTKMEWDRRWFDYYVLGKD"
FT   sig_peptide     complement(317646..317738)
FT                   /locus_tag="Sden_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 31"
FT   gene            318090..318881
FT                   /locus_tag="Sden_0281"
FT   CDS_pept        318090..318881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53577"
FT                   /db_xref="GOA:Q12SJ9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ9"
FT                   /protein_id="ABE53577.1"
FT                   /translation="MKIVLVIVLVIIAVYLYRRTQKTAEKELDVPKVKPQNSPDIKDIG
FT                   VQDISLENSQQAELSTESSTESSAESSAAETSSEDVSPSPFSVVETSAEASLETAPLAT
FT                   DTDTAVTADNQTKAQVATAPETGSALAPLSGNWASDTFTQLVDAYTEQTEPEAQHKCLE
FT                   EVIAHCYKLRKQADYCAYGAKLSDNYLRLFKQLKSDDTFKSELKGGAFMQLTTLLNDVE
FT                   DFDAAIKVCQQAIDYQLDDGTVTGYAGRLARVEKAKAKAQA"
FT   gene            319081..319437
FT                   /locus_tag="Sden_0282"
FT   CDS_pept        319081..319437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53578"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ8"
FT                   /protein_id="ABE53578.1"
FT                   /translation="MRQVVQNVRLSKALLALCLGVILASSLTACTQAPKWTLFFTPLQN
FT                   VTANASANTLVVADIQGYYQTEAQCLHKMQGLMKLAQMQPQSPAGVYRCANECRVEPDN
FT                   SLRCQQVITSESSN"
FT   sig_peptide     319081..319170
FT                   /locus_tag="Sden_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.645 at
FT                   residue 30"
FT   gene            319489..319809
FT                   /locus_tag="Sden_0283"
FT   CDS_pept        319489..319809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53579"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ7"
FT                   /protein_id="ABE53579.1"
FT                   /translation="MITITSVQLNQQALSLLIEADIDFDAFEAFAEPLAQALDCQVRER
FT                   QWGADRHQWLLDFEGSPLWLNYEFYGDICWLSTQNEAEFDVLQYLAGLLQPLITKGANK
FT                   ND"
FT   gene            319802..320791
FT                   /locus_tag="Sden_0284"
FT   CDS_pept        319802..320791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0284"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53580"
FT                   /db_xref="GOA:Q12SJ6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ6"
FT                   /protein_id="ABE53580.1"
FT                   /translation="MTEVAFHFQALTPELILDGIESLGIYPETGLLALNSYENRVYQFR
FT                   CDDGLRYVAKFYRPERWSEAQIQEEHDYALALAAEDIPIAAPCVYEGKTLHHYKGFMFT
FT                   LFPSIGGRAFEVDNLDQLEAVGRFVGRIHQYAAKEKFAHREGLNPQILGVEPLAYLRQS
FT                   GMVSAGMAEAFFTVAEQVLAKAQAIWQQHNFNSIRLHGDLHPGNILWTPDGPGFVDLDD
FT                   ARQGPAIQDLWMMVTGDRLQQLLQLDILLEGYQEFCDFDMRQLALIEPLRALRMLHYNA
FT                   WLAKRWSDGAFPMNFPWFGDIKYWEQQTLSFKEQLSALDEPPLSLLGY"
FT   gene            320939..321550
FT                   /locus_tag="Sden_0285"
FT   CDS_pept        320939..321550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0285"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53581"
FT                   /db_xref="GOA:Q12SJ5"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ5"
FT                   /protein_id="ABE53581.1"
FT                   /translation="MKKALLMAAALLIAPLSAVAAEYKEGVHYTVINDGPATEKPEITE
FT                   FFSFFCGHCYNFSKTVVPKIKTTLPEGVVFSQSHVEFIGNEMGVEMSRAFAVAHQLNVD
FT                   EKMEAAIFAAIHDERKRLINRDDVRALFVANGVEGKDFDSAANSFMVNAQMSKMKRDTE
FT                   NAKLSGVPSLVVNGKYRVETGAVKSFDEVLAIAYHLTKLK"
FT   sig_peptide     320939..321001
FT                   /locus_tag="Sden_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            321952..322155
FT                   /locus_tag="Sden_0286"
FT   CDS_pept        321952..322155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0286"
FT                   /product="protein of unknown function DUF1107"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53582"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ4"
FT                   /protein_id="ABE53582.1"
FT                   /translation="MFPVYAPKLIVKHARIFLTGVVWVQDLGRLEFEKGRFLMPKKSLP
FT                   KVKQAISELNALIESQQQTSAV"
FT   gene            complement(322152..322352)
FT                   /locus_tag="Sden_0287"
FT   CDS_pept        complement(322152..322352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0287"
FT                   /product="protein of unknown function DUF904"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53583"
FT                   /db_xref="GOA:Q12SJ3"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SJ3"
FT                   /protein_id="ABE53583.1"
FT                   /translation="MSLELLSQLETKIQATLENIELLKMELEEEKQKSTQLAEKNQKLQ
FT                   QDLNSWSDKVNGLVGLLNSEI"
FT   gene            322655..323005
FT                   /locus_tag="Sden_0288"
FT   CDS_pept        322655..323005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0288"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53584"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ2"
FT                   /protein_id="ABE53584.1"
FT                   /translation="MIQRLDVSARMSSIVIHNNTVYLCGQVAKDKFSDITEQTRTMLEE
FT                   VDALLLQAGSNREQMLSATIYLKDMQDYHEMNLVWDAWVPQGCAPARACVEAAIAEVEY
FT                   RVEISVIAAINA"
FT   gene            323184..324275
FT                   /locus_tag="Sden_0289"
FT   CDS_pept        323184..324275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0289"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53585"
FT                   /db_xref="GOA:Q12SJ1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ1"
FT                   /protein_id="ABE53585.1"
FT                   /translation="MDIKYNLKPVSERRTQAFIPEGNLGFGSLRTDHMFMMDYSEGEWR
FT                   DPRIVPYGPFEMAPGAMSLHYGQSIFEGAKAFMHEDGEIYTFRLDKNAERMNRSADIVC
FT                   IPNLPEEMQLAAINALIDVDRLWFPQQDGACLYIRPFIFATEDRLSVSPSQKYTFCVIM
FT                   SPSGAYYATGVNNAIRLLISKKFHRAVAGGTGASKAAGNYAASLRAGKAAAEYGAAQVL
FT                   YLDASNTQIEEVGAMNHFHVLKDGTVIIPSFTDTILQSITSKSILELGHLLGCEVRQET
FT                   VMLDKFIADIESGEIIEAGGFGTAAVVSAVGSYIFEDGRIVTVGDGKVGPFTQRIYKLY
FT                   TDLQKGNSPAPEGWVKQVPRLAK"
FT   gene            complement(324324..324479)
FT                   /locus_tag="Sden_0290"
FT   CDS_pept        complement(324324..324479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0290"
FT                   /product="nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53586"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SJ0"
FT                   /protein_id="ABE53586.1"
FT                   /translation="MPDVGPKLASRLLHHFNNVEAVFIASEAALMQVDGIGKQKAKKIR
FT                   EILTHS"
FT   gene            complement(324467..324979)
FT                   /locus_tag="Sden_0291"
FT   CDS_pept        complement(324467..324979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0291"
FT                   /product="ERCC4"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53587"
FT                   /db_xref="GOA:Q12SI9"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI9"
FT                   /protein_id="ABE53587.1"
FT                   /translation="MADTAFLQRKMVLYYDDRGHADTLIHELSRYQDVSLVKKRLTLGD
FT                   YQCHDWLIERKTLADLVHSLCDGRLFSQVARLAASSHHTALLIEGCAQDIANYQIHREA
FT                   LMGAICAITLNFHIPILRSLSQRETAKVLYFCITQLYRNDTDLQLTGRKPKRKKVANFL
FT                   YYKVCLM"
FT   gene            325245..326243
FT                   /locus_tag="Sden_0292"
FT   CDS_pept        325245..326243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0292"
FT                   /product="metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53588"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI8"
FT                   /protein_id="ABE53588.1"
FT                   /translation="MKTGRNDPCPCGSAKKYKNCCMDAISKQNSALLDDISQVTAMNPN
FT                   LTHDELDLVLQQKAFAQNNRPIADFCGLSPAQMANWLYAPFNELNCVAISPPDDLSSSP
FT                   VMRYLEVILDEAMAQNGSFKATSKGNLPTKLVKQASGLLPEFAVAQFSTNISISEYAGS
FT                   NEDKFNALHYTRILAELSGIIYRKSGSYHVKKAAQKQYQSQGLTAFFLPMLEAAITKYN
FT                   WGYLDSWEHDAVLSTFWLFMLWRLQSHASVDELIDEVATAFPDLLHQFPADKYRTPQAQ
FT                   LGMGIDSRFLKRFLQFWGFITLDPKRLFAEPREPRKVQIQPLLTQTFKFTI"
FT   gene            326436..326696
FT                   /locus_tag="Sden_0293"
FT   CDS_pept        326436..326696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53589"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI7"
FT                   /protein_id="ABE53589.1"
FT                   /translation="MLSFFFAFARCEGQNRTLAAVPLCLGPVDLCWLSFVRVKDILIEA
FT                   NGLMPSHLSKIHSTKSKTFLAEPFGQRLLAIFTALSTFYVE"
FT   gene            326962..328041
FT                   /locus_tag="Sden_0294"
FT   CDS_pept        326962..328041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0294"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53590"
FT                   /db_xref="GOA:Q12SI6"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI6"
FT                   /protein_id="ABE53590.1"
FT                   /translation="MSTPIAPLPLANIEQWETRAVLKKTAEAHRYLAELKGVAASIPNE
FT                   AILINTLALQEAKDSSEVENIVTTHDELYKANLFEEAITNPATKEVQDYAYALKQGFQS
FT                   ARQSKLIRLSDILAIQQNLEHNTAGLRKLPGTDLKNARSGEVVYTPPQHADEIASLMDN
FT                   LVQFINNDELCDADPLVKMAIIHHQFETIHPFYDGNGRTGRIINILYLVTKDLLNLPVL
FT                   YLSRFIIHHKANYYANLQAVRDSGNWEPWLLFMLDGIIDTAQNTISLITEMKTLMANVK
FT                   QGIREQLPKLYSQDLLNNLFNHPYTKIDFIVEELGVTRITATKYLEQLVEHGFLAKQKV
FT                   GRANYYINSPLCQVLIAHS"
FT   gene            complement(328024..328333)
FT                   /pseudo
FT                   /locus_tag="Sden_0295"
FT   gene            328711..330219
FT                   /locus_tag="Sden_0296"
FT   CDS_pept        328711..330219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53591"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI5"
FT                   /protein_id="ABE53591.1"
FT                   /translation="MKEVIHASQELLAALGTMSDFKVAATFGVRPYQVRDLRVLHQIPT
FT                   VHADIERSSFDWTAQADALLGTMPDTQVARLLETTRAIVNARRDQLNILAFVPPIFELL
FT                   RKGSARHQWTSEEDLLLGTDFDNIIAEKLNINHLQVTHRRYQLGVDPFRRSATIEWSEQ
FT                   MLDNLGEISDKDFAEYFEICVASVYLKRLLLSIPALNAIDPPSPPSIPPAVVSLLGIKS
FT                   DVELAKTFDISRWPIRVNRLFRGLAPAPKLPRKNQIKWTPEQEALLGTVSDREIAKMMA
FT                   VSPLSVKYRREALHIKPYRILSEPEWNALRLSALGRSEDLALAQMWHCDVAAVRHKRES
FT                   LKIPAHHGPRRWLASELALLGTLSDPQTGKLIGISSTAVRNKRIEMKIKPLLSSKPFRW
FT                   TKKRLALLGTMADERLAYRFKVTSNVISKQRIKLNIPIWTGHQGTWANPEAVAKLGTMP
FT                   DPMLAKQLGITASAVFCKRKSLGIPAFVSSSSSAFSSLSHSNLR"
FT   gene            complement(330281..330883)
FT                   /locus_tag="Sden_0297"
FT   CDS_pept        complement(330281..330883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53592"
FT                   /db_xref="GOA:Q12SI4"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI4"
FT                   /protein_id="ABE53592.1"
FT                   /translation="MICRRNRHRKKLCRKNNKKSTYQFEAIHPFYDGNGRTGRILNVLY
FT                   LIESGLLTLPILYLSRFIVHNKQDYYRLLNQVTKAQNWEEWLLFMLKGVEQTAIWTCEK
FT                   ITTIRALMESTTDHIKAQLPKIYSHELVQLIFEQPYCRISNLVERDIAKRQTASSYLKQ
FT                   LTDIGVLQEIDSGKEKLFVHPRLMKLMTKDSNSINAF"
FT   gene            complement(331141..332454)
FT                   /locus_tag="Sden_0298"
FT   CDS_pept        complement(331141..332454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI3"
FT                   /protein_id="ABE53593.1"
FT                   /translation="MQRTLLDSLIAWKNQPMRKPLLIDGARQTGKTFLLKTLFGKTFTH
FT                   ILRIDFLENPAYKEAFDGSLSPDELLMNLELITNQSFNPETDLLILDEIGECERAVTSL
FT                   KYFAEKAPTYFVAASGSNIGLLNTFPVGKVEQYNLRPLTFQEFIYASKEAPLIKAFDTQ
FT                   VNSPAAHSKLMDKLTDYFFTGGMPEAVAAWYQFKDISILERVEKVTKIHSDLVAGYQRD
FT                   FGKYAGKVDATLIESVFNSIPAQLSLVMDDSVKRFKFKNVHERKSRYSDFETAIHWLRC
FT                   CRLALANYAIEGTPKAPLAAYKKDNRVKLFLFDVGLLNHMLRCSYKEIKQQNYEYKGYI
FT                   AENFVQQELTAMGLDPSYSWNDARAEVEFIASNDEGAIFPIEVKSGKRTRAKSLASYID
FT                   KCAPSKTFKLTGSQGSSALEQTNIVMPLYYTQYLPSKW"
FT   gene            332784..333308
FT                   /locus_tag="Sden_0299"
FT   CDS_pept        332784..333308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53594"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI2"
FT                   /protein_id="ABE53594.1"
FT                   /translation="MAKSDELLNVLAKAVKAGGGIHSATELAFMLGVPCDPAFRKFLTD
FT                   CVKKRRLRRVIKGFYESVITPPEPETAIYKIIKKLRSGVLNYISLESQLSHTGDISQIV
FT                   MGRVTVVTKGRSGCFDTPYGVIEFTHTKKPIEQVAPNLYYDPDIKMYRAYKEQAIADLK
FT                   HCQRNLHMLES"
FT   gene            333337..334224
FT                   /locus_tag="Sden_0300"
FT   CDS_pept        333337..334224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53595"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI1"
FT                   /protein_id="ABE53595.1"
FT                   /translation="MLKQQIRQIVQANPDYAAVTPVIEKEILHHDIMDVLIKQGVMQRL
FT                   TFIGGTSLRMCYNSSRLSEDLDFNGGHDFKPSEFDGLESEIQTYIQNKYETEVWVNKPS
FT                   GEQQGDTVSWKISIIKEANRPDLPRQKMHIDVCAIPSFDIEKRPLLNHYDIVVPTEGIL
FT                   VPVQSLQETLADKLIALAYRARRIKPRDIWDIVWIKQRGINLSKTLVEKKLVARQKQTE
FT                   DFRQALSVQLGKLMTEDEVRNDFNMEMSRFIPKQIKERTLDNPEYWAYVQAEVNAIASE
FT                   LLNDGTAKNPFDMG"
FT   gene            334795..337950
FT                   /locus_tag="Sden_0301"
FT   CDS_pept        334795..337950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0301"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53596"
FT                   /db_xref="GOA:Q12SI0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SI0"
FT                   /protein_id="ABE53596.1"
FT                   /translation="MEQVGIYEKLITQLIDKSINRDVFYLGERPLESAEASVWLSRFLS
FT                   KIIECAIGAIPSGDNQLTEQIGLANKLVLWLKDHVQDDQLITENLLDSKGRILTALFDK
FT                   TNPIATDFPAFTKAIYPLTGLSQSELFCGSNAGISLDTELKREIRSADKIYWLVSFIKW
FT                   AGIRIFKNELEEFTRSGKTLRIITTSYMGATDAKAVEFLASLPNTEVKLSYNTKRERLH
FT                   AKSYLFLRNTGFHTGYIGSSNLSHSALTSGLEWNLKITTQEIPHIIDKSLNTFESYWQS
FT                   SEFELFKGDIGSKNKLQEALREAKGGYSDDSAFHFDIKPFAHQREILEQLDVERTVHQR
FT                   YKNLVVAATGTGKTLISAFDFARFYKQHPEANFLFVAHRQEILKQALSAYRGVLKNNQF
FT                   GELWVAEHKPNSYRHLFASVQSLNLQLLSLPLTVDFYDYIVIDEVHHIAANSYRGLLAH
FT                   FSPKILLGLTATPERHDGQNILDDFCGVIAAEIRLPEAINQRYLCPFQYFAIDDDTDLR
FT                   KIKWHQGRYDIAELSHLYTHNEQRVVRIISSLNDTVTDIHQIKALAFCVSKEHAEYMAS
FT                   KFNLAGISADVLTSDNSHERQQKRQSLISGHVNILCVVDIFNEGVDIPNVDTLLFLRPT
FT                   ESLTIFLQQLGRGLRLTDDKQCCTVLDFVGNSRDEYDFSQKFRALVGKTNQSIKDEITN
FT                   DFPHLPLGCRIELEEQTQAMILRNISRATMNASRLRQLINNFGHQSTLTLSLVNFLRFN
FT                   PNVNLEDIYKLKMSWLELVESARKNQINEPNLDASLAKAYYRAINNHLFACSSISYLQF
FT                   LKQLIIDNFSFDDMDATQCQFALMCHYNFWDKSGAELGFTSIKQSLAALRHAQLQAELL
FT                   DVISLLIERIHHNELEMLIPAIPSLKVHSRYTREQILAASGASYFGKKSTAREGVLVLK
FT                   ALNVELLFVTLKKSVKQFSPTTMYHDYAINESLFHWQSQNSARPEYGRGLGYIEHEKEG
FT                   RKLILFVREQATDENGRTMGFVNFGEVIYMAHSGTQPMNITWKLMTPMPDAMWHEAAKL
FT                   AVG"
FT   gene            complement(338252..338395)
FT                   /locus_tag="Sden_0302"
FT   CDS_pept        complement(338252..338395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53597"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH9"
FT                   /protein_id="ABE53597.1"
FT                   /translation="MMRIIAFLLNQELHQELNQELNQELNQELNQELNQELNQELNQEL
FT                   NQ"
FT   gene            338674..339672
FT                   /locus_tag="Sden_0303"
FT   CDS_pept        338674..339672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0303"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53598"
FT                   /db_xref="GOA:Q12SH8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH8"
FT                   /protein_id="ABE53598.1"
FT                   /translation="MPYSSNTSGSRLIKRLRRLRSSPNMRELVREYEVKLSDLIYPIFI
FT                   EENITNPVPITSLPGLVRIPEAQLGAEIEALNALGIRYVMPFGISHHKDNCGSDTWNSK
FT                   GLLARMISTIKTVCPNMMVIPDICFCEYTTHGHCGVLKQQSIDNDATVENLVKQCINAA
FT                   RAGADMLAPSAMMDGQVMAIRQGLDKEGFSHVAILAHAAKFASSFYGPFRDAVACELKG
FT                   DRHTYQLDYANSRQALHEAMLDEQEGADILMIKPGTPYLDILSTLRSNTLLPLAAYQVS
FT                   GEYAVIKCAANIGVLNERATVLETLTGFKRAGADLIVTYYAKQFAQWQLNE"
FT   gene            339732..340553
FT                   /locus_tag="Sden_0304"
FT   CDS_pept        339732..340553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0304"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53599"
FT                   /db_xref="GOA:Q12SH7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH7"
FT                   /protein_id="ABE53599.1"
FT                   /translation="MVKLGLNGIDPMLLTGLRFTLAVIPAIFFVKKPDVHLFYLIGYGL
FT                   TFGVGVWGLSTWSISSGLSPGMAALLLQTNVIFGLCLGWFLLKESVTPSRLIGSLISLS
FT                   GLAVGLMVTDGSVNVQGVVLILVAAFAWSISGILIKKSNTKNAFAFTLWSMLFAPIPLF
FT                   LISYFQIGASAFTTLLDNLTGMAVFSILYQAYATTLFGYWIWNRMIVLYPLSQVAPFTL
FT                   LVPIFAILGSNILFQEAISLQKVLGCSLITFGLLIGSFSLKRVRSLVQLIM"
FT   gene            340617..341345
FT                   /locus_tag="Sden_0305"
FT   CDS_pept        340617..341345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0305"
FT                   /product="protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53600"
FT                   /db_xref="GOA:Q12SH6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH6"
FT                   /protein_id="ABE53600.1"
FT                   /translation="MIIFTHRQTCIRKAQALMELTWNDKTSDHIKDMMTQNTTIESPIK
FT                   LSVGYESFCDTLKLWYRAFPTLSYTENSVATHNGEVIIEWTAKGRQLGEFLDISATGRP
FT                   IIYSGITNFVFMQDKVIRYSSKVHIQSIISQLIGTSFDARFGQQESNSTEKLFDVIQQL
FT                   LSTKLTRRQVECLSLSTLNISVKEIASLLTIESSSVQTHLKRAFDLLQISNKKMFMAYI
FT                   TANNTIEVFIRMGLFLRKKN"
FT   gene            341656..341937
FT                   /locus_tag="Sden_0306"
FT   CDS_pept        341656..341937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0306"
FT                   /product="transciptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53601"
FT                   /db_xref="GOA:Q12SH5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH5"
FT                   /protein_id="ABE53601.1"
FT                   /translation="MKVTNAKQLSTYLKDARLNAQLSQSKVASKVGIRQDTVSSFELNP
FT                   DSTKLETLFKILSALNLELDIKVRNPQLVDERRHGNATVPEQEWKEEW"
FT   gene            341937..343244
FT                   /locus_tag="Sden_0307"
FT   CDS_pept        341937..343244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0307"
FT                   /product="HipA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53602"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH4"
FT                   /protein_id="ABE53602.1"
FT                   /translation="MAVLDVYMNGYLVGEFTKSSTGSHQFAYAPQWLAIPGSRPISLSM
FT                   PLRKQAYKGDEVYNFFDNLLPDNLEVRNRVVARHNADSTHAFDLLAKIGQDSVGALQLI
FT                   PHGQTPFDVKKIESKPLSEKQLEKVLKGYQSNIPLGMLADDDDFRISIAGAQEKTALLK
FT                   LNGQWRLPIKSTPTTHIIKLPIGEINSHSHSINMSDSVENEYLCMMIVREFGLDAPECS
FT                   IIKVGDIKALAVERFDRRLSSDGQWIMRLPQEDFCQALNIPPAKKYESHGGPGIEQIMP
FT                   YLLGSMNSERDRVNFIKSQVLFWLLAATDGHAKNFSLFIEADGGYRLTPFYDILSMYPV
FT                   IGGKGLNIRDAKLAMGFKATKGKKYQINQIFPRHFIQTAKAVGFDTGIMMEMMHDIADK
FT                   VEAVVVKVKAQLPDDFPAHIRDSILSGLTDRVKRIA"
FT   gene            complement(343856..347116)
FT                   /locus_tag="Sden_0308"
FT   CDS_pept        complement(343856..347116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53603"
FT                   /db_xref="GOA:Q12SH3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH3"
FT                   /protein_id="ABE53603.1"
FT                   /translation="MDIIFDIEVAKNHINNAILLVKNKASEAKVRDSFSQYLPQMFPEA
FT                   PWWVKYHALGSEEHVKFHKNGKVRSGFVDTLIGATVIEYEKDLTVQTIFEAGYGQVKDY
FT                   CASLLNKNHNKEIIIGVLSDTVRWHAYRISEVLPLSYIAGATTYGREHVVLEELEQVDL
FT                   SRNADDALSLYYFLTRYLGREGARPLGAKTLSFDLGFESTFCAQHINAVRDIVTQAFES
FT                   NKKYSDLIKKLWIDFVSYIGDSEDTKSFDEESYISELYMLTLAKLLCANVLESKALKSD
FT                   NAEIESILNGSFFKAKGLTNLVEYDYFGWLNDTPYAIHLIPIAKDIQSDLRAYDFKSVP
FT                   EEDLFGTLMAQLARRSHRILLGQEWTPAWLAQKVVKNVFDKLPENVDPLLVDMCCGSGA
FT                   MVIEVVKQSKHRLMKLGVSASNGGMIRLSKAITGFDIDPLAVMLAKVSWVLAARDWFGG
FT                   LDAGEIAIPIYHADSLFAVTPISKINDLKKEEKFHTLSLDNIEINLPAFLITPECRMLF
FT                   EMIIDRGYEIAMYSADQEKSAITKKITDNMVNKLLNESSSVLSLADITSVKDFSHDLLN
FT                   ALDQLQRDGRNGIWAFVLRNSYRPGLVAGQFNGVVTNPPWLALSKVANNPYKNALRQRA
FT                   ENYGIKPEGSSHLHIEMATVFLLHAIERYLLENAVIGCILPDSVLNAHHHNLFRKGNYL
FT                   NSHRAVTFDVNELWRIEKGTFKNEAIVLYGKKCKHESREFFDGKIVSPLSSSDLTFHNV
FT                   QQGNRTAWTDKKVIGKAKFGLYNPASFNQGPDIMPRTLIFHDFTPGTQHTPKWKISPID
FT                   RTVSDFRYLVTQAKKHKHFTLNADSVSDTFIYDILLSNHLTPFGISTPAKGLLPILKVD
FT                   NGTWESVSEIDLSSFSYGTYSAFKKIFKESRTTSAEFFDKLNTNRGKLVSQNIPTHGWL
FT                   ILYGAGGSNVCSTYIKSNAYSQNKLIIDQTLYWSHVQSEEEALYLTGLLNSEAVCLVIK
FT                   EFQPRGAFGERHIHKLPIGATPPYNPMDIVHIEVVATTKQLMVDWDNFKKSIPDEIMQL
FT                   LNPNSSSLSIRRRKIREKIKNLPSYPAYEQACRDLYGL"
FT   gene            complement(347129..349204)
FT                   /locus_tag="Sden_0309"
FT   CDS_pept        complement(347129..349204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53604"
FT                   /db_xref="GOA:Q12SH2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH2"
FT                   /protein_id="ABE53604.1"
FT                   /translation="MSPTESFATKEGFVGEAERRKRLGQYFTGVRLGKLLASLANVSIA
FT                   KSVIDPMAGNGDMLASCLDLGVPSNSLSAIEIDPIAYHGCVSRIKGGDIILGNAFNLKS
FT                   FESLKLKQWDLVITNPPYVRYQSMSLKAGEEFLLPDAKEVRNGLYSIIDSLTSLDKIDK
FT                   TLFKELIHGYSGLSDLAVPSWILSAALVKNGGYLALVLPESWLSRDYALIIHYLLLRWF
FT                   KIQFIVEDEHACWFTNAQVKTTLLIARREPRKASAFQPMNNDTFLNIKISKKSIGTNSL
FT                   LDNVYPGRENKEKYFSDQARKWLKEGTQFKSENIEVIHVPFSHVIRNIEGVCRKQKWFH
FT                   KIEDESTNSSNFSYVNLPLDLHKWLVNSIKSIPISSLEEMGIDIGQGLRTGANSFFYVE
FT                   ACGIDGENVEVQLSKSFNYGKIKIDRSCLQHVLRRQSELPKHYVIDQLELKGRALSLQN
FT                   HALFDDIETNGILAKESYRIINSELEFLIKKAETLNFGTDNIPKKIVELSAVKPNIRTS
FT                   KIKQNIPPKFWYMLPEFVKRHKPDLFIPRVNNDSPKTFFNPGRLCLIDANFSTICLNDN
FT                   SVFDVYALLALLNSSWCKAALEYTSSVMGGGALKVEATHLRRLPVPNFEPITWKKFSIL
FT                   GQKLSTTKISEKCNEIIEHIDIEFAKSFFSEEDAPLAVHELRKLIQDAVLRRKAHK"
FT   gene            complement(349204..351003)
FT                   /locus_tag="Sden_0310"
FT   CDS_pept        complement(349204..351003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0310"
FT                   /product="DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53605"
FT                   /db_xref="GOA:Q12SH1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH1"
FT                   /protein_id="ABE53605.1"
FT                   /translation="MYNVNFKKFLSLYQNPLPSTRSGPLFNAFSYPTKISPEAIAVFIA
FT                   SHTKPGGTVLDTFGGSGTTGLAALLCDKPTEGMKKMASDLGIEPEWGPRNAHIFEIGVL
FT                   GSFVSNTLCNPPNPTTFSEAVKSLIERANKKLGWMYKAKDMCGNEGFIRHIIWSDVVVC
FT                   YHCKTEVSYWDASVQKSPLALMSVFNCPFCKKECVINDCERALEEVVDDFSNKILKRKK
FT                   RIPTRIYGQSGKSKWQREPNPEDLQLIDLIKIHPLPSTSPNMEIEWGDLYRSGYHKGIS
FT                   HLHHFYTRRNFIVIATLFELCNDFEEVIRDALRLLILSYNATHSTLMTRVVVKKTEKDF
FT                   VLTGAQSGVLYVSGLPVEKNIFQGIQRKSTAFEKAFSLVRGSTSKVVINNSSSEKLSLP
FT                   DGCIDYVFTDPPFGDYIPYAELNQINELWLGSTTNRTQEIIVSKAQGKGVEQYSQMMAS
FT                   VFSEIERVLKPEGLVTVVFHSAKSNIWQALTNAYQKAGLSVRATSVLDKLQASFKQVVS
FT                   TVSVKGDPLLLLTKGEVEHATKFNASDIMDEILNKASIAVGVEQTSERLYSRFVSRCLE
FT                   LGIKVDIDAKLFYLKKQEYLKDK"
FT   gene            complement(351243..351860)
FT                   /locus_tag="Sden_0311"
FT   CDS_pept        complement(351243..351860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53606"
FT                   /db_xref="GOA:Q12SH0"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SH0"
FT                   /protein_id="ABE53606.1"
FT                   /translation="MNARKLVSSIPFETNGFSIQCFANRFKISQEIAKTRIEAFESEGY
FT                   FEKVRDDGKTTRWQLTMKAATLAQASAAKKIKRATADKHYQAFLQRVHEINCNDSYLYR
FT                   VTKVALFGSYLSGTGPVSDIDLFIWVSCKPKFDTDFSIIREQRTKEMLAEGRRFKNLSG
FT                   EMHWPELDVRKYLKNGSRVISIQGHNEGYELFEHKIVFGITN"
FT   gene            complement(352296..352925)
FT                   /locus_tag="Sden_0312"
FT   CDS_pept        complement(352296..352925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0312"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53607"
FT                   /db_xref="GOA:Q12SG9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG9"
FT                   /protein_id="ABE53607.1"
FT                   /translation="MSRVHSARDRDEFGVILDALERNHGLKARWLAELTALWALRISDL
FT                   LAITTAQVDESFNTGEFTIIETKTQKNKVITLTPHAIKLLNKMRLTFPNNIYLFESRHG
FT                   GSRKPLSRKTAWRWMSQVEPDVIKWRRTCGRLGGVNLGTHSLRKSGSRLRQQAGVTLEE
FT                   LQQLLNHSKPETTINYLDNNEQDLVDTFVAGDIALFGEGILDQKNN"
FT   gene            complement(353369..353827)
FT                   /locus_tag="Sden_0313"
FT   CDS_pept        complement(353369..353827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53608"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG8"
FT                   /protein_id="ABE53608.1"
FT                   /translation="MAKRRQSRSAHKRYISIPHCVLDSTSYADLNGSAIKLLTLIVRQW
FT                   NGYNNGNLTCTWDQMKPYFGGQDTMRSALKALIKHRLIEVTGTGSTSRKGGLPPVLYAI
FT                   TWESVDEYRGQGQMTTKPTLSPIRNDWNKINDHKISKSPVLKIGANTS"
FT   gene            complement(353886..354158)
FT                   /locus_tag="Sden_0314"
FT   CDS_pept        complement(353886..354158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53609"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG7"
FT                   /protein_id="ABE53609.1"
FT                   /translation="MNTLFHNGLTLPLSDAHVYQRRGIILAYRNQEPLHFTILRCQEGS
FT                   EVQTYFGAARVDSIQDFKTIMDYGDKFEIVNSWFNCHQQRLETPC"
FT   gene            complement(354155..354451)
FT                   /locus_tag="Sden_0315"
FT   CDS_pept        complement(354155..354451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0315"
FT                   /product="Prophage CP4-57 regulatory"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53610"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG6"
FT                   /protein_id="ABE53610.1"
FT                   /translation="MTIQYTRPTPEQRQELLKVAGESDRLVRENERKQITTLSRSRTWE
FT                   LERLGLHPIRTKLGVNSVAWLLSDLLWFIYHPTLTQAVSSPRTTSKAQLGAQK"
FT   gene            complement(354549..355280)
FT                   /locus_tag="Sden_0316"
FT   CDS_pept        complement(354549..355280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53611"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG5"
FT                   /protein_id="ABE53611.1"
FT                   /translation="MMKMEIISSTAQLPTWYTPERYIHLKRASYDVILNELWLRHHANE
FT                   DIEQGKECKELSLLFNKRFINDLDIPPDDAYNALGLNVKLISSPVLKILAGEVMRDCDA
FT                   TDNRYVHEIGMCNLFGDGFVSLNLKLATNSEIIDEFTILLDKLRKESNIPEPKREFRSV
FT                   EKFDAIFQNHVFEYIDLTLWAKANNLKIPPRVFAEAIVNADKTPAFTATEIQNKVQRNA
FT                   QQILSISYLKQLEVDIKTHRI"
FT   gene            complement(355277..356491)
FT                   /locus_tag="Sden_0317"
FT   CDS_pept        complement(355277..356491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0317"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53612"
FT                   /db_xref="GOA:Q12SG4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG4"
FT                   /protein_id="ABE53612.1"
FT                   /translation="MATITAKQIQTFANGEPKRHPIGGGLYFVVRNSATPYWMLRYTSN
FT                   GKRKEITLGQFPYLSLADAKAEAAIQKRDINAGSDPLIVRQRIKEQSIKVVDDLFNDWY
FT                   ESDLVKRLKHPHIPQRVYRNDIKPAIGEIPIDQVNARDIRAIVQKIAQERPTTANDALM
FT                   YLKQLFRHGIKLDLLGNNPASAFTVSDAGGVELSKDRALTFPEIEKAFKLFKANAMSFT
FT                   RDNYLACAMLVTLGLRKSELCCAMWNEFELDKALWHLPEGRSKTGAPITIPLPRQAMEW
FT                   LNELKIRSCGSAYVFPARRTSSKPHMGNDTLNRAISKLFGREPGRKVQPPNLMGDMLLF
FT                   TPHDLRRTFRTLAASQGVPGHVAERCLNHKLKGVEGIYDRHDYLEERKEAHAKVADLLD
FT                   PIING"
FT   gene            complement(356660..357523)
FT                   /locus_tag="Sden_0318"
FT   CDS_pept        complement(356660..357523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0318"
FT                   /product="conserved hypothetical protein 255"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53613"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG3"
FT                   /protein_id="ABE53613.1"
FT                   /translation="MIQSMTAYARIEHKAQWGTASWEIRSVNQRYLETYLRLPEQFRSF
FT                   EPVLRDRLRKRLNRGKIEVNLRYDLTDNSSNELQLNQPLAKQLLNAANWLKQEAGQGDV
FT                   SLTDILRWPGVLASAEQDMDAIGAELMTAFDSAIDQFIEARGREGAAIKDMLLSRLDGV
FT                   TEQIAAVRTHMPMVMQYQRDKLTNRLAEISGELDPARIEQEMVLLAQKQDVAEEMDRLE
FT                   AHVVEARRILKKGGSEGRRLDFMMQEFNRESNTLASKSISAEITAAAVELKVLIEQMRE
FT                   QIQNVE"
FT   gene            357751..358464
FT                   /locus_tag="Sden_0319"
FT   CDS_pept        357751..358464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0319"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53614"
FT                   /db_xref="GOA:Q12SG2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SG2"
FT                   /protein_id="ABE53614.1"
FT                   /translation="MRPSKRTPAQTRPITITRNFTAHAEGSVLVEFGETKVLCTASFTE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMDREAARGKQSGRTQEIQRLIGRSLRAAVDM
FT                   KALGENTIVIDCDVIQADGGTRTAAITGACVAMVDALNWARAKNIIKSNPLKFLIAAVS
FT                   VGIYKGEAISDLEYLEDSAAETDMNVVMTETGKIIEVQGTAEGEPFSHEELNELLGLAK
FT                   NSIREIVDVQKSALN"
FT   gene            358537..359178
FT                   /locus_tag="Sden_0320"
FT   CDS_pept        358537..359178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0320"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53615"
FT                   /db_xref="GOA:Q12SG1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SG1"
FT                   /protein_id="ABE53615.1"
FT                   /translation="MKEYQVAFIEFALARKVLRFGEFTLKSGRTSPYFFNAGLFNTGGD
FT                   LARLGRFYAAALMDAGIEFDLLFGPAYKGIPIATTTAVALNDHHNLDVPYCFNRKEAKT
FT                   HGEGGSLVGSELTGRVMLVDDVITAGTAIRESMDIIQAHQATLAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCKIVSIVKLADLINYLSAKPGMEAELASVSAYREQYGI"
FT   gene            complement(359333..359986)
FT                   /locus_tag="Sden_0321"
FT   CDS_pept        complement(359333..359986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0321"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53616"
FT                   /db_xref="GOA:Q12SG0"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SG0"
FT                   /protein_id="ABE53616.1"
FT                   /translation="MALSDAAIKVQAALNERGLETPMLPKTSTPEERKIKIEHHMREIL
FT                   TLMSLDLTDDSLMDTPRRIAKMYVDEIFSGLDYDNFPKITVIDNKMGFDEMVRVQDISL
FT                   TSTCEHHLVTIDGLATVAYLPRAKIIGLSKINRIVRFFAQRPQVQERLTQQILVALQTL
FT                   LETKDVAVKIDAVHFCVKSRGVMDSTSSTTTTSLGGIFKSNPATRAEFLQQAKF"
FT   gene            complement(360166..362127)
FT                   /locus_tag="Sden_0322"
FT   CDS_pept        complement(360166..362127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0322"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53617"
FT                   /db_xref="GOA:Q12SF9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SF9"
FT                   /protein_id="ABE53617.1"
FT                   /translation="MKALILGAIMALCCQNAAQANSLLQAERFSRGAEFSNVKLSPSGE
FT                   YLSAITNHEGKDTLIILNTSNKKLLNALNFPGNAQVGDYEWANNERIVLQKVYLKGWTN
FT                   VPQYYGELMAVNADGSQVQYLFGYNSNVQQTGSHIKKNTPIRATAFILDPLPDNKQFML
FT                   VNAIPWDGKRSLDFSLIQSVYRVDLYNGKRTKVMKAPVGYARFMTDHTGEVRFSIGENK
FT                   NNNTKVFYRADGKWQDSKTLNLGLSDLTPISFADKPNSIYAAGREMGQTLGVYKIDLET
FT                   GDKQKILQDPKLDPTDYWVNQQTKQLYSVEYQDSYPTYAFVDNKDKHSVQLKQLIASFP
FT                   GYQVHIVSETRDSKQQLIRTFNDRNPGDYYLFDTEKVKLSYLFSEKKWLDPELMAEVKP
FT                   ISFTNRDGIEITGYLTLPHGLEAKNLPLVVNPHGGPHGVRDVWGFEPQNQLFASQGYAV
FT                   LQVNFRGSGGFGEAFEKAGHQKWGLDIQHDIIDATHHVIEQGFANKNRMCIVGSSFGGY
FT                   SALQSAIIEPDMFKCAIGVAGVYDLPLMFDEGDISERSAGLSFLKQVLGQDKTILKAMS
FT                   PSYNTDKLKAKLLLVHGGDDERAPIEQLESLEEALKARNYPYEKMIMDDEGHGFYNDDH
FT                   RAKYYQKMLSFLDANLNL"
FT   sig_peptide     complement(362065..362127)
FT                   /locus_tag="Sden_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.933 at
FT                   residue 21"
FT   gene            complement(362232..362825)
FT                   /locus_tag="Sden_0323"
FT   CDS_pept        complement(362232..362825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0323"
FT                   /product="cell division inhibitor SlmA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53618"
FT                   /db_xref="GOA:Q12SF8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SF8"
FT                   /protein_id="ABE53618.1"
FT                   /translation="MATSPKINRREHILQCLAQMLETSPGQRITTAKLAAEVGVSEAAL
FT                   YRHFPSKARMFEGLIEFIEDAILSRLNLIMDEEKDTMMRCQLVLQLLLVFSERNPGISR
FT                   VLNGDALLGENERLRSRISVLFAKIETQLKQILREKTLREGQGFNLDEAILANLLLAVA
FT                   EGRIAQFVRSEFKQKPTLHFDEQWTFIQQQLLRS"
FT   gene            complement(362861..363319)
FT                   /locus_tag="Sden_0324"
FT   CDS_pept        complement(362861..363319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0324"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53619"
FT                   /db_xref="GOA:Q12SF7"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SF7"
FT                   /protein_id="ABE53619.1"
FT                   /translation="MKTPIEVKILDPRIGTQFPLPAYATPGSAGMDLRAMVDTELTLAP
FT                   GETKLIPTGIAIHVADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNR
FT                   SDTPFTLTLGERLAQLVFVPVVQAQFTLVDEFERSDRGEGGFGHSGTQ"
FT   gene            complement(363316..364509)
FT                   /locus_tag="Sden_0325"
FT   CDS_pept        complement(363316..364509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0325"
FT                   /product="Phosphopantothenoylcysteine decarboxylase /
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53620"
FT                   /db_xref="GOA:Q12SF6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SF6"
FT                   /protein_id="ABE53620.1"
FT                   /translation="MLTGKKILLGIGGGIAAYKAADLIRRLKERGCDVRVVMSQGAQAF
FT                   ITPLTIQALSGHPVSSDLLDPAAEAGMGHIELARWADAMLIAPATANLIARINAGMADE
FT                   LITTTCLATSAPIILCPAMNQQMYQNLATQDNLANLQRRGFPLWGPASGSQACGEVGPG
FT                   RMLEPLDIAHMLELFFAPKLLTGHKLLLTAGPTREAIDPVRYISNHSSGKMGFALAKAA
FT                   AEMGAEVTLVAGPVNLATPHGVKRIDVESAEQMLEAVMAQVDEHNIFIGCAAVADYRIA
FT                   TVATDKIKKSAEQMQLALVRNPDILATVAQHKPKLFTVGFAAETQDVEKYARGKLEKKQ
FT                   LDMIAANDVSIQGLGFNADDNALVVFDKESCQHLPATNKLTLARQLLTLIEQKLTAQ"
FT   gene            364641..365318
FT                   /locus_tag="Sden_0326"
FT   CDS_pept        364641..365318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0326"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53621"
FT                   /db_xref="GOA:Q12SF5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SF5"
FT                   /protein_id="ABE53621.1"
FT                   /translation="MAIKDWPQGEGPRDKLLQQGAARLSDAELLAVLIRNGISGQNALT
FT                   TGRLLLSHFGGLRSLMTATEDKVCQIPGVGPVKYAQLQAAAEISKRISRENLQRGQILT
FT                   NPDLTRDYLMRQLADRSYEVFALLLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLE
FT                   KRAAAVIICHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMVVGDFEIVSFAERG
FT                   WLN"
FT   gene            365355..365675
FT                   /locus_tag="Sden_0327"
FT   CDS_pept        365355..365675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0327"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53622"
FT                   /db_xref="GOA:Q12SF4"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SF4"
FT                   /protein_id="ABE53622.1"
FT                   /translation="MRPLCASGDGHTRHINARALKIVLEKIDMSRICQVTGKKPMVGNN
FT                   RSHAKNSTRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRIIDKKGIEVVVKELRARGE
FT                   KV"
FT   gene            365682..365855
FT                   /locus_tag="Sden_0328"
FT   CDS_pept        365682..365855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0328"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53623"
FT                   /db_xref="GOA:Q12SF3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SF3"
FT                   /protein_id="ABE53623.1"
FT                   /translation="MAKSKGNREKIKLVSSAKTGHFYTTEKNKRNMPEKMEIKKFDPVI
FT                   RQHVMYKEAKIK"
FT   gene            366115..367434
FT                   /locus_tag="Sden_0329"
FT   CDS_pept        366115..367434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0329"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53624"
FT                   /db_xref="GOA:Q12SF2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SF2"
FT                   /protein_id="ABE53624.1"
FT                   /translation="MRTTELVDGFRHSAPYVNGHRGKTFVVMLGGEALAHPQFRGILND
FT                   VALLHSLGIEVVLVYGARPQIDEGLKAAGIEPAYHNGVRITDEDTLKIIKQVAGALQFD
FT                   ITARLSMSLGNTPMQNAQINLVSGNFVIAQPLGVEDGVDFCHSGKVRRIDALGLRRQLD
FT                   NNGIVLMGPIAASVTGESFNLTAEEVATQVAIKLKADKIIGFSDTNGIVGEQGEVIAEL
FT                   MPNQVEEMLKTMSQDTSASIGTMAFLKASVDACRRGVPRCHLVSYLDDGALLQELFSRE
FT                   GIGTQIVTESAERLRRASISDIGGILNLIRPLEEQGILVRRSREQLEMEIEQFMLIERD
FT                   NLVIGCAALYPFEEDNAGEFACLVVHPDYRDADRGSVLLNNIIGQARVRGYGRLFALTT
FT                   RSIHWFLEHGFNIVEVDALPNKKKQLYNYHRRSKILALDL"
FT   gene            complement(367537..368439)
FT                   /locus_tag="Sden_0330"
FT   CDS_pept        complement(367537..368439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0330"
FT                   /product="rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53625"
FT                   /db_xref="GOA:Q12SF1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SF1"
FT                   /protein_id="ABE53625.1"
FT                   /translation="MSELEYRKGVILAICAYCLWGVAPLYFKLIQQVSPLEILMHRVLW
FT                   SFVLMVVLMQFVGGFSRLRQVFKQPKQLLVLLITSLLIAGNWLIFIWAINNDHMLDASL
FT                   GYFINPLFNVLLAMLFLGERLRKLQWAAVALASLGVIIQLISFGSIPLVSLVLAASFGF
FT                   YGLLRKKVNVDAKTGLLVETAILAPVALGYLLLTLDSSSASMLTNDWTLNLTLVAAGVV
FT                   TTVPLLCFAGAAVRIPFSILGFFQYIGPSIMFILAIKLFNEPFDIEKAITFGFIWVALM
FT                   IFVSDLLLQRRRNKKAKNA"
FT   gene            complement(368582..369046)
FT                   /locus_tag="Sden_0331"
FT   CDS_pept        complement(368582..369046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0331"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53626"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SF0"
FT                   /protein_id="ABE53626.1"
FT                   /translation="MSNNIKTLALAQVAEVFDKHVPFHNLLGLDIKRYDENGVEVVVTM
FT                   KPELIGNIHQQILHGGVTATVLDIVGGLTAFAGLVSSHDDWTLEALQERLTTLGTIDLR
FT                   IDYLRPGRGEVFTGTGSVIRSGNRVSVCRMELHNEQGTHIAFGTGTYMVG"
FT   gene            369240..371081
FT                   /locus_tag="Sden_0332"
FT   CDS_pept        369240..371081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0332"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53627"
FT                   /db_xref="GOA:Q12SE9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE9"
FT                   /protein_id="ABE53627.1"
FT                   /translation="MNNLSPDLDPRLTSSEDELSARLQQVFGYRSFREGQREVMERTLA
FT                   GEDTLVIMPTGGGKSICYQLPALLFQGLTIVVSPLISLMKDQVDSLIQTGVPAAYLNSS
FT                   QPREVSMNVLRQLHSGEIKLLYVSPERLLREDFIERLQHLHVSLFAVDEAHCISQWGHD
FT                   FRPEYAELGRLKQLFPHVPLMALTATADQATRKSICERLNIEPFCLLSSFDRPNIRYTV
FT                   AEKLNAASQLKQFIASQSGNSGIIYCSSRRRVDEVAERLRLQGLKAEAYHAGRSQEERG
FT                   DVQDKFLKDQLDIVVATVAFGMGINKSNVRFVVHYDIPKSVEAYYQETGRAGRDGLDAE
FT                   AYMLFDPADIGRVRHLIEQSEPGPQQQVEFHKLHTMAAFAEAQTCRRQVLLHYFDESAS
FT                   KPCGNCDICINPPKRYDGSEDAKKVLSCVFRLGQRFGINHLIEVLRGSKAANVLDRGHD
FT                   KLSTWGIGKDKSPEHWLSVTRQLIHLGLASQDVTRGSSITLNDAARPVLRGEQTLKLAE
FT                   PRIQLVSSKRKASNSRAPQQYDRQLFARLKLLRREIAEKNDIPPYLVFNDASLAEMSAM
FT                   LPTSPGEMLAVNGVGERKLSRFGGEFLDEISQYLANG"
FT   gene            complement(371096..372814)
FT                   /locus_tag="Sden_0333"
FT   CDS_pept        complement(371096..372814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0333"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53628"
FT                   /db_xref="GOA:Q12SE8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE8"
FT                   /protein_id="ABE53628.1"
FT                   /translation="MASQSAHIRVDNINASIEEHLDRINLLNHQYSDKAKSQLSQIEQA
FT                   AAQHLLTDAETLRLTLLQCYNLFEYGEHDATLLKAKAGLTQARAYKLDAISPYFVLCEA
FT                   DALNYHGEIDKALALIDSAIELARKYQQPQALVNGLYLRAIIDLQIENPNSSMEDLRLA
FT                   LEIYPQAMAQSPGWQLVPKAYLLTAMGSLFYSIGDISQAIFYTDKAREDENAVGKMEYL
FT                   ILTNSASLSLRNNDEPLADKYINQTKKLIAEIPHPIDQAISHDSLALIDFTRNRLDSAE
FT                   AQIKASIDIYIEYQQAIRLARSKRLLAQIYFKQGRDKEALEIIEQSIALTKNSARNLDL
FT                   QDIYTVLVNYYANKKNFEKAYEYQVLRFALEKKISAKINQARFLQFKARANEQAQPTNH
FT                   NSSVTPSQHYLTLGQTYGLVALGLIFLLVSILFFIKKEPKLPPLSRPFDEQEHEVNGIL
FT                   KSAKRAGYPLSILLLNISKIRQVDLADLQTLLVNTLREQDTLKRHSLDEIIIFLPYTSL
FT                   EGARRVATQVNMSVHSWQADSKVEMGAASLQQLDSFEQLLKKAQLDQLSNLKRQQ"
FT   gene            373329..374897
FT                   /locus_tag="Sden_0334"
FT   CDS_pept        373329..374897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0334"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53629"
FT                   /db_xref="GOA:Q12SE7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SE7"
FT                   /protein_id="ABE53629.1"
FT                   /translation="MPNRVIIFDTTLRDGEQALAASLSVKEKLQIALALERLGVDVMEV
FT                   GFPVSSPGDFNSVQTIAKTIKNSRVCALARALPADIDAAAQALAVAEQFRIHTFISTST
FT                   IHVESKLKRSFDDVLAMAVNAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEAAITAGA
FT                   RTINIPDTVGYTIPSEFSTIIETLFNRVPNIDQAIISVHCHDDLGLSVANSIGAIEKGA
FT                   RQVECTVNGIGERAGNCSLEEIAMILATRKDKLGLETGIVAKEIHRTSNLVSQLCNMPV
FT                   QANKAIVGSNAFSHSSGIHQDGMLKAKNTYEIMTPESIGLHRNNLNMTSRSGRHVIKHR
FT                   MEEMGYHTDDFDIDSLYEQFLKLADKKGQVFDYDLEAIVFMATQVAEDDHYRLQHLSVH
FT                   SDSSEGVATATVRIKVEGEDLTEAAIGNGPVDAAYKAIARASGREVEISSYKLSAKGQG
FT                   QDALGQVDITAKYQGRTFHGVGLATDVVEASAQALVHVMNLICRADKVADIKSQIQFNR
FT                   EHAGV"
FT   gene            374894..375988
FT                   /locus_tag="Sden_0335"
FT   CDS_pept        374894..375988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0335"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53630"
FT                   /db_xref="GOA:Q12SE6"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE6"
FT                   /protein_id="ABE53630.1"
FT                   /translation="MSYQIAVLAGDGIGPEVMTEARKVLKEVEQRFGLSIEYSEYDVGG
FT                   IAIDNHGSPLPEHTIKGCEAADAILFGSVGGPKWEHLAPDSQPERGALLPLRAHFELFC
FT                   NLRPAKLHQGLEHMSPLRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGESEEAFDTM
FT                   RYSRKEIRRIAQIAFEAARGRKQKVTSVDKANVLACSVLWRQVVEEVAVNYPDVTLEHI
FT                   YIDNATMQLLRRPNEFDVMLCSNLFGDILSDEIAMLTGSMGLLSSASMNGTGFGLYEPA
FT                   GGSAPDIAGQGVANPVAQILSAALMLRHSLKQEEAASAIERGVAKALEAGYLTAELLSA
FT                   DERSQAKSTTQMGDYIAAAIREGV"
FT   gene            375988..377436
FT                   /locus_tag="Sden_0336"
FT   CDS_pept        375988..377436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0336"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53631"
FT                   /db_xref="GOA:Q12SE5"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE5"
FT                   /protein_id="ABE53631.1"
FT                   /translation="MGQAIVKEGIKTVVTARAKTLYEKVWDAHLVASPAGEAPIIYVDR
FT                   HLVHEVTSPQAFSGLRAAGRPLRAPQKTFATMDHNTSTKSASLDALSPMARIQVDTLAQ
FT                   NCKDFGVKLYDIHHPNQGIVHVMGPELGITLPGSVIVCGDSHTATHGAFGALAFGIGTS
FT                   EVEHVLATQTLRQLQAKTMKVEVRGKVTEGVTAKDIVLAIIGKLGMDGGTGFVVEFCGE
FT                   AISALSMEGRMTLCNMAIEMGAKAGMVAPDQTTFDYLKGREFAPKDDNWQHAIATWSQL
FT                   YTDAEAKFDAEVVLEAQDIAPQLTWGTNPGQVVAIDGEVPNPANEINSTERSSMVKALE
FT                   YIGLTPGTKMTDISINKVFIGSCTNSRIEDLRSAAIHAKGRKVAEGVVAIVVPGSGQVK
FT                   LQAESEGLDKIFIDAGFEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRT
FT                   HLVSPAMAAAAAIAGHFVDIRKPY"
FT   gene            377452..378057
FT                   /locus_tag="Sden_0337"
FT   CDS_pept        377452..378057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0337"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53632"
FT                   /db_xref="GOA:Q12SE4"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SE4"
FT                   /protein_id="ABE53632.1"
FT                   /translation="MQAFTAHSGLAVAIDSANIDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDDAGEKPNPEFVLNQSRYKGASILLAQENFGCGSSREHAPWALADFGLRVVIAPS
FT                   FADIFYGNAINNGLLPVVLTQAQVQQLMDEVQGELGAQVSVDLQLLRVISPSGAEFPFS
FT                   LVESARHKLLNGLDAVGETLTHGQAISAYEANIPAWLA"
FT   gene            complement(378097..378369)
FT                   /locus_tag="Sden_0338"
FT   CDS_pept        complement(378097..378369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53633"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE3"
FT                   /protein_id="ABE53633.1"
FT                   /translation="MSGLDSLYAMLARPVTANVKLKRKVVQPHQGKDIAEDSHESPQSQ
FT                   LPPRITRPKSERRKASNNRYIRAYDRRQKKAHLASDPAPNIDINV"
FT   gene            378604..379833
FT                   /locus_tag="Sden_0339"
FT   CDS_pept        378604..379833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0339"
FT                   /product="signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53634"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE2"
FT                   /protein_id="ABE53634.1"
FT                   /translation="MHFYTARQPILNRRQRVVAYELLFRDSYKNCFPVDVPDKVATAKL
FT                   LVNSFLSMDIEDMTDGKPALINFPTSLLKEHLVHILPYKNLVIEVLETVEPNDDNFAIL
FT                   KQLFDSGYHLALDDFIYSPAWDRFLPLFKLIKIDIVATPLDTIAHILPKLKQKKTRLLA
FT                   EKVETQADFLHAKALGFDYFQGYFFYKPEIVKGNEVELSQPFLMSIYTEVMKPSFSYRK
FT                   LEAYFTQDMDLSYKLLRFVNSSYFSHVKDIISLKQAMIFLGENQLRKFVCLIVMAQLNP
FT                   DKPQILIQNTMLRARLCEVIAKVMKLNKLADAAFLTGLFSTLDAILDKPMEKVLHSLPL
FT                   APEINNALLHQQGELAECLALAIAYMQGNWEFVSEFVSRNHINAGELTRRCNQVYLWLS
FT                   EYQRSSSSKA"
FT   gene            380353..381705
FT                   /locus_tag="Sden_0340"
FT   CDS_pept        380353..381705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0340"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53635"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE1"
FT                   /protein_id="ABE53635.1"
FT                   /translation="MKKTVLTLAISALVVGSTAPVNAAGFQLAEYSATGQGRAFAGEAA
FT                   MADNASTQARNPAMLSYLEGQQVSLGGIYVMTNVDVDGDVSLRSPLFGSAEVVIPADGK
FT                   DVAASALVPNFYYANPLNEDWTLGLGVNSNYGLATEVPADHAAAIFGSHTSVKTVEFNP
FT                   NLAYRVNDAFTLGAGARLVYGEGEISASTPAWISAIGSHPNVPASIAARLPSAGTQLKS
FT                   MQGDDIGYGWTLGSSWQINPSHRLGLAYHSGVELELAGSAAGLSYTGGQDVAIEGYLPL
FT                   ELPAFAELASYHELTEKLAIHTSVNWTQWSVFERLVAHFPGDVKPVGNLETDLVKEENF
FT                   KDNWRFALGSSYQASNALLVRAGVALDKTAVDDAHRTTTIPDSDRLWLSTGAAYQVSKN
FT                   LMIDFAVTYIRSIGDAPISESQNLLGLAEIGFNGEASGDVWLVGSQLSYTF"
FT   sig_peptide     380353..380424
FT                   /locus_tag="Sden_0340"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            381849..382292
FT                   /locus_tag="Sden_0341"
FT   CDS_pept        381849..382292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53636"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SE0"
FT                   /protein_id="ABE53636.1"
FT                   /translation="MNKMWVLLAAMLFSQISHANEAQVSAVKQFVEGFNQKNVQSMQSH
FT                   TTDDVKWFSISEGAMALETSDKEELGEAMQNYFSGYSSAHAKIVNLVNSGDFISTVEQV
FT                   KWQNEGKWFMQCSLGVYRFKQNKIASVWYYPAHVCDATNAQVN"
FT   sig_peptide     381849..381908
FT                   /locus_tag="Sden_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            382390..383883
FT                   /locus_tag="Sden_0342"
FT   CDS_pept        382390..383883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0342"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53637"
FT                   /db_xref="GOA:Q12SD9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD9"
FT                   /protein_id="ABE53637.1"
FT                   /translation="MAEKSTPTKFIVALDQGTTSSRAIVFDHKANIVATAQREFTQRYP
FT                   QAGWVEHDPMEIWSSQSSSLIEVLARAGIESQDVAAIGITNQRETTVIWNKRSGKPIYN
FT                   AIVWQCRRSQGICQQLKAQGLETMISQKTGLVLDPYFSASKIKWILDTVPGARTQAEAG
FT                   ELLFGTIDTWLVWKLTHGAVHVTEPTNASRTMLFNIHSQSWDPELLQAFDIPPSLLPQV
FT                   KPSCAVYGHTDIVGGQIAIAGMAGDQQAALFGQLCVEQGMVKNTYGTGCFLLMNTGEQA
FT                   VTSQHGLLTTVAIGPQTQVNYALEGAVFMGGAVIQWLRDEMAMIEHARDSQALATQVAD
FT                   TNGVYLVPAFVGLGAPYWDADARGALVGLTRGANRKHIVRAALEAIAYQSRDVLDAMVK
FT                   DSGGDIKHIRVDGGAVENDFLMQFQADITDVAVIRPKNIETTAMGAAFLAGLAVGVWAS
FT                   IEELHNITTIDKTFNANMTELERDSRYLGWKNAVKQVMT"
FT   gene            complement(383931..384275)
FT                   /locus_tag="Sden_0343"
FT   CDS_pept        complement(383931..384275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53638"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD8"
FT                   /protein_id="ABE53638.1"
FT                   /translation="MGLDSIYAMLARPVQALYNRKRNVNKVSLTDDIHPDSHESPQSQL
FT                   PPSTAKNQEARIKPNLVKAKEKTASSINPDKEMASDMAVDDGAIANSKEAEADIVLPNG
FT                   EHIKHIDIEV"
FT   gene            complement(384337..385473)
FT                   /locus_tag="Sden_0344"
FT   CDS_pept        complement(384337..385473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0344"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53639"
FT                   /db_xref="GOA:Q12SD7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD7"
FT                   /protein_id="ABE53639.1"
FT                   /translation="MILSWQVLHRWLALIIGLQLLLWIVSGLALNLIPSSVFNTELHRK
FT                   PIETSAISLVNPGQTKLASLSTLAAKLMDKHLVSIELTLLFDEPMYQVQLIDKGQLDGP
FT                   HLAYYWAKDLNPVSLSLDNLSLLARNSYQANAENATSPASFAKPLLLPTEESGFQTQAP
FT                   VYLVAVNDEAQTRIYLNGASGEVLAHKNSRSTIKQWLFMLHFMDYAPENGLTFNHLWIQ
FT                   IIALFSLLLGVSGTALVIKRLYQGHYSLKSPFSRWFGLSRQAASAQVIRVFDKQNTPLS
FT                   RLSLESGALLTSLNHPKERIKTQCGGGGSCGLCMVRFMDTAPKPQEADIAKISRRKLEQ
FT                   GYRLSCQHDAADCQTLAPQQTEINIALTTRGQLNTWCD"
FT   gene            complement(385473..386216)
FT                   /locus_tag="Sden_0345"
FT   CDS_pept        complement(385473..386216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0345"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53640"
FT                   /db_xref="GOA:Q12SD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD6"
FT                   /protein_id="ABE53640.1"
FT                   /translation="MSVSHQIRRAHKWLTLFSAIQLLLWLSSGVYMVVMDIDFIHGDSL
FT                   VVQKNEPINTETLTLTLDEVLARYPEASQLSLFAVHGVTYYRLTVEGKTLLLNAITGQV
FT                   PTLLTQTQAMASAQSYYLGEVLPTSATLYLDEPPAEISPRLLPLWQVNFSPLNTSLYLN
FT                   ASTGALVSKRHDYWRLFDIMWMLHIMDYDTRNDIHNPLLSIMALLALLTALAGIALTYI
FT                   SFRAAPISADNLDDKLVSANNKEGK"
FT   gene            386597..387055
FT                   /locus_tag="Sden_0346"
FT   CDS_pept        386597..387055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0346"
FT                   /product="protein of unknown function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53641"
FT                   /db_xref="GOA:Q12SD5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SD5"
FT                   /protein_id="ABE53641.1"
FT                   /translation="MFRGASAINMDAKGRIAIPMRYRDQLHVHGTGVIVITIDIQSQCL
FT                   LIYPLQEWELIEAKLLTLSDTNPVERSFKRRLLGHAHECELDSHGRVLVPPTLRQYAGL
FT                   DKKAMLVGLLNKFELWDEAAWQQQMDDSQTLIQSQDLSSQDRLADFSL"
FT   gene            387083..388024
FT                   /locus_tag="Sden_0347"
FT   CDS_pept        387083..388024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0347"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53642"
FT                   /db_xref="GOA:Q12SD4"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SD4"
FT                   /protein_id="ABE53642.1"
FT                   /translation="MSQEFAHLSVLLKETVDGLNIQPDGIYIDGTFGRGGHSRHVLSHL
FT                   GPNGRLIAIDRDPQAIEAAKQFADDPRFQIVHGGFGQLADYVAELGLVGKIDGVLLDLG
FT                   VSSPQLDDAERGFSFLRDGPLDMRMDNSQGQTAAQWIARAEIEDMAWVFKTYGEEKNSR
FT                   HIARCIAADREKTPFLRTKDLADLIARITKNKERNKHPATRVFQAIRIYINSELEQIDQ
FT                   ALEGAVNVLAPHGRMSIISFHSLEDRMVKRFMRRHSQGESVPHGLPITEAEINKSKKLK
FT                   TLGKAMKPSEIEVEQNPRARSSVLRVAERLDY"
FT   gene            388039..388353
FT                   /locus_tag="Sden_0348"
FT   CDS_pept        388039..388353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0348"
FT                   /product="Cell division protein, FtsL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53643"
FT                   /db_xref="GOA:Q12SD3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD3"
FT                   /protein_id="ABE53643.1"
FT                   /translation="MSQSPLKLSRLILQDIWQHKWVLLLSIIVIFNAVIVVHTSHMSRK
FT                   LISQWDFLLQERDRLDIEWRNLLLEEQSQSEHSRVTRIATKDLDMSRPLPSQEVVIRLQ
FT                   "
FT   gene            388364..390109
FT                   /locus_tag="Sden_0349"
FT   CDS_pept        388364..390109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0349"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53644"
FT                   /db_xref="GOA:Q12SD2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD2"
FT                   /protein_id="ABE53644.1"
FT                   /translation="MAKQAKLKTKKTNPELIPWRLYVVVGFVFLLFTSLLARAAFIQII
FT                   EPEKLRYESDMRTLRTSSNQVQRGLITDRNGEMLAVSVPVMAVWADPKHSFDQNAFKDM
FT                   RRWQALADVLQEPVDEIVNKVKRDPKKRFIYLKRQVTSAVADYIKQLKIGGIYLKAESR
FT                   RYYPAGETAAQLIGITNIDDVGIEGIENTYNDWLTGTPSKQRVRKSRDGQVVERLDVVE
FT                   EGASSNDLVLSIDQRLQQLAYRELKRATEINQATSGSVIILDVHTGEVMAMVNTPSYNP
FT                   NARDNLQSHRMRNRALTDTFEPGSTVKPFAMVAALEAGAVKLDDVISTSPGWMRVGGRQ
FT                   VRDPVNYGDMSLAKILVKSSNVGISKVALSIPVEQLLGTYQAMGLGNYSGINLAGESAG
FT                   VIHDRRRWSDFERATLSYGYGLTATPLQLARMYATLGNGGISYPVSVLKLKQAPQGERV
FT                   IDEKVARDVMQMLVGVTEKGGTATQAHIDGYPIAGKTGTSRKAVAGGYGDNYMSLFAGV
FT                   APVHNPRLAIAIVINEPKGDRYHGGDVAGPAFGKIMSAALQMLNVEPITEREQVQLAAA
FT                   PRRAQ"
FT   sig_peptide     388364..388483
FT                   /locus_tag="Sden_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.961 at
FT                   residue 40"
FT   gene            390106..391614
FT                   /locus_tag="Sden_0350"
FT   CDS_pept        390106..391614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0350"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53645"
FT                   /db_xref="GOA:Q12SD1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD1"
FT                   /protein_id="ABE53645.1"
FT                   /translation="MMRLSDILAPWFHYAGVESASSMSLDSRKVTQGCLFIALPGHQVD
FT                   GRAYIEQAKAQGAVAALVHTDDPDSHGKVENLGSGITPWPVVNFFQLSSQLSAVAAQFY
FT                   PLTPQKMALIGITGTNGKTSVSQLIAQLTSLLGGKAAVMGTLGNGLWGQLVDSGNTTAD
FT                   AVTVMAQLHDFDVKGADICAMEVSSHGLVQGRVTAVPFDIAVFTNLTRDHLDYHGDMAS
FT                   YASAKKRLFQFPSLKYALLNLDDDTGAQWFEELAATKRKGFSVSPNAKACYYTDKLHFD
FT                   DAGVQGDFYYHDFGENAVSQHKARLVSPLLGAFNLSNLLAAIAALHLSGVAMADLLAVT
FT                   PKLVPVAGRMERFSLPQGASLVVDYAHTPDAIEQALKALRIHCHGQLWCVFGCGGDRDK
FT                   GKRPLMAQAAERFADKLMVTSDNARSEDPSAIIGDVLKGLTQPENALMEVDRVSAVKRV
FT                   ATLAKAGDIVLLAGKGHETYQEIAGQRLDYDERALALTLSQVTL"
FT   gene            391611..392984
FT                   /locus_tag="Sden_0351"
FT   CDS_pept        391611..392984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0351"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53646"
FT                   /db_xref="GOA:Q12SD0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SD0"
FT                   /protein_id="ABE53646.1"
FT                   /translation="MIELTLDALAQKLNAKHLGENLTIANVSTDSRAIPAACLFVALKG
FT                   ERFDAHDFAATAIENGAKALLVERELALDIPQLIVANSQKAMGEIGALVRDIVSPICVA
FT                   LTGSNGKTSVKEMLASILSQGHQVLYTAGNFNNEIGVPLTLLRLSQADEYGVFELGANH
FT                   KGEIDYTSSLVRPRVALVNNIGSAHLEGFGSIEGIAEAKSEIFNHLSADGVAVINADDA
FT                   FCELMKTKAKAFKQLSFSREANTNADIQATGLNMNAAGCYGFTIHYQGQQLAVQLPLAG
FT                   IHQVSNALAASAMCLALGISLTDIVSGLARLAPVKGRMQPHTLGRLLVIDDSYNANPSS
FT                   VSAAIDWLKNRDGFCCLVLGDLGELGDNAAHLHAQVGQQAKEAQIDALFCCGSLSENTS
FT                   LAFGSPHYAELPALLVELTSAIKANRGAVTVLVKGSRSARMERVVENLLNAYEHGELA"
FT   gene            392985..394067
FT                   /locus_tag="Sden_0352"
FT   CDS_pept        392985..394067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0352"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53647"
FT                   /db_xref="GOA:Q12SC9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SC9"
FT                   /protein_id="ABE53647.1"
FT                   /translation="MLVYLAEYLTQFHTGFHVFSYVTFRAILGLLTALVFSLWCGPKLI
FT                   RRLQLLQIGQVVRNDGPESHFSKRGTPTMGGLLILAGIFVSVLLWGDLESRYVLVMLFV
FT                   LGSFGTIGFIDDYRKVVRKDTKGLIARWKYILQSLAALVVAVFLYSSSTLPGETQLVVP
FT                   FFKDVMPQLGLVFIVLAYFTIVGASNAVNLTDGLDGLAIMPTVMVAGAFALIAYLSGHV
FT                   QFANYLHIPHLPEAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGAIA
FT                   VLVRQEILLVIMGGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLFLVLLGLATLKLR"
FT   gene            394074..395396
FT                   /locus_tag="Sden_0353"
FT   CDS_pept        394074..395396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0353"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53648"
FT                   /db_xref="GOA:Q12SC8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SC8"
FT                   /protein_id="ABE53648.1"
FT                   /translation="MQTQFTHIVLGLGATGLSVVRYLVSQGIKPLVMDSRRNPPGADVL
FT                   AQEFADIELITGGFDCRYLVQAQQLVISPGIAIDTPEVRAAMDMGIEVIGDVELFARAI
FT                   ADKKPCVIGITGSNGKTTVTTLVYEMLLAAGLKVAVGGNIGTPALDLLAMDVDYYVLEL
FT                   SSFQLETTYSLNCIAATCLNISEDHMDRYSDLTAYRNAKLRLYDQSRFIMYNLDDELTY
FT                   PHEPMNQNHFGLGVPDGDAWGLGDGKIYHGDSDIINLIDVALIGSHNHGNLLAAMALVH
FT                   ACGVEKEPMVTVAKTFSGLSHRCELVAVKQGVSYINDSKATNVGATVAALEGLSTHLGE
FT                   VYLIAGGDGKGADFRPLTQALSNVVQLITLGRDGHKLAKLKPGAIEVATMAEAVAKAAE
FT                   MAYSGDIVLLSPACASLDMYKNFMARGDDFRQLVEQLPDGV"
FT   gene            395386..396600
FT                   /locus_tag="Sden_0354"
FT   CDS_pept        395386..396600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0354"
FT                   /product="Phosphopantetheine attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53649"
FT                   /db_xref="GOA:Q12SC7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SC7"
FT                   /protein_id="ABE53649.1"
FT                   /translation="MVSNELRTQPLRHGINVSWNRLLGDSATSSMMTYDRSLLCAIIAL
FT                   ICFGFVMVMSASMPEAQKLTGDPFHFIYRHVAYLFGCVVIAYFVLNTELSRWEEYSPYL
FT                   VLMVLLMLMAVLVVGTTVNGATRWLSVGPIRIQVAELAKFVFVIYMAGYLVRRHGELRE
FT                   NRKGFYKPIGVYSLFALLIILQPDLGTVVVLFVCTVSLLFLAGARIVDFLVLVMFGIIT
FT                   FVGLVLFEPYRMRRVTSFMDPWEDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLAYL
FT                   PEAHTDFIFAVIGEEIGFIGIICVLLVLFFVALRAIRLGNLCLLNAKPFEGYLSYGIGI
FT                   WICFQTVVNVGASIGMLPTKGLTLPFISYGGSSLWVMTAAAMLLIRIDHERRLSAIQAI
FT                   EGRIK"
FT   gene            396600..397700
FT                   /locus_tag="Sden_0355"
FT   CDS_pept        396600..397700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0355"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53650"
FT                   /db_xref="GOA:Q12SC6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SC6"
FT                   /protein_id="ABE53650.1"
FT                   /translation="MTVNPMAPRILIMAGGTGGHVFPALAVAKNLAEKGWQVRWLGTAD
FT                   RMEARLVPQHGFDIDFIDIQGVRGNGLLRTLAAPFKIMRSIMQAREVIAEFKPQVILGM
FT                   GGFASGPGGVAGRLAGIPLVLHEQNAIPGMTNKLLARIATKVLCAFPNTFALAGQSVQV
FT                   VGNPVREELALLGSMKQQGQHDALKVLVVGGSLGAKVLNEVMPNVVAQLSRSLSITVWH
FT                   QVGKNNLASTKACYQQMGQAVNVNVAEFIDDMEAAYRWADVVVCRSGALTVSELAAVGL
FT                   PSILVPYPHAVDDHQTVNAAILVDAGAGFLLPQAILTSDNLAEKLSLFANNPEVLVQMG
FT                   KQAREVAVLDATNKVAEICAELARKS"
FT   sig_peptide     396600..396680
FT                   /locus_tag="Sden_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.935) with cleavage site probability 0.772 at
FT                   residue 27"
FT   gene            397702..399141
FT                   /locus_tag="Sden_0356"
FT   CDS_pept        397702..399141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0356"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53651"
FT                   /db_xref="GOA:Q12SC5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SC5"
FT                   /protein_id="ABE53651.1"
FT                   /translation="MTNTEKYKQLRSMIPEMRRIKHIHFVGIGGAGMGGIAEVLVNEGY
FT                   HISGSDIATNSVTDRLISLGAKVIIGHHADSVEHADVVVVSTAINHENPEIIAAKERRI
FT                   PIVRRAEMLAELMRYRHGVAIAGTHGKTTTTSLIASVYAQAQRDPTFVIGGLLNSAGTN
FT                   ARLGTSRYLIAEADESDASFLHLQPMVSVITNIEADHMDTYGGDFEKLKTTFVDFLHNL
FT                   PFYGVAVMCIDDEINREIMPRVGRQIVTYGFSQDADVQALNFNQIGHQSQFVVRRKDKE
FT                   DLALVLNLPGEHNVLNALAAIAVASEDDIDDESIVKALAEFEGIGRRFQHLGEFNTANG
FT                   QVMLVDDYGHHPSEVLATIKAARAGWPDKRLVMAYQPHRYSRTRDLYDDFVEVLSQVDC
FT                   LLLLDVYSAGEAAIPGADGRALCRSIRLRGQIDPIFVASPDQLASVLPDVLQAGDLLLT
FT                   QGAGNIGALSKLLASTNLGFE"
FT   gene            399274..400026
FT                   /locus_tag="Sden_0357"
FT   CDS_pept        399274..400026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0357"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53652"
FT                   /db_xref="GOA:Q12SC4"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SC4"
FT                   /protein_id="ABE53652.1"
FT                   /translation="MSWSDKGRQLRKTLSRVNWYFYSGLVFLVSVLGAIGWGGTQLHAL
FT                   LNDADALPIEAIAVKGERTFTKDDEIQDALQDLMQRSFFSADVVEVQQVLESLPWVYKA
FT                   KVRREWPAQFKVHLTEQVTVARWNDKAWLNVQGEVFEAPLISELAALPVLWGPETMAKE
FT                   VLTSFKQLNDLLTINGFKLVSLSLSPRRAWRAQLDNGILLELGREDKMSRVQRFINVYP
FT                   TLEKSSKPVAKVDLRYDTGFAVGWNETK"
FT   sig_peptide     399274..399408
FT                   /locus_tag="Sden_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.619) with cleavage site probability 0.481 at
FT                   residue 45"
FT   gene            400042..401277
FT                   /locus_tag="Sden_0358"
FT   CDS_pept        400042..401277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0358"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53653"
FT                   /db_xref="GOA:Q12SC3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SC3"
FT                   /protein_id="ABE53653.1"
FT                   /translation="MIKNQERNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGNHPSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLSISGKHIHCQNENGMVSINDEEV
FT                   TQEDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIKSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSGIASADSVLTNDEKDLGVCIVDIGGGTTDIAVYT
FT                   NGALRHCAVVAVAGNQVTSDIAKIFRTPLTHAEQIKVQFASARSAMVSREDSIEVPSVG
FT                   GRPSRSMSRHTLAEVVEPRYQELFELVLKELQKSGFEDQIAAGIVLTGGTSSISGAVDI
FT                   AEATFGMPVRVASPLPVKGLYEYVDQPIYSTGIGLLHYGARRVIERQFERPERQGVTSF
FT                   LNRVKSWFKGEF"
FT   gene            401304..402491
FT                   /locus_tag="Sden_0359"
FT   CDS_pept        401304..402491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0359"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53654"
FT                   /db_xref="GOA:Q12SC2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SC2"
FT                   /protein_id="ABE53654.1"
FT                   /translation="MFEIMDTHSDEAVIKVIGVGGGGGNAVEHMVKHSIEGVEFIVTNT
FT                   DAQALRKSSAGSTIQLGRDVTKGLGAGANPDVGRQAAEEDRENILAAIRGSDMIFIAAG
FT                   MGGGTGTGAAPVVAEIARSQGILTVAVVTKPFPFEGKKRMMYAEQGIAELAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVARGDDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDITIEELETVGN
FT                   HVKAYASENATVVVGAVIDPEMSDELRVTVVATGIGAEKKPDIQLVSKPTPRPEPVAEV
FT                   RAEQVEEPVQNYMSTKGNGNTAAAMQPAVAPMATPMSRADGDYLDIPAFLRKQAD"
FT   gene            402712..403632
FT                   /locus_tag="Sden_0360"
FT   CDS_pept        402712..403632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0360"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53655"
FT                   /db_xref="GOA:Q12SC1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SC1"
FT                   /protein_id="ABE53655.1"
FT                   /translation="MIFQRTVQKMVQTTGVGLHSGNKVTLRIMPAPVNSGIVLTRTDLS
FT                   PAVSIPAKAELVRETTMCTALVNDAGIRISTIEHLFAALAGLGIDNAVIEVDAPEIPIM
FT                   DGSASPFVFLLQSAGIKEQAAAKKYIKINKTIRVEDGDKWAELKPFKGFRVNFKIDFNH
FT                   PEIARSQQHMVMDFSTSAFVKDISRARTFGFMRDIEYLRANNLALGGSMENAVVLDEYR
FT                   VLNPDGLRYEDEFVKHKILDAFGDLYVAGHAIVGEFCAFKTGHALNNQLVRALLVQQDA
FT                   WELVSFDKEADVPVSFMVPGTQAFA"
FT   gene            complement(403637..404089)
FT                   /locus_tag="Sden_0361"
FT   CDS_pept        complement(403637..404089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53656"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SC0"
FT                   /protein_id="ABE53656.1"
FT                   /translation="MKKPPQDLSNLVHQFGKLPEMAEKAELLNNLNQHVKQILNGPVAQ
FT                   ELKVANLRQGVLVIETTSAAWAARINFQKSALLTQLQNETLPMLTAIEVKVNPGLALAQ
FT                   SKTNVAHTQLSSVAAEHLQALAENVEGSLGEKLKRLAALASRNRQS"
FT   gene            404117..405016
FT                   /locus_tag="Sden_0362"
FT   CDS_pept        404117..405016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0362"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53657"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB9"
FT                   /protein_id="ABE53657.1"
FT                   /translation="MSVTVFIQGRNGVTRWQPSKRWLLLPILLLASGTGLYQYSSDRFE
FT                   SQQAKADKNQKLREQQKQQVLQLKNATETQLVTLVTHVAKMQAKITRLEALGQQVAQHN
FT                   LLDDQFDFSTEIGIGGPSEFGSSIELNQLIDDMDKLAARIDNNNVQLSLLETVASNLHI
FT                   DEERYISGRPIYKGWLSSPYGLRNDPFNGRRTMHKGIDFAGTEGADVIATAAGVVTWAG
FT                   NMFGYGELVEIDHGNGLRTRYGHNKALSVNVGDVVAKGEKIANMGSSGRSTGPHVHYEV
FT                   LRSGQQIDPRKYVYRKTS"
FT   gene            405074..407797
FT                   /locus_tag="Sden_0363"
FT   CDS_pept        405074..407797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0363"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53658"
FT                   /db_xref="GOA:Q12SB8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12SB8"
FT                   /protein_id="ABE53658.1"
FT                   /translation="MLGKLLTKLFGSRNDRTLKNLGKIVTQINALEADFQKLSDDELKA
FT                   KTLEFRERLEKGETLDDIMAEAFATVREASVRVFEMRPFDVQLLGGMVLNSNRIAEMRT
FT                   GEGKTLTATLPAYLNGLSGKGVHVITVNDYLAGRDAENNRPLFEFLGLTVGINVAGIGQ
FT                   AEKKMAYAADITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSEHYRKVNVLIPSLIRQEKEDTEDEVGEGDYSIDEKGKQVHLTERGQEK
FT                   VELLLIESGMLAEGDSLYSAANISLLHHVNAALRAHTLFEKDVDYIVQDNEVIIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNYFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVVPTNKPMVRNDMADLVYLTASEKYAAIIKDVEGCRERGQPVLVGTVS
FT                   IEQSELLASLLKNAKIPHSVLNAKFHEKEAEIVAQAGRTGAVTIATNMAGRGTDIVLGG
FT                   NWKVEIENLTNPTDEQIAKIRADWQIHHDAVIAAGGLHILGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDSLMRIFASERVSGMMKKLGMEEGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEYDDVANDQRQVVYSQRNELMDATSIQDTIKNIEADVINDLVDQYIPR
FT                   QSLEELWDVPGLEQRFHQEFGIQLPIQQWLEKEEDLHEETLRERIVASWSDAYQAKEAM
FT                   VGADVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QMLDSLKHDVISVLSKVQVQAQSDVDDMEQRRREEEAKIQRDYQHAAAEALTDESQASS
FT                   DNTPKTMIREGDKVGRNDPCPCGSGKKYKQCHGKLS"
FT   gene            408546..410080
FT                   /locus_tag="Sden_R0015"
FT   rRNA            408546..410080
FT                   /locus_tag="Sden_R0015"
FT                   /product="16S ribosomal RNA"
FT   gene            410634..413538
FT                   /locus_tag="Sden_R0016"
FT   rRNA            410634..413538
FT                   /locus_tag="Sden_R0016"
FT                   /product="23S ribosomal RNA"
FT   gene            413748..413863
FT                   /locus_tag="Sden_R0017"
FT   rRNA            413748..413863
FT                   /locus_tag="Sden_R0017"
FT                   /product="5S ribosomal RNA"
FT   gene            413953..414029
FT                   /locus_tag="Sden_R0018"
FT                   /note="tRNA-Asp1"
FT   tRNA            413953..414029
FT                   /locus_tag="Sden_R0018"
FT                   /product="tRNA-Asp"
FT   gene            414806..416008
FT                   /locus_tag="Sden_0364"
FT   CDS_pept        414806..416008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0364"
FT                   /product="transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53659"
FT                   /db_xref="GOA:Q12SB7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB7"
FT                   /protein_id="ABE53659.1"
FT                   /translation="MTQPFNFEQALKDLQAGKNLTGKDSILGPLIKQLTEAALQAELEQ
FT                   HLAHDEQPNRKNGKTAKTIKHLSGSFELETPRDRNGSFEPQLIKKNQTTLTDEIDRKVL
FT                   SMFSMGMSYRDINQHVEEMYGINVSSVTINAITDKLIPELKAWQQRPLDSHYPIVWLDA
FT                   IHYKVKEDGRYISKAVYTLLALNMQGKKEILGLHLSENEGANYWLSVLTDLNNRGVKDI
FT                   LIACVDGLTGFPEAIASIFPNTETQLCVIHQIRNSMKYVASKNQKAFMADLKCVYRAVS
FT                   KEAAELALDELEAKWGEAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQ
FT                   FRKLTKTKGAFPNENSLLKLLYAGILNASNKWTMPIHNWSLCLSQLAIYFEGRLDSVLE
FT                   I"
FT   gene            complement(415860..416768)
FT                   /locus_tag="Sden_0365"
FT   CDS_pept        complement(415860..416768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0365"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53660"
FT                   /db_xref="GOA:Q12SB6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB6"
FT                   /protein_id="ABE53660.1"
FT                   /translation="MMREVKKANPEFKVNELCRAFEISCSSFYYKPIPLSINKQSVMQL
FT                   VEEVFTDSYSTYGKRRIQAELLDLDCRVGVYAISTVMKNLGLRAIRPKKKHYYPNQGEE
FT                   QVYAPNLLRRQFNPTTYNTHWVGDITYIKSHQGWSYLACVLDLGTKEIVGYALSSQPNA
FT                   ALATAALNNAIQRKRPNTQALMFHSDQGCQYSAKVFRERLKHLGIEQSMSRRGNCWDNA
FT                   VMERFFRSLKTERLNQLAFIKRAFEILCQVKFKFLARCLNALQNKSLTEINKGSNCEWA
FT                   LSIYSRRSICQHKVASTSYFH"
FT   gene            complement(416765..417076)
FT                   /locus_tag="Sden_0366"
FT   CDS_pept        complement(416765..417076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0366"
FT                   /product="putative glycine betaine/choline/proline
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53661"
FT                   /db_xref="GOA:Q12IG1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12IG1"
FT                   /protein_id="ABE53661.1"
FT                   /translation="MTRKSAVHISPLQKLEYAKLMVEQGYTNKQIEDMSGAGKSAVSRW
FT                   KVQYQAELAGETPENAKALTEDQRRIQLLEAQLKQAMRDNDILKKAAAFFIRDNQNLK"
FT   gene            complement(417448..417951)
FT                   /locus_tag="Sden_0367"
FT   CDS_pept        complement(417448..417951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0367"
FT                   /product="Divergent AAA region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53662"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB4"
FT                   /protein_id="ABE53662.1"
FT                   /translation="MTMLTFALDDINHLQESAQVEFKLAGGRDGTGQLPEDMWETYSAF
FT                   ANTLGGEIILGVREDKGEFTIEGIINPMPMLSEIWEILNNPTKISHNILAPTDVQIIEI
FT                   MSKKLIRLHIPAVDKSLRPIYLGQDPFSGSYFRVGDADMRASHEQVKQMRQRSGIDLTL
FT                   TKRC"
FT   gene            418272..420098
FT                   /locus_tag="Sden_0368"
FT   CDS_pept        418272..420098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0368"
FT                   /product="Potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53663"
FT                   /db_xref="GOA:Q12SB3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="PDB:5NC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB3"
FT                   /protein_id="ABE53663.1"
FT                   /translation="MMLEMAVIYLAAAIVAVPVAKRLGLGSVLGYLLAGILIGPFLLGL
FT                   VGEQTDVMHFAEFGVVMMLFLVGLELQPSRLWKLRHSIIGLGGLQVLLSAGLIFAIGFY
FT                   LFELQWQTALAIGLMLSLSSTAIVLQTLTEKGWIKQDAGQNAFSVLLFQDIAVIPILAL
FT                   IPLLAFTDINAAQADHGNMIAHLPSYLQVMISLGVIGTIILAGRYVSAPLFRYIAETHL
FT                   REIFTISALFLVVAIAVIMQKIGLSPALGTFLAGVVLAESEFRHELEVDIEPFKGLLLG
FT                   LFFITVGASIDFPLLLEQSLLVLGLVLGLLLVKALVLFVLAQGFKMQGEQKLLFTLALA
FT                   QGGEFAFVLLSLTQNLEILTLEQTKVVTLVVTISMLCAPLLLMFYERLLVKKTPENPEY
FT                   DNEIEATNSVIIAGYGRFGQVVGRLLSAQGYHLSILDHSPSQIDMLRRFGNKVFYGDAA
FT                   RKDLLEAAGAKDAQLLVIAIDAPDKALEIVELAHKHYPQLKIVARAIDRRHAYQYLRLG
FT                   VTSFKRETFDSAVNLGIEALTLLGNSSTVAERAGDLFSQHDNASLHELAALWGDDHTYG
FT                   VAVRQRMEDLKQVLAKDKAAQERLNTCKGGDC"
FT   gene            complement(420173..421483)
FT                   /locus_tag="Sden_0369"
FT   CDS_pept        complement(420173..421483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0369"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53664"
FT                   /db_xref="GOA:Q12SB2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB2"
FT                   /protein_id="ABE53664.1"
FT                   /translation="MGSSVDGGESFDLVIIGGGITGVAIAQFARAAGYSVCLLEQAEIG
FT                   AQTSANSSKLIHGGLRYLESGQLGLVYKSLANRRTLLSLAPNLVKPIPFTIPVYQDSQR
FT                   PPWLIRLGLSLYWLLSGFSELGRFRTIPPSQWANLGGIKQQGLKAVFQYWDAQTHDKKL
FT                   TQAVASSAITLGAKLLTQAKCTQLTHQGMDAPQGCHWLVRYQLKPEQLKQAQRHKSQLQ
FT                   ADGQDYSEKQYTLAARMVINAAGPWVNEVLSSQSTTNSLTPLAIDWVQGSHLVLDIPAP
FT                   EGIFYLESHLDKRVIFVMPWEGNTLVGTTETLRSSLQTPITPQADEIDYLLQIYQHYFP
FT                   KRHSLEQLNSLIIGHFCGVRVLPKAKGKLFNRSRDTLIVPGTLGVDGFEPRLLSIYGGK
FT                   LTTFRDTAKQVLADIRKQLGSRDVIADVDAISLGDEP"
FT   gene            complement(421588..422430)
FT                   /locus_tag="Sden_0370"
FT   CDS_pept        complement(421588..422430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53665"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB1"
FT                   /protein_id="ABE53665.1"
FT                   /translation="MITLNTLRSSCFSKLKLAIALILLLLTNLAFAHGDEALEVIDLRP
FT                   VKVNFHLKALATDWFTPQGDTQGKRKSITFSKAYLASFSLNLVPCLVQQKPLLTNIDAG
FT                   FFHAIFPKAYANHGVRFDMPTQIPLMLGQDLSQDSDQFVGEFMLPIGRYCEINYTMAHI
FT                   TSTAQQPAMTPYSLYLAGEYHQSSTTNERHHLDHKQAIEISARYAYGQNVPVDFEVTAT
FT                   TKYTHDANLTITLAPEAAFTAALSANNLAKAEHLIARGLLLAIPKQLKASYTEAPKTQ"
FT   sig_peptide     complement(422332..422430)
FT                   /locus_tag="Sden_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.946 at
FT                   residue 33"
FT   gene            complement(422526..425273)
FT                   /locus_tag="Sden_0371"
FT   CDS_pept        complement(422526..425273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53666"
FT                   /db_xref="GOA:Q12SB0"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR025924"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SB0"
FT                   /protein_id="ABE53666.1"
FT                   /translation="MSTQLMKNTDNKPQPHLRLTPLTPPLTPIKRTSALAVIVSSLLLS
FT                   ACGGGDDATPSEPVTTPVVPSVISASLSATSQGSETGPTHMIFTVSLTEANNSGAAISF
FT                   NLTTDASSTAKQGEDYQAFDSVLAIPVGETNASLTINVIDDSDIEALETLTLKASSAVS
FT                   NSASLSVSQDTATATITDNDSQGSDPSYSQNLTPSSNNLRFTANIVTQADTQVQMQFST
FT                   QGMPVKLTPLSPLGNTHDFNLYGLRPETQYQVSGLIHLSTGDIVQTQAQTITTGALPAG
FT                   LPTVQLISQNTTTSAGGLTFLSSTDAETARFFAVDETGAVVWYLDDDSINMSAAPTIKS
FT                   LGQGQLLLLLSREARIIDMTGATISSFSLPAYHHDALLLPNGNLLALVVQTRTVNGKSL
FT                   KGDEIIEVNPTGDIIWRWSSLDHLDTSRFPGALSQRVLDNGDIDWSHSNALAYLGHDDS
FT                   ILLSSRSQSWVVNIDKASGNIVWIFGDNTGANSTLQDKFFTLESGSWQANQHAPMFTSV
FT                   GDLLIYDNRNEAALPGASNNSRAVKYSLNTHLKQATQIWEAIAPKYTSSLGDVDELSNG
FT                   NVMYTSGGPGSNSDTHIVEVSSDASAQTLWEIKLADTSVYRAERLSWDEFLLSSVQTST
FT                   PSTDPILNPKIDTVNCQEAKQFVDTNNSANYIDYDMDGRTNADVYGSEHAPSLGVSCDS
FT                   DTLYIDTNGATNFDWVNLGQGNGGPQANNYHWVIPRNPELTTEQVAIPLLGPVAVTVTG
FT                   IQIFGPNENGADNFADPVTDGLLNYCGGHTRDYHFHERAKCFFEYPTLGGASSLLAPQT
FT                   AGVVLGYAFDGFPIMSPWECTDSSCTSVVQVNSSYRYTGSGDYSNENAWQNHVYEASLS
FT                   PLDQCNGMMRPDGSYAYYATETWPYYLSCYRGPTHLVGENNPRG"
FT   sig_peptide     complement(425121..425273)
FT                   /locus_tag="Sden_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.938) with cleavage site probability 0.396 at
FT                   residue 51"
FT   gene            425545..426099
FT                   /locus_tag="Sden_0372"
FT   CDS_pept        425545..426099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0372"
FT                   /product="protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53667"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA9"
FT                   /protein_id="ABE53667.1"
FT                   /translation="MAYFVAVNGSCTYLLDIPLAISLPEAKSKKIALFVDVQNIYYTCR
FT                   EAYGRQFNYRKLWQLVSQQGEIVQAVAYAIHKGDDGQLKFQDALKHIGFEVKLKPFIQR
FT                   ADGSAKGDWDVGITIDVMEAAADVNTVILLSGDGDFDRLLVKIYQKHGVDTQVYGVPSL
FT                   TAKSLMDSAGQFHPIDASWLL"
FT   gene            complement(426188..426667)
FT                   /locus_tag="Sden_0373"
FT   CDS_pept        complement(426188..426667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0373"
FT                   /product="globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53668"
FT                   /db_xref="GOA:Q12SA8"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA8"
FT                   /protein_id="ABE53668.1"
FT                   /translation="MTSANPKILLMLSCMLLQACVSSSTGVGNTVNKIDSAETAKDSSL
FT                   YSALGKQGGIAAIVDGLLAGIAADQRIVQHFRDTDITLFRQRLIEYLCLVTDGGCVYLG
FT                   ESMAESHQGLGITQAHFDALVGHLIHSMKQQSVPLGTRNALLKRLASKYEDISYR"
FT   sig_peptide     complement(426587..426667)
FT                   /locus_tag="Sden_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.391 at
FT                   residue 27"
FT   gene            complement(426664..427536)
FT                   /locus_tag="Sden_0374"
FT   CDS_pept        complement(426664..427536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53669"
FT                   /db_xref="InterPro:IPR021393"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA7"
FT                   /protein_id="ABE53669.1"
FT                   /translation="MFNSSYLTSAIPPLHIRGLLLLTCVLANSAMADTSRVIATGGATT
FT                   IEGSAGGGLVPWAVINGYNSSDEWSASAMATHVQLNDFSLNVTGASLSFDNSVELSVAR
FT                   QTFNLDTLGGELAQDIIGLKYKIAGELLYTQLPQLSIGVQYKRLDDFTLPSLVGAKDDW
FT                   GFDVYLAATQLYFDALAGHNLLLNGTVRATKANELGLLGFGSQTNDDYQLVIEVSAALL
FT                   LRDDLALGVEYRQKPNQLDFAREDDWQDVFIAWFINKHLSVTAAYTQLGSIAGFDDQQG
FT                   WYLSFEGTL"
FT   sig_peptide     complement(427438..427536)
FT                   /locus_tag="Sden_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(427546..429834)
FT                   /locus_tag="Sden_0375"
FT   CDS_pept        complement(427546..429834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0375"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53670"
FT                   /db_xref="GOA:Q12SA6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA6"
FT                   /protein_id="ABE53670.1"
FT                   /translation="MLTSFRARLIITLLLVLTLVQLITAVAVLTATREDNLLQQQKSLD
FT                   IGVNVFNEVLSNRGNQLNQSLSVLSADFGFKRAIATGEQETISSVLANHGTRIGAHAAV
FT                   ILSPKGALLSSSLADLKQADIDALFEMSANKGKGLNILSLENQSYQFVLQPVKAPTLIA
FT                   WVGMGFLLDNKVAQQAKAITGIDISFVNQTENSLKLVSTLAKADSQSLLSKVNINSLLN
FT                   RPSLSLPDDHLSTAIALDPRHDKLWAVLHQSNAKWQQSYLQLRNTLMLIFAFTLAFALI
FT                   IATWLATGLSTPLERLVRYARKIGQGQTPERIQGAPTELQALADSLVLMREDIEAREKD
FT                   LLFQSQHDDLTGLLNRFSVKRQLAEQQECLSGSLILLDIKRFRHINDIIGFNNADRLLV
FT                   LFAQRLTQLTPSPARIARLDGDAFLLHYPSPMEIELLHLALNSLEAPFSIDGSKISMEV
FT                   RAGLVSIAANGYDIDILIRRGEIALNQARAEDVRILSYRQGSDEQYQRELKIIRDLPLG
FT                   LKSNQLYLVFQPKVTLASNQCAAAEALIRWQHPELGFIAPDEFIRLAENSGNINMVSQW
FT                   VVNESIKQLAAWQQQGIILKLAINLSAHDLSNKALPSQIATQLNAQGLAYDALSIEVTE
FT                   GAVMKDPDAVIAVLQDFRDIGISIAIDDFGTGHSSLAYLKLLPVDEVKIDRSFVKDMFI
FT                   NKQDAMIVETSIQLIHGLGMSVVAEGVEEQETVELLKAINCDIIQGYVFSKPLKNEDFS
FT                   LWFHDFNQV"
FT   sig_peptide     complement(429742..429834)
FT                   /locus_tag="Sden_0375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.454 at
FT                   residue 31"
FT   gene            complement(429834..430517)
FT                   /locus_tag="Sden_0376"
FT   CDS_pept        complement(429834..430517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53671"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034242"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA5"
FT                   /protein_id="ABE53671.1"
FT                   /translation="MPIKAVLFCVIFILGISATPLIAASLEIKVTDSQQLAISDAVIEL
FT                   FPAQISAGQLSTVTKPSAAKAFEMFQKNRTFVPFVLAVPKGTHVDFPNLDRTRHHVYSF
FT                   SEAKPFELKLYIGKTESPVLFDNPGLVALGCNIHDYMQAFIYVAESPFVAVTDENGELT
FT                   FDDLPQGQYQVKIWHPWQTTVMPLSELKISTEQAKLAINLAIEHQAKPSAPAAGFGTQT
FT                   NLKGP"
FT   sig_peptide     complement(430446..430517)
FT                   /locus_tag="Sden_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            complement(430704..431129)
FT                   /locus_tag="Sden_0377"
FT   CDS_pept        complement(430704..431129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0377"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53672"
FT                   /db_xref="GOA:Q12SA4"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA4"
FT                   /protein_id="ABE53672.1"
FT                   /translation="MELIYTAQAKTTGGREGRSVSSDNKLDIQLSTPKELGGAGGSGTN
FT                   PEQLFAAGYSACFIGAMKFVAGQDKINLPTDLSVTADVGIGGNTKGVGFAIAVVLNISL
FT                   PSMDPDAAKALVDKAHQVCPYSNATRGNIDVELIISH"
FT   gene            complement(431506..433428)
FT                   /locus_tag="Sden_0378"
FT   CDS_pept        complement(431506..433428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0378"
FT                   /product="diguanylate cyclase/phosphodiesterase / histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53673"
FT                   /db_xref="GOA:Q12SA3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA3"
FT                   /protein_id="ABE53673.1"
FT                   /translation="MTLFRQIYALLFGLFLLTITSVAYVQFHETQNFLVQQMDSDLNNA
FT                   SNSLGLMLVPVLESGDAVGAETLVNVIFEGGYYQQIKLTWLVDGKQQVWNNAIRVENVP
FT                   QWFIDLEIFSTITKQSTITSGWLQLAEIEITAHPGFGYHELWRIITNTIMVFAVLFLIA
FT                   ILLARVGLTLILKPLHNLSEHAQRIAKRQFGPDMPTPKTEELKELVRAFNSMSSQLKQV
FT                   FNSLDEEVSALRKKNLVDQVSNLPNRQYMVSRLNGWLTEPSGGALFLAKFDWLEEVHSK
FT                   YGYQVRDETIHLLAQKMEQHLQEIAPSVIARIAAYEFAFLVEDVEHDQLNKYLQTLIRT
FT                   LNKEISKAGCKPNEGFALGVAERFGQMKVADIMAQADNALQKALLENKVFHWFETSQQQ
FT                   LFSREEWRDNLTLAISEKQFQFRWQPIQFCDNQQISQRELYCQLQLGDKLLHAGQFMPY
FT                   IELLSLGSLLDKCLIEKVAESKLLERNYESVAINLTHNSIGDTDFHLWLKQVLRSTPHV
FT                   ERMCFEIPEASVYSDLDACEKLCSIIRDSGAHFGIDHFGRQFGSMAYLQSLRPSYVKLD
FT                   QSFAYIDDNQHNSELCRALVNVAKGLDIQVIVTGIQEEDQLERFRTLRLDAYQGFIAPP
FT                   VNIKS"
FT   sig_peptide     complement(433357..433428)
FT                   /locus_tag="Sden_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.881 at
FT                   residue 24"
FT   gene            complement(433437..434150)
FT                   /locus_tag="Sden_0379"
FT   CDS_pept        complement(433437..434150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53674"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA2"
FT                   /protein_id="ABE53674.1"
FT                   /translation="MVLFTKLKTKSLSRRACQISLLTSVLLGSYLYASPTQELNSAKII
FT                   STLTAHYGERAGLRAKAWFQVLSKAEHVDEQEKLKMVNQFFNLFRFVEDKTLWGDSNYW
FT                   ATPMEFIGVNGGDCEDFSIAKYFTLLQLGVSEDKLRITMVKATTMNQYHMVLAYYPTPS
FT                   SIPLVLDNLDREIKPATQRNDLLPVYSFNGKQLWLNKEKGRGVLAGSSSRLKKWNDLKH
FT                   RLGVDRLRQPKLKME"
FT   sig_peptide     complement(434049..434150)
FT                   /locus_tag="Sden_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            complement(434295..434900)
FT                   /locus_tag="Sden_0380"
FT   CDS_pept        complement(434295..434900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0380"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53675"
FT                   /db_xref="GOA:Q12SA1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA1"
FT                   /protein_id="ABE53675.1"
FT                   /translation="MNKLLVLLMLALSTGCSMNDISSMDSPTEQKFDLNDQDRDGVIVA
FT                   RERCPETLSGATISNYGCGQIKPIHERQELKILFPTNSYVLDPQYYGQIELIANMMKQY
FT                   PNTNVTIEGHCSKKGSYELNMALSHNRANAVTQVLTSQFGIAPSRLNAIGYSFDRPVDM
FT                   SDTEEAHRRNRRVIAEISGEDTAADLKWNIYTVDKQVN"
FT   sig_peptide     complement(434841..434900)
FT                   /locus_tag="Sden_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.766 at
FT                   residue 20"
FT   gene            complement(434897..436303)
FT                   /locus_tag="Sden_0381"
FT   CDS_pept        complement(434897..436303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0381"
FT                   /product="Type I secretion outer membrane protein, TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53676"
FT                   /db_xref="GOA:Q12SA0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q12SA0"
FT                   /protein_id="ABE53676.1"
FT                   /translation="MNKYTHTGLKLTAVALAVMLSSAAQAQTLEQAVAHTLDTNPELRI
FT                   AFNRFKAREEQVNQAYAGYMPTVDVSGGYGWEQTDSVSTRRKAGQGDVDSDGKIDLERG
FT                   ELGVSIKQMLFDGFYTSSEVDRYSYEASSDQWALFAAAEDIALEVSKVYLKFIHTEQVL
FT                   TLAEKNLQSHKDIYDQIKQRTDSGLGSIADLSQISGRLARANANVISAKNNMFDAKAQF
FT                   VRIAAAAPENLIMPVPDADMLPADMGLSLKMAQDNHPILKSAASDIGAAKHERESAQAN
FT                   YYPKVTLELNGGWNNNTNGEDGYSAFNSQNVNGYTNDLAAMVRVKYNLFAGGKDLAREK
FT                   ETAYKINEAKEIRERAHRQVIEGVNLAWNAYELLAPQKQYIRDHVVAAKDTQVAYSQQF
FT                   NLGQRTLLDLLDTENELFEARKDYLQAEYDETVAQYRVLNATGQLLESLRVTRPSVWQG
FT                   ERHYEGGVGE"
FT   sig_peptide     complement(436223..436303)
FT                   /locus_tag="Sden_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(436330..437712)
FT                   /locus_tag="Sden_0382"
FT   CDS_pept        complement(436330..437712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0382"
FT                   /product="Type I secretion membrane fusion protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53677"
FT                   /db_xref="GOA:Q12S99"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S99"
FT                   /protein_id="ABE53677.1"
FT                   /translation="MSNKLTSQDLEMVNDVYGAMLSDAPTGHRLIIWTLTGMMVSFIIW
FT                   AYFSELDQVTTGTGKVIPSSQVQLIDSLDGGVLQEIFVEEGVLVTKGQPLARIDDTRFR
FT                   SDFAQQEQEVYGLQTNVLRMRTELDSILISDMSSNWREQVLITKQDLVFPVELIEQEPE
FT                   LVKRQQEEYNGRLDNLSNQLEILVRQIQQRQQEIEELASKITTLTKSYQLVSRELELTR
FT                   PLAQKGIVPEVELLKLERTVNDIQGELKTLRILRPKMKALMDEAILKRREAVFIYAADL
FT                   RAQLNELQTKLSRMNQAQIGAFDKVSKAVITSPVNGTIKTIHINTLGSVVQPGEEIIEI
FT                   VPSEDQLLIETKIAPKDIAFLHPGLPAIVKVTAYDFTRYGGLQGTVEHISADTSQDEEG
FT                   NSFYTIRVRTKESSLIKDDGTQMPIIPGMLTSVDVITGKRSILEYILNPILRAKDTALR
FT                   ER"
FT   gene            complement(437702..439885)
FT                   /locus_tag="Sden_0383"
FT   CDS_pept        complement(437702..439885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0383"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53678"
FT                   /db_xref="GOA:Q12S98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S98"
FT                   /protein_id="ABE53678.1"
FT                   /translation="MSAIAPKSQEQWTISASQKVTVDPLLDSLVLLTDHFGSPCSSDSL
FT                   TAGLPLNSAIITPDLLPQAAARAGLAAKLSRKDLNQMTGLMMPCILLLKDKKACVLRAL
FT                   DLDGDKATIQLPETGGEEILTLGDLESLYVGYLFLVKQEYRGDKSFDVHLHDNTTHWLW
FT                   QTVKESAPIYRDALIASVLVNLFALVSPLFIMNVYDKVVPNLAFESLWVLAIGAGIAYI
FT                   FDFIMRQLRSYLIDVAGKKVDIIVSSKLFFKAIGIPLSKRSPSVGGTARQLGEFDSIRE
FT                   ILASATITTLVDLPFAIFFIIIIYIVAGDLALIPVIASILIIGFTLYIQPKLKAAIEES
FT                   NRFASLKHGHLIESLTAIESIKANGAEGLVQKSWQQMIGHTANWQLITKKLTNHVTHVA
FT                   NFIVQFSVICIVILGVYRVADNEISMGGIIAAVILASRAISPMAQLAGLITRGNHTASA
FT                   LRQLDQIMTQEDEFQNKGHLASQYRLQGKISADNIAFCFPNSERPALHPMSMTIQPGER
FT                   VAIIGRNGSGKSTLAKMLVGLYQPTQGSLSYDGLDSGQIHPSDLRRNFGYLPQDVTLFH
FT                   GTIRDNILFGTRQVTEHQLIRAVQLSGVSMFTNLESEGLDQQVGEGGLSLSRGQRQTVA
FT                   LARATLNDPPVLMMDEPTASLDARAEKQFIRSMQHVSKDRTLLLITHKMHLLKLVDRII
FT                   VLDRGHILADGPKKEVLEKLNYGLLAGAQANEQ"
FT   gene            complement(439984..452841)
FT                   /locus_tag="Sden_0384"
FT   CDS_pept        complement(439984..452841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53679"
FT                   /db_xref="GOA:Q12S97"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S97"
FT                   /protein_id="ABE53679.1"
FT                   /translation="MGACMGSVTTTKNGVLSTAEGNVTLTVNNETRNVQAGETIPAGAT
FT                   LFFADNLPYVITYSDGSTETNAADFFADTDNDDPAALAEIQALQDLIASGEDPTEDLPE
FT                   TAAGTPTGNQGNSGFVSVGRSGDETLAASGFDTTGFTAAPAATPSDDFIDTNDSPSVLA
FT                   NDSNTINEDGVATGNVLLNDSDTDTVLTVTSFEVGGTSFPAGTSVTLEGGVLVLNADGS
FT                   YTFTPNENWNGSVPVITYTTNTGSTATLTITVTPVDDPSVLDNDTNTIAEDTVASGNVL
FT                   DNDSDLDNTLTVTSFEVDGTSYTAGTSVTLEGGVLVLNADGSYTFTPNENWNGSVPVIT
FT                   YTTNTGSTATLTITVTPVDDSSLLINDTNTIAEDTVASGNVLDNDSDLDNTLTVTSFEV
FT                   DGTSYTAGTSVTLEGGVLVLNADGSYTFTPNENWNGSVPVVTYTTNTGSTATLTIEVTP
FT                   VDDPAAFAGDDIGAVTEDASNPTLVDTGTLTINDADTGQSVFQVGNGTPSVGALGSLTI
FT                   DAAGNWTYNVANADVQYLAEGETKVETFVVLSADGTEHTITITITGTNDIPVIAGDDIG
FT                   AVTEDASNPTLVDTGTLTINDADTGQSVFQVGNGTPSVGALGSLTIDAAGNWTYNVANA
FT                   DVQYLAEGETKVETFVVLSTDGTEHTITITITGTNDIPVIAGDDIGAVTEDASNPTLVD
FT                   TGTLTINDADTGQSVFQVGNGTPSVDALGSLTIDAAGNWTYNVANADVQYLAEGETKVE
FT                   TFVVLSADGTEHTITITITGTNDIPVIAGDDIGAVTEDASNPTLVDTGTLTINDADTGQ
FT                   SVFQVGNGTPSVGALGSLTIDAAGNWTYNVANADVQYLAEGETKVETFVVLSADGTEHT
FT                   ITITITGTNDIPVIAGDDIGAVTEDASNPTLVDTGTLTINDADTGQSVFQVGNGTPSVG
FT                   ALGSLTIDAAGNWTYNVANADVQYLAEGETKVETFVVLSTDGTEHTITITITGTNDIPV
FT                   IAGDDIGAVTEDASNPTLVDTGTLTINDADTGQSVFQVGNGTPSVDALGSLTIDAAGNW
FT                   TYNVANADVQYLAEGETKVETFVVLSADGTEHTITITITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSTYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGTADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSTYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGAADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSTYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGAADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSTYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGTADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSTYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGTADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSTYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGTADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSAYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGTADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSAYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGTADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIGEDSQASGTVIE
FT                   AGNLDNGTNVVGTPTATGLLVATDVDAGAALTWSVQGTADSAYGAFSVDPVSGQWTYSL
FT                   DNAASVTQALAEGQSAVLTFTVRVTDEHGAYAEQLVTITITGTNDSPVITNDVSQLAGS
FT                   VVEASASDSGTPTATGQLSATDVDANATQAWSVQGTADTTYGTFSVDPASGQWTYTLDN
FT                   GLPATQALAQGQTETLTFVVRVTDDKGAYVDQTVTLTITGTNDTPVIVSATNATVSEEG
FT                   LINGLVDNQGNTDSTNATVVSGTINIQDADGDALTVSLSGPAGFTSGGDAIAWIWNASS
FT                   HTLTGYTGTLNSASYSEVMTIALTPPPAGSSGNWGYTLTLLDVLDHPITTEEDILTLAL
FT                   GVNVSDGTNSTTGTLTIVVEDDAPVLLESTAVNVTTIDIPDSLVGKFNLTNKIGNHNSL
FT                   DFDGFTITAKGFTSATNSALINSQINGSESGIGVKSAGAPYHNLENEVDFRKFSDGSSA
FT                   SEEVIVKLDADTIAYGVKIEFAKIYGGELESGVVEFWRDGQLVSIQTFNSDASSGNYAK
FT                   NFEVLAGGFDTMIIRATDNGKPASHPDNSDMTIKSIEFIGTAAPIAIAYATGTLAQEWG
FT                   ADGKGAFEFMGSNESGLTTADGQAITMTLVGNTLVGRTDAGDLVFKVEFTPSTGQWDFF
FT                   QYEEMLTPVGDNDIDFRVRATDGDGDGVISTFAVKPLLDTVPPTAPSVLILDDVNNNGI
FT                   LTNAEINDDGVQIQVNVDHADLAIGGHVTLNINNAGTPETLQLKLNSSGELVNLDGTPP
FT                   ANTSFSYSNGVITWTESTPDSGQSITVDATQTDLSNNTSISATDTAEVRMTYEYASGTH
FT                   GDNTIVGTESNDIIVSDQTGIQVVDGQNYNIAFIVDTSGSVGTSALNTMKTQLTSVFNT
FT                   LKASAIGVHSGVVKILLVDFDTGLKFAVSVNLAEANALSTLTTALGTMSSGGNTNYKAG
FT                   FDAATSWFTNGSASTNHGTNLTYFITDGQPNTDANKAPAAFASLNAKSTVEAIGIGNGI
FT                   NYTTLAAYDTDHTPVTGVNANQLAAVILGTENQLLQGDDTVDGGIGNDIIFGDLAKFAG
FT                   IAGQGFPALKEYVALHTGQNVNDVDIKAVHAYITNHIHEFNLANVNDGNDTLRGGSGND
FT                   ILFGQGGNDLLIGGNGDDTLIGGLGDDTLTGGDGRDTFVWSAGETGIDHITDFNINQDK
FT                   LDLSDLLIGEETGNLSDYLSFSFSGGNTTITIDADGTGAGTANQFIVLDGVDLSVQYGS
FT                   ANTGDIINGLLGTNGNGALIVDTLASTVNSSSEQLMRHFDEYSKNDGSLLP"
FT   gene            complement(453185..454375)
FT                   /locus_tag="Sden_0385"
FT   CDS_pept        complement(453185..454375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0385"
FT                   /product="HemY-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53680"
FT                   /db_xref="GOA:Q12S96"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S96"
FT                   /protein_id="ABE53680.1"
FT                   /translation="MIKALIIVAIILIGLCVSPLFIDNTGYVYIAIGEYQIETSLIVAI
FT                   TALVATVIIMLLTKWLLGLIINLALSSKHLPLRWRQSAAKKHTLQGAIAMAAEDWPLAE
FT                   KSMLKGAANGELPTLNLLVAAQAAHKQKKTQARDEYLASAAAEPTAQEAVSISKIRFFM
FT                   QDGEFSLARMELDKLTPTSKSPDAIIRISLELYPKLKDWQALKTLLPIAQKKQLASTEI
FT                   INQLTFDANSQLVAQAATKNTQELDKVWHWLSKSERQDPLLALIYIKGLISFGLAEEGN
FT                   KLLIKLVKHEPCGTIFEALPELVTAQDSEIRKQLMRHEASFENDASYQACVAKLCLQSR
FT                   DIKEAKIRLQSACRLAPKSEYWLALAQVQEQLGENTNAAQSYRHASTSPSTACSLV"
FT   gene            complement(454372..455583)
FT                   /locus_tag="Sden_0386"
FT   CDS_pept        complement(454372..455583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0386"
FT                   /product="protein of unknown function DUF513, hemX"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53681"
FT                   /db_xref="GOA:Q12S95"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S95"
FT                   /protein_id="ABE53681.1"
FT                   /translation="MEHTDKETKKAAPAAGSTTQAAPADPKSSPSTHAVEKEAVNTINK
FT                   ADKKMNKAATPSSQTPSKWPMRLGLLLCFIIACTALAASYWLYSQSVLLKSELAAKQLQ
FT                   AQQITGSVNTSLSYAKAKIESLEKQQQNNANAYQELTATQATIEQLQTQVNALAQRSPN
FT                   HWMASEADYLVRMAGRKIWLESDLLTAVQLLESADERIAAMQNPALLPIRKALSQDIAQ
FT                   LKSIKLLDTSSHILALDNLIIKLDNLPLNANKTLASSPVTTDAKLSDDIGDWQANLRKS
FT                   WQTFSSSLVTIRKRTTDLEPLLSPEQQWYLTENIKNKLLQAQRALQDKNNSEFQQSLAM
FT                   AKQWLGQYFDLHQASTAAAIETINKLAEIKLTPITHQQLTAAPLLEQLVTFGDLSAPAG
FT                   EPTL"
FT   gene            complement(455744..456460)
FT                   /locus_tag="Sden_0387"
FT   CDS_pept        complement(455744..456460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0387"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53682"
FT                   /db_xref="GOA:Q12S94"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S94"
FT                   /protein_id="ABE53682.1"
FT                   /translation="MKVLLTRPEGRNQQMADALTQLGIGYHLCPLLEITPSNTPPKASF
FT                   FSADKLVFISANAVYFAANNLNNHFPMHCEYFAVGEATQMALAEYQVVSQSAPSSQQDS
FT                   EGLLSLSQLQDVELQKITIVRGEGGRETLAQTLSERGANVDYWQVYQRSKPALDPKSVC
FT                   QQWQDLGIDTLVLTSGEALANLMELVPKELFAWLRSCHMIVPSHRVQVQAISQGFHRVS
FT                   NANGASTQAILTALAL"
FT   gene            complement(456537..457484)
FT                   /locus_tag="Sden_0388"
FT   CDS_pept        complement(456537..457484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0388"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53683"
FT                   /db_xref="GOA:Q12S93"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S93"
FT                   /protein_id="ABE53683.1"
FT                   /translation="MEAFHMSQHLIRIATRKSPLALWQAEFVKAELERIHPGLSVELVP
FT                   MTTKGDVLLDTPLAKVGGKGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLGLEIIC
FT                   EREDPRDAFVSNNFANLAELPKGAVVGTSSLRRQCQIRAMRPDLIIKDLRGNVGTRLAK
FT                   LDSGDYDAIILAAAGLIRLKLISRIASYISPEESLPANGQGAVGIECRTDDARVKALLA
FT                   PLEHLETRYRVIAERAMNTRLEGGCQVPIGAYAEIEGDELTLRGLVGNPDGSQIITGQV
FT                   KGLKSEASQLGEQLAEILLAQGAKTILDAVYGKA"
FT   gene            complement(457673..458008)
FT                   /locus_tag="Sden_0389"
FT   CDS_pept        complement(457673..458008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0389"
FT                   /product="Frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53684"
FT                   /db_xref="GOA:Q12S92"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S92"
FT                   /protein_id="ABE53684.1"
FT                   /translation="MAMTDTEFHQLVDAMFSQIETAIEYAIDEQDADVDIDASGNVLQL
FT                   EFQDRSQIVINKQEPLHEIWIATRFGGYHFAFKENRWFDERNQQEFMPFVIDAIHKQSG
FT                   IELKLTA"
FT   gene            458293..459537
FT                   /locus_tag="Sden_0390"
FT   CDS_pept        458293..459537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0390"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53685"
FT                   /db_xref="GOA:Q12S91"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S91"
FT                   /protein_id="ABE53685.1"
FT                   /translation="MDHFIYQDQNLFAESCSVAEIAQQHGTPVYIYSRATLERHWRAFD
FT                   DAVGTHPHLICYAVKANSNLAVLNVLARLGSGFDIVSGGELARVIEAGGDPKKVVFSGV
FT                   GKTVEEMQQALELGIYCFNVESSAELEQLNLVAQSLNTKAPVSLRINPDVDAGTHPYIS
FT                   TGLKENKFGIAMEEAEQVFVRAAALSHIDVKGVDCHIGSQLTELKPFLDAMDRLLGLVD
FT                   RLTALGIELSHLDVGGGLGVPYDNETPPAPQVYAAALVERLGERKLTLIFEPGRAIAAN
FT                   AGIFVTQVLYLKENSNKRFAIVDGAMNDLLRPALYSAWQKIIPVQQSDAATQAFDIVGP
FT                   VCETGDFLGKDRQLAVVAGDLLAIRSCGAYGFAMSSNYNSRPRVAEIMVDGSQAFVVRE
FT                   REKRQQLWQGEQLLP"
FT   gene            459600..460427
FT                   /locus_tag="Sden_0391"
FT   CDS_pept        459600..460427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0391"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53686"
FT                   /db_xref="GOA:Q12S90"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S90"
FT                   /protein_id="ABE53686.1"
FT                   /translation="MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLANRNFGVGFDQ
FT                   LLLVEPPYDPDLDFHYRIFNADGSEVEQCGNGARCFARFVRNKGLTQKNKIRVSTSSGK
FT                   MTLRLERDGSVVVNMGVPVTDPSNIPFKAKKVEKTYLLQTPVQTFLCGAISMGNPHCVI
FT                   EVDDIDTVAVDEIGALLTRHERFSKGVNVGFMQIINPGHIKLRVYERGAGETLACGTGA
FT                   CAAAAIGQLQDKLSRQVRVDLPGGTLHIDWDGEGKPLWMTGPAEHVYDGQIQL"
FT   gene            460577..461197
FT                   /locus_tag="Sden_0392"
FT   CDS_pept        460577..461197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0392"
FT                   /product="protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53687"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S89"
FT                   /protein_id="ABE53687.1"
FT                   /translation="MQFDAAMDEHIVREYLLDNPDFFNRYPELLLSLQLPHQERGTVSL
FT                   VERRQEVLRQRVTQLEEEITSLMVCAQENEKIFHFNNDLSHKLLACEDLGELRQVLSEG
FT                   LKHHYGFSHVRLITVHDIDSELANIWRHRISLGHYFGRLTQSESKRLFGGEVGSVALTK
FT                   LSDENGQVIFAVASPDSTHFHPGMDNLFFDQLRRLLDHMLPKF"
FT   gene            461274..462239
FT                   /locus_tag="Sden_0393"
FT   CDS_pept        461274..462239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0393"
FT                   /product="Tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53688"
FT                   /db_xref="GOA:Q12S88"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S88"
FT                   /protein_id="ABE53688.1"
FT                   /translation="MAQTSLFARFERYLTSERQLSPYTVRNYLFELRRAEPYLFTTLSL
FT                   PEYAAQTSQTNAITSPQTDEQWLALSHEALQALLAKLHRQGLSPRSLSLCLSALKQFFE
FT                   YLLAEDCITHNPAKGLSAPKQAKPLPKNIDVDAISHLLAIDGDDPLVIRDRAIMELFYS
FT                   SGLRLGELASLNYGDIHLGLQEVKVLGKGGKERRVPVGKLAMEALALWHTQRLLLVQAD
FT                   EPALFVSNQGKRLSHRSIQARMAKWGQNQALSVPVHPHKLRHSFATHMLESSGDLRAVQ
FT                   ELLGHANLSTTQIYTSLDFQHLAKVYDGAHPRAKKGREKG"
FT   gene            462236..462949
FT                   /locus_tag="Sden_0394"
FT   CDS_pept        462236..462949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0394"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53689"
FT                   /db_xref="GOA:Q12S87"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S87"
FT                   /protein_id="ABE53689.1"
FT                   /translation="MKQYLRLRAFKAISFDLDDTLYHNTPYLQLATDKFFAFLNQNYPK
FT                   TQTLHAQGWLTIKHDLFDLHPELKHDTSAARYAMVHDGLMSLGYKESEASEGAQKSMAC
FT                   FHFYRSDFTLDDKVLNLLKQLAESVTLVGISNGNVDASRIGLSESLAFVQHPGHGVKMK
FT                   PHGDMFELACQRLNISPAELLHVGDHQMADVSGARRAGCQSVWFNPEKHPLTRRTGSIL
FT                   PHVELDDLNKLLNLV"
FT   gene            complement(462985..463488)
FT                   /locus_tag="Sden_0395"
FT   CDS_pept        complement(462985..463488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0395"
FT                   /product="Divergent AAA region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53690"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S86"
FT                   /protein_id="ABE53690.1"
FT                   /translation="MTTLTFALDDINHLQESAQVEFKLAGGRDGTGQLPEDMWETYSAF
FT                   ANTLGGEIILGVREDKGEFTIEGIINPMPMLSEIWEILNDPTKISHNILAPTDVQIIEI
FT                   VSKKLIRLHIPAVDKNLRPIYIGQDPFSGSYFRVGDADMRASHEQVKQMRQRSGIDLTL
FT                   AKRG"
FT   gene            complement(463600..464125)
FT                   /pseudo
FT                   /locus_tag="Sden_0396"
FT   gene            complement(464657..465145)
FT                   /locus_tag="Sden_0397"
FT   CDS_pept        complement(464657..465145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0397"
FT                   /product="Kelch repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53691"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S85"
FT                   /protein_id="ABE53691.1"
FT                   /translation="MPYIAPLSGRLASVAIGIKDSAYIFGGYTVAEDHQELSTADNYRF
FT                   NIQDLRYQRIADMPVAVDDSAVASYQDRYIYLFGGWHQDGNVNLEQVYDTHTDTWSQAS
FT                   PIPAPAVFGQAVCMFANQLVLCDGVKIKANLRQKRSYQASPVCLFGEISPDNHQRIAW"
FT   gene            complement(465147..465380)
FT                   /locus_tag="Sden_0398"
FT   CDS_pept        complement(465147..465380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53692"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S84"
FT                   /protein_id="ABE53692.1"
FT                   /translation="MSSQVHGTQIHTSFQDSPASAAKPILTYPNLPQAVSNNAVALVKK
FT                   NDNSYLVSFMGLGANKGYQDVHNHAWSLASFG"
FT   gene            465493..466359
FT                   /locus_tag="Sden_0399"
FT   CDS_pept        465493..466359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0399"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53693"
FT                   /db_xref="GOA:Q12S83"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S83"
FT                   /protein_id="ABE53693.1"
FT                   /translation="MTLSQVGLFADGVAVKRIGAEPFRLAKEYVDEVVTVSSDEICAAI
FT                   KDIFEDTRAIAEPAGALALAGLKKHLGKTGKGEKVAAILSGANVNFHSLRYVSERCELG
FT                   EQKEAILAVKVPEKPGSFLRFCELLNKRVMTEFNYRFSGRDQAMVFAGIRLSNGAEELA
FT                   EIIKTLESQGFEVQDLSQDETAKLHVRYMVGGRPPKPLQERLFSFEFPEHPGALLKFLT
FT                   TLQSQWNISLFHYRNHGAAFGRVLAGFEVPASDALPFARFLTELGFVYQEETHSPAYQL
FT                   FLNTPAV"
FT   gene            466554..467162
FT                   /locus_tag="Sden_0400"
FT   CDS_pept        466554..467162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0400"
FT                   /product="Abi-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53694"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S82"
FT                   /protein_id="ABE53694.1"
FT                   /translation="MAPALIPYIKPYQESKELCERLAKQGLKIEDQNEAEKIIKRYSYY
FT                   RFKAYLIPFKNNNTKTYNEGSTFENSHLLYQFDCELRSTLFQIIEKIEVGVRSSVDQWI
FT                   TSQTNNPFWYLDSSLFSHNGDQIKTVSRVRDSFKDSKEEFAKHYREKYYNQYCPFYRDL
FT                   PPAWVAIEIMTFGNVVKLLENITEARIQLRSATLTKLSG"
FT   gene            complement(467151..468092)
FT                   /locus_tag="Sden_0401"
FT   CDS_pept        complement(467151..468092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0401"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53695"
FT                   /db_xref="GOA:Q12LY4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q12LY4"
FT                   /protein_id="ABE53695.1"
FT                   /translation="MSYQQLTEGRRYQISVLLDQGISIALIAKAINCHRATVYRELKRC
FT                   HALQGYCPDSAQASACKMRRHSAKYTIPDTRINFVRFLLQHDWSPEQISRVLSGMNQAV
FT                   SHEWIYRFVARNKRQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRER
FT                   FGDWEIDTVLGKHGTGSIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHT
FT                   ITADNGREFAHHEVIANALDTTFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSD
FT                   AIILFAQNRINYRPKKCLKFKQPAVVFKQLAA"
FT   gene            468383..468616
FT                   /pseudo
FT                   /locus_tag="Sden_0402"
FT   gene            complement(469009..469263)
FT                   /locus_tag="Sden_0403"
FT   CDS_pept        complement(469009..469263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53696"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S80"
FT                   /protein_id="ABE53696.1"
FT                   /translation="MSRFGTAQFGSAQFSAYETVISGIEKSEIIPEDAKRAIKDFLKDT
FT                   FHDLWNELQDIFDLEPPLQLLEHWEPLLEMLQSMLQSAI"
FT   gene            469806..470945
FT                   /locus_tag="Sden_0404"
FT   CDS_pept        469806..470945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0404"
FT                   /product="alanine-glyoxylate aminotransferase"
FT                   /EC_number="2.6.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53697"
FT                   /db_xref="GOA:Q12S79"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S79"
FT                   /protein_id="ABE53697.1"
FT                   /translation="MISAPTVNSFTPPRRTLMGPGPSDVYPEVLAAQARPTIGHLDPLF
FT                   VGMMDELKSLIQYAFQTKNEMTLAISAPGSAGMEACFVNLVEPGEKVIVCRNGVFGERM
FT                   RQNVERVGALAVVVDNEWGEPVCPKAVEAALKANPDAKFLAFVHAETSTGALSDAKTLC
FT                   RLAQEHDCLSIVDAVTSLGGVELLVDEWGIDAIYSGSQKCLSCVPGLSPVSFSPKAVAK
FT                   LMSRKTPVQSWFLDQSLVMGYWGNKDSGLKRSYHHTAPVNALYALHEAFRLLALEGLEN
FT                   AWARHKKMHLVLAAGLEQLGLKFVVAAEHRLPQLNAVYLPQGVDDALVRTQLLEEYNLE
FT                   IGAGLGALAGKAWRIGLMGFGARRENVALCLKALEEVMN"
FT   gene            complement(471095..471349)
FT                   /locus_tag="Sden_0405"
FT   CDS_pept        complement(471095..471349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0405"
FT                   /product="protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53698"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S78"
FT                   /protein_id="ABE53698.1"
FT                   /translation="MFNPKKIEDVAKQLSENLPSGLKQFAGEFEERSKQILQNQLMKLD
FT                   FVSREEFEVQQHVLLKTREKLEALQAQVNELEKKLAEQA"
FT   gene            471508..473520
FT                   /locus_tag="Sden_0406"
FT   CDS_pept        471508..473520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0406"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53699"
FT                   /db_xref="GOA:Q12S77"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S77"
FT                   /protein_id="ABE53699.1"
FT                   /translation="MKLNPAQNDAVHYVSGPCLVLAGAGSGKTRVIINKIAYLVEKCGY
FT                   KARNIAAVTFTNKAAREMKERVAQSMGRKEARGLWISTFHTLGLEIIKREYKVLGLKAG
FT                   FSLFDDQDTLALLKDLTEDEFDGDKDLLKALASAISNWKGDLVIPAQARKLAKDEQSQL
FT                   FSFLYQKYAQQMKAYNALDFDDLILLPTLLLRHNEEVRTRWQTRIQYLLVDEYQDTNTS
FT                   QYELVKLLVGERSRFTVVGDDDQSIYSWRGAKPQNLVLLGKDFPALKLIKLEQNYRSSQ
FT                   RILRAANILIANNPHVYDKALFSELAYGEPLRVLIAANEEQEAERVVAEIVRHKFVGRT
FT                   KFGDYAILYRGNHQSRLLERALMTNRIPYKISGGTSFFARAEIKDIMAYLKLVVNPDDD
FT                   NAFLRVVNLPKRGIGPASLERLGSFANEKHISLFSAIFEGELNHHLAPAATAALYQFGR
FT                   FIVDTGEIATRGEPVDAIKQLIRKINYEDYLYETSTSAKAAEMRMKNISELYRWVTEML
FT                   QGDELDEPMTLPEVVTRLTLRDMMERNNEDEGGDQVQLMTLHASKGLEYPFVFMVGTEE
FT                   RILPHQVSIDEDNVDEERRLAYVGITRAQRELWFTLCRERRQFGETMRCEPSRFLLELP
FT                   QDDLIWENRKPVQTEEQRQETGKSHIANLRDMFKK"
FT   gene            complement(473596..476217)
FT                   /locus_tag="Sden_0407"
FT   CDS_pept        complement(473596..476217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0407"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53700"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S76"
FT                   /protein_id="ABE53700.1"
FT                   /translation="MDVAPSFISSDIEHLQKRVIRLKRLARKYKRAEIIQNALLEISNI
FT                   ATKAASLDLFYQGVHLHLKKLIPADNFFIASRDANTGLISLPFFADEKDPHPSELYPDE
FT                   EISSIIERGITGYVLKTGKPLLCDTNKFDELIATGAIDDLGSPSHQWLGVPIKRNHHSI
FT                   GVLVVQSYHPDITYGELELELMGFICHHISGVMERLKHHEQLEQAIVERTKELSHAYET
FT                   VKQEVKERVRAERLQKALFEIADLSASNADQNRFYVQLHQIISQLIPAQNCFIALINNV
FT                   DATLSFPFYVSQMNLSYPASRPMQDGLTEYILATKEPKLLSQNDIKTLIEQDEIYAIAP
FT                   ALNQTHAMHQWIGIPLFIHGNIAGALTIYSISQDQNYQVKDLELLNFVSHHIANAIERK
FT                   MAVESLKRSHDELEDKVSQRTQALAELNDNLQEEIMQRRKIEAQLQHDAKHDGLTGLPN
FT                   RSFFMERLSYAIKHGRRHGHDQFALLFIDLDRFKQINDTFGHLEGDKFLIETARRLKSC
FT                   IRENDALARLGGDEFVILLDSIQGTQDALDVSDRILYQVSQPYKLGKQDFISGASIGIA
FT                   FSGHHKEDTSESLLKSADAAMYQAKSKGKGCYVIFDSQIDKQAKQAAEMKKAFKRALLQ
FT                   QEINISYAPVMNFNDLSIIALEPQASWKHPDGSLKTHNQLKSLAEQCQLIIHFDAYIFD
FT                   HLNHNYSKLVQQFSNKICIHLSVSSQHIKHKHGLRNLKRTLKKSQLDLSSIWVFFHEKA
FT                   FVQDTENHISAFQHLSQMDVNIGMNGYGTGYSSLSSLSLLPISALKLDSNISKHLVNEQ
FT                   QMQLTKAYQLAASSLGVDMFVEGVDTVQQKRQLSQLGYQQGQGKTFEKKHLNYIKVQKS
FT                   CA"
FT   gene            476436..476512
FT                   /locus_tag="Sden_R0019"
FT                   /note="tRNA-Arg1"
FT   tRNA            476436..476512
FT                   /locus_tag="Sden_R0019"
FT                   /product="tRNA-Arg"
FT   gene            476585..476660
FT                   /locus_tag="Sden_R0020"
FT                   /note="tRNA-His1"
FT   tRNA            476585..476660
FT                   /locus_tag="Sden_R0020"
FT                   /product="tRNA-His"
FT   gene            476790..476866
FT                   /locus_tag="Sden_R0021"
FT                   /note="tRNA-Pro1"
FT   tRNA            476790..476866
FT                   /locus_tag="Sden_R0021"
FT                   /product="tRNA-Pro"
FT   gene            477020..477096
FT                   /locus_tag="Sden_R0022"
FT                   /note="tRNA-Pro2"
FT   tRNA            477020..477096
FT                   /locus_tag="Sden_R0022"
FT                   /product="tRNA-Pro"
FT   gene            complement(477458..477967)
FT                   /locus_tag="Sden_0408"
FT   CDS_pept        complement(477458..477967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0408"
FT                   /product="putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53701"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S75"
FT                   /protein_id="ABE53701.1"
FT                   /translation="MLRLMLKLALVLMLSTNALAHQQQETYTNVSFNQRSAMLEVQHRF
FT                   YLHDAEHAAKRLLDKNSDLMSDPVSREAFAYYAIAKFALQDETKQTLPLNYVGTELDGK
FT                   YLWVYQETPITDKMQDLWIKMSSLQEIWPLQINHINLEKDKKVTSVRLHASDANQWHKL
FT                   SFNLAD"
FT   sig_peptide     complement(477905..477967)
FT                   /locus_tag="Sden_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 21"
FT   gene            complement(477967..480414)
FT                   /locus_tag="Sden_0409"
FT   CDS_pept        complement(477967..480414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0409"
FT                   /product="putative Zn-dependent aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53702"
FT                   /db_xref="GOA:Q12S74"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S74"
FT                   /protein_id="ABE53702.1"
FT                   /translation="MRLSCQLLALLSGVILVLNAQANPILQTKGDFQDKFRQLDEDLPT
FT                   ANDYRNAAGEPGKAYWQQQVDYQIEASLDENLRRLSAKQVVTYHNNSPYGLKYLWLQLE
FT                   QNRFKADSIGELTQTIDSVDADSARMGEVAAQINIHDLRRQQFLADTPMGYQLGKITDI
FT                   KGTPLKYTVVGEQMRIDLPKPLAAGETMQFKLEYSFNILEEDAVDARSGFEHFPDDKRK
FT                   NGNDIFMMAQWFPRLSAYSDYEAWHNKAFLGSGEFTLEFGDYDVKLTVPKDHIVASTGE
FT                   LQNLTSVLTQQQAKRLKQAETATKPVFIVSPDEALANESSTVSGHKTWHFKAENVRDFA
FT                   WASSRKFIWDAKGYQQGGDTQAKVMAMSFYPKEGGELWQRYSTESVIHTMQVYSRFTFD
FT                   YPYPTAISVNGPVGGMEYPMISFNGPRTIWHPEDDSRTYTLSEKQFLIGVVIHEVGHNY
FT                   FPMIVNSDERQWTWMDEGLNSFLDGVASKEWDPKLDWGREAQDIIEYMKSDVQVPVMTQ
FT                   SDSVLKLGPNAYTKPAVALNILREVILGRELFDFAFKEYALRWENKRPTPADFFRTMEE
FT                   ASGVDLDWFFRGWFYTTDHVDISLDKIYKLRLDTLNPDIDFKRQRQDSLAKPSSYFSRS
FT                   NQAEGKQAWVDKHPDNQDFHDKHDKFTATNQDRNDYQEMLAELEPWERQALKRAIKEDQ
FT                   NYYVLEFSNLGGLVMPLLLELSYEDGTVTKMNIPAEIWRKSPHHVSKLIITDKNKVLAS
FT                   VALDPNQETADVDRENNFYPRRIIQSRIEAFKDDKDDAKDSRDLMFDVNAELESPETKE
FT                   FKK"
FT   sig_peptide     complement(480346..480414)
FT                   /locus_tag="Sden_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.968 at
FT                   residue 23"
FT   gene            complement(480599..481354)
FT                   /locus_tag="Sden_0410"
FT   CDS_pept        complement(480599..481354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0410"
FT                   /product="putative cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53703"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S73"
FT                   /protein_id="ABE53703.1"
FT                   /translation="MHLTKLHITSLVLSLSAIPVFNGHADTINISSDIWCPYICDENPG
FT                   YVVELTNRAFELMGHEVQFNLMPFNRALLEAQKGNVDAVLAVTPKNLVDHQLHSGEMKI
FT                   GLSYNDFYTLTTNKWRFTELEDLNQHSVAIISGYDYDAIQDHIDTNPDAFYLATGENPL
FT                   AMNIKRLIRGRFQILLGNRNVISYTSKQLKMGEKIRYAGSFGTPLPLYIGFSVSKRHYA
FT                   DIFTEGMAKLKANGEYDKILIKYQIYPFD"
FT   sig_peptide     complement(481277..481354)
FT                   /locus_tag="Sden_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            481515..482504
FT                   /locus_tag="Sden_0411"
FT   CDS_pept        481515..482504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0411"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53704"
FT                   /db_xref="GOA:Q12S72"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S72"
FT                   /protein_id="ABE53704.1"
FT                   /translation="MTLSTHVSFTQPGNADVMTFSATNLAQPLAGQVQIKVYAAGVNGP
FT                   DIKQRMGAYPAPEGASPILGLEVSGEICALGEGVSQWQLGDKVCALVPGGGYSERVNTF
FT                   AAHCLPIPEGLSFEQAAALPETLFTVWGNLFMRAGLKAGESVLIHGGSGGIGTTAIQLV
FT                   SALGADVIVTSGSDDKCQYCLEQGARVAINYNQQDFVEPVLTATEGKGVNVVLDMAGGD
FT                   FINQNLKALAMDGRMVSVAMQRGPQAQVDVFRIMAKRITWTGSTLRPQSVEAKAEIAKA
FT                   LMNTVWPLIAAAKISLPLDSVYPFSEVIAAHQRMESGQHKGKIVLSLI"
FT   gene            482830..483255
FT                   /locus_tag="Sden_0412"
FT   CDS_pept        482830..483255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53705"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S71"
FT                   /protein_id="ABE53705.1"
FT                   /translation="MYNTAKKQVWFGELRTSKGNTVVVHDNQLPEAPKGRIYLYNTLRN
FT                   VIGEYVEDIVKVNLYDLSDAEVKAAEAEFGGAFKTARAEFMEKNQTRIDLSKVPDTAPV
FT                   RKAKPVPEVDDIPDLDVSDDDDFGDDEDDYPDDDSSE"
FT   gene            complement(483608..484636)
FT                   /locus_tag="Sden_0413"
FT   CDS_pept        complement(483608..484636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0413"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53706"
FT                   /db_xref="GOA:Q12S70"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S70"
FT                   /protein_id="ABE53706.1"
FT                   /translation="MVRFSVLAPWQDPRGGEIERIRLDNGIIAIEVLSLGGIIRSLWAP
FT                   DSQGERANLVLGCDSAADYLEQDAHLGAIAGRYANRIAKAKLKYQDEQYQLDANHGEHC
FT                   LHGGSEGFNRKLWQLGTLPDGVRLILKSPDGEMGFPGNCTVQLDYRLVGNNLYVEMFAS
FT                   VDKACPVSLTQHSYFNLDASQSSLNHQLQSAATHYLTMDDSGIPIAKRAVKDSAFDLSQ
FT                   GVELSLQTHAPELKATQGFDHCYLMDNPAGELKCFGTLSSPVSGRRLTLYTNQASVQVY
FT                   GANFLAHTLGRNQQPLAQYQGVCLEPQHLPDAPNQRELGQDPWLQPNKVYHHISRYQFD
FT                   TI"
FT   gene            complement(484666..485811)
FT                   /locus_tag="Sden_0414"
FT   CDS_pept        complement(484666..485811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0414"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53707"
FT                   /db_xref="GOA:Q12S69"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S69"
FT                   /protein_id="ABE53707.1"
FT                   /translation="MPNPTQRATKLFMQTFGTTADALYQAPGRINISGEHTDYNEGLVL
FT                   PVAINFHTVIAVKRRDDDVFRAVSDAFPGQIKQWRFANEQPFNHDDGWVNYLKGVTAAM
FT                   SHSGLHAKGLDLAIVGNVPLGTGLSSSAALEVAFGTAISYASQLHLSPLAIAQLAQRGE
FT                   SQYMGLKCGVMDQMISALAEADNALLIDCADLEGENVALPESLNIIVIDPRLDRAAFNE
FT                   QTLQRQRQCDQINALLGTDSIRHLSLAQLEAVKNSLTPEQAKLINHIKTENERTPSTAR
FT                   ALKQNNIPRFSQLMQQSYLSLRDDFMLHYPEVDTLVNMLHQLVGERGGVRFSDGCVLAL
FT                   VDHELTDAVVNLVEQDYFKQTGIEAKIYLCSASGGASRIDS"
FT   gene            complement(486037..487716)
FT                   /locus_tag="Sden_0415"
FT   CDS_pept        complement(486037..487716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0415"
FT                   /product="sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53708"
FT                   /db_xref="GOA:Q12S68"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S68"
FT                   /protein_id="ABE53708.1"
FT                   /translation="MEPAILIITLLCGMLVSRIGLPPLIGYLGAGFVLFMFGIEDASLP
FT                   LLQQLADLGVTLLLFAIGLKLDVKSLLKAEVWAGSSLHLMGSLLFFVPVLKLLGVLGIE
FT                   QLTGLGINQLLLISFALSFSSTVFAVKALEDNGDMQSLYGRVAIGILIMQDIFAVLFLT
FT                   ISKGAVPSVWALGLLLLPFARPFIYKVFDKVGHGEMLVLFGLVMALVVGAWLFEAVGLK
FT                   PDLGALIIGILLAGHAKSSELAKSIYYFKELFLVAFFLTIGLNGLPTWADVGLAGILVA
FT                   LVPLKVMLFLYLLTRFRLRSRTSLLASFNLGNYSEFGLIVAAVAAHKGWLAPEWLIVIA
FT                   VALSLSFLLAAPFNANVSKLYQKFQPYLTKLERHPLHPEDRQIRIGKPRFLILGMGRIG
FT                   CGAYDELRLRFSGEILGIEHKQELVDFHRSEGRNVVQGDAGDSDFWEKLEKAPQLELVL
FT                   LAMPHHVGNLFAVKQLQRLNYEGKISAIVQYAEDAQALRESGVDSVYNLYEAAGAGFVD
FT                   HVVAELFETQQLETEQLKTEGKASTSALTTTAKSIKKPKASS"
FT   gene            complement(487859..489733)
FT                   /locus_tag="Sden_0416"
FT   CDS_pept        complement(487859..489733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0416"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53709"
FT                   /db_xref="GOA:Q12S67"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S67"
FT                   /protein_id="ABE53709.1"
FT                   /translation="MNKILSLLLSSLILLSPLAHSESFGQSKSFSFLSSEPVLLPVNEA
FT                   FSFDYQQQGNQLKISWVIADGYYMYRDKLSFSIEGAKLTEVVLPRGKMHLDDYFGEQEV
FT                   YYSFIEFPLELQQIDANANLSVTFMGCAEGKLCYPPTKRMVPLIASAGEAASSSASPAD
FT                   KAIIGGSQRDAISADNTPAAEAVHVSTQDSLSQMLAGDSLLWTLAIFFGLGIGLALTPC
FT                   VFPMYPILSGIIVGQGKKLSTAKAFTLSMAYVQGMAITYSLLGLVVASAGLKYQAALQH
FT                   PAILIVLAILFAVLSLSMFGLYDLKLPAKWQEKMNSLSNNQKGGNLIGVFLMGVISGLV
FT                   ASPCTTAPLSGALIYVAQSGDLMQGFLALYVLSMGMGIPLLILGTSGGKILPRAGAWMD
FT                   IIKTVFGFLLIAVSIVMLSRIWVGVVSDVLWSVWALAFVGYLMHQNKLSEFNWKQTARS
FT                   IMLILMLMASFSYGFQAVMNHFGFTSPSLAQQAASQSTGMKAAKHIEFIKIKSLDDLNR
FT                   ELAKASANNQTALLDLYADWCVACKDFETITFKDSQVEQRFQQLVLLQADVTKSDDIDV
FT                   ELLEHFNVLGLPTLLMFDKNGQQREDLRITGFLGPKDFVKQLDLLINK"
FT   sig_peptide     complement(489668..489733)
FT                   /locus_tag="Sden_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 22"
FT   gene            complement(489730..490053)
FT                   /locus_tag="Sden_0417"
FT   CDS_pept        complement(489730..490053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0417"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53710"
FT                   /db_xref="GOA:Q12S66"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S66"
FT                   /protein_id="ABE53710.1"
FT                   /translation="MSTTALMVLTTCPDKTMADAIAKRLIETGLAACVQLGQSVESYYA
FT                   WQGEVCQSVEVPLQIKCLAVHYHAIEQVIVELHSYQVPEIIALPIEQGLTTYLKWIEET
FT                   AKS"
FT   gene            490338..490991
FT                   /locus_tag="Sden_0418"
FT   CDS_pept        490338..490991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0418"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53711"
FT                   /db_xref="GOA:Q12S65"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S65"
FT                   /protein_id="ABE53711.1"
FT                   /translation="MFIILFLLFVLIPVVELSVLIEVGDSIGALSTVALVFLTAIVGVS
FT                   LVRSQGLSTMMQVQQKLARGEAPGKEIVEGMMLAAAGVLLLIPGFVTDFIGLLLLTPFT
FT                   RSPIAGFLFKRMQLKVKTRGAGFGAHFNGQQGPGAGRSPFDAGNVFDADFERKDEPTPR
FT                   SHHIETNVVDPSRAEKDITPEQNPKANTEKSAEDNAEESTTDSAKADQPKAPNP"
FT   gene            complement(491176..491523)
FT                   /locus_tag="Sden_0419"
FT   CDS_pept        complement(491176..491523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53712"
FT                   /db_xref="GOA:Q12S64"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S64"
FT                   /protein_id="ABE53712.1"
FT                   /translation="MNSAIKAALLSAFICPGTGQWWLKQRLVGSGFMLVSVICLGYLML
FT                   ELVARAQVIVTQIVNGEIANDLVSIYAEVSAIPAEAMGTMNLLTWVFIANWLLSILNAY
FT                   WLGTQADKAAD"
FT   gene            complement(491573..492952)
FT                   /locus_tag="Sden_0420"
FT   CDS_pept        complement(491573..492952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0420"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53713"
FT                   /db_xref="GOA:Q12S63"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S63"
FT                   /protein_id="ABE53713.1"
FT                   /translation="MKDKHGLLSAPIGRVLLTMSLPNLLGILTVLGFSLVDTFFISQLG
FT                   TESLAAISFTFPVTLVVTSIAIGIGAGVSTQLGRLIGSGNAPKAKIFLFDALSLTLLLT
FT                   SLLALMASLLITPLFSLLGANAAIISLIEAYMLFWYLGCPLLVLLMVGNQGLRATGDTK
FT                   SPAMIMMLAALVNLILDPLLIFGLGPFPRLEMQGAAIASLLSWLIACSLSGYLLVVKRK
FT                   LVKISAVNIQRMRAHWQQLAHIAQPAALMNLINPVANGILMAMLARLNHEAVAAFGAGI
FT                   RLESLLLMVVMALSSSLMPFIAQNLGAGNPKRAKEALLLSLRFIVIFQLIVYLPLYFFA
FT                   ADIAGLFSQDAQVIEWLSFYILVLPLAYGPLGIVIIVATSLNAYHRPMSSLVINLCRLV
FT                   LIMLPLAALGSYLGGVKGLLLALPITNTLMGLACYILATKISEPTSSRPNRLEREQKYR
FT                   A"
FT   gene            493178..493468
FT                   /locus_tag="Sden_0421"
FT   CDS_pept        493178..493468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0421"
FT                   /product="chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53714"
FT                   /db_xref="GOA:Q12S62"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S62"
FT                   /protein_id="ABE53714.1"
FT                   /translation="MNIRPLHDRVIVKRLEVESKSAGGIVLTGSAAEKSTRGEILAVGN
FT                   GRLLENGTVKPLDVKVGDVVIFNEGYGVKKEKIDGEEVLILSEADLMAVVG"
FT   gene            493528..495165
FT                   /locus_tag="Sden_0422"
FT   CDS_pept        493528..495165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0422"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53715"
FT                   /db_xref="GOA:Q12S61"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S61"
FT                   /protein_id="ABE53715.1"
FT                   /translation="MAAKEVKFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFG
FT                   SPVITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVVEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVAELKKLSQECSDTKAIAQVGTISANSDESIGEIIA
FT                   TAMEKVGKEGVITVEEGQALENELEVVEGMQFDRGYLSPYFINKPETGSIELDSPFILL
FT                   VDKKISNIRELLPILEGLAKTGKPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDVAILTGGTVIAEEIGLELEKATLEDLGTAKRVVITKDNTTIIDGSGEHT
FT                   QITSRVAQIKQQMEDSSSDYDKEKLQERMAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALVRVASMIADIEVLNEDQKHGVVIALRAMEAPLRQIATNA
FT                   GQEASVVANTVKNGTGNYGYNAGNDTYGDMLEMGILDPTKVTRSALQFAASIAGLMITT
FT                   EAMIAEIPQESAPDMGGMGGMGGMGGMM"
FT   gene            495624..496205
FT                   /locus_tag="Sden_0423"
FT   CDS_pept        495624..496205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53716"
FT                   /db_xref="InterPro:IPR040704"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S60"
FT                   /protein_id="ABE53716.1"
FT                   /translation="MEQFESEFNRARNIFFEVKQLKLTYEQLYSDAGNWQIISEASLEF
FT                   FRLVHWSFRDSMIMQLCKLTDPKVQGRGKNSHLNLTLEYLLKSDVVEKSGKYQKIIDLY
FT                   ENKITHLRKPLKEFRHKLGAHADYPTMMSSSIVDPLEGEIFALFDAVEEFFILMNSSVF
FT                   GYCSLKSSSSSNSYRKGASDLLKILNKQRE"
FT   gene            496341..496631
FT                   /locus_tag="Sden_0424"
FT   CDS_pept        496341..496631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0424"
FT                   /product="transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53717"
FT                   /db_xref="GOA:Q12JS8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12JS8"
FT                   /protein_id="ABE53717.1"
FT                   /translation="MSLKKSHKSYPQAYKDEAVLMVLEQGYSVADAAKSLGVSTSLLYN
FT                   WKEKHQALQQGIALEESERDELKRLRRENKELRMEKEILKKASAFFAREMK"
FT   gene            496691..497500
FT                   /locus_tag="Sden_0425"
FT   CDS_pept        496691..497500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0425"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53718"
FT                   /db_xref="GOA:Q12JS7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q12JS7"
FT                   /protein_id="ABE53718.1"
FT                   /translation="MSVSKSGYYDWHKRPTNVISLETLKLYRLVRQLFKQSRGSLGNRE
FT                   MVKKLRKEGYQVGRYLVRKIMHRLRLKATQRRAYKVTTQRKHSDAVADNLLNMNFNPVS
FT                   ANQVWAGDVTYLKTGEGWMYLAVVMDLYSRRIVGWHIDKRMTTDLISKALMKAYNLRQP
FT                   ARGLVFHSDRGSQYTSKQFGKLLSSYGIRASMGDVGACWDNAVVERFFGSLKHDWIFKV
FT                   AQPTREFMKQDVTAYMKYYNLERLHSANGDLSPVEFENSQLKVSNLG"
FT   gene            complement(497477..497833)
FT                   /locus_tag="Sden_0426"
FT   CDS_pept        complement(497477..497833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0426"
FT                   /product="Abi-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53719"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S57"
FT                   /protein_id="ABE53719.1"
FT                   /translation="MSKIPYTKPPLTFTEQITRLEDKGMIFSNKATAEIKLSSINYYRL
FT                   SGYWYPFRIRDKAGKVKNQFQSGTNFDDVLFLYEIDRQLRSLILDAIERVEIAVRTQFT
FT                   YHLGLYWSTQIGHF"
FT   gene            498202..498450
FT                   /locus_tag="Sden_0427"
FT   CDS_pept        498202..498450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0427"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53720"
FT                   /db_xref="GOA:Q12S56"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S56"
FT                   /protein_id="ABE53720.1"
FT                   /translation="MALSLNQALNQGSLGLLVKETRNKAALTQEVAAMLCGVTKKTLIR
FT                   VEKGEDVYISTVFKILNGLGINIVAGQHSDANASGWY"
FT   gene            498454..498797
FT                   /pseudo
FT                   /locus_tag="Sden_0428"
FT   gene            complement(498966..500912)
FT                   /locus_tag="Sden_0429"
FT   CDS_pept        complement(498966..500912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53721"
FT                   /db_xref="GOA:Q12S55"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S55"
FT                   /protein_id="ABE53721.1"
FT                   /translation="MIVDLQKGQLTSASYTLFSEDDKVQRLKLTLKILITILVLLLACE
FT                   LYFNGFPTANVSSISRLAVAMLSSIVILVFFFLWTSPDTCSVISGMVLWLVAVFITCAC
FT                   WLGNGIFDTSILAFPCLLLLAVILSGKLIFTSIFVYLISALCFFAYSHSQGLLTGAILV
FT                   DEVPLSARVISYLITLTFFSVGVFYVFKDIRIRFKRLLKKNNALEISNFKLRELSRYDQ
FT                   LTLLPNENACKTYLEQILQQQKPSSHILAFITVNISNLASIKINYSHTLCDKTLIMLAQ
FT                   ALSLYASESAVIYRFQQNEFVILKHSADHRGISKFAEKIHQACSQTFHVEDFDIVLQPN
FT                   IGIAIAPFDGRSMEELRHNSLLAVHAKFDGNKADFNFFDQAMADKERHKLQLTKALRNA
FT                   IINNELVLHFQPQIDLETGQIIGAEALIRWMSPQYGFVPPTVFIPLAEQAGVITDITQW
FT                   VIEHSVKACQQWHQLGFNKLCVAVNLSAEDFKRGNLVTYTMSILHQANLPAHFLELELT
FT                   ESMLMDDINNIQKQINELRAFGISFSIDDFGTGYSNLGYLTKFNVSTIKIDRSFVANIC
FT                   QSSNELQIVKAIIEMSKSLSITNVAEGIEDSETALMLSKLGCEVGQGYLWSQPLTQQDL
FT                   IVLLSAKHKELSY"
FT   gene            complement(500909..502507)
FT                   /locus_tag="Sden_0430"
FT   CDS_pept        complement(500909..502507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0430"
FT                   /product="GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53722"
FT                   /db_xref="GOA:Q12S54"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S54"
FT                   /protein_id="ABE53722.1"
FT                   /translation="MNKSGLVIRLAIVIIFTAVIVGLITTQIFYRFTFLNEQVLGQQSI
FT                   HQLSNTVSKTASIASYLGDEELAREVVNGLISNDVITSAAIKTDTLVVKSDNFPDADAS
FT                   IDTLEFALYSPFQKDRRVGLLIVEANDDYLRVKANNISATNTFFVGIEALIITIISILV
FT                   TYYVITRPILNIGKALHSISPGTSERIAKPLSHQKSEIGQLADDVNELLAKAEQQLLKE
FT                   KSLRSEVEVLESRFRMLFENATSAIALVEPKGDLLLYNETFETLIQKLQLPLKKNYGNY
FT                   LQDLFIMKKELHEQIQIAFENNESAMAELELISPQDEKIWMQVVVTPLVTDDFQENYQI
FT                   TLHDISKRKYQISLLDKKANFDSLTNLFNRHAAEQHLRQLMANREPFALIMMDLNDFKP
FT                   INDIFGHDAGDELLIHVSSQLLKSVRKADILARWGGDEFVLILPKASREDVINVCAKSA
FT                   AKLSKPHNLSQHDKSVFVTASMGVSFYPDDQVELLELIRSADKAMYQAKKQKTINNELY
FT                   LSFTSDKANLVSGKK"
FT   gene            complement(502500..502937)
FT                   /locus_tag="Sden_0431"
FT   CDS_pept        complement(502500..502937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53723"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S53"
FT                   /protein_id="ABE53723.1"
FT                   /translation="MKKINQASAAILALLFFSVSVLAQDSLAVVVNKANPVDELSRSEL
FT                   IDLFMGKYVAFPNDVKAIPVELNGDHKIKVDFYKQLVDMPLSQVNAYWSRLRFTGRKRS
FT                   AIFQSNEAELIAFIIANEQAIGYVPQSLITDELKVVYILHE"
FT   sig_peptide     complement(502866..502937)
FT                   /locus_tag="Sden_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(502937..504181)
FT                   /locus_tag="Sden_0432"
FT   CDS_pept        complement(502937..504181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53724"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S52"
FT                   /protein_id="ABE53724.1"
FT                   /translation="MFLAQCKNLLCFSLLVLTPYGVANEANNDKLQFSGFATLGAVYSD
FT                   SSHRGYRKDVSSDKGVYSGEIDLKQHSLVGLQTNWAISPSFDFVYQGVFRDLPEPSLDR
FT                   YTTLAFLRYEMNTNWSFRVGRTAPDLFLLTEYRDVDFSYAWATAPNEIYGIIPYRSIDG
FT                   VDVTYTQRVFGGVFKTKLFTGSSEAEISATSVVEEIKIEDLVGLSLSFDHFNWIVQAKY
FT                   TQATIANDAKTNQMGIDIISQIPDFLWPNADAFAQSLRLAGKQANYASVSGQYVWQDWL
FT                   ASAELARITSEDQVFPSITSGYGALSYQFNAHQVYGIFAFTNSDYYVFNEPGVNRAALG
FT                   ELIQGVTSLKNFYATNQQTFSLGWRWDITNYMASTLQWNHTKLDEQGTTLWLTHPGQEV
FT                   AENVNTYLLSLSMVF"
FT   sig_peptide     complement(504110..504181)
FT                   /locus_tag="Sden_0432"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.894 at
FT                   residue 24"
FT   gene            504413..504568
FT                   /locus_tag="Sden_0433"
FT   CDS_pept        504413..504568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0433"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53725"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S51"
FT                   /protein_id="ABE53725.1"
FT                   /translation="MLCGVTKKTLSCVEKGEDVYTSTVFKILNGLETNIVAGQHSDANP
FT                   SGDTNL"
FT   gene            complement(504695..505603)
FT                   /locus_tag="Sden_0434"
FT   CDS_pept        complement(504695..505603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0434"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53726"
FT                   /db_xref="GOA:Q12S50"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S50"
FT                   /protein_id="ABE53726.1"
FT                   /translation="MINIIYVFLLMFILLGCKSTTVDLTVKPGKCYQIEYTAKPHYTLQ
FT                   VSQKTVAAINRFNNCDFVEAQTILNTAMPMLANDNMLIASYHAQMGAYDMMKNSLDRGN
FT                   YQQVISSSKVWANFVKIENDPRIIKELYIAYRMLKNEEKTTQLAALAFETPDAAESYFS
FT                   LWHQKSFPQHYKNKKINITLALLDLMHEQLQSMNELPSSRYPGDTVNTRLNRTDLSKPF
FT                   SIYKVAPEAISPGWVILSFSVNKKGRTEDIKVIDVSPVGGFEADAINTLSKWLYLPAES
FT                   ENGKAIKTENLKVKLEVNTQN"
FT   gene            complement(505627..505893)
FT                   /locus_tag="Sden_0435"
FT   CDS_pept        complement(505627..505893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53727"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S49"
FT                   /protein_id="ABE53727.1"
FT                   /translation="MENLTIRGPLNSPKHYSILVIQIAINPMEIDGFYNQGKQNILFYR
FT                   EWKSDIFPLPMTHSDTLFFGKIKRTTLSRWPPLTQSMSVVVIT"
FT   gene            complement(506071..506559)
FT                   /locus_tag="Sden_0436"
FT   CDS_pept        complement(506071..506559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0436"
FT                   /product="Uncharacterized protein UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53728"
FT                   /db_xref="GOA:Q12S48"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S48"
FT                   /protein_id="ABE53728.1"
FT                   /translation="MEKVFEKLMYASRWIMAPIYLGLSLILFALGIKFFQEIFHLIPNI
FT                   FEIAEVDLVLITLSLIDITLVGGLLIMVMFSGYENFVSQLDVGESSEKLNWLGKMDAGS
FT                   LKNKVAASIVAISSIHLLKVFMNAENIANDKIMWYLLIHITFVLSAFAMGYLDKITRK"
FT   gene            complement(506724..509012)
FT                   /locus_tag="Sden_0437"
FT   CDS_pept        complement(506724..509012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0437"
FT                   /product="transcriptional regulatory protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53729"
FT                   /db_xref="GOA:Q12S47"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S47"
FT                   /protein_id="ABE53729.1"
FT                   /translation="MAEQYSIGGFFIDLSRNQITQNNQSQIIAPKALAVLTYLAENQGK
FT                   VVSHDALLENVWQGTVVSPNTLQRSIAQLRKALGDDGKVQVYIKTHAKQGYSLECDVRW
FT                   HDNIESPPLNAAQENIVDTPTMSETNALAMSEDNTQSKAQHHSHDKDQSKSATTTDNAK
FT                   PSKLTVMPLFTLFGIIILAYIGYQYLMPQPPSKLSFGELRLLTTTDNKEFASIYSPDGQ
FT                   YVVFHRYSAVFCRNNIWAKNTKTQQETQLTKDFDSYGSHSFSTDGNQLVFIQTGGCSKP
FT                   EPDNQCYKLMSLDFHKALQAPQSAKVLVECKNSEIKFPKWLNNDDIALFQKLSNRWKLT
FT                   RYSVSANKTTDIYEIDEGNLIYYDYSPEDELLAVISSHKDGQYYIEILKPDGRLISSNR
FT                   IEYPKEIAKFKRIYPNFSPLKEQLIFSTGRQLFTLSFDGQVTNISLPLDQSMGQPQFHP
FT                   DGKRMLVIKGHYDSDIVSLPLSQLTSSPLVSSQPNTAQIENAQIVQSSAQTQSLTSSDY
FT                   SVIERSTYGEDSAKLQPNGELIAYQSDRSGEEQLWITDGKSSQQLTDFPMDTYIYGMDW
FT                   AADGQSLLVNANDVLIQVSLDSTQTIFPLEYPVFQLFQWDSKNNRAVVLIRIQEVLTFA
FT                   ELNLTHLETRTINDKDINWALKSENGQLVYADKMGRFWRPGPVEDQRIEALDGQEAEKQ
FT                   RFVINDNVIYGINKQNQLWSYGLNEDKFDILADLPSNVDYLTDIDNSQLLMSIRVSARK
FT                   DVAELTIKQ"
FT   gene            509271..510155
FT                   /locus_tag="Sden_0438"
FT   CDS_pept        509271..510155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0438"
FT                   /product="WD40-like beta Propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53730"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S46"
FT                   /protein_id="ABE53730.1"
FT                   /translation="MKHLYFFIVLLLSMLLLSSKSYSQEGFPVLKGPYMGQQPPGMMAE
FT                   LFAPGIISKQGWELEGVFAPGMKEFYFTLDRSEYTNGPDKKFSPTVIGYRQHNNIWTKY
FT                   IEFPRRGETAFSPDGKRMHMAEGYKDRIGEGWSERKSLGPMFDRKDWGIMRLTVSSQGT
FT                   YVFDDYKSKDVIRISRLKDGKRQAPIKMGPAVNSGTYTAHPFIAADESYLIWDSKREGG
FT                   YGDSDLYISFRQQDGTWGPAINMGDKVNSDKWEAYASVTSDGKYMLFNRGVDGRDVDIY
FT                   WVDAQIIETLKPQ"
FT   sig_peptide     509271..509342
FT                   /locus_tag="Sden_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            510180..511100
FT                   /locus_tag="Sden_0439"
FT   CDS_pept        510180..511100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0439"
FT                   /product="WD40-like beta Propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53731"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S45"
FT                   /protein_id="ABE53731.1"
FT                   /translation="MVKTLTLLVLLWAIPLTSAAAEAKIEDTIENAASFPILKGPYFGQ
FT                   TPPGLTPEVFAAGIVSVDGRYEGGVSFSADFNEMYFSATVKGHSIVYFSTLENQHWTQP
FT                   IKANFTQGKVADEFSPFASLSGNRIYFSTYDSSYPLKIWYVNRLDNAWSKAILLDSPLN
FT                   KEEVIMSSEAQNGDLFYINSSKRKMYYALNNNNQFAEGQDVGIEYGSHGFISPSQDFLV
FT                   VDAHKDNDETKDKDIYVYFKQQDGTWSKPINLGSTVNSNFREGSPTITPDGKYLFFNRY
FT                   DEKSGNPNIYWVSTDIITELKKTNF"
FT   sig_peptide     510180..510242
FT                   /locus_tag="Sden_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.743 at
FT                   residue 21"
FT   gene            complement(511241..511519)
FT                   /locus_tag="Sden_0440"
FT   CDS_pept        complement(511241..511519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53732"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S44"
FT                   /protein_id="ABE53732.1"
FT                   /translation="MSKLNAEQRKTRDNERFSQRVDERRVKGEDVVAYALANDKAYKFL
FT                   TKSEKHSFKERQAAQGEVAQQNSKLKQQQELAKIEEGFFEDEDALST"
FT   gene            complement(511721..512440)
FT                   /locus_tag="Sden_0441"
FT   CDS_pept        complement(511721..512440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0441"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53733"
FT                   /db_xref="GOA:Q12S43"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S43"
FT                   /protein_id="ABE53733.1"
FT                   /translation="MENGTLVRWNEGKGFGFIQPEQKITCLLNNKPDEALNIDVFIHIS
FT                   TLKHMARKPKVGDNIEFERELQADGKVRARRAHITGVAILASSLQVNSQSHSKAALSTN
FT                   SSAIHHSSQHNSLHSKDAFHLVKSGRDTAPKNKMASHIITTLLLISLGIYGFSQSNKIT
FT                   ANASEPVPTQLQSDANTLSQNTVQKLQPNFYCETAKTHCSHMKSCEEATFYLKNCPTTQ
FT                   MDGDGDGIPCERQHCGY"
FT   gene            complement(512694..513773)
FT                   /locus_tag="Sden_0442"
FT   CDS_pept        complement(512694..513773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0442"
FT                   /product="penicillin V acylase precursor. Cysteine
FT                   peptidase. MEROPS family C59"
FT                   /EC_number="3.5.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53734"
FT                   /db_xref="GOA:Q12S42"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S42"
FT                   /protein_id="ABE53734.1"
FT                   /translation="MCLRVLNNLNEQYPVTGRNMNWFRPINVSLYRFTEGLEKQGLTHK
FT                   QMHTLALPQSAVFKWRSSYASVVAMMGDDEQGYAAVDGMNDQGLMVNALYDTPATYAPA
FT                   EPNQNNRNISVLCWPQYILDCFADAKSVAEYARHNTLVILDDLVPEGGNERELVPAHIH
FT                   LAVSDKTGNSSIIEITNGVLSVYENPKYQVVTNEPDYATQLSILKHWQYLWGQTQPRID
FT                   TPVYTVMGGYTPIQSFDNAAFYLSLSDKTEQPEDVLAQTRAFMQKGAIPYQFNPKQSDH
FT                   ATCTRWTNMADHHSKTYYFINPLNMMPVWLDVKHTGQPSAKIQLITVKESKIDNHSELH
FT                   GNLQKQLIHCQDPFALMTH"
FT   gene            513867..514880
FT                   /locus_tag="Sden_0443"
FT   CDS_pept        513867..514880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0443"
FT                   /product="GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53735"
FT                   /db_xref="GOA:Q12S41"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S41"
FT                   /protein_id="ABE53735.1"
FT                   /translation="MHEVELDKTHKLRAKVLIGTCGLLGMLGLLLGVINILFIGLSPVL
FT                   AGLQLGYALVSFWLMQRALNDNHKPWEAHLYVYGLTAIVMFAVYVARLESFMFCWALIL
FT                   PILYLLMLGKQTATLPASFLFIFVLIDISIKSDVMPWPMILNFSCSYALIWLIAYVYEN
FT                   NRERSENELQTLALLDPLTQHYNRLALSKRFQSLSQTSTLPMCILLLDLDYFKVINDTY
FT                   GHEAGDIVLKACAKQISSIAGYSDTFRVGGEEFCVLVQAEHANQAVELAESIRKLISDT
FT                   EFLFENQNLAVTVSVGVATFEAKMTLSNLLAKADKQLYLAKDLGRNKVMFDGGYLK"
FT   gene            complement(515109..515414)
FT                   /locus_tag="Sden_0444"
FT   CDS_pept        complement(515109..515414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0444"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53736"
FT                   /db_xref="GOA:Q12S40"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S40"
FT                   /protein_id="ABE53736.1"
FT                   /translation="MFDQTTNTEVHQLTVGKIETANGTIKPQLLRDAVKRAVTNFFSQL
FT                   DGQEASEVYEMVLSEVEAPLLDIIMQHTRGNQTRAANMLGINRGTLRKKLKKYGMN"
FT   gene            complement(515431..516399)
FT                   /locus_tag="Sden_0445"
FT   CDS_pept        complement(515431..516399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0445"
FT                   /product="Dihydrouridine synthase TIM-barrel protein nifR3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53737"
FT                   /db_xref="GOA:Q12S39"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S39"
FT                   /protein_id="ABE53737.1"
FT                   /translation="MQIGPYQLKNQLIVAPMAGVTDQAFRNLCLRYGAALAVSEMLSSN
FT                   PEVWDTEKSRQRMTHSGEEGIRSVQIAGADPDLMANAAQFNVEQGAHIIDINMGCPAKK
FT                   VNKKFAGSALMQDPALVKDILQAVVAAVDVPVTLKIRTGWDPEHKNGVQIAQIAQDCGI
FT                   ASLAVHGRTRQCMYKGFAEYDTIKAIKQNISIPVVANGDIDSPEKARFVLDYTGVDALM
FT                   IGRGAQGRPWIFKEIQHYLETGKKLAPIEIHEQRLVMLEHLTKLYELYGEYKGVRFARK
FT                   HTGWYLNQEEQRQFRADFNRLESADQQYSLVECYFDELVKN"
FT   gene            complement(516676..517557)
FT                   /locus_tag="Sden_0446"
FT   CDS_pept        complement(516676..517557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0446"
FT                   /product="LSU ribosomal protein L11P methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53738"
FT                   /db_xref="GOA:Q12S38"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S38"
FT                   /protein_id="ABE53738.1"
FT                   /translation="MPWIQLRINTNSDHADAIGDILMEQGAVSITYEDGKDTPIFEPKL
FT                   GETPLWQDTVVVALFDAGTDLAPTVALLATSPMLGENFPHKIEQIEDKDWVREWMDSFH
FT                   PIQFGTRLWICPSWREIPHPDAVNVILDPGLAFGTGTHPTTALCLEWLDSLDLSDEEVI
FT                   DFGCGSGILAIAALKLGAKKVTGVDIDYQAIDASQANAVRNNVQDQLALYLPEDQPEGL
FT                   IADVLVANILAGPLRELAPLIAEKVRQGGKLALSGLLQEQAEELAEFYSQWFQMDPPAY
FT                   KDDWSRLTGIRK"
FT   gene            complement(517684..518949)
FT                   /locus_tag="Sden_0447"
FT   CDS_pept        complement(517684..518949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0447"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53739"
FT                   /db_xref="GOA:Q12S37"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S37"
FT                   /protein_id="ABE53739.1"
FT                   /translation="MNLTELKDTPISDLVSLAETMKLENMARTRKQDIIFSILKAHAKS
FT                   GEDIFGGGVLEILQDGFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDSIFGKIRPP
FT                   KEGERYFALLKVSEVNFDKPESSKNKILFENLTPLHAEERLRMERGNGSTEDITARILD
FT                   LCSPIGKGQRGLIVAPPKAGKTLLLQNIAQSITYNNPDVVLIVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHRPKRFFGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   QELHLSRKAAEKRVFPAIDFNRSGTRREEKLTTTEELQKMWILRKILHPMDEVAAMEFL
FT                   IDKLAMTKTNDEFFTAMKRAKS"
FT   gene            complement(519163..519489)
FT                   /locus_tag="Sden_0448"
FT   CDS_pept        complement(519163..519489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0448"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53740"
FT                   /db_xref="GOA:Q12S36"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S36"
FT                   /protein_id="ABE53740.1"
FT                   /translation="MSDKIVYLSDDSFENDVLKSELPVLVDFWAEWCGPCKMIAPILDD
FT                   VAQEYAGRVTVAKLNVDQNNVSPAKYGVRGIPTLLMFKGGELVATKVGALSKTQLKEFM
FT                   DAQI"
FT   gene            519642..520940
FT                   /locus_tag="Sden_0449"
FT   CDS_pept        519642..520940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0449"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53741"
FT                   /db_xref="GOA:Q12S35"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S35"
FT                   /protein_id="ABE53741.1"
FT                   /translation="MSETHLSTQRFADLPLHAEVIQALNENGFEFCTPIQALSLPVLLK
FT                   AKDIAGQAQTGTGKTMAFLVATFNHLLTTPAPQARELNQPRAIIMAPTRELAIQIAKDA
FT                   NLLAKHTGLKVGIVYGGESYEVQREVLDKGVDILIGTTGRIIDYVRQGVISLNSIQAVV
FT                   LDEADRMFDLGFIKDIRFLFRRMPDASSRLNMLFSATLSMKVQELAYDHMNDPEKVEVT
FT                   PEEKTSKNIKEEIFYPSTEDKMRLLLTLMEEDWPEKAIVFSNTKHSCENLWSWLEGDGH
FT                   RVGLLTGDVPQKKRIRILEQFTSGDLDVLVATDVAARGLHISDVSHVYNYDLPDDCEDY
FT                   VHRIGRTGRAGNKGVSVSFACETYALNLPAIEQYIGHSVPVSRYDREALLDDIPTPVKI
FT                   HRKHPTSRTRDGAKGAHRSGGARPPRHRTRRPS"
FT   gene            520941..521873
FT                   /locus_tag="Sden_0450"
FT   CDS_pept        520941..521873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0450"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53742"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S34"
FT                   /protein_id="ABE53742.1"
FT                   /translation="MQTPAYAAITLGSNSFNMLVARTIGHQPVIIAKYKRKVRLAEGIT
FT                   KDGILNEAVMARGLDCLAMFATMLKKHHIDADHLAVLATATLRMIANADDFHRRALPIL
FT                   GHPIEVISGMREAELIYQGMMATTTGQGRRLVIDIGGASTEFIVGDGHSVLFKTSVPIG
FT                   SVVFNKQFFSAAPFQQLDFDDVYHHIYTVIEPHLEMLRNLGWHTVVGASGAVQSVVSVL
FT                   AHREVSEVITLEVLTGLRDEILAQSDAKLAQIDGLRADRRPTFVSGVAILLALFEHLSI
FT                   DALHLSGGALREGVIHMLAQRLSLAVNDA"
FT   gene            complement(521977..522384)
FT                   /locus_tag="Sden_0451"
FT   CDS_pept        complement(521977..522384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53743"
FT                   /db_xref="GOA:Q12S33"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S33"
FT                   /protein_id="ABE53743.1"
FT                   /translation="MTQDMLTGELTPEMLLSLATFADSHQAYQLDEDKIADLSELTQDT
FT                   EIVTLVGTWCPDCYREVPRLIKILASLNSPHISTRYIGLDRDKRDKQGLGAKFEFSRIP
FT                   TIIIMQNNQEVGRIVERPNTSLEQALLDILF"
FT   gene            complement(522384..523394)
FT                   /locus_tag="Sden_0452"
FT   CDS_pept        complement(522384..523394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0452"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53744"
FT                   /db_xref="GOA:Q12S32"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S32"
FT                   /protein_id="ABE53744.1"
FT                   /translation="MNLITSAFPLRRMRRMRKHDFSRRLMAENSLSVNDLIYPMFVLEG
FT                   VNRSEKIASMPGIERYSIDLLLKEAAELVELGIPLIALFPVTPADKKSLLAEESYNSDG
FT                   LVQRAVKELKQAFPQLGVMTDIALDPFTTHGQDGIIDDTGYILNDITTEILVKQALSHA
FT                   DAGADIVAPSDMMDGRIGAIRQALEAAGHINTQIMAYSAKYSSNYYGPFRDAVGSAGNL
FT                   KGGNKHSYQMDPANTDEALHEVALDIQEGADMVMVKPGMPYLDIVRRVKTELAVPTFAY
FT                   QVSGEYAMHMAAIENGWLAEKPVVMESLLCFKRAGADGILTYFAKRVATWLKEEK"
FT   gene            complement(523412..525337)
FT                   /locus_tag="Sden_0453"
FT   CDS_pept        complement(523412..525337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0453"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53745"
FT                   /db_xref="GOA:Q12S31"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S31"
FT                   /protein_id="ABE53745.1"
FT                   /translation="MSLNSGRRVSSRTLKLLPLLSLLLLLNVVMVGMSYAAEHRPTPLR
FT                   ITATSITKIDLADWLYINTATQAEQLSQVRQSTADQWRKYKPTDLRYIGAKNIWVSFSL
FT                   YNPNDNLSRIIALDNPLLDSVELYHLIDNRVQKVTHMGDSLPFYQRPLLSNIFLYPIEL
FT                   EPNELHTFYLKVNTKGSINLPLVLWSANDLTQESEAQGLTHGLQIGILVAIGLFSLFIA
FT                   LASGSFSYSYYSVYVMALTLLVASVHGVAFRYLWPQFPSIQQYVIPFTIPIILAFSLLF
FT                   TEKVLQLKYHSLPMLRCCRVLVSYSFVLCLLVPLIPYDILLYLLVLSVFLISLILLAFS
FT                   AIQAIRGQKNARLYTLGRFGLLIGTILSGLIYLGLINLNIMPQTPVMIGLTFEVVVMAS
FT                   VLAMRYSDERKAKQKIQQETLEQAERIRETREEALRAEAEANAKLEQMVQERTLELEIT
FT                   LRELNDVNQKLLEQTTLDSLTGVKNRNAFDKRLVAEGRISRRQQTPMAILMLDIDKFKS
FT                   INDEFGHLGGDHCIQSIAKVLTEQLKRPTDLVSRFGGEEFAIILPNTDLDGAMIVAETV
FT                   RASIDELQLVWDEKPMKISASLGVSAAVIESDEHPIELLELADKALYQAKRNGRNRIEQ
FT                   AIIENA"
FT   sig_peptide     complement(525227..525337)
FT                   /locus_tag="Sden_0453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.960 at
FT                   residue 37"
FT   gene            complement(525334..526134)
FT                   /locus_tag="Sden_0454"
FT   CDS_pept        complement(525334..526134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0454"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53746"
FT                   /db_xref="GOA:Q12S30"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S30"
FT                   /protein_id="ABE53746.1"
FT                   /translation="MSRYVDIAVNLLSPSLIEHAENIINDAEKLNVSPLIVIGSDLSES
FT                   LAAYELAQQYPNKLYTTAGVHPHQASGWDEHSPLTLKKLAELNSVVAIGECGLDYNRDF
FT                   SPRDMQRAAFEAQLVLAAELNMPVLMHCREAFDDFIRILTPYRAALPYAVLHCFTGNED
FT                   DLAKCLALDLHIGITGWVCDERRGLELAKLVPSIPDDRLLIETDSPYLLPRSLRPKPKS
FT                   SKNLPQYLPYILDYIATLRGQDSAELAKTCYLNSCTVFGLEPAV"
FT   gene            complement(526135..526644)
FT                   /locus_tag="Sden_0455"
FT   CDS_pept        complement(526135..526644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53747"
FT                   /db_xref="InterPro:IPR016987"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S29"
FT                   /protein_id="ABE53747.1"
FT                   /translation="MRLIWTAATLVLLSAPAFASIETQLANCAAVSDKLARLICYDDLA
FT                   SSTSASSSVSASASMAVAPAVAATNKNETFGLKKTAVKKEDFGLIKKTEIEEIEKLYFT
FT                   VAEFDKDAYGSLTITLNNDQVWKQSGSQRFKLKTGQKIFIERGALGSFLLGSDDRNSTI
FT                   RVKRLK"
FT   sig_peptide     complement(526585..526644)
FT                   /locus_tag="Sden_0455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(526709..527494)
FT                   /locus_tag="Sden_0456"
FT   CDS_pept        complement(526709..527494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0456"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53748"
FT                   /db_xref="GOA:Q12S28"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S28"
FT                   /protein_id="ABE53748.1"
FT                   /translation="MSQQLPLISHLLELRTKLLKAIASVLLVFIASVYWANDIYHYVAI
FT                   PLMESLPENGSMIATDVAAPFFAPFKLTLILSFFLAIPYVLYQIWSFVAPGLYKHEKRL
FT                   VMPLLLSSTLLFYAGIAFAYYIVFPVVFGFFASAAPEGVQVATDISSYLDFILKLFFAF
FT                   GLAFEIPVAVVLLCWAGVTTPEDLQTKRPYIVVGAFVIGMLLTPPDIISQTMLAVPMLL
FT                   LFEAGLFAAKFYRNNADDNQRDTTDIPKDEDSSDKDVTK"
FT   sig_peptide     complement(527384..527494)
FT                   /locus_tag="Sden_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.793) with cleavage site probability 0.785 at
FT                   residue 37"
FT   gene            complement(527498..527896)
FT                   /locus_tag="Sden_0457"
FT   CDS_pept        complement(527498..527896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0457"
FT                   /product="twin-arginine translocation protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53749"
FT                   /db_xref="GOA:Q12S27"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S27"
FT                   /protein_id="ABE53749.1"
FT                   /translation="MFDGIGFMELLLIGILGLVVLGPERLPVAVRSVTGWIRALKRMAN
FT                   SVKDELEQELKIEQLHADLKKAESKGLANLSPELQESIDQLKQAAQSVNRPYQLDESNE
FT                   QEPKIAPPQANIAETPTQSGDTHSKNNG"
FT   gene            complement(527903..528142)
FT                   /locus_tag="Sden_0458"
FT   CDS_pept        complement(527903..528142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0458"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53750"
FT                   /db_xref="GOA:Q12S26"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S26"
FT                   /protein_id="ABE53750.1"
FT                   /translation="MGGISIWQLLIIALIVILLFGTKKLRSLGGDLGGAVKGFKNAMTS
FT                   ETSEEEKKALEDSQTAQTSQQAEKKPESKDKEQA"
FT   gene            complement(528246..529895)
FT                   /locus_tag="Sden_0459"
FT   CDS_pept        complement(528246..529895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0459"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53751"
FT                   /db_xref="GOA:Q12S25"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S25"
FT                   /protein_id="ABE53751.1"
FT                   /translation="MSISSLHRGYQVLRTLLHYGLDELLAKDKRPKLFPLIRGCFFWIR
FT                   NQHKDKSAAERLKLAMQELGPVYIKLGQMLSTRRDLLDDEWAYQLAMLQDRVPPFDSAL
FT                   AREAIETELNASIDSLFDDFDDVPLASASIAQVHSATLKSNGKAVVLKVLRPNVEALIL
FT                   ADLQLMSHCAALLERILGDGNRLRPAEVIEDYRLTILGELNLKLEALNAIKLRNNFLDS
FT                   DALYVPYIYEDLSFTRLIVMERIYGIAVSDLSALKAQGTNLKLLAERGVELFFTQVFRD
FT                   NFFHADMHPGNIFISRDHPDNPYYIGLDCGIMGTLTDVDKRYLAENFLAFFNRDYQRIA
FT                   QLHLESGWVSEHTDIVAFEQAIKIVCEPMFNKPLAEISFGHVLLALFRTARQFNMVVQP
FT                   QLVLLQKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAKQVGPKALFDKFKSNAPFWAE
FT                   KLPELPELVYDNLKLGRKLLGTQQQMLDKYLKYQHKAHKSNYLLITSAVFVICGTILFT
FT                   QAVTLWASLLCLGTGAGLWLLGWQARPKNRKL"
FT   gene            complement(529892..530512)
FT                   /locus_tag="Sden_0460"
FT   CDS_pept        complement(529892..530512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0460"
FT                   /product="protein of unknown function DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53752"
FT                   /db_xref="GOA:Q12S24"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S24"
FT                   /protein_id="ABE53752.1"
FT                   /translation="MQPNHLALLACAAVELGFDKLPPQAKADYAKAKSLHGKVFKLQLT
FT                   QLPFPLHLVFAKQIQVLSHYDAPVHVQLTADVATLYRLTEGASLSELIKQDKLSIDGDT
FT                   QLLQDFSQFLKQIRFDFAEPLSRYLGDAATHKIVTQAKSLHLSAKQICKDTAEHLSQLA
FT                   TEEYGLTPHRGEYHAYRVNVDNIALHTLALEHKIALLREKITP"
FT   gene            complement(530512..531267)
FT                   /locus_tag="Sden_0461"
FT   CDS_pept        complement(530512..531267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0461"
FT                   /product="demethylmenaquinone methyltransferase /
FT                   2-octaprenyl-6-methoxy-1,4-benzoquinone methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53753"
FT                   /db_xref="GOA:Q12S23"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S23"
FT                   /protein_id="ABE53753.1"
FT                   /translation="MSEGDSNKTHFGYKTVEADKKADLVASVFHSVAAKYDIMNDVMSF
FT                   GIHRFWKRFTIETAAARPGMKVLDLAGGTGDLTAKFSHLVGERGQVVLADINDSMLKVG
FT                   RTKLRDKGIVNNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMLRVLKPG
FT                   GKLLVLEFSKPQHEMMRKAYDLYSFKILPKMGEIITKDADSYEYLAESIRMHPDQDTLK
FT                   EMMQTAGFEQVDYTNMTDGIVALHKGYKF"
FT   gene            complement(531373..532389)
FT                   /locus_tag="Sden_0462"
FT   CDS_pept        complement(531373..532389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0462"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53754"
FT                   /db_xref="GOA:Q12S22"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S22"
FT                   /protein_id="ABE53754.1"
FT                   /translation="MFTAFDQHALDALLSPRSGETKLGQTVAILDSALPLEQALSHAKQ
FT                   QGARFAILGISEDLGPRANLGRGGANDAFSAAMSQWLNLQSNRFYTGKNCLILGEITPP
FT                   ALAADASLEQLRQATQTLDEQVIALVSQVFDAGLEPIVIGGGHNNAFGLLMAAKLSLGE
FT                   PLAAVNLDPHSDFRPKEGRHSGNGFSYAAANGALDHYHVLGLHELKNSETTLEQLSLFG
FT                   GKWHTYQQIWVRQELSLSQALKQIAKDLNQTQLAVGLELDVDAINTMPSSASTVAGVPL
FT                   VDALHYVHYIAKHCPTAYFHIAEAAPACHSANLSAGYRDVGQSISELIYAYIQGRCV"
FT   gene            complement(532553..533038)
FT                   /locus_tag="Sden_0463"
FT   CDS_pept        complement(532553..533038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0463"
FT                   /product="Protein of unknown function 1935"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53755"
FT                   /db_xref="GOA:Q12S21"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S21"
FT                   /protein_id="ABE53755.1"
FT                   /translation="MEYNTSELCDMYIDVVDVVEPMFSNYGGCSSFGGAISTVKCFEDN
FT                   GLIADALQEDGEGKVLLVDGGGSLRRALIDASIAQIAVNNNWEGIIVYGSVRDVDALEE
FT                   LDLGIQALASIPVGAEGNGVGEIELPVNFGGVTFLPGDHIYADNTGVILSPEPLDID"
FT   gene            533413..533667
FT                   /locus_tag="Sden_0464"
FT   CDS_pept        533413..533667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53756"
FT                   /db_xref="GOA:Q12S20"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S20"
FT                   /protein_id="ABE53756.1"
FT                   /translation="MENVNWIEILGYVASVMVAISLMMKDIILLRWINFVGCGLFAAYG
FT                   YAIDAWPVAGMNAFVAGINIYHLVKIYRAPKPVKADAEA"
FT   gene            533908..534507
FT                   /locus_tag="Sden_0465"
FT   CDS_pept        533908..534507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0465"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53757"
FT                   /db_xref="GOA:Q12S19"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S19"
FT                   /protein_id="ABE53757.1"
FT                   /translation="MLASLQQINLIFEGCRAANPAPHCSGIDRDGYMWTKLDKWLFCYL
FT                   LHWSREWGLTSLAKRVSRSGDGPIYVGLGVSLLVFHPQGAGFFNQLLWGFAIELPLYLG
FT                   LKHSLRRPRPCHALLELKFSFEPADKFSLPSGHTAAAFMVASFIAVTFPFLNPWVFIWA
FT                   SAIGWSRIALGVHYPLDIIAGMALGLGSASVVLCWL"
FT   gene            534552..535607
FT                   /locus_tag="Sden_0466"
FT   CDS_pept        534552..535607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53758"
FT                   /db_xref="InterPro:IPR005262"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S18"
FT                   /protein_id="ABE53758.1"
FT                   /translation="MRILYGVQGTGNGHISRARVMAKSLKKVGVTVDFLFSGRVAEQYT
FT                   DMSCFADFRVNEGLTFVTEQGKVHLAKTLKQNLASAILREVNELDVSQYDLVLNDFEPI
FT                   SAWAAKRQQVPSIGISHQSALCHKVPKQGVTWLDELLLKHFAPVDMALGCHWHHFACPI
FT                   MPPFVDVQAISHQHGQLILVYLPFEDADEVADFLTPFDDYQFLVYHRAKPIKPLPEHIR
FT                   WYGFSRLGFKAHLAECGGVVANAGFELSSEALTLGKKLMVKPLQGQFEQGANVAALELL
FT                   AAGQSMSVLDTGKLRRWLKAPSPKPINYPRTGDELATWLAQGDWQRPQDLCDSLWSQVE
FT                   LPDNWNYRDDS"
FT   gene            complement(535765..536232)
FT                   /locus_tag="Sden_0467"
FT   CDS_pept        complement(535765..536232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0467"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53759"
FT                   /db_xref="GOA:Q12S17"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S17"
FT                   /protein_id="ABE53759.1"
FT                   /translation="MLTKLEHAEKKWGGSHKLIDQWLNHRRMLLIQYFKIAGLAPYTRP
FT                   DKKLPPFQTVKNFCAQLVDYVSEGHFEVYDQVVTACEEFGESSRAVAQALLPKISDTTD
FT                   MALDFNDKYTEADDEQVLYQLDKDLSKLAQSMETRFELEDELLEILHSRHS"
FT   gene            536786..537850
FT                   /locus_tag="Sden_0468"
FT   CDS_pept        536786..537850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0468"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53760"
FT                   /db_xref="GOA:Q12S16"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S16"
FT                   /protein_id="ABE53760.1"
FT                   /translation="MAELKNDRYLRALLKQPVDATPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCRNAELACEVTLQPLRRYKLDAAILFSDILTVPDAMGLGLYFEEGEGPRFERPTD
FT                   TVDAIKKLCIPDPEDELGYVMRAVSTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKT
FT                   FEKIKKMAYAEPAALHMLLDKLADSVILYLNAQVANGAQSLMIFDSWGGALSHHAYREF
FT                   SLRYMQKIVDGLTRFADGRQVPVTLFTKGGGLWLESMAETGCDALGLDWTVDIGDARRR
FT                   VGDKVALQGNMDPSMLYASPERIHQEVGQILSSYGKGTGHVFNLGHGIHQHVDPEHAGA
FT                   FINSVHELSPQYHK"
FT   gene            538084..539430
FT                   /locus_tag="Sden_0469"
FT   CDS_pept        538084..539430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0469"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53761"
FT                   /db_xref="GOA:Q12S15"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S15"
FT                   /protein_id="ABE53761.1"
FT                   /translation="MPVSMFNSTLNPSLTLASLLLLIPLFSACNSDNKPLAKAAETLTP
FT                   TPPAQSTKLAETMGINAEKPVSVGPRPAFLVNQMQDSELKTRLAQCIGDETYRSDFAIG
FT                   HRGAAMQFPEHTRESYQAAIDTGAGVVECDVTFTSDKVLVCRHSQCDLATTTNILAIPE
FT                   LANKCSVPFSPADAANGVPASAKCCTSDITLADFKRLSGKMDGANPQATTVEAYMQGTP
FT                   DWRTNLYSGSGTLMTHAESIIMFKAAGIKMTPELKSADVVMPFDGFSQQDYAQKMLDEY
FT                   TEAGVAATDVMPQSFNLEDVKYWIANAPEFAAQAVYLDDRYDLADFDPQDSRTWSPSMS
FT                   ELSNAGVKIIAPPLWVLVTLDENNKLVPSEYAKAAKAAELEIISWTLERSGLLKEGGGW
FT                   YYQSVTEAINDEGNALELLHVLTTEVGVIGVFSDWPATVAFYANCMAKS"
FT   sig_peptide     538084..538179
FT                   /locus_tag="Sden_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.805 at
FT                   residue 32"
FT   gene            539772..541763
FT                   /locus_tag="Sden_0470"
FT   CDS_pept        539772..541763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0470"
FT                   /product="TonB-dependent copper receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53762"
FT                   /db_xref="GOA:Q12S14"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S14"
FT                   /protein_id="ABE53762.1"
FT                   /translation="MGKTNFKLSLLAGALVMAMQPSVQAQEQHNCTKDEKCNDYLVVTG
FT                   DVMREPVNVVSDPKKPRLPLPAFEGSGFLKTIPGFSVTRKGGMGGDPSFRGMGGSRLAI
FT                   VDDGQHVYGACGGRMDPPTNYIYPESYDEITVIKGPQTVKYGPVGSAGTVLFEKNRHRF
FT                   TERGIIGRASITGGSFDRKDSIIEFVAGNADYYVDFDMDSSSSDHYKDGNDNPVQSSYD
FT                   RDNIKVALGWTPSENTVIEFAMGQSEGEAEYADRLNKARQIDNESYTLLVQHDFDSELL
FT                   KNVDFQVYSNENDHIMDQFDRGVNMGMDVMRSTSGGHFWLGLTPMMNWDLTLGVDHMQS
FT                   DHQGRGINMMQDKGLDDLLRKPFMKNMEYANWGLFVESVYHLDHSKVFAGMRYDNWDTD
FT                   LYVGQKGNRADDVFSGYARYEYRDGFSQYYAGVGHAERVPDYWEIMKTSASNPMQKSFD
FT                   LEPEETNQLDIGWIYDNGLVFSSSLFYGKLDNYILVDSTGPMTVARNIDATLYGGEASI
FT                   DYDVNEHFSAQVTLSYTLGDNDTDNVDLGQVSPLESKFSLNYQKDAWAAGLLWRVVDSQ
FT                   HRVTIGHGNIVGQDLAESSGFGTVAINASWNYDDHLRLILGVENLFDIAYAEHISKAAG
FT                   GNDLPGSEPMFQVNESGRNFWAKLTYEF"
FT   sig_peptide     539772..539849
FT                   /locus_tag="Sden_0470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(541895..543745)
FT                   /locus_tag="Sden_0471"
FT   CDS_pept        complement(541895..543745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0471"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53763"
FT                   /db_xref="GOA:Q12S13"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S13"
FT                   /protein_id="ABE53763.1"
FT                   /translation="MLKQILTATLISLMPMCLSANDSWQQSSDWQALEQEIDTLRQEQG
FT                   IALASSAADRDGILWQYTKGPINANNNNQIDADSLFRAGSVTKVFTAIGVLQLMEQGKL
FT                   KLDDPVSLHLPNVIIDNPWAETDPVRVKDLLSHTAGFRDAGVTELYVEKADASAPLSQV
FT                   INKYQLQVRWRPGTRQAYSNFGYLIAGHLIEQLSGEPFEARLNHTILQPLKMDSSNFSQ
FT                   QEEVLSTLVAGHGSALTGGKDKVPAMPISVRPAGSLVTSLNDLTRFSRMLLNEGELDGA
FT                   RIISKASFDVMLTSAMDKNSGLHQAAYGLGLYPVSRESGRYFCHSGGIDGFLSNICFSK
FT                   QQNMTFVALSNAMTLSGGQVFNKALPFLAKAQLPEVQPLDFDIKPWLGFYRPQSSRQQS
FT                   MASMDSLMKGSTLSFEEGSLTIKPLFGSADKYVYVAEQGFRPVDKAAVTLTLVLDSQGQ
FT                   PMIQESWETYLPDNSWYASMLNYTFLTFAIILLVTSVSALLLAIYLLIRKSLGKNISSN
FT                   PKLALALLLLPITLFGLYLFFTQLAMWELNHVTFAALILWLLSWSWPVGIAYFSWLVWQ
FT                   ERSKLILKRSKAFWGLALTSQWVMALYLVHFGAYNMMLWS"
FT   sig_peptide     complement(543683..543745)
FT                   /locus_tag="Sden_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.942 at
FT                   residue 21"
FT   gene            complement(543804..544385)
FT                   /locus_tag="Sden_0472"
FT   CDS_pept        complement(543804..544385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53764"
FT                   /db_xref="GOA:Q12S12"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S12"
FT                   /protein_id="ABE53764.1"
FT                   /translation="MNNNGYFNCPHTNSLWQDYFAKVDKELTKAPYSLAMTLRQELESH
FT                   AFEAAEASAGESELHKLTHALNELGEPSRIVPPLLSASFVSNAQDSGTPMAMSRALIYQ
FT                   SGRSLKKTLLAILIGFIAILALPLAALAILKPFFYDNIGFFTKDGGTMMGFFVNTDGWE
FT                   EHLGYGFIPVALIASFVLYKIAMVMLKLIK"
FT   gene            complement(544388..544717)
FT                   /locus_tag="Sden_0473"
FT   CDS_pept        complement(544388..544717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0473"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53765"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S11"
FT                   /protein_id="ABE53765.1"
FT                   /translation="MAIERWQKQMRKGLLEFLVLLCLKDNEYYGYSLLVKLKALADIDL
FT                   AEGTIYPLLSRLNKEELIDFRWEIMPSGPARKYYQITPLGLETVNEMNTAWQQINASVN
FT                   QAWSK"
FT   gene            complement(544986..547073)
FT                   /locus_tag="Sden_0474"
FT   CDS_pept        complement(544986..547073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0474"
FT                   /product="colicin V processing peptidase. Cysteine
FT                   peptidase. MEROPS family C39"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53766"
FT                   /db_xref="GOA:Q12S10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S10"
FT                   /protein_id="ABE53766.1"
FT                   /translation="MFALFPQKKCPFIFQSENSECGLACLAMISSFYQRKTDLMTLRKQ
FT                   LGYSESGMSVRTLCEYAEQINLDSRPLQVDVHEIDQLRLPCVLHWDLNHFVVLTQCSKK
FT                   SVTIHDPAIGKVTYSIEKFKQHYTGIAVELFPAINFKKENRDTGLKLSPFWQASVGLKA
FT                   GLFKIFIASVLLQLFSLASPYYMQLVIDDVIVNQDSELLTLLFIAFSMLALVSLVTSIL
FT                   RDLIGLHIQNHLNIQWSSGLFSHLVRLPISWFEKRHIGDIVSRFGSQGEIQSFITSTFV
FT                   SVVLDGLMVTTTLIMMYIYSPKLTIIAIIAVLIYACLRWIFYRPFRRNAEEVITASAKE
FT                   DSFFLEGIRSIQAIRLHGHEDKRKNEWLSLHSNVVNLGIKGSLWSLGFSSVNTIVFAIE
FT                   NMCVIYFAANFVMEGVFSIGMMMAFMSYKGQFSSRINSLIDSFVSFKMLDIHLSRLSDI
FT                   ALEPQEAHRKGLGLAENIVGCITLENISFRYGLKSKILFDNVNLTLKFGDNIAITGVSG
FT                   SGKTTLLKIILGLLEPTSGRILFDGVDIKKIGLVQYRKLIGSVMQNDSLLSGTLADNIS
FT                   FFDEAYNPLKIEQSCKLASIHDDIEALPMGYQTLIGDMGVQLSGGQVQRVLLARALYLE
FT                   PCVLVLDEATSNLDIDNEQRINSGISSLPVTRILVTHRQSTLEYVDKVYNLTTQGLEPV
FT                   S"
FT   gene            complement(547127..547555)
FT                   /locus_tag="Sden_0475"
FT   CDS_pept        complement(547127..547555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53767"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S09"
FT                   /protein_id="ABE53767.1"
FT                   /translation="MLLVICTFFITTLKKESKMRALKTSEMEIATGGGSRANDALLGAA
FT                   GTALGGGSCGLQGAAAGALAGAAMGPLFGNFIGQAVSGACSNGYTRVPLSGGGTAEGRS
FT                   GGSAGYWPSSGGAGGRGSGGLGAFGGRIHKGNATFSME"
FT   gene            complement(547921..549162)
FT                   /locus_tag="Sden_0476"
FT   CDS_pept        complement(547921..549162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0476"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53768"
FT                   /db_xref="GOA:Q12S08"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S08"
FT                   /protein_id="ABE53768.1"
FT                   /translation="MSDLFRKQVLEKNKTTYYGKAVVAVPVHYSIILFFLSITVISILA
FT                   FLFYSDYAKKEKVKGYLVPTNGLARVYSHTSGVVSQIAVKEGDIVTKGDTLLSVSNDKF
FT                   LQNSLSSDQEKIKQIDKQINLVKGQLAQYDSLFKERALRLNRIIHFLKKEQIELALQGS
FT                   LLRDRVQLAKDRLDNIKTLQIDNFASQSEVKTQLDLVLDFQQRTQEHNTIVLKSETNLA
FT                   NALNDKARLPFEKQQQVDQLNIELSKLANNKTAILENNNLVLKAPITGTVSSIKFNIGE
FT                   FASSGDYLVIIIPSDSELEAEVFVPTRAIAFIKEGDEVNIKLDAFPFQKFGVTHGEVSH
FT                   VAKNIIFSAETTSKLSFNEPVYKIKVRLAQQYIKTYGNKTALIPGMLLQADINTGKRTL
FT                   IEWLLEPLFIINGY"
FT   gene            complement(549598..550722)
FT                   /locus_tag="Sden_0477"
FT   CDS_pept        complement(549598..550722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0477"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53769"
FT                   /db_xref="GOA:Q12Q18"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q12Q18"
FT                   /protein_id="ABE53769.1"
FT                   /translation="MYIESFKQHFSAIDDHRQSAKVTYPLFDVLFGSLCAVIASSNGWF
FT                   EIREYILGHHSWFKKQKMFIDGIPADDTIARIVSMIEPDSFNACFLAWMKSVHQLTNGE
FT                   VIAIDGKTLRGSYNRDDRSSTIHMISAYASANKLVLGQLKAEQKSNEITAIPTLLKMLD
FT                   LRGALVTIDAMGCQTAIATTIIDKGGDYLLAVKNNQGNLAKAINKAFSSHRSAGLSDDH
FT                   VNIEKSHGRIENRACFVLSSAELDGDFTHWEALKSIVMVESFRAVKGKTASLEYRYYIS
FT                   SKVLSAEQALSATREHWGIESMHWVLDVSMNEDECQIYKNNGAENLAYLRHMSLNMLQK
FT                   EPTKLSIVGKRKRCLMNPAFLEKVLIAGLCAPTK"
FT   gene            complement(550984..551904)
FT                   /locus_tag="Sden_0478"
FT   CDS_pept        complement(550984..551904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0478"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53770"
FT                   /db_xref="GOA:Q12S06"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S06"
FT                   /protein_id="ABE53770.1"
FT                   /translation="MPMYVVGHKIPDSDSICGAIALAYLKNQIDEPAIAARLGELSPET
FT                   AFILERFGFEAPLFKESYAGEEVYIVDHSELTQAPDDIAEATIVGIVDHHKLGDLTTST
FT                   PLECWIRPVGCSNTVIKMMYDFYKVDIPADIAGIMMCAILSDTVIFKSPTCTTADIRCV
FT                   EALAEIAGIEDFKALGMEMFKVKSAVEGTPARDLVMRDFKDFNMNGNLVGIGQLEVIDL
FT                   AVFDAIKADLEADIKALKQEGKRHSVLLLLTDIMKEGSEMLVISDDSELTKKAYGKATV
FT                   DGKVWLDGVLSRKKQVVPQLQKAFA"
FT   gene            complement(552022..552486)
FT                   /locus_tag="Sden_0479"
FT   CDS_pept        complement(552022..552486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0479"
FT                   /product="conserved hypothetical protein 22"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53771"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S05"
FT                   /protein_id="ABE53771.1"
FT                   /translation="MIVDTLANHHLYHGLHPRLEVALNHIASTDFSPLPVGNYPIDGDN
FT                   IFVIVNDYHTKPRQVEPFEVHQKYIDVQFVVSGEEEFGYLPLADQTPSKPYYEKHDYAE
FT                   FDYESNKANAAFIPLKTGMFALFFPGDMHMPGTSSEPALVRKVVIKVKID"
FT   gene            552795..553844
FT                   /locus_tag="Sden_0480"
FT   CDS_pept        552795..553844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53772"
FT                   /db_xref="GOA:Q12S04"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S04"
FT                   /protein_id="ABE53772.1"
FT                   /translation="MSALRLIAGPTAFKAISEHGLNPELFSQILAASGGPKWLSIAGLD
FT                   KYLFSEFFKDRTTPLYTLGASSGAWRLACFAQEDPLAAYQRLEKFYIGQRYENRPSPIA
FT                   VTEQVQDVIRAILGPKAGQDIVDNRVIRSHFVVCRARHLNRSNHRLALAAGLATTAMTN
FT                   MFSRRSLGWHFERVVLGHQDPHSPFGALKDLPTHQALLNKQNLSQALLASGSIPLLLAP
FT                   VKQIQGLAAGHYYDGGLTDYHFDLKLPKGLTLYPHFYPHMSPGWFDKSLGWRKAKANYH
FT                   NALILAPSSEHIANLPFGKIPDREDFSTMSSASRMTYWREAVKWSESLADEFAKLVASG
FT                   NIMQKLERL"
FT   gene            553997..554575
FT                   /locus_tag="Sden_0481"
FT   CDS_pept        553997..554575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0481"
FT                   /product="ATP-dependent protease La (LON) domain protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53773"
FT                   /db_xref="GOA:Q12S03"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S03"
FT                   /protein_id="ABE53773.1"
FT                   /translation="MKTTEMALLVQDAVLLPDGRIEVRIASPSQLSMIANVFKGQYPLA
FT                   FAAAKAHSPLPCYVTATQCDIIDFNQLEDDSLSIVLEGRQRVKILSAAQQRNQIWIART
FT                   LPCANWRNEPIAGEFEIISAALEQFYEVNPDLLGLYSQTHLEDATWVSQRWLEVLPMYN
FT                   KDKLILVEQPNCHKTMNFVLQLLKSHVGA"
FT   gene            554658..555596
FT                   /locus_tag="Sden_0482"
FT   CDS_pept        554658..555596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0482"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53774"
FT                   /db_xref="GOA:Q12S02"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S02"
FT                   /protein_id="ABE53774.1"
FT                   /translation="MPTLTMTNNAARAAQPSYVVLPKNELAPATVADFLMQHFSQIAPQ
FT                   VWRQRLSEGKVHWKDGELINEHTAYRPMARVYYYREVALETKVPFDEVILHQDEHAIIA
FT                   YKPHFLPVTPSGNYVNECLVHRLRIKTGIDTIAPAHRLDKDTAGIVLLTLNPEVRHQYH
FT                   NLFTQGQISKHYHALAKLTPEIHAAHQGGGLRLPLTWTVKNRLGPATPSFLMQLVEGEA
FT                   NSHSEIQLIAIKEDMGLFALSPITGKTHQLRVHMQSLGVPILNDRFYPQLQPKGVDNFD
FT                   KPLKLLAQRLKFVDPISGIERDIQCQGFSLD"
FT   gene            complement(555602..556510)
FT                   /locus_tag="Sden_0483"
FT   CDS_pept        complement(555602..556510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0483"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53775"
FT                   /db_xref="GOA:Q12S01"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12S01"
FT                   /protein_id="ABE53775.1"
FT                   /translation="MTGMTFGRNMTAQTQQSIMAKLALYAQLSRIDRPIGTLLLLWPCL
FT                   MALLFAAKGMPDIKVLLIFILGVVIMRACGCIINDYADRNLDAHVERTKQRPLASGAIS
FT                   SKEALSLFALLGLLAFALVLLLNPLVVKLSVVGIVLTIMYPFMKRVTNMPQMFLGIVWS
FT                   WSIPMAYAAQLGEVPVEAWWLFAANWCWTVAYDTMYAMIDRDDDLKVGIKSSAILFGRF
FT                   DRQWIAVFQLMAFGCFLMAGLSAEREFIYALGLLGFIAFSVYQQRLIFSRERPACFKAF
FT                   LNNNWVGMLLFLTLAADYLLY"
FT   gene            complement(556553..558721)
FT                   /locus_tag="Sden_0484"
FT   CDS_pept        complement(556553..558721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0484"
FT                   /product="ATP-dependent DNA helicase UvrD"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53776"
FT                   /db_xref="GOA:Q12S00"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q12S00"
FT                   /protein_id="ABE53776.1"
FT                   /translation="MDVSRLLDGLNDEQREAVGAPLSNMLVLAGAGSGKTRVLTHRIAW
FT                   LMQVEQQSPYSILAVTFTNKAAAEMRERVEKVAGSNMGRMWIGTFHGLAHRLLRTHFQD
FT                   ANLPQSFQIIDSDDQLRLLKRILKSLNLDEKQYPPRQAQGYINGKKDQGLRPKHIDAGG
FT                   FPIEQNLLNIYKVYQESCDRAGLVDFAEILLRAHELWLNKPHLLAHYQERFKHILVDEF
FT                   QDTNAIQYAWIRVLAGNSANVMIVGDDDQSIYGWRGAQVENLHKFLQDFPGSSTIRLEQ
FT                   NYRSSANILNASNELIANNPDRLGKKLWTEDKDGEPISIYCAFNEMDEARYIVSRIQDW
FT                   QEKGGALTDCAILYRSNAQSRVLEEAFLHKGMAYRIYGGLRFFERQEIKDAMGYMRLIN
FT                   NHNDDAAFERIVNTPTRGIGDRTLDIMRTTARQHQLTLWQASLRLLEEKVLAGRAANAV
FT                   RGFMDLIVDLKVDTEAMQLFTMVDTVVNTSGLRSMYQAEKGEKAQSRIENLNELVTAAR
FT                   SFEMPEELEDMGELNAFLSHAALEAGEGQADAFTDAVQLMTLHSAKGLEFPMVFMAGVE
FT                   EGIFPSKMALDEGDRLDEERRLCYVGMTRAMEKLTISYAESRRIYGREDYASPSRFIGE
FT                   IPAKYVEEIRLRAKVTTPTMSSKISKPRATIAQDTGFKIGQTVKHFKFGQGDITSFEGM
FT                   GDKARVQVNFTDVGSKWLLVTLAKLEAC"
FT   gene            complement(558779..559054)
FT                   /locus_tag="Sden_0485"
FT   CDS_pept        complement(558779..559054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0485"
FT                   /product="Phosphotransferase system, HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53777"
FT                   /db_xref="GOA:Q12RZ9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ9"
FT                   /protein_id="ABE53777.1"
FT                   /translation="MPRLERKITIVNKLGLHARAATKLAVLASEFEAEISLFQGDKQAS
FT                   AASVLGLLMLESAMGKEITIVAQGKDAQAALDAICSLINSKFDEAS"
FT   gene            complement(559076..559930)
FT                   /locus_tag="Sden_0486"
FT   CDS_pept        complement(559076..559930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0486"
FT                   /product="Uncharacterised P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53778"
FT                   /db_xref="GOA:Q12RZ8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RZ8"
FT                   /protein_id="ABE53778.1"
FT                   /translation="MKLVIVSGRSGSGKSVALRVLEDLGYYCVDNLPLPLIGSLLAQLK
FT                   SSNDLVAISVDVRNIAEQGKVLEQQLALLPPETEISSFFLNSSDKVLLKRFSETRRLHP
FT                   LSRSQMSLQEAIKLEGRLLEPIAKMVDHHIDTSLLNVYELSDQVRQILLGSVDKELVIN
FT                   IESFGFKHGMPTEADFMFDVRFLPNPHWETELRPLTGLDVPVQEFLARQPLVHKLIWQI
FT                   ENLFETWMPHLERNNRSYLTIAIGCTGGQHRSVYIADQLAKRFANGKHVVNARHRELGD
FT                   VKA"
FT   gene            complement(559927..560370)
FT                   /locus_tag="Sden_0487"
FT   CDS_pept        complement(559927..560370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0487"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53779"
FT                   /db_xref="GOA:Q12RZ7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ7"
FT                   /protein_id="ABE53779.1"
FT                   /translation="MELCSILQPECTTCATPGSKKKVLELISELVAAQYPPLSAQAVFE
FT                   SLVAREKMGSTGIGNGIAIPHGRLDNITQPIGVFIKCDEAIAFDAIDKQPVDLLFALLV
FT                   PEDQCKQHLSTLAAMAEKLSDKHILKQLRKTQDAAELYQVITQ"
FT   gene            complement(560373..560660)
FT                   /locus_tag="Sden_0488"
FT   CDS_pept        complement(560373..560660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0488"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53780"
FT                   /db_xref="GOA:Q12RZ6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ6"
FT                   /protein_id="ABE53780.1"
FT                   /translation="MQINVTGHHIEITESLREYISGKFSKLERHYDQINNVHVVLNVEK
FT                   LQQIAEARISLSGTEVFATSEHADMYAAIDILIDKLDRQVIKHKEKLTKH"
FT   gene            complement(560687..562168)
FT                   /locus_tag="Sden_0489"
FT   CDS_pept        complement(560687..562168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0489"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53781"
FT                   /db_xref="GOA:Q12RZ5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ5"
FT                   /protein_id="ABE53781.1"
FT                   /translation="MKASLQLKMGQHLTMTPQLQQAIRLLQLSSLELQQEIQQALESNP
FT                   LLELEDEFSQEKPPKKDDIQGDTDFSDNSQVSVEKDTSSVDTAESLTKESMPDELPMDT
FT                   TWDEVFTAAPNSGSASGGSFDDMPFQGETTEGLYEHLEWQKNLTPFSETDRAIATAIID
FT                   AIDERGYLTQSTQDILEAMGNSDVELDEVEAVLKRVQHFDPVGIAARDLRECLLIQLAQ
FT                   YAADVPHLNNARMLIDEYLDLIAGRDFRLLMRKTRLKEDELRDAIALIQSLNPRPGLIV
FT                   AHNEDEYVIPDVTVLKKNGRWMVELNPDCMPKISVNQQYAAMARSSKSQVDSQFIRGNL
FT                   QEAKWFIKSLESRNDTLLKVANCIVQYQQGFFEFGEEAMKPMVLNDIAEAVEMHESTIS
FT                   RVTTQKYMHTPKGLFELKYFFSSHVSTDDGGECSSTAIRAFIKKLVAAENQKKPLSDSK
FT                   MAQLLAEQGINVARRTIAKYREAMLIPPSNQRKSL"
FT   gene            complement(562255..562986)
FT                   /locus_tag="Sden_0490"
FT   CDS_pept        complement(562255..562986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0490"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53782"
FT                   /db_xref="GOA:Q12RZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ4"
FT                   /protein_id="ABE53782.1"
FT                   /translation="MIQSKLTAENLAKSYKNRQVVKDVSLSVSTGQIVGLLGPNGAGKT
FT                   TTFYMVVGLVKSDKGRILIDDDDLTGDPMHLRARKGIGYLPQEASIFRKLTVRDNIMAV
FT                   LQTRKSLSNDEREEQLEHLLEEFHITHIRDSQGMSLSGGERRRVEIARALAADPQFILL
FT                   DEPFAGVDPISVIDIKKIIQQLKSRGLGVLITDHNVRETLDVCERAYIVSHGNLIAEGT
FT                   PAEILDNQQVRAVYLGEQFKL"
FT   gene            complement(562983..563537)
FT                   /locus_tag="Sden_0491"
FT   CDS_pept        complement(562983..563537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0491"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53783"
FT                   /db_xref="GOA:Q12RZ3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ3"
FT                   /protein_id="ABE53783.1"
FT                   /translation="MKQSNILLIGLLMATCHSVHAKQGDLQQELKVEAVSQKADIKNNQ
FT                   IIFFGPVKVVQGSINIHADELRAFSTAKSPSKVMLAIGNPATFSQELDDGSTGTASAKE
FT                   IRYDLASRTLTLTGEAKLDQAGNQVTGNSIRYNIKDQQLIAESTGKGQDRVITIIQPEN
FT                   YQDSNIKPSLPEIPVKKQDEQ"
FT   sig_peptide     complement(563472..563537)
FT                   /locus_tag="Sden_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(563524..564084)
FT                   /locus_tag="Sden_0492"
FT   CDS_pept        complement(563524..564084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0492"
FT                   /product="protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53784"
FT                   /db_xref="GOA:Q12RZ2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ2"
FT                   /protein_id="ABE53784.1"
FT                   /translation="MNRVTLAIIAFFSASLFLYWQVQVKRNAMEQIQVDVIERPAFIAD
FT                   ELRSAEFDKQGLLVSKVTATHMEHYESTQVTHFTEPVYLVYPESGKAQWQLQANKGRLN
FT                   KQTGKMLLENNVIIDAINIEEPVQSISTQSLAFDMNTMIMTSDDMLYVKGKDFIIQGLG
FT                   LYADLEAEELTLLSQVEGTYEAK"
FT   sig_peptide     complement(564028..564084)
FT                   /locus_tag="Sden_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.711) with cleavage site probability 0.577 at
FT                   residue 19"
FT   gene            complement(564081..564632)
FT                   /locus_tag="Sden_0493"
FT   CDS_pept        complement(564081..564632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0493"
FT                   /product="Phosphatase kdsC"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53785"
FT                   /db_xref="GOA:Q12RZ1"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ1"
FT                   /protein_id="ABE53785.1"
FT                   /translation="MAQQGLYGPVSDLVWNKAQKIKLLICDVDGVFSDGRIYMGNNGEE
FT                   LKAFHTRDGYGVRSLLTSGFAVAVITGRKSKIVENRMTALGISQIYQGIDDKFVPFNAL
FT                   MQHYQVSPEEVAYIGDDMVDLPVMKAVGLAVCVADGHPYVKQHAHMVTQINGGHGALRE
FT                   LADLLLLSQDKFNSAHGMSI"
FT   gene            complement(564634..565611)
FT                   /locus_tag="Sden_0494"
FT   CDS_pept        complement(564634..565611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0494"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53786"
FT                   /db_xref="GOA:Q12RZ0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RZ0"
FT                   /protein_id="ABE53786.1"
FT                   /translation="MVNQNQWRQWGCKVIDIEKAALEHLYQFVDSDAFSQACELILQCK
FT                   GKVIVMGMGKSGHIGNKISATLASTGTPAFFVHPGEASHGDLGALAKEDIILAISNSGE
FT                   SSEILTLLPVIQRMGVPVIAITGKPESNMAKLAKIHLCIQVPEEACPLGLAPTSSTTAT
FT                   LVMGDALAVALLQAKGFTQDDFALSHPGGSLGRKLLLKVSDVMHQDDRLPCVPHDICIT
FT                   EALYEISKKGLGMTAVVDANQCLVGIFTDGDLRRVIDAEVNLRTTPIEQVMTKNCVTTT
FT                   AGILAAQALQVMESKNINGLIVVNEQQQPIGALNMLDMVKAGVI"
FT   gene            complement(565676..566638)
FT                   /locus_tag="Sden_0495"
FT   CDS_pept        complement(565676..566638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0495"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53787"
FT                   /db_xref="GOA:Q12RY9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY9"
FT                   /protein_id="ABE53787.1"
FT                   /translation="MLVNILYLVVGLAVLVWSADRFVYGAAAFARNLGLPPMLIGLTIV
FT                   AMGSSAPEMFVAATASMEGMSDTAIGNVLGSNVANITLILGITALLGALSVTSETLKRE
FT                   IPLMIAATVLAGFLLHDGVLSRIDGLILLGAFFALMGYLIYQALSNKSADAFIDESDAE
FT                   IPKGVPTLRAVFWIVVGMVLLPLSADWMVDGAVGIAKTFGLSDLVIGLTIIAVGTSLPE
FT                   LAACVAGVMKKEHDLAIGNIVGSNVFNILAVMALPGLIAPGEVDAQASSRDFYMVLATS
FT                   CALAILVLSSGAKKQLTRWHGVLLLLTFIAYQIVIFSSN"
FT   gene            566822..567643
FT                   /locus_tag="Sden_0496"
FT   CDS_pept        566822..567643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0496"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53788"
FT                   /db_xref="GOA:Q12RY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY8"
FT                   /protein_id="ABE53788.1"
FT                   /translation="MSELTMPNKPTSLVEIKNLSFSRGSRVIYEDISLSIPQGKVTAIM
FT                   GPSGIGKTTLLKLIGGQLTPDSGQVLFDGHDVHQLSRSELFNLRKRMSMLFQSGALFTD
FT                   MNVFDNVAFALREHSGLPEAIIHKIVIMKLQAVGLRGAAYMMPNELSGGMQRRAALARA
FT                   IALEPEMVMYDEPFAGQDPISMGMLVKLIRQLSDSLKLTSIVVSHDVTEVLGIADYVYV
FT                   VADKRVVAHGTPEQLKQSDNPQLVQFIQGAPDGPVPFHYPAGNYQQELMRG"
FT   gene            567636..568433
FT                   /locus_tag="Sden_0497"
FT   CDS_pept        567636..568433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0497"
FT                   /product="protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53789"
FT                   /db_xref="GOA:Q12RY7"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY7"
FT                   /protein_id="ABE53789.1"
FT                   /translation="MDKMSQLLNQIALVGQSAIAFMRGFGKAGLMLWGALFHIPNVRKG
FT                   GPLLLKQIYVLGVRSMIIIIVSGLFIGMVMALQGYNVLVGFGTEESLGPMVALSLLREM
FT                   GPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQVIAPRFWAGVISMPLL
FT                   AVMFSLVGIYGGHLVGVEWKGIDSGTFWSILQASIEWRQDIVNCLIKSTVFAVVVTWIA
FT                   LYRGYEVNPNPEGISRATTSTVVQASLAVLGLDFLLTAIMFGQ"
FT   gene            568521..568994
FT                   /locus_tag="Sden_0498"
FT   CDS_pept        568521..568994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0498"
FT                   /product="Mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53790"
FT                   /db_xref="GOA:Q12RY6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY6"
FT                   /protein_id="ABE53790.1"
FT                   /translation="MLTRKIELLVGMFLLSGLVAFCLLVFSVANVKINADDNSYVLVAE
FT                   FNNIGGLKVRSPVKVGGVVVGRVTDISLDSDKLVPIVTLAMDKRFNQFPETSSLSIQTA
FT                   GLLGEQFLGLTPGFVDDDIAMLGDGDKIQDTRSALILEDLIGQLLYSMSSKDK"
FT   sig_peptide     568521..568604
FT                   /locus_tag="Sden_0498"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.557 at
FT                   residue 28"
FT   gene            569006..569659
FT                   /locus_tag="Sden_0499"
FT   CDS_pept        569006..569659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0499"
FT                   /product="toluene tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53791"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY5"
FT                   /protein_id="ABE53791.1"
FT                   /translation="MKTRLGGFFTGLIMLLGVQSFAMAEEVNTTDPYLLIEQAANITFA
FT                   RFRADKALIDADLNHLKVIVKEELMPYVDYKYAAYKVMGQYLRDTSVDQRERFVTAFEG
FT                   YLVATYAQAFTQYTDQKVLYDPGTDFSKEKMVEVNVQIIEEGRPPIKILFKVRRLKDDS
FT                   WKAFDLIAEGISLLASKQSEISNLIRKDGIDAVIVLLNEKTKEKIDRKAGADAA"
FT   sig_peptide     569006..569080
FT                   /locus_tag="Sden_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.954 at
FT                   residue 25"
FT   gene            569656..569952
FT                   /locus_tag="Sden_0500"
FT   CDS_pept        569656..569952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0500"
FT                   /product="SpoIIAA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53792"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY4"
FT                   /protein_id="ABE53792.1"
FT                   /translation="MIEFTQQGDACAIQGSLGQQQVIELWPKRRKLFNSDTQALDVSGI
FT                   TYVDSAGVALLLELARLSHKGSPKRKMPRMLTNPSKHLSKMIELYDLEVFVQP"
FT   gene            570014..570265
FT                   /locus_tag="Sden_0501"
FT   CDS_pept        570014..570265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0501"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53793"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY3"
FT                   /protein_id="ABE53793.1"
FT                   /translation="MDCKQIEQILIDALGLEEAHASADGSHYKVVAVGECFDGMSRVKQ
FT                   QQAIYGPLNEYIASGELHALTIKTFTPTQWKREKIFNM"
FT   gene            570281..571540
FT                   /locus_tag="Sden_0502"
FT   CDS_pept        570281..571540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0502"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53794"
FT                   /db_xref="GOA:Q12RY2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RY2"
FT                   /protein_id="ABE53794.1"
FT                   /translation="MDKLTIQASKPLTGSVVISGAKNAALPILMAGVLAETDFVLSNVP
FT                   ELRDVSTSCKLLRCLGAEVDELGGGRIRISTTNLNEFCAPYDLVKTMRASILILGPLLA
FT                   RFGTADVSLPGGCAIGARPVNLHLHGLEQMGAKIEVKEGYIKARVDGRLKGAHIFMDMI
FT                   SVGATENLLMAAALADGITIIENAAQEPEVTDLAHCLIAMGAKITGVGTATLKIEGVER
FT                   LQGCEYRVMPDRIETGTFLVAAAVTRGRIRCENADPASMEAVLAKLEDAGATVTSGEDW
FT                   IELDMHGKQPKAVNIKTAPYPAFPTDMQAQFCVLNALAQGTGRVTETIFENRFMHVPEL
FT                   IRMGANMELEGHTCIIQGIDKLNGAQVMATDLRASASLVIAGLMAEGTTLVDRIYHLDR
FT                   GYEHIESKFQGLGAEVIRVK"
FT   gene            complement(571655..572731)
FT                   /locus_tag="Sden_0503"
FT   CDS_pept        complement(571655..572731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0503"
FT                   /product="Peptidase S1C, DegS"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53795"
FT                   /db_xref="GOA:Q12RY1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY1"
FT                   /protein_id="ABE53795.1"
FT                   /translation="MNIKALLLYLTKAVLFGLVMAAVFLGATSIINGDGFGSNLTGNNH
FT                   SSKTLSFAAAVRKAAPAVVNIYSLSIAEDQPLNSGSLQGLGSGVIMSKEGYILTNYHVI
FT                   KKADEIVVALQDGRKYTSEVVGSDPETDLTVLKIDGDNLPVVPLNLLTPVQVGDVVLAI
FT                   GNPYNIGQTITQGIISATGRNGLSSGYLDFLQTDAAINAGNSGGALIDTDGELVGINTA
FT                   AFQVGGEASGNGISFAIPIKLAHSIMGKLIKNGRVIRGAIGVSGEALSPVLAQILNLPN
FT                   QKGVVVTGVDPTGPAARAQLRARDVIIAYENEEVPGVEMLMDRIAETPPDSRVTLTIIR
FT                   EGKVQALPVVIAEKPLPE"
FT   sig_peptide     complement(572666..572731)
FT                   /locus_tag="Sden_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.479 at
FT                   residue 22"
FT   gene            complement(572895..574256)
FT                   /locus_tag="Sden_0504"
FT   CDS_pept        complement(572895..574256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0504"
FT                   /product="peptidase Do. Serine peptidase. MEROPS family
FT                   S01B"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53796"
FT                   /db_xref="GOA:Q12RY0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RY0"
FT                   /protein_id="ABE53796.1"
FT                   /translation="MRTKLTLLSAALLTASLSSPFIPVSASAAIPQSVNGQMLPSLAPM
FT                   LEKTTPAVVSVAVSGTHVSKQRVPDIFRHFFGPNGPQEQTQERPFRGLGSGVIIDANKG
FT                   YIVTNNHVINGADDIQIGLYDGREVKAKLIGTDPESDIALLQIEAKNLTAIKQTDSEEI
FT                   RVGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEQLENFIQTDAAINSGNSGGALVNL
FT                   NGELMGINTAIVAPGGGNVGIGFAIPANMVNNLVAQIIEHGEVRRGVLGISGRDLDREL
FT                   AKGFGLDTQHGGFINEVMSGSAAEKAGLKAGDIITSVNGKKIKTFQELRAKVATLGAGA
FT                   KVDLGIIRDNKTKSITVVLGEADATVSSEAGGIHPMLQGANLENSKKSGIVITEVAQGS
FT                   PAAMNGLKKGDVIVGINRDRISDLKTLKEQLKDPKGSVALKILRDGSLLYLILR"
FT   sig_peptide     complement(574170..574256)
FT                   /locus_tag="Sden_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            574564..575676
FT                   /locus_tag="Sden_0505"
FT   CDS_pept        574564..575676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0505"
FT                   /product="AFG1-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53797"
FT                   /db_xref="GOA:Q12RX9"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RX9"
FT                   /protein_id="ABE53797.1"
FT                   /translation="MSQLSPWQHYQQDLKRDDFSHDLAQEQAVTALQRVYEELIAATKP
FT                   ASGIAALLKAVTGKNKRASVQGLYLWGGVGRGKTYLMDTFFDALPTEDKLRAHFHRFMH
FT                   QLHHDLGELKGVQDPLLTIAKKMAKQYQVICFDEFFVSDITDAMLLGTLFQALFKEGVV
FT                   LVATSNIIPDELYKNGLQRARFLPAIALINQHCQILNVDSGIDYRLRTLEQAEIYHHPL
FT                   DAQADVNLLQYFKQLAPESEVFTHALDIDGRKIAIRQQSQGVLLVDFRALCDGPRSQRD
FT                   YMEIARLYHTVLLSGLVQMGAQQTGDDIARRFLAVVDEFYERNVKLIISAQVSLEQIYT
FT                   QGQLDFEFRRCRSRLIEMQSHDYLALEHLP"
FT   gene            575953..576381
FT                   /locus_tag="Sden_0506"
FT   CDS_pept        575953..576381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0506"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53798"
FT                   /db_xref="GOA:Q12RX8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RX8"
FT                   /protein_id="ABE53798.1"
FT                   /translation="MKTFTATPETVTRDWFVVDAEGKTLGRIATEIAIRLRGKHKPEYT
FT                   PHVDTGDYIIVINAEKVTVTGNKAAGKIYYSHSGFPGGIKQISFEKLQAQKPEMIIEKA
FT                   VKGMLPKGPLGRAMFRKLKVYAGVEHNHAAQQPQVLDI"
FT   gene            576396..576788
FT                   /locus_tag="Sden_0507"
FT   CDS_pept        576396..576788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0507"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53799"
FT                   /db_xref="GOA:Q12RX7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RX7"
FT                   /protein_id="ABE53799.1"
FT                   /translation="MSATQYYGTGRRKTSTARVFAKAGSGNIVVNQRPLDVYFGRETAR
FT                   MVVRQPLELVEMTDKLDIYVTVKGGGTTGQAGAIRHGITRALLQLDEALRPTLRSAGFV
FT                   TRDARKVERKKVGLRKARRKPQFSKR"
FT   gene            576795..577067
FT                   /locus_tag="Sden_0508"
FT   CDS_pept        576795..577067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53800"
FT                   /db_xref="GOA:Q12RX6"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RX6"
FT                   /protein_id="ABE53800.1"
FT                   /translation="MECKKTQLMLGFLLPEICKMSQGNKEIDMEFKILMLALGLVLVLE
FT                   GIGPLLFPNKWRRYLKEVSEQNQDVLRRLGGALVTAGLVLLVIFS"
FT   gene            577135..578430
FT                   /locus_tag="Sden_0509"
FT   CDS_pept        577135..578430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0509"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53801"
FT                   /db_xref="GOA:Q12RX5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RX5"
FT                   /protein_id="ABE53801.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLV
FT                   INGDKTVLHLIPSGILRDNVKCIIGNGVVVAPDALLKEINMLKERGVPVEERLLISEAC
FT                   PLILPFHCALDIAREKARGNKAIGTTGRGIGPAYEDKVSRRGLRIGDLFNAELFATKLA
FT                   EVMKYHNFMLTEYYKVEAVDYQKTLDDALAIADYLKSMCTDVTELLDTARKAGEPIMFE
FT                   GAQGTLLDIDHGTYPFVTSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPT
FT                   ELSCEIGDYIGHKGQEFGATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLE
FT                   EVKICVGYQYPDGTVETVTPLAAEGYEEVTPVYETMPGWSDITFGATSIEQLPAAAIAY
FT                   IKRIEELLETPIDIISTGPDRNETMILVNPFN"
FT   gene            578546..579163
FT                   /locus_tag="Sden_0510"
FT   CDS_pept        578546..579163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0510"
FT                   /product="Sel1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53802"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RX4"
FT                   /protein_id="ABE53802.1"
FT                   /translation="MLRLSLLLLCLLQSSAMAESLAVDIYSNEQLIKLLRDGTYLHRVK
FT                   ADECQLVQDIEARAEVLQQPLYQFLWGEMLNQGVCVKQHASRGMAMLRTAAEQGSAEAM
FT                   VKLAEYYYQGKLVIKDKERAVQYALPAATNGSIAAQMMLVRLFSEGHGSSRDYPLAYHL
FT                   LYNNVFEDEATQNKALSLLRVLAAKMPTSVVERAQQARFSTR"
FT   sig_peptide     578546..578602
FT                   /locus_tag="Sden_0510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 19"
FT   gene            579199..581652
FT                   /locus_tag="Sden_0511"
FT   CDS_pept        579199..581652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0511"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53803"
FT                   /db_xref="GOA:Q12RX3"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RX3"
FT                   /protein_id="ABE53803.1"
FT                   /translation="MINDPHFEREQDKYDNPIPSREFILEYLRAQKSPITRDNIAKALN
FT                   IHDEEPLEALRRRLRAMERDGQLVFTRGQSYGLPERMDLLSGTVLGHRDGFGFFKPDEG
FT                   GDDLFINNRDMLMYFHGDKVLAQKAGTDRRGRREARIVRLVQPRTAALVGRYHVDAGMG
FT                   FVIADDRRITQEILIASEDTHGARAGDVVVVELTRRPGRFVKAAAKVTEVLGKTLAPGM
FT                   EIEIALRNYDLPHTWSAVIEKKLKRIPDEVTEEDKLDRVDLRHLPLVTIDGEDARDFDD
FT                   AVYAEKKPSGGWRLWVAIADVSHYVRTDSALDEEARARGNSVYFPSQVIPMLPEKISNG
FT                   LCSLMPHVDRLCMVAEMTIAASGKLSGTKFYPAVMHSHARFTYTQVADMLEGGAIAPEH
FT                   AALFPHLQCLQSLYLTLDERRAERGAIAFETLETQFIFNEQRKIEKIVPRGRNQAHKII
FT                   EECMILANVASANFVKKHKGEVLYRVHEAPSEQKLANFKEFLAERGISMDGGLEPTPSD
FT                   YQNLMLKIADRPDAELIQVMLLRSMRQAVYSPDNEGHFGLALEAYSHFTSPIRRYPDLV
FT                   LHRVIKYLLAKEAGETKDKWTQNGGYHYLTEELDALGEECSTTERRADEATRDVSDWLK
FT                   CEYMQDHVGDSFEAVIASVTNFGLFVRLNELFIDGLVHISSLASDYYQFDGTRQRLIGE
FT                   NTRKIYQVGDAVSVKVAAVNLDDRQIDLVMIGDNVKGRAKSGASGSRKPLTARERTNLE
FT                   GAKTDKKSSTKAAAKSDAKPRRKRKPAKSAAESGSKSTQKKPATKKPAANKSAPKKTVK
FT                   KKPKQ"
FT   gene            581674..582414
FT                   /locus_tag="Sden_0512"
FT   CDS_pept        581674..582414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0512"
FT                   /product="RNA methyltransferase TrmH, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53804"
FT                   /db_xref="GOA:Q12RX2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RX2"
FT                   /protein_id="ABE53804.1"
FT                   /translation="MKKQDFIYGIHAIESLLTHSPERILELWVLQGRDDDRLAPLLKAA
FT                   QDFGCTAQRATKKTLDEKADSSQHQGVVARVQAAKVLAENELDALLDSTEVPFLLILDG
FT                   VTDPHNLGACLRNADAAGVQGIIVPKDNSAGLTPTVSKVACGAAETVPLFQVTNLARTM
FT                   RHLQDRGVWIVGTAGEADGALYQAELTGPLAIAMGAEDKGLRRLSREACDKLVSIPMAG
FT                   SVSSLNVSVATGVCLFEAVRQRIK"
FT   gene            complement(582500..583879)
FT                   /locus_tag="Sden_0513"
FT   CDS_pept        complement(582500..583879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0513"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53805"
FT                   /db_xref="GOA:Q12RX1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RX1"
FT                   /protein_id="ABE53805.1"
FT                   /translation="MVSPMRTFTSLYSTTFLMVLAAGLLTTYLGLRLTVMAVPQLWIGA
FT                   MMSAYYVGLVAGSKLGHKLIAQVGHIRAFVACAGIVTASALGHALIDDLSVWLVLRLFV
FT                   GMGMMCQYMVLESWLNEQSDDSQRGTVFASYMIVSYLGLMAGQGAISLYPELGIEPLLL
FT                   IAICFSLCIVPISITRRIHPAPLTPAPLNMLLYWRKAPQALTTVALGSMIVGCFYGLAP
FT                   AYASSHGIAPEEVALYMSCTILAGLLAQWPMGKLSDVMPRSRLIRINCALLGILVFFIA
FT                   MLPYNEIYSLALTGLFGILAFTFYPLATALANSRVTQEERVGLSATILVTFGLGASVGP
FT                   LIASSLMQALGDAMLYVFMGVCAFGLLIALHFINSRQKSERQVSGDYVMGGGDLVLSPY
FT                   AAAIDPRVDMESVQDQMINPHEEDINAFEFDDELSDYEPIEDDFIDDQSEYDIEPNSKE
FT                   A"
FT   sig_peptide     complement(583766..583879)
FT                   /locus_tag="Sden_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.946 at
FT                   residue 38"
FT   gene            complement(583973..584728)
FT                   /locus_tag="Sden_0514"
FT   CDS_pept        complement(583973..584728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0514"
FT                   /product="protein of unknown function DUF481"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53806"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RX0"
FT                   /protein_id="ABE53806.1"
FT                   /translation="MKNVFAVFGLLLTSSLSANLAWALVPPDYQDPPSDFTAEVEAGLQ
FT                   LNTGNNESKNFNSRAYLTYDTPKTRQEGTFKVYYAADGTETTSEKYDLFLQSSYKLNRG
FT                   YVFGRGEFTWDDFGSFTEIRTLSTGYGFDLIKSYKTKLSLEAGPGYRYDMPRATLSDPE
FT                   PRANREVILRTAARYSVKLQEYTSLNADVTAETGLDNNTLTLDMSYKNTFLQDWAFKIG
FT                   MNVRYTQDVPQDSQRTDTTTTFNLLYTFQ"
FT   sig_peptide     complement(584657..584728)
FT                   /locus_tag="Sden_0514"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.876 at
FT                   residue 24"
FT   gene            584952..585344
FT                   /locus_tag="Sden_0515"
FT   CDS_pept        584952..585344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0515"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53807"
FT                   /db_xref="GOA:Q12RW9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RW9"
FT                   /protein_id="ABE53807.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSGVITAANGTIHRLEDWGRR
FT                   QLAYPIQDLHKAHYVLMNVEATAESIEELETAFRFNDAVLRNMVMRTKVAVTEASPMAK
FT                   ARDERDSRRSPSDDRIEEESAEENAE"
FT   gene            585353..585655
FT                   /locus_tag="Sden_0516"
FT   CDS_pept        585353..585655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0516"
FT                   /product="restart primosome assembly protein PriB"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53808"
FT                   /db_xref="GOA:Q12RW8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RW8"
FT                   /protein_id="ABE53808.1"
FT                   /translation="MNNHLSLSGTITRSRRFESPSGIAHVVVTLEHKSQRYEVDMLRNV
FT                   YCLIQVILSGPRFNSVADELKAGMQVEVEGFLSLQQGRNGQNRLVLHAENVELKT"
FT   gene            585668..585895
FT                   /locus_tag="Sden_0517"
FT   CDS_pept        585668..585895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0517"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53809"
FT                   /db_xref="GOA:Q12RW7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RW7"
FT                   /protein_id="ABE53809.1"
FT                   /translation="MARYFRRRKFCRFTSEGVAEIDYKDIVTLKNYITESGKIVPSRIT
FT                   GTSAKYQRQLARAIKRARYLSLLPYTDLHQ"
FT   gene            585936..586388
FT                   /locus_tag="Sden_0518"
FT   CDS_pept        585936..586388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0518"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53810"
FT                   /db_xref="GOA:Q12RW6"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RW6"
FT                   /protein_id="ABE53810.1"
FT                   /translation="MNVILLDKIANLGSLGDQVSVKAGYARNFLLPFGKAVVANAANVE
FT                   VFEARRAELEAKLAAELATATARAEKLAALEAVVIASKAGDEGKLFGSIGNRDIADAVT
FT                   AAGVELAKSEVRLPLGALRTTGNFEVEVQVHTEVKAVVKVTVVAEA"
FT   gene            complement(586461..586736)
FT                   /locus_tag="Sden_0519"
FT   CDS_pept        complement(586461..586736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53811"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RW5"
FT                   /protein_id="ABE53811.1"
FT                   /translation="MSNQMLGAFGPYTSEINPEAKAAFADAMEHFVGVKYSPVAVASQV
FT                   VSGTNYSFFCNAEVVVPGSTVYPTMVDVYKPLNGPAQLTHIGKLNR"
FT   gene            complement(587850..590045)
FT                   /locus_tag="Sden_0520"
FT   CDS_pept        complement(587850..590045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0520"
FT                   /product="dipeptidyl-peptidase 7. Serine peptidase. MEROPS
FT                   family S46"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53812"
FT                   /db_xref="GOA:Q12RW4"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR019500"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RW4"
FT                   /protein_id="ABE53812.1"
FT                   /translation="MRIALVAALVLSSGFAYGDEGQWQPYQMPSIADKLEQHGIKIPAK
FT                   QLADLSQYPMNAVVSLGYCTASFVSPQGLVVTNHHCAYRAIQYNSKSEHNYLENGFLAK
FT                   TKADEPSAGPNERLYITEAVTDVTKQVMANLSADPLARYEDIQTNSKALVKDCEADDNY
FT                   RCEVNSFHNGLEFYLTKQLIIRDVRLVYAPPESVGGYGGDIDNYEYPRHSGDFAFLRAY
FT                   VGKDGKPATYSKDNVPFTPKSFVKVNADGVKAGDGVFVAGYPGSTSRYRMTSELKFASD
FT                   WLYPTYASRYQLQIDTIKAMGAGNKDVAIKYAGTMASMENRMKKLNGLLDGFKATDIVG
FT                   IKQARENDFLAWLKQDKGANQALVTELQSLLSTQHQQLQGSYYFSNAQSSALLDAAKSL
FT                   YRLAKEKQKSDDKREQGYQERDMKMFTAKLERIDSSFEASVDQMLWQQDLNAYLAQPLK
FT                   EAALDKALGITSPAQLDAKLASFYQATELNDQAKRLAWMNADTAAFEASSDPFIALAVA
FT                   LYDANMAQEKAEKRLEGELSVARPAYMKAVIAYNQANNWPVYPDANGTLRITYGMVDGY
FT                   QSKDALYKQPFTRLEGIVAKHTGVEPFNAPSKLVDAINAKRYGSHEVENLYPELGTWIC
FT                   RLFSCLDEAGKFGSVPVNFLSSVDTTGGNSGSPVFNAKGDLVGLNFDSTYEAITKDWFF
FT                   NPTITRAIHVDFRYILWMMDEVDNADNLIAELELVRN"
FT   sig_peptide     complement(589989..590045)
FT                   /locus_tag="Sden_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            590199..591605
FT                   /locus_tag="Sden_0521"
FT   CDS_pept        590199..591605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0521"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53813"
FT                   /db_xref="GOA:Q12RW3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RW3"
FT                   /protein_id="ABE53813.1"
FT                   /translation="MSQQGAFKPKKKPRDAQIDALKLPPHSIEAEQSVLGGLMLDAEAW
FT                   DRVTEAVVAEDFYSRSHRMIFAAMNRLVETGQPIDLITVSEQLEIEDQLEDAGGFAYLG
FT                   EIAKNTPSAGNIVSYAEIVRERAVVREMIHVAHEIADAGYHPEGRDSSALLDLAETKVF
FT                   KIAEKRTNANEGPEGIKSILEKTVDRIEKLYNNPHNGVTGVSSGFGDLDKMTAGFQGGD
FT                   LIIVAARPSMGKTTFAMNLCEQAAMNEDKPVLIFSLEMPSEQIMMRMLASLGRVDQTKI
FT                   RTGQLDDEDWARVSSTMGIMLEQGKMYIDDGSGLTPTDVRSRARRIAREYGGLSMIMVD
FT                   YLQLMQVPSLSDNRTLEIAEISRSLKALAKELNIPVIALSQLNRSLEQRADKRPINSDL
FT                   RESGSIEQDADLIMFIYRDEVYHDDSEDKGTAEIIIGKQRNGPIGRVRLTFQGHYSRFD
FT                   NYAGPQFEED"
FT   gene            591695..592786
FT                   /locus_tag="Sden_0522"
FT   CDS_pept        591695..592786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0522"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53814"
FT                   /db_xref="GOA:Q12RW2"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RW2"
FT                   /protein_id="ABE53814.1"
FT                   /translation="MKPFPRAEISRKALQANLARIRELAPQSKIMAVVKANGYGHGLLN
FT                   VANSVATYDQGADGFGLARLEEALELRSGGVNARLLLLEGFFRVTDLPLLVQHHIDTVV
FT                   HHESQVEMLEQAELTTPVTVWMKIDTGMHRLGFSLAQFDAIYQRLLACHNIAKPIHLMT
FT                   HFACSDEPDNSFTQAQIDAFESVTASLDGDRSLANSGGMLFWPQSQRDWIRAGIALYGV
FT                   SPMVGDKGGNHGLVPAMELKSQLISVKDHQAGDSVGYGAFWRARKDTRIGVVAIGYGDG
FT                   YPRHAPEGTPVWLNGRRVPIVGRVSMDMLTVDLGLDSQDKVGDEVLLWGSALAVEEVAD
FT                   HIGTIAYELVTKLTPRVAVALLP"
FT   gene            complement(592873..593340)
FT                   /locus_tag="Sden_0523"
FT   CDS_pept        complement(592873..593340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0523"
FT                   /product="CheC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53815"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RW1"
FT                   /protein_id="ABE53815.1"
FT                   /translation="MNVEFINPFLASLLNVISTMASMQLTPGKPQVKTHNLAKGDISGL
FT                   MGMVGPKTKGSLSITFEQGLILEIMDKMLGEKPDFLNEDVSDLVGEITNMVTGGAKNLL
FT                   SDKGYDFDMATPAVVVGKNHSISHKAKGKKILMPFSHAAGNAYIEICFDEE"
FT   gene            593682..594551
FT                   /locus_tag="Sden_0524"
FT   CDS_pept        593682..594551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0524"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53816"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RW0"
FT                   /protein_id="ABE53816.1"
FT                   /translation="MSQSYNVELTHMPSLFSLYRKIFFGRKPGWDNKPLPKIHVKVANT
FT                   ALSADKLTQYANVCGFNFDGVYLPPTYLYVQAFRLHAVIFTHNAMTFPLLGMIHLKNSI
FT                   QAFRRVKITEAVSLECELSSSELKEAGLEFELVSKAYVGTELVWQAHSTYLYRIESAGR
FT                   RARPPRGSEMSWDSAKNWSLSEDLGRQYAKASGDYNLIHLHPLLSKRFGFERVLAHGMW
FT                   SKARCLAEVMPVIGERGFSVDVEFKLPVFMPSEVSFAFEQNDTGLVFELRDSKGRRPHI
FT                   QGQVSYLD"
FT   gene            594604..594969
FT                   /locus_tag="Sden_0525"
FT   CDS_pept        594604..594969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53817"
FT                   /db_xref="GOA:Q12RV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV9"
FT                   /protein_id="ABE53817.1"
FT                   /translation="MSVKCTHCYLSIKMDNQVNHRGKGLGVEIQCPHCQAWLGRSRILS
FT                   GLKLVGFYGAVSAGLVGYFLELDTRLVSLGMILFAIVLAVSHLMDHLLVTQAPEISSAR
FT                   ALRQVSERKRQARDAEP"
FT   gene            595050..595409
FT                   /locus_tag="Sden_0526"
FT   CDS_pept        595050..595409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53818"
FT                   /db_xref="InterPro:IPR019731"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV8"
FT                   /protein_id="ABE53818.1"
FT                   /translation="MSGCSRMQAQYFLFFSLRLGIVRIKPHIRQMISIGLCALLMFLSL
FT                   ASSAHESLHYDDGASTHCTLCFHQHQLNHLLESKTVFLPVIKQGVVQLEFILESRITGF
FT                   TAHYLARGPPSDSIS"
FT   sig_peptide     595050..595199
FT                   /locus_tag="Sden_0526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.976 at
FT                   residue 50"
FT   gene            595482..596720
FT                   /locus_tag="Sden_0527"
FT   CDS_pept        595482..596720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53819"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV7"
FT                   /protein_id="ABE53819.1"
FT                   /translation="MQILSRFSLLALACASVSNVSMAADGSLTNPNISGVLNGHYQSGD
FT                   RALGGTEEGFGLGETELALSANIDNNFYGKITAVLETHDGDTEVNLEEAFIQTLALPGG
FT                   FSIRGGRFLSDIGYLNNQHSHTDAFIDRPAVYRAFLGGHYFDDGVRVSYVAPTDIYWTL
FT                   GTEAFKGEKMRAADEHGERKFSDVGVYSAFSKWGGDLSLSSSWQLGVNYLRNENGQAYL
FT                   EHHEAHDEHADSHDDHSGHSHSAAYTGENTYVADFVYKWAPDGNYKYQHLSVSGEFFRV
FT                   DNIAALAEEAHEEQEHHEDDHGEDHDEGHAEGKSKDYHQGWYLSSVYQFSPSWSAGARY
FT                   GEVDTQTIHGDHLHGQELKETEFSLAWHSSHFSSVRLQYTHQDGTNFDGFTDDSIFSLQ
FT                   YVMTLGAHSAHQF"
FT   sig_peptide     595482..595553
FT                   /locus_tag="Sden_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            596704..597651
FT                   /locus_tag="Sden_0528"
FT   CDS_pept        596704..597651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0528"
FT                   /product="periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53820"
FT                   /db_xref="GOA:Q12RV6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV6"
FT                   /protein_id="ABE53820.1"
FT                   /translation="MRINFKQKLYLGLIAFASLSSFYSVSARAELNVFACEPEYAALVQ
FT                   TLAPNAKVYSATTAMQDPHQVQARPSLIAKLRQADLLVCAGGDLEIGWLPMLQMKASNS
FT                   QVLSTDKGLFFATEQVQTLDKLTQVDRSMGDVHEKGNPHVHFDPERMLQIAEALTQKLI
FT                   SLDIEHQAEYQQNLQGFSSDWQVAMQRWQQQAKPLQGRKVIAYHSSFRYLFAWLGMEQV
FT                   ADLEPKPGLAPTTSHLVSLLERTKMGDVMAVVVASYQDERGGVWLADRAKLPLLVLPMS
FT                   VGGNDDSTDLISLYDSVLTILTNAAETTAATSGE"
FT   sig_peptide     596704..596793
FT                   /locus_tag="Sden_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 30"
FT   gene            597657..598448
FT                   /locus_tag="Sden_0529"
FT   CDS_pept        597657..598448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0529"
FT                   /product="ABC-3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53821"
FT                   /db_xref="GOA:Q12RV5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV5"
FT                   /protein_id="ABE53821.1"
FT                   /translation="MIDLELASILLPAFAAGILVLSTHVLLGRQVLARGIIFIDLAIAQ
FT                   VAALGAIVSHIDHRIESLAYAHVWMPALFALGGAGIIAWLAKHFETELEAFIGCFYVLS
FT                   AVAAMLLLANDPHGGELLKQLMSGQILWVSWDDLLLPMLVSMLVLVLIALRPSLLAGNS
FT                   FYFLFAIVITLSVELVGVYLVFSSLILPALAVNRLKTNNRLWYAYAVGMLGFFIGLMLS
FT                   ASYDLPSGAAIVATLALCCLVFRLLAHVVGLLQSHRGKAQA"
FT   gene            598540..599286
FT                   /locus_tag="Sden_0530"
FT   CDS_pept        598540..599286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0530"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53822"
FT                   /db_xref="GOA:Q12RV4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV4"
FT                   /protein_id="ABE53822.1"
FT                   /translation="MLLIARSIILFVLLSLAFVFAIVYCLLRPRHRDNVHVFAHIFGAV
FT                   APVLGIKVINRCVDPNVVKSPCIYLSNHQNNFDLFTHTSAVPKGTVSLGKKSLAWMPLF
FT                   GQIYWLSGNILIDRNNRNSAFDTMTKTIEKMKKDLLSVWIFPEGTRSRGRGLLPFKVGA
FT                   FHTAIAAQVPVVPVLASCQNHIKLNRWNNGVVIVEMMAPISTQGLGKTEAKSFCAEVHA
FT                   KMSTRLEQLNQEAKLLMADPQGKDSV"
FT   sig_peptide     598540..598605
FT                   /locus_tag="Sden_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.772) with cleavage site probability 0.638 at
FT                   residue 22"
FT   gene            599328..599717
FT                   /locus_tag="Sden_0531"
FT   CDS_pept        599328..599717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0531"
FT                   /product="protein of unknown function DUF1260"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53823"
FT                   /db_xref="GOA:Q12RV3"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RV3"
FT                   /protein_id="ABE53823.1"
FT                   /translation="MSMERQLKEQFAENREIVEALLGDGSDADSEYVIEHHFSSTNFDK
FT                   LEKAAVDAFKLGFEVNDAEEMELEDGSEIFCFDAIANHKLDVALLDKACEQLMQVAHKQ
FT                   KVDYDGWGTYFIGDEIEEDDEEEQA"
FT   gene            complement(599795..600760)
FT                   /locus_tag="Sden_0532"
FT   CDS_pept        complement(599795..600760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0532"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53824"
FT                   /db_xref="GOA:Q12RV2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV2"
FT                   /protein_id="ABE53824.1"
FT                   /translation="MENDQSAMNELHWLIDMVQTIDVGLVVLDRNNDIQLWNGFMENHS
FT                   GVSPNSIKGKNLFETFPKLPADWLKQKMQSVYLLKNRTFISWEQRPYVFEFKNYRPITG
FT                   RADFMYQNITLLPLASLTGIHHICIIVYDVTDIAVNKLQLKGANEQLELLSQTDGLTQL
FT                   HNRRHWQECMEHEFERFNRYADIASLVMIDIDNFKQINDKYGHPAGDKVIQHIAHLLKN
FT                   ALRETDCAGRYGGEEFSAVLAKTNATDALQFTERLRTQIEASEVSYKDQKIKVTVSLGI
FT                   NALHSGMGSSSSWLSGADKALYQAKQMGRNKSVIYTDEQE"
FT   gene            complement(600781..601776)
FT                   /locus_tag="Sden_0533"
FT   CDS_pept        complement(600781..601776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0533"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53825"
FT                   /db_xref="GOA:Q12RV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV1"
FT                   /protein_id="ABE53825.1"
FT                   /translation="MTIPILICDDSALARKQMARTLPKDWDVEISYATNGAEGIEAIRA
FT                   GKGEVVFLDLNMPVMDGYEVLQIVQQQDLPALIIVVSGDIQIKAHERVKALGALDFIQK
FT                   PVSADSISNILQEYGILTLTQGKEIEDTPMIKVDLRDACQEIANIAMGQAADLLAKLLD
FT                   VFVLLPIPNVNVLEVSELTMALKATTESSQVSALCQGFIGAGIAGEALLLFHDSSFEDM
FT                   AKLMKLDTAKDTSTQVEVMMDTGNVLIGAFLNGISEQLDMSFSQSHPVVLGRHCTVNDL
FT                   INDNSEKWQRTLAMEINYRIEDYNIQCDLLLLFTEDSLPTLNFKLGYLLD"
FT   gene            602102..602908
FT                   /locus_tag="Sden_0534"
FT   CDS_pept        602102..602908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0534"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53826"
FT                   /db_xref="GOA:Q12RV0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RV0"
FT                   /protein_id="ABE53826.1"
FT                   /translation="MEGGLVRLEKHQGIAYVTLSRPDKYNALNFDMFKAIDKAIKQLQQ
FT                   DKQLRLVILTGAGGNFSSGLDVKSLSKDPGKALNLLFKWLPGNANLAQRVSLGWQRLPV
FT                   PVIAVIEGVCYGGGMQIVLGADIRIAADTAKLSIMEAKWGLVPDMAGLAGLRQLVSKDQ
FT                   ALKLTYTAEVLNADEALSLGLVTEVAAEPMARAKALAEQIMQTSPDACAAIKLSINRSW
FT                   TASLRSLLSRESLSQVRLLLGRNRLIAALRQTKDPQKPYRNRQPWW"
FT   gene            complement(602996..603874)
FT                   /locus_tag="Sden_0535"
FT   CDS_pept        complement(602996..603874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53827"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU9"
FT                   /protein_id="ABE53827.1"
FT                   /translation="MLTRRDLILVILFSAAINLLHSPSVYGKTDYDYLPQDEVTSIEVE
FT                   GQPLPVLVRPWEGKLRLGSVIIIGPSDSNADAAGFISHLRKSLNPEGWASISLTPPKGL
FT                   YRPSFATGAEEIAKAGSEQLSVSGYQPTPLYNSAQLLELRNFQQEALTKSFTPLEALSD
FT                   SYTGLKMYLVSDDSAGILVSLLFDKKIPAPDVLVLINPYREHEELIDEPSRRKSIAQQL
FT                   LMQTFPVLDLQSPNGHPVSLANAHQRQAVNQLKSPRLYRQYRLNLRLDNPSGWEEAQNY
FT                   IEGFARIATGN"
FT   sig_peptide     complement(603791..603874)
FT                   /locus_tag="Sden_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.982 at
FT                   residue 28"
FT   gene            complement(604053..606959)
FT                   /locus_tag="Sden_0536"
FT   CDS_pept        complement(604053..606959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0536"
FT                   /product="SNF2-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53828"
FT                   /db_xref="GOA:Q12RU8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RU8"
FT                   /protein_id="ABE53828.1"
FT                   /translation="MPFALGQRWISDTESELGLGTVVQVEGRMVTLLFPATGENRMFSR
FT                   AEAPLTRVIFNPNDTVESHEGWSITVTEVVEKDQLVVYHGTHSETGETVSLRETLISHN
FT                   IRFNKPQDRLFAGQIDRLDRFGIRYQCQLLRHKLASSDLLGLQGPRVGLIAHQQWIAHE
FT                   VGRRYAPRVLLADEVGLGKTIEAGLIMHQQLLTGRAERILVIVPDTLRHQWLVEMLRRF
FT                   NLRFSVFDEDRCVEAYADNDNPFYTEQLVICSLELLRKKKRLDQALDADWDLLVVDEAH
FT                   HLEWSEDAPSRAYQVVEALSEVVPGVLLLTATPDQLGHQSHFARLRLLDPDRFYDYDAF
FT                   LTEEQGYQAVAEAAEALSGEKKLNDSAINSLTELLSEKDIAPSIRLIQANEVDPEQQQA
FT                   ARDGLLQELLDRHGTGRVLYRNSRASVKGFPKRIFNPHPQAMPEQYVTAERVNAMMSGK
FT                   KTPQAKALEALSPEKLYQAFESDSASWWKFDTRVDWLIAFLKSHRSKKVLIIASQAETA
FT                   LSLEEALRTREGILATVFHEGMSIIERDKAGAYFAQEDAGAQALICSEIGSEGRNFQFA
FT                   SHLVLFDLPLNPDLLEQRIGRLDRIGQKNDIQIHLPYLEGTAQERLMQWYHHGLNAFEL
FT                   TCPSGHVLFNEFAEELTQVLCEDDADAMTQLLNHTQHKYKELKQAMERGRDKLLEINSH
FT                   GGARAAALIERLAQKDNDTHLVGSVIRLWDIIGVDQEDNGENTIVLRPSEHMLFPTYPG
FT                   LPEDGVTVTFDRETALSRDDIAFISEEHPLVQTGLDLITGSETGTTSVAVLKNKALPAG
FT                   TLFLELIYMADASAPKSSQLYRYLPPTPIRVLLDKNGNNLATKVDYNNFEKQLSAVNRH
FT                   IASKLVNASQPLLHPLLAKGQEQAQQGLDALLVDARASMTSQLTAELERLEALKAVNPN
FT                   IREEELEYVRNQMAELNGYLDASQLQLDAIRMVLVSHV"
FT   gene            607374..608768
FT                   /locus_tag="Sden_0537"
FT   CDS_pept        607374..608768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0537"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53829"
FT                   /db_xref="GOA:Q12RU7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU7"
FT                   /protein_id="ABE53829.1"
FT                   /translation="MKQDRRKLFVLDTNVLLHEPLAIYSFKEHDVVIPMTVLEELDNIK
FT                   DRKHDISRDARVAIRALEDILGGPTTPEQILKGVPLPSREGHLDVAGSLSIFPDHQVDF
FT                   IAGALPGDNNDNLIINVALHLQKVHKPRTVVLVTKDINMRLKAKGAGIEKVEDYRTDQL
FT                   IDDIRFLAKGFYQFEGDFWSKLDKVTTERQGKHTIHHVPIAALGKEAFYLNQYLLDDEA
FT                   NFCGRITGKTDTQLDIIDLGRDRLNHIEAWGIKPKNIYQGMALNALLDPEIDLVILTGP
FT                   AGCGKTLLAIAAALELVVERKRYDKIIVTRNTPEIAESIGFLPGTEEEKMAPWLAAITD
FT                   TLEVLHKNDVNPSGSMNYIMEKANIQFKSINFMRGRSIQNSVVLLDECQNLTASQIKTM
FT                   ITRMGEGTKLICCGNLSQIDSTYLTAVTSGLTYIVERFKDFEGSANVYLNGVVRSRLAE
FT                   YAEEHL"
FT   gene            609025..612726
FT                   /locus_tag="Sden_0538"
FT   CDS_pept        609025..612726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0538"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53830"
FT                   /db_xref="GOA:Q12RU6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU6"
FT                   /protein_id="ABE53830.1"
FT                   /translation="MKSTEPDLQLKSPIQRNYNRAVFYTYIGVIVMALLSAWVLFDRQK
FT                   VQLIEQREEQVARHVLQIDLLLESSIRAVKSLRNVAVDHLRLGELARKDMLPEYEKFNQ
FT                   DGQFFTLEPSYANGGEPFTNMGRITGSGSLKNRSDKFYQELEMLFELSLSFPVAKEAAP
FT                   KASSIYYISNQRIMSSYPWSANEQGFREELLNKNQFRLATPEMNPQRSVFWSQAYVDVS
FT                   EQGLLTTLGLPVYLENEFIGSINLDMTLSSLAKQIRMYFKMPGTVILLDQQNNILSHSD
FT                   FDSTEMNRVYHISQRIPSELHSLAESEIFDAHEGVLRNGYYIHSVALHNAPWRLLYLQE
FT                   ESALFQDAWDKLQLTFLLVVLALSVLVTIVHWQTRRAFVSPASRLLTHLEVCSQSPIKP
FT                   PHKITSGWEPWFQLVSRIFEENKQYTLHLAEQNKRLDNLVAKRTQRLRETTERREREYA
FT                   LLRSLIDSIPEAIVFKDQEGKYLGCNKSAEHMLGYSESEMIGMTSVELTSPEQGARIRL
FT                   EDSQVLKDRAALRYQEKVDISGKSVLLDILKLPFYNRRGELLGLISVWRDVTREYQSAE
FT                   QLRLSEERYHLAMDAVEDGLWDWYLDSEQIICNPSYYSMLGYETNEFPALISSIEELIH
FT                   PDDRDRVKTYRDLYLSEPSGAYETEFRMRTKSGRYLWVLSRGRVVEFTADGMPSRMLGT
FT                   HKDITRQKSNEVALLEAKHDAELANMYKSEFLANMSHEIRTPMNAIIGMLQLASRTQLT
FT                   LQQQDYLNKAGFSAESLLRIINDILDFSKIEAGKLELESVPFSLEKVLDHVIDMNALSA
FT                   QEKGVELLLFSPLTTGLTLKGDPLRLGQVLVNLLSNAVKFTQDGEIELGCEDVGERDTQ
FT                   ISLKFWVRDTGIGISREQQANLFDAFSQADGSTTRQYGGTGLGLSISKHLVSMMGGNLS
FT                   VESEPQQGSTFSFTLSFDIAKELPQQPLVVPKQLNNLTSLVVDDNPSALQIYSTLLRDF
FT                   SFGVNTATGGAEAIERLLQQDIDLLLLDWMMPVVSGGMVIKAVDEMIADGRLKKRPVII
FT                   IMTAYSTEPLNLELDKYEYQAVLQKPFKASSLFDEIIGAFAAPAKIKQEIAEQVEPQPL
FT                   QSGLILLVEDNFINQQVASELLKSAGYDVVIADNGQIALDLVAKQEFDAVLMDIQMPVM
FT                   DGLTAAKILRETYSTQQLPIIAMTAHAMSGDKEKSLNAGMNAHITKPIVLTELFETLAY
FT                   WIALKNQG"
FT   gene            complement(612728..614530)
FT                   /locus_tag="Sden_0539"
FT   CDS_pept        complement(612728..614530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0539"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53831"
FT                   /db_xref="GOA:Q12RU5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU5"
FT                   /protein_id="ABE53831.1"
FT                   /translation="MQVPQLQHFYINEEQSIYLLKANDARQHKAWIRLCKQQLSKLGYA
FT                   QIEFIGKGAYGFVFAGINQNNQSHVFKFSRINLPQNIQDRLEEEAYMLSQVQHPNVPKA
FT                   IKFQRVGKQGILVMERGKGEDLDKICLRLGALPAAMILSIARQLADILVYLRQGKPLVH
FT                   GDIKPSNLVYDIATDHLSLIDWGSAVFAQQDEHYHGVADNVMALMSHSQQDTNARMGDV
FT                   YFIGEEQLNGAQSTPRFDEQGVAATLYALASGQISRFGCRVIPATSIGLPVELAKTLTA
FT                   MLSEDPHTRRLGGDYFIKSLCNGPKLYLPTLNTLPHTAQIPVWSQSKTKQVETVCYSSR
FT                   KSFLKEHNTQDPIEKMDDIQLEKYYRNFMAGMGDTEKGFIAAVSRVGQYPIVGGLAIHW
FT                   QETGVYIDSNLAIYDPKAKAALIQAVNNMVTLARGIRRIGVFKVCFFNAKDTLHLERAD
FT                   SSSPFISASDFPLPFEVGDVPTLEDKSRLHSYFEDGKDPDENLELPNEIMTELGWLNQI
FT                   HHTGCIIFEALPNHLKIHSYLRLLNPRKQAAFRASLDRILFHASKIQGQGVSGFMKLPY
FT                   KNTRHFEFIEQQPERFYPKNPKQT"
FT   gene            614684..615046
FT                   /locus_tag="Sden_0540"
FT   CDS_pept        614684..615046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53832"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU4"
FT                   /protein_id="ABE53832.1"
FT                   /translation="MSSLEYKDLAPLFDFPRKRILQSMDVYHCPHAVFYNQRDERCITC
FT                   HQGEECLWMNRNDALIALEEKPIDELKQQLLIAVDYIDANLTPHHLSRRDCDCDNCHWR
FT                   NRVQQALNKDINTLKP"
FT   gene            615146..615802
FT                   /locus_tag="Sden_0541"
FT   CDS_pept        615146..615802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0541"
FT                   /product="Thiopurine S-methyltransferase"
FT                   /EC_number="2.1.1.67"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53833"
FT                   /db_xref="GOA:Q12RU3"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12RU3"
FT                   /protein_id="ABE53833.1"
FT                   /translation="MEPNFWHDKWHQQLIGFHQASVNALLLTHWQQLEIKPQGQVFVPL
FT                   CGKSLDMCYLAELGHNVLGCELNLSAVEQFYAENQLTVTCEPIGEHQFFDCEQVQIWQG
FT                   DIFTLAPKITQDISGFYDRAALIAWPESLRQAYVKQLAKLIPQGCRGLLVTLDYPQETL
FT                   QGPPFAVSPTWVETHLSEYFDITLLACRDVLDDNPRFIKKDVPWLNESAYLLKRK"
FT   gene            615955..616749
FT                   /locus_tag="Sden_0542"
FT   CDS_pept        615955..616749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0542"
FT                   /product="UBA/THIF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53834"
FT                   /db_xref="GOA:Q12RU2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU2"
FT                   /protein_id="ABE53834.1"
FT                   /translation="MLSESYLSRFAGIGRLYGQDALVKFSQSHVMVIGIGGVGTWVAEA
FT                   LARSGIGQISLMDLDDICVTNSNRQSHALASTIGQSKVAVMAARLRDINPECKVNEIED
FT                   FLTLDNLGEHLVPKAEGGELDFVVDCIDAVKQKAALIAWCKRNKLPLVTVGGAGGQTDP
FT                   TQIQLLDLSKTYQDPLLAKVRNILRKDYNFSKNPQRRFAVDAVFSSQHLVYPQNDGSVC
FT                   NTKAGADGSMRMDCASGFGAVTMVTGTFGFVAASRVLAKLAL"
FT   gene            complement(616756..618360)
FT                   /locus_tag="Sden_0543"
FT   CDS_pept        complement(616756..618360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0543"
FT                   /product="ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53835"
FT                   /db_xref="GOA:Q12RU1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033414"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU1"
FT                   /protein_id="ABE53835.1"
FT                   /translation="MKLSTSQLLKSPIGRRLMLSIVLFSSFITLLTTGYQLINDYRTDV
FT                   QRIDQAFSSIEKANLEVLAASIWVIDEKLINTQLKGLSQLSDITYVSIKDDSEQEWQLG
FT                   TKKTANTIEKQYDLLYRPADNTKVGTLVVQADLNFIYNKLYDKAILILLSNGVKTFLVA
FT                   GFILFLVWIHVTKHLLNLSQYCNEIDFKKPFTPLKFERKAFKDEFHSVAQAINHMQHQV
FT                   RLSLDELQNSKFQLQDSLADRERLLEIERSYKQELAAQVKAQTAELELSLARLKKAQQV
FT                   MVEQEKMAALGGLVSGVAHEINTPIGICLTAASAQLVHVDELILLIHSDDATLEQINGI
FT                   LLDYQQSCKLIINNITKASNLIQKFKTIAAEQQNEKSVQFNIYQLLMGVLDASKLIHPT
FT                   LDVDIGIEVDKNLCITANYSLVNQIVTNIVSNIYYHGFNEIDKPKLIIKVEIAQMQASI
FT                   ALHNNGVAIPEEVSAHMFEPFFTTARHKGGTGLGLSAAFNAATLLKGKIDYQANSPLGG
FT                   PLFTLLFPIERQHEYVI"
FT   sig_peptide     complement(618256..618360)
FT                   /locus_tag="Sden_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.842) with cleavage site probability 0.517 at
FT                   residue 35"
FT   gene            618556..619167
FT                   /locus_tag="Sden_0544"
FT   CDS_pept        618556..619167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53836"
FT                   /db_xref="GOA:Q12RU0"
FT                   /db_xref="InterPro:IPR025982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RU0"
FT                   /protein_id="ABE53836.1"
FT                   /translation="MMKMKLASMTQVANKKVLMSFMSWWVLACGALLLMPTKILVALSL
FT                   QDFVTHYADFIGLGLIVGVAYFLSQLLGFFVDESIVHLNNKRSIETIESKVKLLDPAER
FT                   ALLREFFLQGATILTLPQDELAVRSLVETQILEVVGNVRHYAIQGPTAEYKITMRARIY
FT                   LNRDVLRLPAGEPSKEELSNLIKARPQFVSGLVQQRKHAA"
FT   sig_peptide     618556..618681
FT                   /locus_tag="Sden_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.915) with cleavage site probability 0.483 at
FT                   residue 42"
FT   gene            619708..619792
FT                   /locus_tag="Sden_R0023"
FT                   /note="tRNA-Leu1"
FT   tRNA            619708..619792
FT                   /locus_tag="Sden_R0023"
FT                   /product="tRNA-Leu"
FT   gene            620416..620739
FT                   /locus_tag="Sden_0545"
FT   CDS_pept        620416..620739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53837"
FT                   /db_xref="GOA:Q12RT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT9"
FT                   /protein_id="ABE53837.1"
FT                   /translation="MASPQSATEQSNSKGSSALNSPTTAKACEATHHAVDAVAVKAAIA
FT                   EDTLRKTAASSQETLVHKQEEIKQQLQNSLSKTRELAAQNPLATAGIAFAAGIVLTALL
FT                   RRR"
FT   gene            620749..621240
FT                   /locus_tag="Sden_0546"
FT   CDS_pept        620749..621240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0546"
FT                   /product="putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53838"
FT                   /db_xref="GOA:Q12RT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT8"
FT                   /protein_id="ABE53838.1"
FT                   /translation="MQNRERSEAPVQKPDQSAAQTDLTGQAGSTQSALNNVMQQAIEQL
FT                   AQIAALSSSVKQAYISQLKLAGKIATAEWQLTGRSLLIAAALVVCFGAGIILFWGSSLL
FT                   LLGYLLFQLSSSLLITVTALVMLQFVLLLWCWRSLGYILSQAGFSKTWRQLRLLLFTPQ
FT                   "
FT   gene            621251..621499
FT                   /locus_tag="Sden_0547"
FT   CDS_pept        621251..621499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53839"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT7"
FT                   /protein_id="ABE53839.1"
FT                   /translation="MLIQKLLKKQQLNLTELAEQSQQQQKLLLASNLQLTQSVRAFMGS
FT                   TSGLLVSFSLGCLFQLRHHSMVKLLRSVVGLRWFTKL"
FT   gene            621711..622156
FT                   /pseudo
FT                   /locus_tag="Sden_0548"
FT   gene            622555..623108
FT                   /pseudo
FT                   /locus_tag="Sden_0549"
FT   gene            complement(623221..623820)
FT                   /locus_tag="Sden_0550"
FT   CDS_pept        complement(623221..623820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0550"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53840"
FT                   /db_xref="GOA:Q12RT6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT6"
FT                   /protein_id="ABE53840.1"
FT                   /translation="MQPFYFKQFGNLEMGTKEHILDIAESLFNANGYTAVGVDLIRDTA
FT                   CVSKTSMYRHFGSKNKLILAVLVRRHLRFEDKLGGAISPEMTMEEKLNALIDWHFKWFN
FT                   AEDFHGCMFMHAMSEFKESDDAIADSASMHKKWLKALIKQIISNTPNDDEQLAESKAES
FT                   IMAFIEGMIVRAEFDDITSFRPIYRFAIQTLSKTNF"
FT   gene            623922..624443
FT                   /locus_tag="Sden_0551"
FT   CDS_pept        623922..624443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0551"
FT                   /product="HPP"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53841"
FT                   /db_xref="GOA:Q12RT5"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT5"
FT                   /protein_id="ABE53841.1"
FT                   /translation="MNKLKGGGSLPPRPSLLQLLKGLIGGTLGILCLCLLGQYSGVPWL
FT                   MAPFGATCVILFAAPTSPLAQPRNVIGGHFIAASVGIAALYGLGDSYITMSVAVGVAIV
FT                   AMQFLRAVHPPAGANPIVIILAGKSAVSLSFLFTPVLVGSVLLVVIASLVNNYGVKDGW
FT                   PVYWHGFGKT"
FT   gene            624741..625679
FT                   /locus_tag="Sden_0552"
FT   CDS_pept        624741..625679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0552"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53842"
FT                   /db_xref="GOA:Q12RT4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT4"
FT                   /protein_id="ABE53842.1"
FT                   /translation="MDTCVVNLIEPGDEVIVCINGAFGQRIAESVAKVGGIVTEVHSEW
FT                   GTPVLPEKLEQALSATPNCKIVSFVHAETSTGVRNDAKVLCEIANRHGALTLVDAVTSL
FT                   GGIPVCVDEWGIDAIFSGTQKCLSCPPSLSPVSFSQRAIDKIQSRKSAIPSWFLDVTKV
FT                   SSYWTGQARAYHHTAPVNALYGLHQALVEYHYEGNEKSFARHAAVSAELVKGLSILGLH
FT                   PLVEDKYRLPQLITVKIPEYLDEAKLRRALLSTYDIEIGAGLGMLAGKVIRIGVMGNGA
FT                   RIENMQRLISALSKVLVQDDVKIKCKTESFA"
FT   gene            complement(625836..628409)
FT                   /locus_tag="Sden_0553"
FT   CDS_pept        complement(625836..628409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0553"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53843"
FT                   /db_xref="GOA:Q12RT3"
FT                   /db_xref="InterPro:IPR004866"
FT                   /db_xref="InterPro:IPR004867"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT3"
FT                   /protein_id="ABE53843.1"
FT                   /translation="MATLKRLIPLAITLSSFNAFANFSQTELNEFAEKTSWSWQVIDNY
FT                   HNGDKSHLANIELVNQSRVDLPKGIADWVIYTNVIRPILTKKSQGLAFQFVQGDLYKIT
FT                   PTVNFKGLKAGDKLTIPFEAENWASSHSDFMPRSFITQHSLTPAIFRSTDTEDSSKYIK
FT                   PLNRPEQYQRYNTPRDHWEKPTSAWRYDRYSPAQEYALTEDDAKRVIIPTPNKVKYSSS
FT                   STLLTADWQISYQGSLKSEAHLLSETLDKKLKGSLKITPNNLPAQDKNLISLSIYNGDE
FT                   SWKPESYSLEIEKNRIEIVGADSAGVFYAIQSLLSLTPSGTQSQIELPQLSANDAPHFE
FT                   WRGFMYDMSRNFHGVEITKKLIDQMAHYKLNKLHLHLTEDESWRIEIGGLPELTDLGSQ
FT                   RCFDLSETECMLPTRGSGPFKTSQTNGFYSKEEFIDILKYAKQRHIEVIPEVDMPGHAR
FT                   AAIKAMELRHNKLIKSGDKTGANAYLLSDPLDKSVYSTAQFFNDNSINVCMDSTYNFVD
FT                   KVAYEFQQMYREAGLKLTNIHIGGDEVGVGSWTASPICNALYQAIDSGVKGPADLKAYF
FT                   TRRAAEVLAARGLNIAAWEDGIMFDRITPFPIEQFANNKVYVNAWDNIWEWGVSDRAYR
FT                   LANEGYHAILSMGTHLYFDHPQEPDPAERGLYWAARYTDVEKVFNFIPDNVYANADFTR
FT                   AGEPIDNLEDLVGRALHQLNKPENIAGIQGQVWSETIRTPEQLGEMIFPRIIALAERGW
FT                   HRNTVLASEQQEQARQWAKFASVLALKEYPKLEEAGVSFYLPIPGAKRIDNQVHIISQL
FT                   PGLTLEYSLDNGENWQVYNKPIRLPDAIKVRSRSGKHTSRVGSFE"
FT   sig_peptide     complement(628344..628409)
FT                   /locus_tag="Sden_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            629035..629619
FT                   /locus_tag="Sden_0554"
FT   CDS_pept        629035..629619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53844"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT2"
FT                   /protein_id="ABE53844.1"
FT                   /translation="MGKTRLITRKLHLLWLLIFLNGCAVPLLLMSPQGQLLWALMKPMV
FT                   GLDPNDVGLFEQPLIKGRMQSILGPHYASTMKILATADEIQQQGPLYYVISKHSPIPEV
FT                   AEKAGFVWNAENNQMAVMLLTGGSPQVFAEKLIKDKVKSTVDDKVQDVKDEVHQAGREQ
FT                   ITALVPQWPTELTDAIMLAKPVLPQVTLPKT"
FT   sig_peptide     629035..629139
FT                   /locus_tag="Sden_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.806) with cleavage site probability 0.311 at
FT                   residue 35"
FT   gene            629944..630804
FT                   /locus_tag="Sden_0555"
FT   CDS_pept        629944..630804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0555"
FT                   /product="MltA-interacting MipA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53845"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT1"
FT                   /protein_id="ABE53845.1"
FT                   /translation="MNKINVILLRSWLLGLLLAPNLLMASDIATSVTQGGEQRLADGGY
FT                   FELGASVYGTNQLDIRQTEHESIQPSLLISGMYQYKGLFAEMVHQSQDGINFGINLWSS
FT                   NNWSLDLLAVNYQGSAGRSENTELSQLDEDGRNAYLMETDSIFIGAGFRVTRYWDDHYV
FT                   FQYRIVSDYFDDQGISTTARLGKSWQVRNWNFHALASIEYASTKLSRNLFGVESMEATE
FT                   LFPEYRPSSAVTYGMELGVAYPLSEKLVFRTVYRLNVLSKEITASPFNQADYGSFFNAS
FT                   FSYVF"
FT   sig_peptide     629944..630021
FT                   /locus_tag="Sden_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            630810..631238
FT                   /locus_tag="Sden_0556"
FT   CDS_pept        630810..631238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53846"
FT                   /db_xref="InterPro:IPR021559"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RT0"
FT                   /protein_id="ABE53846.1"
FT                   /translation="MMNKSNFPLAFLWRRTLFHTAILASVFTATSVWSQDKSIAFTATP
FT                   ERCVALYKGQICYQEVLFRWQTPSQGEYCLIMSKSGRRITCWNGASQQEYHYSFEGDKT
FT                   TSFSLVADDNAEPLAQVKVVVTWVYKAPKQSQSGWRLF"
FT   sig_peptide     630810..630914
FT                   /locus_tag="Sden_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            631241..631945
FT                   /locus_tag="Sden_0557"
FT   CDS_pept        631241..631945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0557"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53847"
FT                   /db_xref="GOA:Q12RS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS9"
FT                   /protein_id="ABE53847.1"
FT                   /translation="MTVEKHILVVEDDTSLAEWISDYLLDHGYGVTVASQGDYALEMIA
FT                   DELPDLVLLDVMIPVKNGFDVCKEAREFYSGPILFMTACVEDGDEIQGLEMGADDYLTK
FT                   PIRPQVLLARIKALLRRASDEEPKQQLVFGALVLNATAKTVTVHQQAVGLNDNEFDVLW
FT                   LLALQAGTVVSRIDLVSQLRGIEYDGLDRSVDIRVSRLRKKLQEAQDQPYKVKTIRGKG
FT                   YLFCRDDAAPKS"
FT   gene            631942..633237
FT                   /locus_tag="Sden_0558"
FT   CDS_pept        631942..633237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0558"
FT                   /product="ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53848"
FT                   /db_xref="GOA:Q12RS8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS8"
FT                   /protein_id="ABE53848.1"
FT                   /translation="MKKLIVSLVLVVLVTIASLGWSISEFASFYDKDDEQTNPANQLAA
FT                   LTLMGTGLAKTLDNHPLQSQTFLASWNQHNIEQLSLMGSAEFILPLPLKAKFNADKFLM
FT                   LESDEGISLHYLLPSTDQVLNINTLLVTEADSGLNLNRLYTMLFYLGVVLILLLWVSPL
FT                   IRRLINLSQVTQAFGMGDLQQRIAVSKTSYIGAIEAEFNRMADRIQQLLDDNKLLSRAV
FT                   SHDLKTPIARLRFGIEALEETQNPELKTKYFQRVNRDLDTMEDLVMTLLSYARLGQGDI
FT                   PLERTDIALNAWLQNKLLESDDAEHQLEFLPLPHEVTVNVDPKYLSMQINNLLSNALRF
FT                   SRSKVQVSLMVQDEVLWIHVDDDGQGIDELEALQVVKPFVRGKHSRGNMGHGMGLAIVE
FT                   RIGLWMGSKLHISRAPELGGARLSLSFESHSI"
FT   sig_peptide     631942..632025
FT                   /locus_tag="Sden_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.401 at
FT                   residue 28"
FT   gene            complement(633280..634278)
FT                   /locus_tag="Sden_0559"
FT   CDS_pept        complement(633280..634278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53849"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS7"
FT                   /protein_id="ABE53849.1"
FT                   /translation="MKIAIVSLLATLVVLQACGNSDNKKAIVKQQVNEVHGIQPDKVPN
FT                   YIENFKLQYEQLDLQIDGVKYSLSFFDTDDAEKVIIAKYGNGLIYLGFDFEKEQPINSI
FT                   MLLEGDISDLEDFKPTAILKGSNIELSEREDNMVYQGSIEDVNTKKLYSIRAVINESLL
FT                   EAGDSTLTLEGNVATLNGTLGTATYIQMDELIKTKSFDTLKFGKVSGSINDDINMHTGR
FT                   LIRAAKLTTLMPTGSFAYSGGVDLFAAGNQRIFQDGGELGVHSWCCLAGKDAGQLSKTD
FT                   PAHGAQLTYFREMLGAEKGPEFYFFTINAAPAASIHKMKKAEMVKYSLITE"
FT   sig_peptide     complement(634219..634278)
FT                   /locus_tag="Sden_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.797 at
FT                   residue 20"
FT   gene            complement(634384..634866)
FT                   /locus_tag="Sden_0560"
FT   CDS_pept        complement(634384..634866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53850"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS6"
FT                   /protein_id="ABE53850.1"
FT                   /translation="MKSVIKSALKSNIRSCLCLGVALALTACATSYDTQKEFWSFGKGF
FT                   ETVQIAPNSWQISFVGNTNTDRSLARKYVLRKSAELSQQAGFPYFAFTNEQMDRDAVGQ
FT                   FGVGFEGGHDTLWGSSSTTQETSVLVEVTGLKTKEEHQGSRVYDAKFIMNNVAVED"
FT   sig_peptide     complement(634777..634866)
FT                   /locus_tag="Sden_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.677 at
FT                   residue 30"
FT   gene            complement(634886..635659)
FT                   /locus_tag="Sden_0561"
FT   CDS_pept        complement(634886..635659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0561"
FT                   /product="MltA-interacting MipA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53851"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS5"
FT                   /protein_id="ABE53851.1"
FT                   /translation="MKTLCIAISAILMSTHAMADDNSYIRNGNIYSNQGQYFVGAGVAT
FT                   GSKFFKDQDDQTGVYFNGGYHGEDFNADLGGINYRFFGNNDSAINFSAYMVANPGFDTD
FT                   SEDILKGMKERDFSGDLGLNADFHLGQGTLSAKFQHDITGAYDGYQADITYYHPMDLGF
FT                   ASLVPYAGAHYFSNEFVNYYTGVASFEATSKRPAYQSNGALAFKVGYVLDIPITENLSL
FT                   TQATAYTHLGSNMADSPIIDAKNQWLTTFGVNYSF"
FT   sig_peptide     complement(635600..635659)
FT                   /locus_tag="Sden_0561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            635979..636500
FT                   /locus_tag="Sden_0562"
FT   CDS_pept        635979..636500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53852"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="PDB:2OQM"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS4"
FT                   /protein_id="ABE53852.1"
FT                   /translation="MLYDLTVVQFSKMLKNLNAIFDKAEAFAELKKVDMDVLLNSRLAA
FT                   DQFNLIRQVQIACDTAKVGVARLTGQLETAPKHDDSETTLAELRQRIASVLTYLEGFSE
FT                   ADFANAATIQISQPRWQGKYLTGYEFAIEHAIPNLYFHITTAYGILRHNGVEVGKKDYL
FT                   GAMPYKAPIL"
FT   gene            complement(636736..638772)
FT                   /locus_tag="Sden_0563"
FT   CDS_pept        complement(636736..638772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0563"
FT                   /product="transcriptional regulatory protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53853"
FT                   /db_xref="GOA:Q12RS3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS3"
FT                   /protein_id="ABE53853.1"
FT                   /translation="MIFVFDNIEINTALVTITRNRQALEIEPKLFSLLVYLCQNPNRAI
FT                   SRDELINTVWENRFVSEAAINRAIGQLRKHIEDDTSHPKYIRTVSKVGYRLDAVVQHIP
FT                   QAQFQWEAKKQLSNNKRNISPKAVIFVFFVLISIILVLFTVPQLDTPQLSTSVSIDNIS
FT                   PITTSSNISFNPHFDTANNELLYLFKEHSRSSAQIKALNSQHKTLELSQDNYYYTDVVS
FT                   FDDTRVIASRLTDLKQRDCEIVTINKITHETQKITDCGKSIINDLLFDKVSNMLYYRFR
FT                   KNVSHPYAIYAISLASFRIHQLSRPVSTGNGLGHTVFTLSPNKQQLAMIEYQSTAEDEL
FT                   QVFDLQSQQIIQRHSVPKDIHSVLYRSPTSLLMVNSEGMHSLDLVNAQITSVEHTAEFG
FT                   RFSYKGDNEIVFEKYYFQSNLVQIPLDTTESTNLTKLMGVNGNASIAHHSDTIIFYAIT
FT                   PQSTAIKLRQPDGEILDSQFPETARHVANFDWFDDDSQLVASVNSQLYLLNLKNLKWRR
FT                   LPLDFKTIHHVSVIDGENVLFSAEKNGDWNLWSLDLATNALTLMTNTEAYSGQVYKNTL
FT                   YYTKFSTPGLFYKDITTDNEQSLIPDLPVTEWTNWQIIEDTLIYRQDHHLMQYDLNSKK
FT                   TLLLFDLNNKPIRACRVNHKISKLICELQQHSVSNIWQADIRD"
FT   gene            639096..639947
FT                   /locus_tag="Sden_0564"
FT   CDS_pept        639096..639947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0564"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53854"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS2"
FT                   /protein_id="ABE53854.1"
FT                   /translation="MGFVKPFSKINGSIIMVILGLLASACGQSGSETGGLVDANEPVSP
FT                   QPNLGEQQGVLEQNLPVPNNQQTDYFRVILYGNSHVSGLPSLIQLLINTGVPQVRVEVK
FT                   NVGGGFLDESYYNDAYQARLTATPWTHAIFQGQKYSQSGTSIYPTTAAQKWLDKAKSLG
FT                   ITPILFPEHPQDGKLEEGEYVYQLHQGITSMQSSCLAPIPLVWERVIQLLPDVHLHAPD
FT                   GNHASSLGNFLTALVFYEVITGRSADLLPYLSNIAISEQIQSIFGQVVSEVLADKPACP
FT                   TF"
FT   sig_peptide     639096..639191
FT                   /locus_tag="Sden_0564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.507 at
FT                   residue 32"
FT   gene            640513..641118
FT                   /locus_tag="Sden_0565"
FT   CDS_pept        640513..641118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0565"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53855"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS1"
FT                   /protein_id="ABE53855.1"
FT                   /translation="MKTLFTPTLIALTCFSTLAIGAEMSLNASTSTSGSPQLKTEQPLA
FT                   QSSSANGSANANNQTKASGAANTEASAANAEANGEASGKTVAIADSDESLTLDGINQGE
FT                   MAAGLFGQASGDEDIKEVIILPEQALSAVNSVTASSTQGVSQAALVSANAISQQVQAST
FT                   TGLVQQNTREQVAQTVSQSVNAEVSNTIKNTLRLSGGL"
FT   sig_peptide     640513..640578
FT                   /locus_tag="Sden_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.768 at
FT                   residue 22"
FT   gene            641213..642133
FT                   /locus_tag="Sden_0566"
FT   CDS_pept        641213..642133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53856"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RS0"
FT                   /protein_id="ABE53856.1"
FT                   /translation="MMAIYSRITCVLLLSCAQPSAMAQTETQNDAVTVTGKAQAGMEYQ
FT                   SNVNISELEQASGASDSATVLEAEINLGWQASEALRFDTGYSINDKRYQDASDYDTRLQ
FT                   LAFIDSNYRFDNMNLGANFYHAKADLAQRDFMSLNQYSLYSMHNLSDTWYLRPSVKRSE
FT                   KTFAQLESRDASNNGANLDSYWFFDQGQRFVSVGLNYEDEAAQDNAFSYGAKGVSVRAS
FT                   SKFDLWQLSQQLQLGMKLSLRDYAQGIDGASRDDLHQQFDAKWTLNINSHFAVVTSLEY
FT                   GDYQSVLDSANYNETRAGLMLQVSF"
FT   sig_peptide     641213..641284
FT                   /locus_tag="Sden_0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            complement(642130..643527)
FT                   /locus_tag="Sden_0567"
FT   CDS_pept        complement(642130..643527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0567"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53857"
FT                   /db_xref="GOA:Q12RR9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR9"
FT                   /protein_id="ABE53857.1"
FT                   /translation="MSTFTLSSMALLGLGLLPLTANAQLLPLPPLPSQVIGTLDKTTER
FT                   QTERLNALKQQGLLEQQLQQSLASKATLLNPLTQLPNIVPVVNALGQTVFNDVAVEQGL
FT                   RAVEREWLLLLSTSQWQQLLTQAPELESYLSSQITLTQLQLQLIKIRVPSQLDNMAALR
FT                   LNLPELLAPYLSRNYIYQTQTAEPLAHQETANPAPTDKALATTVPAAPICNQPITLGMV
FT                   DTAISPHHSALTQTAQFALLQRSFLAEGIAISYAHGTAVAGVLAGRDKQLNPLLSSLTL
FT                   LNAGAFYAQNAYQQGASLESILQALNWLVSEGVRVVNMSLTGPDNPVLQQVVTGLAEQG
FT                   TVLIAAAGNGGPAAAPLFPAAYPQVIAVTAVDKRLELYRWANQGDYIDFAALGVKVLTT
FT                   RADGSIGMESGTSMATPVVTAKIACLLAAKPELDLSQIVQQLQQQVVDLGVPGKDPLFG
FT                   HGVLVRP"
FT   sig_peptide     complement(643456..643527)
FT                   /locus_tag="Sden_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            643654..644142
FT                   /locus_tag="Sden_0568"
FT   CDS_pept        643654..644142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0568"
FT                   /product="Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53858"
FT                   /db_xref="GOA:Q12RR8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR8"
FT                   /protein_id="ABE53858.1"
FT                   /translation="MKTELTLLLPALRRFAYSLTGTMPDADDLVQNTVVRLLKSPPPEG
FT                   VPLAKWAFKICRNQWIDDYRSQKVRTLATDKPELQDENFTDGEAEMINDITLGEVNTAM
FT                   NSLSDEQREVLSLIAVQGMSYSEAADILAIPTGTIMSRLARARANMVSFFNQKSGSMA"
FT   gene            644139..644888
FT                   /locus_tag="Sden_0569"
FT   CDS_pept        644139..644888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53859"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR7"
FT                   /protein_id="ABE53859.1"
FT                   /translation="MKITDETLSAFIDAQLPEAQMEQVREAIALDETLAERLADLAMVD
FT                   PMVKAYYQDIDQHPVPEATLRLLEEDVAPTAKIIAFPSWRKLQQQVQQHAAAWVFIALL
FT                   AGYGVSQFDIISGTAPEPSSTFASQTSSFDLNLGEQLESQMSGQRIALTDNQALSIRLS
FT                   FYNQEGDLCRQYGLESDSQMSENISCRQQGEWQQVASVSLPKDKTGDAQYQTASGGSAL
FT                   DSVLDSMMKGSGLTLVQEQQALASLQD"
FT   gene            645027..645425
FT                   /locus_tag="Sden_0570"
FT   CDS_pept        645027..645425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53860"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR6"
FT                   /protein_id="ABE53860.1"
FT                   /translation="MILKTLTLIFAGLFLIGCSQHALFQPNTVEEAGYRFTEYKITQGY
FT                   YRISVSSAKHNNLEHQTFDHKALEQQALNRARELTEQQGYDWFVVISPTQQQEVKRQTP
FT                   SQVNKAGTSASKQDSHIIEIHMGIGVKP"
FT   sig_peptide     645027..645095
FT                   /locus_tag="Sden_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.963 at
FT                   residue 23"
FT   gene            645531..646007
FT                   /locus_tag="Sden_0571"
FT   CDS_pept        645531..646007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53861"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR5"
FT                   /protein_id="ABE53861.1"
FT                   /translation="MERKSSILLAFALSFSASAEVYQCADGKYQADPCDENSQPVDLSG
FT                   VGSVIQRSETTVQSSAVSTATSDKKKEITTYIEKRRISREIAQLESDRRRVIAQRDQRL
FT                   RNLRESSQYANNNLAGATWQQSLAQEQLAATQEADTLVESIDRQIEQLKKDLEP"
FT   sig_peptide     645531..645590
FT                   /locus_tag="Sden_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            646407..648740
FT                   /locus_tag="Sden_0572"
FT   CDS_pept        646407..648740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0572"
FT                   /product="periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53862"
FT                   /db_xref="GOA:Q12RR4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR4"
FT                   /protein_id="ABE53862.1"
FT                   /translation="MQKELPLKTAPVQRDSLGRWILNCMAAVLLTVSAFFLWGAHSLVD
FT                   SRFDNFDASVYEQQLLRVSGIFEQNRLSFELQVNDYARWDHTEAFVLNQQPAYIEENLF
FT                   PTSLANIQVDGFIFTRLDGSLVTPPLLRVGAELTPMPDPMWEAISQQLPSLIKNDKSTA
FT                   HTRFVWFEDEVIMVSGTHITDTAQANAPSGYLFFIRHLDEARLGALRELTGVNFRLAQT
FT                   TSMDTVETQFTYKRHKSHPHWLTSMNLTGLPALIQVQGSTHLQAERQLTFTLLAFSVAG
FT                   LSIVALFGIYWLIHLKVIRRLELFSKLADKNRQTRAQSIRWPVSGSDELDNLASSMNDF
FT                   ITEVEVRHKELNYLANHDPLTGIGNRRLLMASLDDKMELLKSNPKFTCNLLLLDIDQFK
FT                   LFNDGLGHAAGDEILCLIAKRLSTKVKDSDTLVRLGGDAFAILQENVSLASTQDFATDL
FT                   LQHLAVPFVYQEHQLNLRASIGFAQVKLKLSKEDVIRNADLAMYEAKRRGKNQVAIFTV
FT                   NLLDTVSRRMHLEQALREALNQQSLEVWFQPIIDARYGKIVGMEALSRWSLEGEYIPAD
FT                   EFISIAEASGMVAQLGKQVLDKVGAVLQELRLQYPALECNVNLSVQQFRDPQLISDIVA
FT                   CRVKYQLPASALHLELTESMIAQSESEILPIMRALVNQGFKFHLDDFGTGYSSLERLKH
FT                   LPFDTLKIDRSFITPLSLGDDVMVRNIINIGHELGMNLIAEGVENERELEHLLQLGCNQ
FT                   IQGYYFARPMPYHALKIWLKEHQD"
FT   gene            649527..649808
FT                   /locus_tag="Sden_0573"
FT   CDS_pept        649527..649808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0573"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53863"
FT                   /db_xref="GOA:Q12RR3"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR3"
FT                   /protein_id="ABE53863.1"
FT                   /translation="MKYLLTILTIVVFLSGCNTTPSQPTEGYVQLQFDITEAGATDNIK
FT                   VIKSVPSGFFDEEAKKSLSKWKYKPKVVNGVTVRQVDLKVQLDFTPKK"
FT   gene            650014..650604
FT                   /locus_tag="Sden_0574"
FT   CDS_pept        650014..650604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53864"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR2"
FT                   /protein_id="ABE53864.1"
FT                   /translation="MLRFASQALQNVIGLFADGFALARISKAHVSNAYLSNSWLSNRWF
FT                   TAFVKTKLLIGIVLLQLVGANVGAHQLHPDTKVEEGGQHSHLQLTTQVTTLSQCEISDH
FT                   LDAHTNATEHQVADFHGAANDGEPSHTDSHQVVSTETQDVDICLDCQCHGGHASLVGGM
FT                   SPLAPSPLTDSPVLLALNYFPPESLPSYRPPIV"
FT   gene            650744..651985
FT                   /locus_tag="Sden_0575"
FT   CDS_pept        650744..651985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0575"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53865"
FT                   /db_xref="GOA:Q12RR1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR1"
FT                   /protein_id="ABE53865.1"
FT                   /translation="MKNQTFNAFFAASSVGASLLFSSLFALAALGFPAQAGEGHGHDAT
FT                   PKASVNAQPLAANISGEKQEAQAHGEEKHGNEALKLTQVQRNLAGIEVSELQAQHFNLA
FT                   SFATATLLVDRDKTASLAAQLEVKVIARHVVPGQRVEAGQPLLTLGGAAVAQAQADYIN
FT                   AASEWDRVKRLSNGAISDSQRLQAQVNAELKRAILESLKMTKSQIATLATSPSAIGSYA
FT                   LLAPFSGRVQQDIAMLGQVLAAGTALMQLTDESSLWVEAQLSPAQADTVDIGTQALVRV
FT                   EDKTLQGEIIGRSHEIDSITRTEQVLLRIANTEHQLHAGQFAELYLTSGAGAKANPMGI
FT                   VVPDAALTRSGDGDWQVFIEDEDGFEAVEVQVVERQRGLSLVRGLDDNAKVVVSGAFFL
FT                   ASELAKSGFDIHNH"
FT   sig_peptide     650744..650854
FT                   /locus_tag="Sden_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.774 at
FT                   residue 37"
FT   gene            652017..655250
FT                   /locus_tag="Sden_0576"
FT   CDS_pept        652017..655250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0576"
FT                   /product="Heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53866"
FT                   /db_xref="GOA:Q12RR0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RR0"
FT                   /protein_id="ABE53866.1"
FT                   /translation="MLQKLIQAAVANRLLVVIALVCALLASLAALPKLNLDAFPDVTNV
FT                   QVTINTAAEGLAAEEVEKLISYPVESAMYALPAVTDVRSLSRTGLSIVTVVFAEGTDIY
FT                   FARQQVFEQLQAAKEMIPTGVGVPEIGPNTSGLGQIYQYILKAEPDSGVSAFELRSLND
FT                   YLIKLILMPVSGVTEVLSFGGDVRQYQVQVDPNKLSSYGLSMTQVTTALESNNRNAGGW
FT                   FMDQGQEQLVVRGYGMLPAGNEGLLAIGQIPLTEVKGTPVRVADIAKVAFGSEIRVGAV
FT                   TMTRRDANGDAEKLGEVVAGVVLKRMGANTKSTIDDIKARVKLIEQALPRGVSFEVFYD
FT                   QADLVDQAITTVRDALLMAFVFIIIILALFLVNLRATLLVLLSIPVSIGLALMVMSYFG
FT                   LSANLMSLGGLAVAIGMLVDGSVVMVENIFKHLTQPDRRHLKAAQMRADGEADPYHGYE
FT                   DGALPASEHEIAFDENHEPNMALRIMLAAKEVCSPIFFATAIIIVVFAPLFALEGVEGK
FT                   LFQPMAVSIILAMLAALLVALIVVPALAVFLFKKGVVLRQSPLLVPLESGYRKLLTATM
FT                   ARPKLVILAAAGLFVGSLLLVPKLGTEFVPELEEGTINLRVTLAPTASLETSLAVAPKI
FT                   EAMLLEFPEVSYALSRIGAPELGGDPEPVSNIEIYIGLNPIESWTTADSRLALQREMED
FT                   KLKVFPGLLFTFSQPIATRVDELLSGVKAQLAIKIFGDSLDVLATKGQVLSDLVAKIPG
FT                   AVDVSLEQVSGEAQLVIRPKRDSLARYGISVDQVMSLVSQGVGGVSAGQVIDGNARYDI
FT                   NVRLAKSFRQTPDAVQDLLLVGANGATVRLGDVASVEVEMAPPNIRRDDVQRRVVVQAN
FT                   VAGRDMGSVVADIYKIIPEAQLPAGYTVVIGGQYENQQRAQQKLMLVVPISIGLIALLL
FT                   YFSFGSLKQVGLIMANVPLALFGGVIALYLSGTYLSVPSSIGFITLFGVAVLNGVVLVD
FT                   SINQRRQSGESLYESVYEGTVGRLRPVLMTALTSALGLIPILMSSGVGSEIQKPLAVVI
FT                   IGGLFSSTALTLLVLPTLYRFLYQAKRNS"
FT   sig_peptide     652017..652106
FT                   /locus_tag="Sden_0576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.941 at
FT                   residue 30"
FT   gene            655483..655746
FT                   /locus_tag="Sden_0577"
FT   CDS_pept        655483..655746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53867"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ9"
FT                   /protein_id="ABE53867.1"
FT                   /translation="MLNENHALIFDFPEFKQDIVYLNYKKPEFQALSKQYHLLDYDIRQ
FT                   LEVAGSPTDDEHMHALKVRRANLKDVLFQQLKAHHDEAVATN"
FT   gene            655984..656364
FT                   /locus_tag="Sden_0578"
FT   CDS_pept        655984..656364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0578"
FT                   /product="transcriptional repressor, CopY family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53868"
FT                   /db_xref="GOA:Q12RQ8"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ8"
FT                   /protein_id="ABE53868.1"
FT                   /translation="MARKKSSQLTDSEQSIMEVLWQKGEASVRDIADALSEDKASAYTT
FT                   VQTMCKILVEKGYAEFRKEGKAFIYAPTMTQKEARQGALASLLNRFFGGSPEVLAQHLM
FT                   QETDIELKDLAALQRQIDASKD"
FT   gene            656391..658016
FT                   /locus_tag="Sden_0579"
FT   CDS_pept        656391..658016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0579"
FT                   /product="peptidase M56, BlaR1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53869"
FT                   /db_xref="GOA:Q12RQ7"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ7"
FT                   /protein_id="ABE53869.1"
FT                   /translation="MMTELTLFTTLAFHHLTIGGLLSLGLLLTLKLVPSSAELRSWLWM
FT                   TVFVLVTLVPFSLLSFNESAAVTNSASSQGASQVLAISGTQVIDARPNTGPIKFPLAEQ
FT                   GWHLSSAVVFMLSPLLQGFLVIWLLGSVWRGYHFCVSLVRTWRLLGRSKMGLAAHLQAE
FT                   INDKHIALDTRLNAFAVPRISLCQGVSSPLVTGLWSPKIIIPLSLARQLSVEQLIPIVL
FT                   HEQAHIQRKDIWCGLFQEVIAILFWWSPVIRFLNKKIHIDRELACDIRAAKQLTGKQYA
FT                   QSLLDCAKLMIQEQRSVLTMGLFSKKKELVYRVDQVLQKNAFTQVNKFWVTALCLGLSV
FT                   GSIQAATSLSPKIIVSEARADGKQYSLLPQTQGQRLVDAVLNNDIATIKTMQNAGVDLD
FT                   IPAIGDGTALMVAVQKHNLTMVQALLSLGVNVDQPSIGDGNPLIVAAMVNDLEIAKVLL
FT                   DAGADVNAIVHHDETALINASYRGFMEMTRLLVERGADVNLAVKTGPGDGGEIRSPLNR
FT                   ARNQQIKDYLISQGASQDGVLARR"
FT   gene            658192..659604
FT                   /locus_tag="Sden_0580"
FT   CDS_pept        658192..659604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0580"
FT                   /product="membrane bound O-acyl transferase, MBOAT"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53870"
FT                   /db_xref="GOA:Q12RQ6"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ6"
FT                   /protein_id="ABE53870.1"
FT                   /translation="MIFNTPIFFWFFCIFILFYGFVFLKQTPRVYLILVGSLVFYGAWN
FT                   YSFIPLLVGSGIADYFIAQAIANSQQQRIKQYWLGLSIALNIGILAVFKYADFALNSVA
FT                   SLLDVLGYQPSLGTLAWVLPVGISFYTFQSMSYTIDVYRGEIKPRKGLVEFVAALSFFP
FT                   QLVAGPILRAKHILPQMHAIALPKWDAVKHGFLLISVGLLKKTGADLLAIPANKAFEAE
FT                   EALSTLEMWTGVLAFTGQIYGDFSGYTDMAIGIALLLGFSIPLNFRVPYFALSPVDFWR
FT                   RWHISLSSWLKDYLYISLGGNRNNHRARNIFITMLLGGLWHGAAWTFVAWGAFHGAIIT
FT                   ATHYLGSLKMFNGFSQSNALTTKFVKWAITFYLVMMGWVLFRAVDMSSALLIFTSLHDV
FT                   GSNVVMGKHAMTIFTMTAIWVLLVHVMDFYVINAADKLENQPWLFWSLIILIQTLCLLI
FT                   GEPSNEFIYFQF"
FT   gene            659579..660874
FT                   /locus_tag="Sden_0581"
FT   CDS_pept        659579..660874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53871"
FT                   /db_xref="GOA:Q12RQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ5"
FT                   /protein_id="ABE53871.1"
FT                   /translation="MSSSTSNFNPAIGPEGVAVAASGTESTASQLGINHAEPRRLFANL
FT                   LLAIILVSLLSMGLVRVFYEYIDANKGGVLGRVHQAQLALERITSEPDDLVMFYGSSMT
FT                   QAGFSPRKFDKEVNSLNESTSGKNIKSFNFGFGGLNPYFQDLLSRRIAEGFQAKDKRLK
FT                   LAMIEFNPFQSTKARWQGAASSLDSFVTMLATDKEMLAMALDDVTRGVRLFNIKYVRNQ
FT                   ISAEMITSYYGHELFPPERKQVFKEAEAVVKEKRALGKQISEAFEREYPNYQGEQWSYD
FT                   WQGGGTIPEERSSETLALVKEYSAVAYTDVYMKNDRLSRIRSADIEGLDFEPLLIESFI
FT                   NTVKNFQSISDKVAVIMLPRNSRWIQYSPETQARLDAAVAQIEAATGVKVVDHQQLEGI
FT                   DDKMFRDTTHLDRYTGDIAYTDILIRDFGRAL"
FT   gene            complement(661252..663381)
FT                   /locus_tag="Sden_0582"
FT   CDS_pept        complement(661252..663381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0582"
FT                   /product="TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53872"
FT                   /db_xref="GOA:Q12RQ4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ4"
FT                   /protein_id="ABE53872.1"
FT                   /translation="MNHTFSVISLAVVGSLLSLPLVAFADDGIERIAIHAERMPSELNA
FT                   IARSVSVIDENMLRQQFATANNLAEVLAKVVPGMAPPSPALSNFGTTIRGRNALVLIDG
FT                   VPMNTNRNISRDLHNLHPSQVARVEIFRGGNALFGSGATGGVIYIHTKTGQAESQQHSR
FT                   IGLKSSLNELSGDALSYLVSHASSGEAQGWLYRVAGSTEKTNGYYDADGDRLAPEPSQG
FT                   DSYDSPIYSLDTKVSKEWDNQKLTLSALWYSLEQDSDYASDPSAATEPYITKARAIKGL
FT                   QLDKQNEIKNLVLNAQYQRLLTEDATLHTQAYYRDYAARFAPFDGRPFATWDHLAQTYL
FT                   ESSNIGLRITINTQLSDSIELDWGLDTNDERSEMPVTTYDGQVYDDSNGLVFQPLGDKD
FT                   FVPEISHKSLAGFTQIRAKISNQFSVEGGLRYERIDASFKPFVTLGSQTAVPGSSYDYS
FT                   SFVYNLGGTYNINDDHTLYFATNEGYDLPDIGLQIRYASSQFDLSQSNLEPVETTDYEL
FT                   GWRGVVGPIAANFAYFTSSSDLGNVKSENMGLALSRNKVRIDGFEASANYQINTAWSVD
FT                   INYSYINGEEKPDGKIDYTTMNGFSIPPNKLAAVLGYESDSGWNSQLTWLNVAGKDYRL
FT                   DGKNAFGRRDTESYNVLDWQNSFELGAGMLTIGIENLLNEQYFSLYSQLQRNSNNTSSI
FT                   PGRGRTLSLQYQFNW"
FT   sig_peptide     complement(663304..663381)
FT                   /locus_tag="Sden_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            complement(663507..663899)
FT                   /locus_tag="Sden_0583"
FT   CDS_pept        complement(663507..663899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0583"
FT                   /product="ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53873"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ3"
FT                   /protein_id="ABE53873.1"
FT                   /translation="MLNKTLSFLVPSTLKPNEEILPDRVAWLSKKIQTEQLWRVPITVD
FT                   SRSMSIMDGHHRYTVAMQLGLAKVPCLLLSYEEVEFWSTHPNIQLTPHMVVEYANKGIR
FT                   LPPKSTRHQFKTPLPDCNVSLKLLFD"
FT   gene            complement(663889..665106)
FT                   /locus_tag="Sden_0584"
FT   CDS_pept        complement(663889..665106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0584"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53874"
FT                   /db_xref="GOA:Q12RQ2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ2"
FT                   /protein_id="ABE53874.1"
FT                   /translation="MVNSKLIGDYIAEQHSEVCAFIYDLDQLSAHIRTMTSRLPKQVDC
FT                   YYAIKANSDSAILRALLPHVYGFEVASMGEIEKVRAISQNVPIAFGGPGKTITELTRAL
FT                   TLNVQLYHLESELQLARLNQLAKEQNQLVRCLLRVNPYFDLPSATLQMAGQATQFGIDE
FT                   RELLALLPRLGDYPNIQVEGLHFHCLSNNLDAVKHVTLVRHYLQTASTWAAQFGLTWTT
FT                   VNIGGGIGVTYQGETEFDFPLYAEQLTLLCRDYPQLHLATECGRYISADCGVYLTEVTD
FT                   IKLSHNEYFAVLRGGTHHFRLPSSWQHSHPFKIYPRETWHYPFTRPSVTDTAITLCGEL
FT                   CTPKDVLAKNVHVAQLKVADVIVFQKAGAYGWHISHHDFLSHPHPQRLYIKENQFMKNG
FT                   DDHVAQ"
FT   gene            complement(665099..665878)
FT                   /locus_tag="Sden_0585"
FT   CDS_pept        complement(665099..665878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0585"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53875"
FT                   /db_xref="GOA:Q12RQ1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ1"
FT                   /protein_id="ABE53875.1"
FT                   /translation="MTPLALKQRLSSASPTFGVFSSIASCVAFEQLALAGYDYVIIDVE
FT                   HTLFNPAQLDSLLLAAKASGISALVRIPNSRWDWIAPLLDAGATGIIAANIKTAAEAEA
FT                   LVAASYYYPLGKRGLNSTRFNGYASQDLAASNTAANTKIVLIAMIESREGLANASAITA
FT                   VTGIDAILEGAADLSQDLGLPWQTQHPDVKSALQDLQTVCARQSCGYIALPRQLPDISQ
FT                   WRMRGIHHFVLGDDRSIMRRAHQQHLNAYLQEYQLGG"
FT   sig_peptide     complement(665792..665878)
FT                   /locus_tag="Sden_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.853 at
FT                   residue 29"
FT   gene            complement(665875..669321)
FT                   /locus_tag="Sden_0586"
FT   CDS_pept        complement(665875..669321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0586"
FT                   /product="IucA/IucC"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53876"
FT                   /db_xref="GOA:Q12RQ0"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RQ0"
FT                   /protein_id="ABE53876.1"
FT                   /translation="MIWTSLQKKLSEQYLNTYFRELEIDLAQYGDKHHAYRVPLTDGIT
FT                   QLCFSINHFSSSGYHSYHYPIQLQQGSSINSITDVDQLVSLLCDALTTISHPAATQQLL
FT                   GSIRNSLAQSTYFTEARRSLVHMGTIAGDFIAAEQGLLLGHPFHVTSKAMQGFNDADLR
FT                   RYSPELGAAFKLHYFAVAPTLMLERPLQGSEIPQDSSAVTAANALLASAFQHYTLLPCH
FT                   PWQANYLLDKPELQPYLRDESILSLGPLGETVWPTSSVRTVFAPNLGLFIKLSLDVRIT
FT                   NFIRNNPPSHLARAMDASDYLCQHQLCDAIPGLLVLPELGAHSLAITGLEASFAVLYRQ
FT                   GLTPAQTRHTRVVASLVEECPLTGQLPLAEFICEAAADHGTTPNAEFVCSWWRAYVYAS
FT                   LLPALQLFAKSGVSLEAHLQNSLMLFTNGWPTTLVVRDMEGASIAPRAEFALAPDSHAS
FT                   YTESQAWFRFQYYVLVNHVAHVLSAIARHFPVRETQLWQVCAEILRDKHLAMALQPYCK
FT                   QLLQATHLPAKGNLLSTLKGCGEAPVWVNIPNPLALLNDVYISPSAWQRSESRVLSQLL
FT                   EALCYEQLLSLDWHGGIAHIRITPTLAYQFKADYTAHFNRLRIDPNSLIRLAEHHYQQP
FT                   SLATLLKDLGQLQLTDQHAWLRFSDELYQTTAKHAQVLAADAHGLLRDLPYVTLEAKVN
FT                   NGHLYHPSFKSRLGFTLADNAQFGPELASPFTLQWLAVSKSQARFNALAEYADGTLLLQ
FT                   SFTTAQQRELSRELATQGLSLDTVYLVPVHPWQWQHIGALYFARVPGVYTLKCNGPHYL
FT                   PQQSIRTLSHADHPQSLSVKLALSITNTSTSRVLAPHTVANASAISDWLSLCVADNFAW
FT                   QQVRKPLLLREVAGLSIAGQNALPAEYGALACIWRESIESKISTMQRAVPVTSLTQLDN
FT                   DGQPLIAPWIAKHGLSHWLQQLIDVAFIPVMHLLWHHGLAMESHAQNMILVLENDLPVQ
FT                   VALKDFHDGVRYNPAWLANPDLLPQLTDAPAAHAAVNPNSFLVTTEADELRDFTQDALC
FT                   FVNLGELGWFIEQHFGLSGEAFWQSVAKRVMHYQTKHPELKARFALFDFFAPQIAVEQL
FT                   ASRRFLPEQRLRVMAVDNPLHIAQQQMAFNMTKNSRNEVTR"
FT   gene            complement(669318..670496)
FT                   /locus_tag="Sden_0587"
FT   CDS_pept        complement(669318..670496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0587"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53877"
FT                   /db_xref="GOA:Q12RP9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP9"
FT                   /protein_id="ABE53877.1"
FT                   /translation="MRNTFYTLLCIQFLVTFALMLLIPVMPLYLQQLNNNVPLSGFWSA
FT                   AAIAAPAIGALLSAPMIGKGCDRFEKKTMLMLTQCLFVISLFAMALASSLISFLVARLL
FT                   LGFAGISVVLTVYFCHASYQSEALQLAKQQRAIALACLFGPLVGGYALDSLSMHALLLF
FT                   SAISSAVLLGISTVIVRDLVQPQPPAEPSVINARLWSWPLVGWLAAGCAVQAAAFALVV
FT                   AFALYYQAQWPGTEHIASQIGALHATAWLATFLFAGFWGKRNQSGNPRFNFMLASAGCG
FT                   LALLCIPWVNQLWLFMLARFCQGACFAALPQTLFLQISKICPINQRGAALGLARSSQVV
FT                   GQLLGPLSVALVYDQFGANSVLWPVVLWFFAGSCFVILPTLFTSTSFKVTSI"
FT   sig_peptide     complement(670404..670496)
FT                   /locus_tag="Sden_0587"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.722) with cleavage site probability 0.543 at
FT                   residue 31"
FT   gene            complement(670489..672183)
FT                   /locus_tag="Sden_0588"
FT   CDS_pept        complement(670489..672183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0588"
FT                   /product="putative siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53878"
FT                   /db_xref="GOA:Q12RP8"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP8"
FT                   /protein_id="ABE53878.1"
FT                   /translation="MQHWQTAQLNSLIAALYLENFANFRHFCHLDGEKLLITLDPSRTL
FT                   KLSVRQPTRATCLLPMVIKDESVILIVEGGEHASRVTLYDMLNVLTSAHWWPESTQAKA
FT                   INLWHQALQGRTALANLPALSSVSLEQASLSETTFETVMEYRAMQIDRPNHPFAHAKGS
FT                   LQALLGQSSTEIDWWALPKEHIFTQQITGPAMALLNREQQHDIAVKMRALFAEDATLYL
FT                   ALPALKSERPIISLLPAAVCLNTQTLVQSTTSSLRSFQFTARQHVKFATSQTTLGAKRT
FT                   MPPRYLHNGDAAYQLLQALVLRSAVVADLLQLCDERAWWSTGSEHNLIACQGEFAVQMR
FT                   SFPATGLAKLPRFTMAALNHPQSWLWLKAQGFSLPALWMQLLTGFVQLHLTLWQYGVLP
FT                   ECHGQNLQVWLDDSGSWRFILRDHDTLRICPTQLQHQGMEVPDYKINWHTPNTLVLPDL
FT                   AALLAYFTTLGVQVNLYPIAKALESIGEYHETQFWQQLRECVANVAKTLPTEERTVLES
FT                   NLLHAQEWPFKAIIAPLLHANESATGMPSALYRIDNPLIAHSKELYA"
FT   gene            complement(672199..673212)
FT                   /locus_tag="Sden_0589"
FT   CDS_pept        complement(672199..673212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0589"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53879"
FT                   /db_xref="GOA:Q12RP7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR023866"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP7"
FT                   /protein_id="ABE53879.1"
FT                   /translation="MNITTELRYLSQSDIRLLGGDHSHAFMSAIEEGLRLHAKRQFVQP
FT                   LKPYLRWPDAPHIADRIIAMPCYLGGDNPIAGIKWIGSRQHNPTKHQLPRASAVIILND
FT                   AETNYPVAILEASLISAMRTAAITGIATKYLAKENFKEVSIIGCGPIAQMQVQTLLEQY
FT                   PQIMIVNLYDLNPAAADMLISQFATRFPNVHFTIQASAEAAVKCAEVLVTCTVSDAPYI
FT                   PFSWLQPGCFVSNISIMDIEKDVFLKADKVIVDDWDQSNREKKVINQLVEEGLFSREQL
FT                   HAELGDILTGEVGGRDNDDEIILLNPMGMAIDDIVCARWFYQAALAKDIGTRLPLF"
FT   gene            complement(673241..674251)
FT                   /locus_tag="Sden_0590"
FT   CDS_pept        complement(673241..674251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0590"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53880"
FT                   /db_xref="GOA:Q12RP6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR023927"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP6"
FT                   /protein_id="ABE53880.1"
FT                   /translation="MFETIHSSILSCIGNTPIVRLERLFADYPQTVLTKLEMLNPGGSV
FT                   KDRPARYMLEQGIANGTINDNSHIIESSSGNLAIALAMSCLQLGLLFTAVVDPKISPTN
FT                   LKLLEIFGAKVVQVTEKDCNNGYLLTRINTVNQLLLSTPNAVWINQYANPDNWRSHYYG
FT                   EAEEILQQVAAPIDYLVIGASTSGTLMGISRRLKEAYPQMRVIAVDIVGSVLFGGHSAP
FT                   RELPGIGASRVPELLNASEVDDVIYVDDYESAMACHRLVKTESIFAGGSSGSAVAAIEK
FT                   LLPQIPANSTILTLFADRGDRYLDLVYDQDWLNMVKANHEQSLRAQTPFLIEKTA"
FT   gene            complement(674594..675133)
FT                   /locus_tag="Sden_0591"
FT   CDS_pept        complement(674594..675133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0591"
FT                   /product="protein of unknown function DUF1697"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53881"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP5"
FT                   /protein_id="ABE53881.1"
FT                   /translation="MQTYIILLRGINVGGNNLVPMKALTQVLLDAGFCQIKTYIQTGNI
FT                   LLQSPHSSHESDGAQLEQDIAKLIHTHFGFTPDIMQLSLSEFSTAAANNPYQDKPGNTV
FT                   HCYFCQQLPSPDEARLKELATSTEEYRIEGRVLYLHAPDGIGRSKLAANIEKCLKVPAT
FT                   ARNLNTVNKLLDMVNT"
FT   gene            complement(676167..677183)
FT                   /locus_tag="Sden_0592"
FT   CDS_pept        complement(676167..677183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0592"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53882"
FT                   /db_xref="GOA:Q12IK6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q12IK6"
FT                   /protein_id="ABE53882.1"
FT                   /translation="MKITTVGLDIAKSVFHFVGVNKAGKLVKKKMIKRKDLLHFLAQIE
FT                   PCLVVMEACGGANYWAREFEKVGHQVKLIAPQYVVPYRQGNKNDYNDALAIAEAAQRPN
FT                   MRFVQPKPAEQQDIQMLHRMRERLSKQSTALVNQVRGMLAEYGIVITKGKASFRSKLPD
FT                   ILENADNELTAKGRSIFYQLYEEFNGIEERLKRCDNQVQQETKNNHVCQRLESVPGIGP
FT                   VTATAFYAAVGEGKDFTNGRHFSAWCGLVPKQHSSGGKDNLLGISKRGNAYLRTLFIHG
FT                   ARAVLYHSDGKGDRFSRWAIALAERRGFNRACVAVANKLARIAWVIAAREDEYRMAV"
FT   gene            677345..677656
FT                   /locus_tag="Sden_0593"
FT   CDS_pept        677345..677656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0593"
FT                   /product="putative glycine betaine/choline/proline
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53883"
FT                   /db_xref="GOA:Q12IG1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12IG1"
FT                   /protein_id="ABE53883.1"
FT                   /translation="MTRKSAVHISPLQKLEYAKLMVEQGYTNKQIEDMSGAGKSAVSRW
FT                   KVQYQAELAGETPENAKALTEDQRRIQLLEAQLKQAMRDNDILKKAAAFFIRDNQNLK"
FT   gene            677653..678504
FT                   /locus_tag="Sden_0594"
FT   CDS_pept        677653..678504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0594"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53884"
FT                   /db_xref="GOA:Q12RP2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP2"
FT                   /protein_id="ABE53884.1"
FT                   /translation="MMREVKKANPEFKVNELCRAFEISCSSFYYKPIPLSIKKQSVMQL
FT                   VEEVFTDSYSTYGKRRIQAELLDLDCRVGVYAISTVMKNLGLRAIRPKKKHYYPNQGEE
FT                   QVYAPNLLRRQFNPTTYNTHWVGDITYIKSHQGWSYLACVLDLGTKEIVGYALSSQPNA
FT                   ALATAALNNAIQRKRPNTQALMFHSDQGCQYSAKVFRERLKHLGIEQSMSRRGNCWDNA
FT                   VMERFFRSLKTERLNHLAFINHSAVVSVVEQYIQFYNYKRRHSAIDYKTPHQKYNELKK
FT                   AA"
FT   gene            complement(679734..680108)
FT                   /locus_tag="Sden_0595"
FT   CDS_pept        complement(679734..680108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53885"
FT                   /db_xref="GOA:Q12RP1"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP1"
FT                   /protein_id="ABE53885.1"
FT                   /translation="MLKVHKFVRFSALIREFRIRYSISNAPKQFASGNKSVNRCITKRG
FT                   DGYLRKQLIHGARTVVSHASKKNDDLNQWITQLRNRKSICTTVVATAHRLARLMWILLH
FT                   KQVPYAPQYGAYQGISHEAN"
FT   gene            680712..681218
FT                   /locus_tag="Sden_0596"
FT   CDS_pept        680712..681218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53886"
FT                   /db_xref="GOA:Q12RP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RP0"
FT                   /protein_id="ABE53886.1"
FT                   /translation="MRNWLKTILFVSAFSPTLLVLAGVRYYSGIVDALLYQLIVISLIG
FT                   ITLPFLILSWVKGQTESLNFTAKKVESADYYLLVFLGSYASPIIMKIAEIDFGLMLLTV
FT                   GVIFLVAWVVSNIPSHPVLYLAKFRFYKIESESGMVYTLITRREIRSPKNITVVKQISN
FT                   SMLME"
FT   sig_peptide     680712..680780
FT                   /locus_tag="Sden_0596"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.973 at
FT                   residue 23"
FT   gene            681222..682103
FT                   /locus_tag="Sden_0597"
FT   CDS_pept        681222..682103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53887"
FT                   /db_xref="InterPro:IPR032359"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN9"
FT                   /protein_id="ABE53887.1"
FT                   /translation="MTLSLFALTSDPAKRIVKFNLSNDVQADLTTYLKDQESSFDLQQD
FT                   EIVFDGKYKPDAGEVLCIENYDDIDNLESAIRNPTSLDLVDPSEDFFHYIKALFSGYIL
FT                   ETGGVKVLLQNFDRRKIISTNGLSIFHSANVYKKIEGIGLTIDHKLTATLEEGKLKFFS
FT                   FHNTRQIFDLSEYYKEATDDDVIEFSNMDLIKSADNSQLLEMSDSWVRRKISLIQQSGI
FT                   LQNVPINEMKAVATEFSIPFITITENGDELIKIPDNKSDLKKLLRFLDEDYYKSPLSKT
FT                   NFITNSKRVLGN"
FT   gene            682614..683738
FT                   /locus_tag="Sden_0598"
FT   CDS_pept        682614..683738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0598"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53888"
FT                   /db_xref="GOA:Q12RN8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN8"
FT                   /protein_id="ABE53888.1"
FT                   /translation="MYIESFKQHFSAIDDHRQSAKVTYPLFDVLFGSLCAVIASSNGWF
FT                   EIREYILGHHSWFKKQKMFIDGIPADDTIARIVSMIDPDSFNACFLAWMKSVHQLTNGE
FT                   VIAIDGKTLRGSYNRDDRSSTIHMISAYASANKLVLGQLKAEQKSNEITAIPTLLKMLD
FT                   LRGALVTIDAMGCQTAIATTIIDKGGDYLLAVKNNQGNLAKAVNKAFSPHRSAGLSDDH
FT                   VNIEKSHGRIENRTCYVLSSAALDGDFTHWEALKSIVMVESFRAVKGKTASLEYRYYIS
FT                   SKVLSAEQALSATREHWGIESMHWVLDVSMNEDECQIYKNNGAENLAYLRHMSLNMLQK
FT                   EPTKLSIVGKRKRCLMNPAFLEKVLIAGLCAPTK"
FT   gene            683738..684001
FT                   /locus_tag="Sden_0599"
FT   CDS_pept        683738..684001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53889"
FT                   /db_xref="GOA:Q12RN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN7"
FT                   /protein_id="ABE53889.1"
FT                   /translation="MNTHAVAQGEGPIQYGFIGLLIANTLLYPYSRFVYENVVGFILGR
FT                   QVFFVNAIFMLVVKLFTMALCWCLAIFIAPIGLLYLYFRNSK"
FT   gene            complement(685061..687187)
FT                   /locus_tag="Sden_0600"
FT   CDS_pept        complement(685061..687187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN6"
FT                   /protein_id="ABE53890.1"
FT                   /translation="MTADLPLILAGPFLRHCDNDNFTLCWVSREPLTELKLTLAAKQHS
FT                   LTSEHLQEFALGDKAFYYLLHLTQTDLLPSNQGISYHLSANGHSDVFASISELTYAAQI
FT                   PPTTEPANADGTEVDGTDTVNKAQSTKALANSANGPVFYIKPDIVDMLHGSCRNPHHHS
FT                   DDALKAADTRLSQDLSLEARPSLLMLSGDQVYVDDVSGPMLFAIGQVITLLGLKQECFE
FT                   GAKIADSEALDYNPGSMYQRHNKLLPHTQYPAKTALWRWYRNHPIFTSSMAENHLLSLA
FT                   EVIALYLLTWSPSLWQCVDIPQHATELNKLASQRWNKQYQYLMVFVEGLGQVRRLLAHL
FT                   PTYMMFDDHDVTDDWNLTARWEEAAYGHAFSKRIIGNALIGYTLFQGLGNNPDKFKLEL
FT                   LPLIHKLFSQANTLTINTNSHSIDAACTDQNAAEVASENTPGKTAVKTAGETAAEKADE
FT                   TVGPQDVLIQALLKFEHWHYSLATSPKVVVLDTRTRRWRSESNLAKPSGLMDWEALMDL
FT                   QQELIDQDKVIIVSPAPIFGVKFIEAIQRTATLIGGSLLVDAENWMAHPGAANALLSIF
FT                   MHRKTPQQFVILSGDVHYSFSYDIRIRFRHGSPHIYQITCSGIKNQFPEKLLPWFDKLN
FT                   GWLYGHFSPLNWFTKRKRMLIRGRRPNGHSSQRLVNRSGLGILTLAENGAPKQISVLHS
FT                   DLSQTIFEPPRNER"
FT   gene            687553..688941
FT                   /locus_tag="Sden_0601"
FT   CDS_pept        687553..688941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0601"
FT                   /product="ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53891"
FT                   /db_xref="GOA:Q12RN5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN5"
FT                   /protein_id="ABE53891.1"
FT                   /translation="MKEASILSKREASAVKMLSRGLGSADQLALLRALGWLLQLLLTLV
FT                   GEQAFGLSLQLTPLTWVLGLAFGYLLVTLWYRKGLFLHETGLFSVLLIDTLLWTAWLYF
FT                   SGGATNAFISLLLLPIALAAVTLPLWAAWSLTALSTLAYSLMIFFVPSFDTGGAPSTSE
FT                   HAAMGHEMMAHMAHGTMDMGSHYVGMWLNFVVSALALTTSVALIARRMRKQDAELAYHR
FT                   EAQLTQEQLLALGTASAQMAHQLATPLSSLRLLLDEAKESPQALAYQTQTAEEMDLALG
FT                   RCEHTLKELRLATENIRSQHMAKQNLADLINALQHSCLLFMPQAKISWPDTLSSGLAAI
FT                   ELNTDPSVVPALMALIDNGLRASMDNIQQPKVSITVALQAAGQGIGLRIRDFGQGIAPA
FT                   LLAQLGNRLVQSPKGLGAALLLSHASIERLGGQLILAQHPQGGTVAEVRLPTVNSETGT
FT                   KRTA"
FT   gene            688938..689489
FT                   /locus_tag="Sden_0602"
FT   CDS_pept        688938..689489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0602"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53892"
FT                   /db_xref="GOA:Q12RN4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN4"
FT                   /protein_id="ABE53892.1"
FT                   /translation="MKRLLIIEDDQGLAAILSRRMARHGFECQLSHDASDALLTARHFQ
FT                   PSHILLDMKLAKDNGLNLIVPLRNLLPKTMMVLLTGYASIATAVEAMRLGANNYLAKPV
FT                   DTHTLLAALDVNKDAMQGETKSDEQDDLPLNPKRLEWEHIQQVLSANQGNVSETARQLG
FT                   MHRRTLQRKLLKKPVSSLSN"
FT   gene            689545..690504
FT                   /locus_tag="Sden_0603"
FT   CDS_pept        689545..690504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0603"
FT                   /product="lipase, class 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53893"
FT                   /db_xref="GOA:Q12RN3"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN3"
FT                   /protein_id="ABE53893.1"
FT                   /translation="MTTAYLTSINATDKNKVLQLMEASLQAYQAFNTQDPMDCQLDGLI
FT                   PPQGFEYVDYWTGVDAIFNRDKTLECYGVVFRTLKAPFKYIFAFRGTASFLDVLDDLGT
FT                   EKRLFVPFDVTQAVPAQVQVESGFFDVYSDSKSDSQAPTPSMQQQVFSLLDKYNASDKP
FT                   IAELLITGHSLGSALSELFTLDVAVSRPKIMASNINFACPRVGNSDFVQFYMQQGAQQD
FT                   PSRQTLRVQNTYDKVPCVPPTLMGYQHIPHALLIAFHKDSLLGKFDFLDSHASANYSAV
FT                   LIAAAKNQQGVCVDERLPVGATDFISSQAPNPNTIGLL"
FT   gene            complement(690603..691763)
FT                   /locus_tag="Sden_0604"
FT   CDS_pept        complement(690603..691763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53894"
FT                   /db_xref="GOA:Q12RN2"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN2"
FT                   /protein_id="ABE53894.1"
FT                   /translation="MQYDASIMQPLVRNVGESIGVSAQVDMLSPKDEGRFQSSVPIENM
FT                   VWIENFLKGEAFNQGLTAPAWPFEPISESDENYKFGKDLYQQRCQGCHLPVISDPALLA
FT                   HLTPIEYRQDGQRLQTEEKVLDLVIIPQQDIGTDPAQGNILKTRLIDTSGKEQGRTDRQ
FT                   TSGLGLDAVLCSLDTQQVLNNQLFESENPQNVDLINGIKMSDGGDANFALALGSTVEQT
FT                   ILAWYKENVISDPKLIEKLSGGRPNCLQAGQGYKARPLNGVWATAPYLHNGSVATIKDL
FT                   ICNTQQQRPKFVLLGDIRFDADNLGLYQAPKLQNIAKQTLATGKLYTDEGYFILDTSLG
FT                   GNSNQGHSFSDEFNPALPHNKQSTGVIGEKFTDKECEAILDYLKMI"
FT   gene            692028..692264
FT                   /locus_tag="Sden_0605"
FT   CDS_pept        692028..692264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0605"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53895"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN1"
FT                   /protein_id="ABE53895.1"
FT                   /translation="MPNCDQHDAFGKAEQLRQQIEQLNPQGIHTTASFGISDLTSMPDD
FT                   ACFDTLLKITDYALYRAKNEGRNRVFTISMAQS"
FT   gene            complement(692383..692793)
FT                   /locus_tag="Sden_0606"
FT   CDS_pept        complement(692383..692793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53896"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RN0"
FT                   /protein_id="ABE53896.1"
FT                   /translation="MNKIILTLVLSLLSLPIFAEVVVIAHPSNGDTFDRKEIENIYLGK
FT                   SRTFPSGAAVLPLNLDNSVPAREAFDSKVLNKTSTQIKSYWAQKVFTGKGTPPKEVGSV
FT                   AEMLELVAANPSIIGYVDSSDATDAVKVIGKF"
FT   sig_peptide     complement(692734..692793)
FT                   /locus_tag="Sden_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            complement(692803..693879)
FT                   /locus_tag="Sden_0607"
FT   CDS_pept        complement(692803..693879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53897"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM9"
FT                   /protein_id="ABE53897.1"
FT                   /translation="MKNKIALGICSILLSTTAYAEVNVSGFASVVGGQVLDGTGVAEFD
FT                   LGPTFLADYPLVGKYEEEITFDPDTLFGLQFSADLMDGLRATAQVVSRGANDYSASFEW
FT                   AYLSYELNDNWTVQAGKKRLPLYYYSDFFDVGYAYVWIRPPADNYTWQIFNYTGVSGLY
FT                   NYVVGDWTVSGQVYFGSEDSEPNKLLSEFFFLENTREIWKDIKGIVVELNKDWFELRLT
FT                   HMQYTNERYIGGVQQEWNGSTERTGKFYGLAANVEYDNYLILSEINRLVLDNTNLDTYL
FT                   ITFGYRIDSVMPYISYSNFDDGEDGEVHNTTSVGIRWDFHPSAAFKIQYDDVKDKGGPG
FT                   LKVAGDATAISVGVDVVF"
FT   sig_peptide     complement(693817..693879)
FT                   /locus_tag="Sden_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            694114..694452
FT                   /locus_tag="Sden_0608"
FT   CDS_pept        694114..694452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53898"
FT                   /db_xref="InterPro:IPR022172"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM8"
FT                   /protein_id="ABE53898.1"
FT                   /translation="MKVNVKRAFIAEMDSAQQLYEQGQFTKAFFHLERAHILGQAYVIP
FT                   HTQSHWWMLKVGLKTHDAREVLGQIPRMLASVIFSRIWVPVGNTGGAKVSPFEPMAIPE
FT                   DLKAILQK"
FT   gene            complement(694523..696655)
FT                   /locus_tag="Sden_0609"
FT   CDS_pept        complement(694523..696655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0609"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53899"
FT                   /db_xref="GOA:Q12RM7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM7"
FT                   /protein_id="ABE53899.1"
FT                   /translation="MLNSKNRFRLTSVAMAITMSFTATVVAAEAKKIESTPEVIVVSGS
FT                   VLGNSEVADLKTYTGNRSIITSDQIERTGVHSIDSALQQVPGLKIKDETGTGILPNISV
FT                   RGLDSSRSGYAQVLLDGIPMTLAPYGHTGQSLFPATLFMIDRIDVARGGASVQYGPNNV
FT                   GGVINLISKPIPDDWETHLHERMTFFGEGQTLFDTNISTGGAVNDDFALRLDGNITKGE
FT                   SFREHSDTDIKNLLLKTVWNIDERNSLDTSLQYYDAFSELPGALHTAAYEADSQQSLRP
FT                   NDEFKADTKRLSMKYSHVLAGSDTIDYGEFDLTAFGNKSSRNFQWDFYDKNKDTDGNLG
FT                   SSWSDTTQEATHLRNSPRDFTVVGIEPKMSLFIDGDVSQHIIAGARYVNEDITYQLNHI
FT                   EKSTQAAVRPRDWQMDTDAMAYFISNKIGFLDDSLSVTPGLRYEDVRMTFTNLGQDYSQ
FT                   DNHVTELLPGITLGYEFTDAWFAYANAQRSLRTPQISQLWPKGQTLESELSWNYEAGIR
FT                   FTPTERSNINLAAYRIDFKNKAEYDRNISMFVNIGQTKNQGIELEGTYSPLSLPELTLS
FT                   GAYNYLDTEQLDGEYAGNELPSVSKHQLSASALYSIDDIDLGLMAYYYSQSFADLANTV
FT                   TESVSGTEGEVPAYTVINFNISTEFFKQDNKGLKVGLSVNNLFDNDYYFRGLDVSPAGR
FT                   VAAPGRSLSLDIGYRF"
FT   sig_peptide     complement(696572..696655)
FT                   /locus_tag="Sden_0609"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.951 at
FT                   residue 28"
FT   gene            complement(696913..697692)
FT                   /locus_tag="Sden_0610"
FT   CDS_pept        complement(696913..697692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0610"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53900"
FT                   /db_xref="GOA:Q12RM6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM6"
FT                   /protein_id="ABE53900.1"
FT                   /translation="MPKLASIAPSMESTRPLLQPITVVNRQLQAHCHVMSHSHLWGQFV
FT                   YASQGVLAVNTPAARYLVTPEQGVWVNSNISHSVTAITEVRLTSFYLDESQCQALPEQS
FT                   CVLNVAPFLHALIQEARLIPSDFDWQGPRGRLLRLIRDWLSEAKNAPFHLPYSSHPKLM
FT                   QLFGELQNNPANQDNIATWGQRLGASSRTLSRLIKAETGLSYRHWRQRLNLQLSLSLLA
FT                   QGHSINHIADSLGYASPSAFIHMFKQQTGDSPARYRK"
FT   gene            697796..698680
FT                   /locus_tag="Sden_0611"
FT   CDS_pept        697796..698680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0611"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53901"
FT                   /db_xref="GOA:Q12RM5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM5"
FT                   /protein_id="ABE53901.1"
FT                   /translation="MEWLGIYLILGGAVGVMAGLFGIGGGGVLVPAFVSIFLAQGMQSH
FT                   LVMHYAIATSMACILVTSFASMRAHNAKGTVQWPIVNSMAPWIILGTFAATFIATALST
FT                   QVLAGIFSVFMLSVAIKMLRQTSSGQVHDSKRLTPSSMGLAGLGIGAISALVSIGGGSL
FT                   TVPYLSNRGINIKHAIGTSAAIGLPIAIAASLGYWVNGLTSAEAAQEMGIYDIGAQTRA
FT                   VMGDGWWQVAAQSLDMSLGFISVPAAVCVAFGSYFSAPYGVVLAHKLPVGLLKKLFACL
FT                   LIILSLKMFSSLV"
FT   gene            698843..699496
FT                   /locus_tag="Sden_0612"
FT   CDS_pept        698843..699496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53902"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM4"
FT                   /protein_id="ABE53902.1"
FT                   /translation="MNFTQKSAILSLVFLSFSPLSGSCAPLEAATLINQSLYGFKLSIV
FT                   NMPVASEGYFFNLGGSHGDSHSQAQGTGLILSRPPLTHDVLTPLAVNFLDGAGYQSESR
FT                   WTLSYEFDDFALSLGANINQPFYADSPQMFEQANQMQDYSYFKVGELNVGGEYRPMDWL
FT                   TFSLNFHQGMADNAQDVFALATKLDLNRSFSVQFIGLLGSDTSKGALLKTSYHF"
FT   sig_peptide     698843..698932
FT                   /locus_tag="Sden_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.942 at
FT                   residue 30"
FT   gene            complement(699529..700263)
FT                   /locus_tag="Sden_0613"
FT   CDS_pept        complement(699529..700263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0613"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53903"
FT                   /db_xref="GOA:Q12RM3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM3"
FT                   /protein_id="ABE53903.1"
FT                   /translation="MIIDPLSLALAAIIIFFAAITQSLIGFGLAVVASPLLYLVEPDLV
FT                   PAPVIMMGFAISVLTLIRERGHLEFNGLQYALLGRIPGGFLGASLLILAPQAVLGLVIA
FT                   AIVAIAVILSVFKFSVPVNRTSLFIAGIISGIFGNIAAIGGPPMAILLSGKDASQFRAA
FT                   LSAFFIFSSLIALIILAVTGLLSWRHLWLACMLLPSVVFGFLVAGRLVGRVDKQKTRSA
FT                   TLILCSLSALVLTVQSVLTLVN"
FT   sig_peptide     complement(700162..700263)
FT                   /locus_tag="Sden_0613"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.489 at
FT                   residue 34"
FT   gene            complement(700363..700677)
FT                   /locus_tag="Sden_0614"
FT   CDS_pept        complement(700363..700677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0614"
FT                   /product="methionine repressor, MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53904"
FT                   /db_xref="GOA:Q12RM2"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM2"
FT                   /protein_id="ABE53904.1"
FT                   /translation="MTEWNGEYISPYAEHGKKNEQVKKVTVSIPLKVLKVLTDERTRRQ
FT                   VGNLRHATNSELLCEAFLHAYTGQPLPNDEDLSKDQIDGIPSEAKKMMEAMGLEWEELE
FT                   "
FT   gene            700878..702050
FT                   /locus_tag="Sden_0615"
FT   CDS_pept        700878..702050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0615"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53905"
FT                   /db_xref="GOA:Q12RM1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM1"
FT                   /protein_id="ABE53905.1"
FT                   /translation="MSQHKLATLAVRHGIESDTQHGSVVPPIYLSTNYSFEGHQQPREF
FT                   DYSRSGNPTRNLLAEALAKLEQGHSAVVTCTGMAAITLVTSLLAPEDVLVIPHDCYGGS
FT                   YRLFTHLAAKGSFKLVVIDQNDANALADALQLKPKYVWLETPSNPLLRVVDISAICQLS
FT                   HQVGAKVVVDNTFLSPALQQPLTLGADIVVHSTTKYINGHSDVVGGAVVAKDADIGERL
FT                   DWWANTLGLTGSAFDSYLTLRGLRTLSVRMRQHQENTQLIIESLINSPVVNKVYYPGLT
FT                   AHPGHEIALKQQQGFGGMVSFELNGGEAALVAFLSELKLFSLAESLGGVESLVAVPATM
FT                   THRAMTAKARDEAGISDTLLRLSVGIEDGVDLVADIEAALAAVATLKVVV"
FT   gene            702061..704502
FT                   /locus_tag="Sden_0616"
FT   CDS_pept        702061..704502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0616"
FT                   /product="homoserine dehydrogenase / aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53906"
FT                   /db_xref="GOA:Q12RM0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RM0"
FT                   /protein_id="ABE53906.1"
FT                   /translation="MARSHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKS
FT                   TNFLYKLLDLRDTGQLWQEELQVLISFQQALIEQLLSNEQARDLRERLSNDKAQLASLL
FT                   SLEQRNEYQISHVVSFGERWSARLMAALLRESGVAASHVDACSILVADEGAVPKIRVEE
FT                   SKAKIQTLLAERTNERLVITGFICANAQGDTLLLGRNGSDFSATLIASLADIGRVTIWT
FT                   DVEGIFNADPNKINDAKLLKSMSLAEADRLARLGSPALHSRTLQPLFNTQVSLAVRSSY
FT                   ASHTDFTLIAPQSSSASAPVVTSLSQVVLFSFKLETHNKIESDSQSKPQPQSQFESVLA
FT                   ALTSAGLTPLAHWEYGADKHELAFMLENQKQVNALLSKQAPTFGITELQLNLDLGLVAL
FT                   VSADAEHFRRSFARLLSRDAKPIYQDNLSLVTLVPRAQVNLLTQKVHRRCAGPKMRIGV
FT                   LLLGVGNIGEAWVDLFRRANHALNNELEASVELVGIVSSKKALIAEQGIDLNHWQQIFA
FT                   EKACQWQYEQLFERLDKLDCDEIVALDISASASLTLQYPELFARGIHVVSANKLAGSGP
FT                   LPFYKELKQQLSNRRLFWRYNASCGAGLPIQHALNDLRNSGDTIEAVGGIFSGTLCWLF
FT                   ENFDGKKSFSELVLEAKSLGLTEPDPRDDLSGRDMQRKLLILAREIGLGIELDDIKLHS
FT                   LVPSELVDLPLDDFLAQIRSLDSDILQQYLSAAEQNKVLRYVASLDRVDGKLQAEVGLK
FT                   WVDSHHPYANLTPGDNVFVIRSAFYQGNPLIIRGPGAGREVTAAAIQSDLVQICKDLLQ
FT                   E"
FT   gene            704831..706318
FT                   /locus_tag="Sden_0617"
FT   CDS_pept        704831..706318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0617"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53907"
FT                   /db_xref="GOA:Q12RL9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL9"
FT                   /protein_id="ABE53907.1"
FT                   /translation="MDQLVSTINGVIWSPALIFLCLGVGLYFTIRSRFVQLRHVPEMVR
FT                   LIFDGKSNAAGVSSFQALAMTLAGRVGTGNIAGVATAITFGGPGALFWMWMVAFFGASS
FT                   AFVESTLGQIYKEKIDGEFRGGPAFYIEKGLGMKWYAWIFAVATIFACGILLPGVQANS
FT                   IGSALETAFDLSPAVTAALIALLLGFIIFGGVKRIAHFASAVVPFMALGYIIVACVIIG
FT                   MHIEQLPDVIILVVKSAFGLEAGFGAILGLAIMWGVKRGIYSNEAGQGTAPHASSAAAV
FT                   SHPAKQGLVQAFSVYIDTLFVCSATGFMLLITGLYNVQGPEGEAIFTGIAGIAAGPGYV
FT                   QTAMESMMPGFGNMFVAIALFFFAFTTIIAYYYIAETNIAYINRQVHRPWLTLLLKFAL
FT                   IAATVYGTVKTADLAWGLGDIGVGLMAWLNIVAILLLHNKAFACLKDYEAQKAQGLDPV
FT                   FDPEAMGIENADFWVERKKQHQAIADEAAKAQASNTP"
FT   gene            complement(707148..708791)
FT                   /locus_tag="Sden_0618"
FT   CDS_pept        complement(707148..708791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0618"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53908"
FT                   /db_xref="GOA:Q12RL8"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL8"
FT                   /protein_id="ABE53908.1"
FT                   /translation="MKIRSDILRTYQSIHTWTGILSGLVLFIGFYAGALSLFKPQITQW
FT                   ATPVHQHLAAIPQAKLDNLISQAFKEYPKTQQGFIVDLSGDTSPLSWYTQGGGRGIRLD
FT                   DIRSHASLDDNDKIISQTHAQNELGSLIDQLHRTAGILGEVDHFEVGVLILGLAAGLYF
FT                   LALVSGVIFLLPTLTKNLFALRKNKGASRFWLDSHNLIGVISLPFHLIIAWTVVVFAFH
FT                   DFAYGGLGLIYGDKPLFERPQRSAMIYKISDLPSIQTYINKVAEITDGYDIKSLTFSNL
FT                   SSPGPALAINITSDTQVMRSGYSDVIYMHPYTLEVQFSTASLENGPIYDPIVTSFFALH
FT                   FGNYAGNFGRLVYFILGLLGAFLFYSGNLLWLEKRRQKQSIQSRANRFMGALTIGVCLG
FT                   SMLGVACSFLITKWLYLVAEQVNTYYMMCYYSIFFSALGYSFIRGTASAAIHLLYALFL
FT                   SCLLIPTTSLLAVLLPSLFSEGIRAPSSYLIDVFAALFAIAFYLGAKKVQQRAYYGEPN
FT                   SIWAISTAHSSSLEKTPESRLESNPASQQS"
FT   sig_peptide     complement(708687..708791)
FT                   /locus_tag="Sden_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.694) with cleavage site probability 0.624 at
FT                   residue 35"
FT   gene            complement(708788..709087)
FT                   /locus_tag="Sden_0619"
FT   CDS_pept        complement(708788..709087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53909"
FT                   /db_xref="GOA:Q12RL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL7"
FT                   /protein_id="ABE53909.1"
FT                   /translation="MIQAYRNQKIQPHWWSKTIISLILGLSLAYALIGIFAWQGPGGID
FT                   APVKVQFNMWMLCLLWLMILSFSFMFKTRWSALCYLGGANLVAYLGYLVARLLS"
FT   sig_peptide     complement(708968..709087)
FT                   /locus_tag="Sden_0619"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.678) with cleavage site probability 0.312 at
FT                   residue 40"
FT   gene            complement(709084..709347)
FT                   /locus_tag="Sden_0620"
FT   CDS_pept        complement(709084..709347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53910"
FT                   /db_xref="GOA:Q12RL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL6"
FT                   /protein_id="ABE53910.1"
FT                   /translation="MFQLAAIALNILGSVLIYLSSRHQKMIKQRLTKGFLILGCLLILL
FT                   SLWPLLTALHPPSALFIWLLISFTNLISIPFLSLLKNSERPQ"
FT   gene            709491..711551
FT                   /locus_tag="Sden_0621"
FT   CDS_pept        709491..711551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0621"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53911"
FT                   /db_xref="GOA:Q12RL5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030150"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL5"
FT                   /protein_id="ABE53911.1"
FT                   /translation="MEQKMFKKKLLVAAILCTPIMSPVNAAVDAQPMRSIEVIKVVGEK
FT                   TERSLKDTTSSVSVIDEDKLASGQYLSVSNALSEVPNLVTLTGSVPDIRGISGNGSATG
FT                   FNSFTGGAKARVSTLVDGVAEPFVADMTGDSGLWDIEQVEVFRGPQSTINGRNSIGGTI
FT                   FVKTKDPTFDWNGAVRGGYRNQQDYIDSAVMLSGPIFEDQLAFRISGQNLTGNTFNKGE
FT                   VYAGNPAHFDLNELISRRWRGKLLWQPTGADNFTLLYSFTYNDEKGDTGRNYFSGDNPW
FT                   AYKPLFQRYIETESNTHSVKIDYRLNDDYSFDLLAAYIDYDWGFEGYESVAAAEQQVIM
FT                   QDKSYTLDGKFNFGLQNPEFNGFVGLSYYKREQDFSSSGGVTYVGDDSSSSHSIYGEVS
FT                   YALTEQWKIIAGGRVEKEQQIRNFAMSTRGRVVADKLDDDHNIALPKLVLQYALNQDTT
FT                   LAVSARSGYNAGGGALSFADNAYYYYEKETVDTFELSSRSSFDDGNINISSNVFYNNFD
FT                   GYQASNNERKITNIDEAVTYGLELEAGVMLNDDWQLNSGLGLLKSEIKAASPSYGDIIG
FT                   NELNSAPKITANIGLKYWVNDELTLGLSGNYVGEYYADINNTTERVAGDYVVSRLNLDY
FT                   QNDQWRVSGFVNNLFDEQALTVNEPANRSYPQGYAAIIEPRAFGVSVTYSF"
FT   sig_peptide     709491..709571
FT                   /locus_tag="Sden_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            complement(711869..712744)
FT                   /locus_tag="Sden_0622"
FT   CDS_pept        complement(711869..712744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0622"
FT                   /product="DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53912"
FT                   /db_xref="GOA:Q12RL4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL4"
FT                   /protein_id="ABE53912.1"
FT                   /translation="MSIAKKLKSSLLSSLLNKGPLFIAGPCSAETKKQLLQTAHSVKAS
FT                   GAQVIRAGIWKPRTRPGKFEGVGEQGLEWLAQAKEETGLPITTEVANAAHVKLALEYGL
FT                   DMLWIGARTTVSPFAIQEIADALAGNDIPVLIKNPINPDIELWIGAIERIQAAGITEIA
FT                   GIHRGFSTVEKFMYRNPPIWEIPIELKNRLPDLPIICDPSHISGNREFIKLISELAIGY
FT                   GFNGLMIESHIDPDNAWSDAKQQITPKELEIIISQILSFNKKGSKLFDKKVIKEHLAFN
FT                   NEINKEYLLE"
FT   sig_peptide     complement(712655..712744)
FT                   /locus_tag="Sden_0622"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.821) with cleavage site probability 0.815 at
FT                   residue 30"
FT   gene            complement(712820..714133)
FT                   /locus_tag="Sden_0623"
FT   CDS_pept        complement(712820..714133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53913"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL3"
FT                   /protein_id="ABE53913.1"
FT                   /translation="MLDNTLIPAVDGPKLAVPSSTGMREKWTGAMLDQTGRAYCGAIRL
FT                   DFSPSCVAQKVYCAIADTLARHAILAAKFDIEADELVGYAPEEAQLREVLLKHLAIEHT
FT                   GMTDGSFLSYRAKKANIPGLRLASVTDDTGLHVWIGFWIFTCDGASIDLLMQDIVDRYN
FT                   GKTSVSSQCWGEYIKLKSSSPNKHLVSEQERLLAYPAPGPYGLDAIRKPQASTSLKMQS
FT                   VHFNTSVPRIKLLACAKAYRVTPFVLMFGAFQRAVCALSKVKTVVTGVPFANRLENDDL
FT                   NVVGPLSITVPVTTTHRLDEGITAELKGLQRSVISAASRQQIEPSYLYPQGISPRTAAY
FT                   ALPFPQLFNAWNSKSDGKTMPLSKTESLTMKLLPNDTCRVGFEITLDDNSDNISGRIDM
FT                   DFGLYEGLAEPVIKYITDELKEICENYHHETLEALSDG"
FT   gene            complement(714139..715566)
FT                   /locus_tag="Sden_0624"
FT   CDS_pept        complement(714139..715566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0624"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53914"
FT                   /db_xref="GOA:Q12RL2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL2"
FT                   /protein_id="ABE53914.1"
FT                   /translation="MTEILGKQTMNAKRWQILSVISIMQLVLLLDATVVNVALPQIKHD
FT                   LGLTDGSLTWVVNAYLIAAGSLLLLGGRIGDAYGVLRIFKFGVAIFAIFSVVATLAPNA
FT                   TLLIVGRAGQGVGEALAAANGLAMISLLFPSGPERGKAFGIWAGLGGLGSILGVLLSGV
FT                   LTEYLSWRWIFGINIPIILALGVAIVLVIPTFPKKISTHLDLGNACILVFAMVAIVMAI
FT                   IGTGIEQLTLLRITLLLLGALGITLVLKRCKQSEDGIIPARLMTRSPRLAGYGIIAIQA
FT                   ATSGALFYLGVLLMQDSLGMTPLQTGLAWLPFCLGFFPGIFLSITIEQRKSALAAAVIG
FT                   LIISSLGFVLFALGVNANNYWVGMMPAMLVTAIGFGCVAPVAQSLATSDLSEADAGSGS
FT                   GIATTIQQLLQVGGVTILVSIALAVKDDTSVVNIDSNGFMTAFLIASFVLITGAIVVGF
FT                   SRNALAPTIGEPSAEIR"
FT   gene            complement(715616..716236)
FT                   /locus_tag="Sden_0625"
FT   CDS_pept        complement(715616..716236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0625"
FT                   /product="aminodeoxychorismate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53915"
FT                   /db_xref="GOA:Q12RL1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL1"
FT                   /protein_id="ABE53915.1"
FT                   /translation="MKVLLVDAFDSFVFVIEHYYAKCGAKTKVVRVNDNPLEHYQQWQP
FT                   DLLVLGPGPGTHEEHGYLDILNAIDEDQAVFGVCLGHQAIGAFFGWKLMRAPTVEHGKY
FT                   AMIQHDGQGIFNRVPSPIKVVRYHSLAIAAPELDGELLTTAITQGSGVNMAIRHRTRPI
FT                   EAVQFHPESIGTEHGLAMVRNSLALVNRVSIMEQSLAPEKSTA"
FT   gene            complement(716241..717641)
FT                   /locus_tag="Sden_0626"
FT   CDS_pept        complement(716241..717641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0626"
FT                   /product="Anthranilate synthase component I and chorismate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53916"
FT                   /db_xref="GOA:Q12RL0"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RL0"
FT                   /protein_id="ABE53916.1"
FT                   /translation="MLVQLTESSWAVERTKVPEAAPLAQVRKGMLGLYPHPALFETKRG
FT                   FQDIDGSKTMFMLDKLLEIKLVDNIWYIDGKGPFEQYVAACYALVNDANQPLCERLRQV
FT                   TKLLSLPEEYPIMLTLGYSAARFFEHLPQMTAEQGEPEVLMRVYRYLVHYDHGDDAEKG
FT                   AQIDVLKTQHDEVVNTQILVDALTQPEQSSAPMKPWQLGSIKDLTEKDAFYAAVERAKE
FT                   HIRIGDIYQVQLCRRAISNAAIPPVDLYERLVSINPAPYMYYLDLGDRHVISSSPELML
FT                   RVSGGMAQVRPIAGTMTHEEYGGSPLEKIPKEAAEHLMLVDLARNDLARCAVTGGVKVS
FT                   SFMQEDAYGPLLHLVSTIDTPVRRECDIWDLIATNFPAGTMTGAPKIRAMEIISDLEQA
FT                   ARGLYTGCAGYISGTNSAVLALTIRTIIGDSGLYLLQSAAGVVADSQASSEWEEAGAKI
FT                   NSFSRAMG"
FT   gene            complement(717641..718987)
FT                   /locus_tag="Sden_0627"
FT   CDS_pept        complement(717641..718987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0627"
FT                   /product="coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53917"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK9"
FT                   /protein_id="ABE53917.1"
FT                   /translation="MHILEGEKAMFNNQLHQEWLEHIDDYINGQIELKNLFQTTESHAE
FT                   KVIDYVDEQSSFYREHLRNKSGSSSQFKVLDGVPFTTKEDLRFAGTSVCSLPFDKIAMY
FT                   YETTGTTGTPTPCPRSSIDVETSGAFVKKAMNDVYQARFGTMNALTAIMGPSELYAFGD
FT                   TYGEICRKLGIPFVRLWPESPRVGLDKAAHLITNLGVRSLICSPAVALALARFYTSIGV
FT                   APRETSVDQIFVLGELCTPEMLQNIAHLWGANCSHGLYGSQEAHAVATGCSQGNLHFCE
FT                   TNYLAEILPIPGLEGIGELCLTMLVPGAKPLIRFRTGDLASFSPATNCSCGSHSRCLKV
FT                   FGRVDDIITIAERQMLPASIESAVLGAVDNVLGYQVAVSTADNGTETIEVSVIATIEPG
FT                   SIAQIQKKMTDYFAIPVKLNVTEQLDARTETGAYVSWKHARIIDNRKSS"
FT   gene            complement(718975..724488)
FT                   /locus_tag="Sden_0628"
FT   CDS_pept        complement(718975..724488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0628"
FT                   /product="Amino acid adenylation"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53918"
FT                   /db_xref="GOA:Q12RK8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK8"
FT                   /protein_id="ABE53918.1"
FT                   /translation="MTLGTIDLGEQLRVHKRVKDSPNGNKTIWDAFETLDSNHSSEVER
FT                   VEEEIILPDGLTASFNDLTAIAAMLGSLLSPEACINVGLFADGLATCVEVDANDLCHSH
FT                   NVKAYLAEQRLSKELPRRDVTARVDIEVTDGTINPPITSLVWFLAQNGRFLLSVRQDRI
FT                   DLSARMQLRKLIAFACARVLDPRAIPTYDAMPTRRHDKCHQSKPLVELVFKHKQLRPTA
FT                   LAIIDNTSSQTLTYAELWHASSVILQQISEQVNLSRKHPRIALFMERSWQHLASIIAIQ
FT                   RMGGTCVLIDPVHPDYRINSYIEECAPDAILAAASTTARADNLSGYTVINIGKKYLQLS
FT                   QLDRKYADWVKTTEQDCFIAETSGSTGRPKAARLSYTGMVATIGTIIDYTALNERSRGS
FT                   WLSSPGYGMVEVDPLPVLGAGGTVCIPSSEVVKDARLLAQWFKKHNVTHTLVMTSIAET
FT                   LWANEQQLALNTMLIAGERCKQWPPTSLNYRVLNVYGSAEAAVVSIEDLSATRRTLLPS
FT                   TGRAVPGVNLYIVDEHGQELPANCIGELIITGSTLSIGYLNDQDTVKNFHSNKLDSSSA
FT                   LQYTSGDRARMRLDGTLDIFGRSDAVVKIRGNRVDLAEVDITALEVEGVIKAATTSITD
FT                   DTGTTLVLFVEQAPGAACVVEAVRQHLGDRLQPAAQPSQIVSGILPLGSNGKVDYSALR
FT                   SVKIKRDANQLVFYPSTKVETAVRDCWLTWTRSDEAILTSSFFQSGGDSLRAMRLVGEL
FT                   ACKHGINIEMSAFIGNPVLSNLVQLANASKEAHLPQFDNLAANEQLLPFELNESQQALW
FT                   IGRGADFDYGGVGCQGYFEWEVKQLNHKNFVRAVGLLVARHPMLRMTIDDTGKQRIGAV
FT                   DGTQAVKFVDLSELPQSKINEEIDLIRSQMADEEIGTSQWPLFQFKVSKISSDLSRIHF
FT                   CVDMLIADAWSIFQVIIPDLIELYKDDKAQLPELKTTFSDYVAYRHKVVKSERYRADKD
FT                   YWLQKITQLPAAPKLPLLEKGESSLIQKFQRHHSTLEKDSWDQLKAQAQKRNISPSGVV
FT                   ALALCEVLRCWSEERQFTLNFPVSDRMPVSDDIDLVVGDFTNTLLVPYEPVANETFEVR
FT                   GQRLQNSIWQALDHRLFTGVEVLRELSRFRQSGLTPLMPVVLTSLLGHPGRHDVSLLGR
FT                   EVFGVSQTPQVTLDVQIRESQGTLYFKWDYLSGVIRPDVIEAMFEAFCEFLQELSKDPQ
FT                   EWDRTEREFRPQAQIAIRNSVNMTEAAVPQIHLRDMLLARVKDPGNALALIDANHSYTW
FT                   AELGNASAHISQLMKGVSKPNDQFVGIILPKGVLHYASVYACLLAGLGYVPIDIDLPPE
FT                   RMRKMLVKAGVRAVITVPGAITPDGLQKIELTARDFEVWAKQPMDFELAPVPQHYVPYV
FT                   IFTSGSTGEPKGVEIPEIAVVNHVYDVVERFALDNSSRHLATAALHFDMSVFDIFGPLL
FT                   HGGSVVMPEPAAGPDPEAWLRLHHRHQVTFWACVPAIMDLLCTVAETANITRIVDSVKN
FT                   IVMAGDWIPLSLLPRARALFPSATLYSCGGPTETTNWSVIHEIHHDEGSIARSVIYGKP
FT                   MMNSKYHIVADDLADRPDWVPGEMLVESDISLANGYIGQPELSQQTFIFHPKTGRRMYR
FT                   TGDLGRYLPNGEIEILGRVDNQIKINGLRVELGEIENVSQKCSGVSRACAVALLGSDGR
FT                   PKQIALAYIGKANLEPVIHAALIASLPTYMVPKVIQQLDELPLSKNGKVDIRTLREILR
FT                   NDMKEQKPNNTNSILREIIPVISTILAKPVILPDDNFFDLGGDSLTAMKIKIELEAKLS
FT                   HPISLENIMLTDTIGELAQCIS"
FT   gene            complement(724527..725630)
FT                   /locus_tag="Sden_0629"
FT   CDS_pept        complement(724527..725630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53919"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK7"
FT                   /protein_id="ABE53919.1"
FT                   /translation="MSSSKAQRVGLTNESLAQWIVSEHFERFSEATVVDMAEAYVGLYS
FT                   NRPTSWLAFLARNQSSELTTAIAMETAPSVVRVPGMRRSKFLLPQSLAATVFAATRLAL
FT                   IKHEWRLQEVGLTLADYQKMLPELIEITSKGPVQLKDIGAALGLIGSQASILTTVATYD
FT                   GALIRVPSSNLWSNRWLYVAAADEFLSALELNMDLEKCQQAIADRYIEHYGPVSIDDLA
FT                   WWLAVSKKTARALIAGSGAKEFLPGMWISPTRQERLELHISHPSKAPSTEVRFLPAWDP
FT                   LLMGYSPGSQQRQCLGLDLIGGFDSAGNGRPVVMLGGQAVATWKSSLSGSKRSISLEHT
FT                   HCSENQRKVIEAATSVWAEKIGVNYNR"
FT   gene            complement(725717..726418)
FT                   /locus_tag="Sden_0630"
FT   CDS_pept        complement(725717..726418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0630"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53920"
FT                   /db_xref="GOA:Q12RK6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK6"
FT                   /protein_id="ABE53920.1"
FT                   /translation="MQEQIKYVAINGSPRIDGNNARVLEWATHYLKEQGVTLEVFSLAQ
FT                   ANIQPCMCGDCNFRNSPCEQNDDAAHAVSLMEASDGVIYASPVHGFGSTPLMSTFLERV
FT                   GTGFLRHNRTLTNKVAGVLVTGRRMGHVEVYNQMLQCALLNRMIVTGYGFPAMLVGDKK
FT                   GEVLGDEEGMEMVRRMLDRMVSMTRLIREYETLTGHKALEIVVPGERHRENKNGEFWVP
FT                   PKADMYRNETR"
FT   gene            complement(726587..727942)
FT                   /locus_tag="Sden_0631"
FT   CDS_pept        complement(726587..727942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0631"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53921"
FT                   /db_xref="GOA:Q12RK5"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK5"
FT                   /protein_id="ABE53921.1"
FT                   /translation="MTSENSLIYGQADLLAKGLQELATHDPELMGILDADVKRQHNTLS
FT                   LVASCCAVKTRTLAASASVLVNVTAEGTPGRRYHAGCENVDLVESLAISRARQLFDAQY
FT                   AGVQSHSASSANYQVLSAFLEPGDTLLGMSLDHGGHLTHGSPVTFSGSYYQAIGYGTTS
FT                   QGLIDYDEVLKLARLHKPRLIICGATAYSRIVDFERFREIADEVGAILLADISHIAGLV
FT                   ATGRHPSPINAAHVTTTCTHKQLAGPRGGLIMSGRDANEMVPGRNKTFAASLEQSVFPW
FT                   MQGAPAVNIIAAKAAAFGYAMSPEFDAYMERIRTAADTVAMAFQQKDYEVVGRKSENHT
FT                   VLIRLRGDLTGAIAESALEKCGIIVNKNRVPGETRSAFVTSGLRIGTGSLAQRNLDPEG
FT                   CLRVVDLICKILDEVKPLGDREYTLDPTMEQQFRAQAKALCVAFPLEDYTQP"
FT   gene            complement(727955..728935)
FT                   /locus_tag="Sden_0632"
FT   CDS_pept        complement(727955..728935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0632"
FT                   /product="phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53922"
FT                   /db_xref="GOA:Q12RK4"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK4"
FT                   /protein_id="ABE53922.1"
FT                   /translation="MTDMTYDVEQDVVAESERISAIFSEVLDIGQVAATDNFFNLGGDS
FT                   FDAIRVMSRLDGNLPIVALFEHPTAETLARFRLTEESLAITRLVPLFDQTKTNGPIVVI
FT                   CVPYGGGDPTAYRDLFNDHPDVRVFGVDFGDAEIHSPSDFSGLINTLVNEIEAIDAEQI
FT                   IVYGHCAGAATAACLASAITFTTSAVSLVVAASNPVDDPDAAIHDAAMTSDADWGQYLR
FT                   SLGAFNGLTDKETDAMLTKGRRDHFIATEAYRTLARQPARGIPAMLLLGDKDPATVKVE
FT                   EIVNKWRKIIDLVKSANVTGGEHYFIRTHAQEVASKVLSFQLKHK"
FT   gene            complement(728958..730067)
FT                   /locus_tag="Sden_0633"
FT   CDS_pept        complement(728958..730067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53923"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK3"
FT                   /protein_id="ABE53923.1"
FT                   /translation="MLTSSLTPIDGRPTIKNEKVMRILADALLSAEAKAVVAHEFHTGI
FT                   AAEISTVIELELEVSVFEQLLHEMIVAGWGEQIGQYFKVINTIDSNEHETLRHTQLAVR
FT                   SGSALFAAAKVTTANAQRYYLSVHHALADEHTLEIIRNYLKLSNKKAKDLVLNDMDHGR
FT                   QAYCRYVKRQQTKAKEASALVKVSTPHMAPLILSQDGRLAWNAQAKRISVQRRLNTQRP
FT                   AHEIRPIDTVLTRLSEAGVILQGNTLCSSKNWRLADETHAIGMMTGLITKPLKPSTKSL
FT                   CEPDIALEASARYSPDARAALECCRRSEIFINGAAPRRISGTQVIDTAFPVGLDIRRTG
FT                   EFEIQFEIEGPFSSKAAVIEVLNELTDVF"
FT   gene            731116..731841
FT                   /locus_tag="Sden_0634"
FT   CDS_pept        731116..731841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0634"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53924"
FT                   /db_xref="GOA:Q12RK2"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK2"
FT                   /protein_id="ABE53924.1"
FT                   /translation="MLNYATVPYIKHVSEKKILGFPGVCYQCRFDTGGYSDSNVMQLLG
FT                   EDLHGSLSLAVTKRKSEFVAGRYMARQALIALGSTSFTVGIGTNRAPLWPDAFVGSISH
FT                   SKEYAICAVANVANITRLGIDVENFLDEKSARDIVGSVLIRSEYTLVGTYSNPNPVIVT
FT                   LIFSAKESLFKALYPEIGRYFDFDVVQTKIINFKTGIFSLELVKELNPSLPVGTRFEGI
FT                   FELGADTVFTMITGSIVVS"
FT   gene            731996..732865
FT                   /locus_tag="Sden_0635"
FT   CDS_pept        731996..732865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0635"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53925"
FT                   /db_xref="GOA:Q12RK1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK1"
FT                   /protein_id="ABE53925.1"
FT                   /translation="MSKQYTPEKVWTFDAQSGGTWAKTNRPVSGATHEKTLPVGKHPLQ
FT                   LYSMGTPNGQKITIMLEELLASGEKRAEYDAFMINISESHQFSSGFVDINPNSKIPALV
FT                   DNSQSTAISVFESGAILLYLADKFERFIPKSQAATLAKRTLVLNWLFWLQGSAPYLGGG
FT                   FGHFYSYAPEKFEYPINRFTMETKRQLDVLDKQLAKHEFIAGDEYSIADIAIWPWYGNL
FT                   VLGNLYSAAEFLDVASYQHVSRWAKAIAKRPAVERGRIVNCTWGEPWEMLEHRHSSADI
FT                   DAVLKLKP"
FT   gene            734654..737494
FT                   /locus_tag="Sden_0636"
FT   CDS_pept        734654..737494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0636"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53926"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RK0"
FT                   /protein_id="ABE53926.1"
FT                   /translation="MELKNLFKLGAISTALILAGCGGDINISTAADPAAPTIPVTPPPV
FT                   TQTPQQIAYSGFATKSTSVTSVDGKEVWLLKGTLASTAAKASSQSSSSQSTGGQTGNKI
FT                   VLGNDVVWQLDGAVIVGGDNTNPMELTLEAGTKVLGGSDSYLVISRGSKIYAQGTKAAP
FT                   IVFTSLETALGEAGKAGQWGGLVLLGNAPVNSCPDLNNCAAAFEVGNHNYGGNDTQDSS
FT                   GTLQYVRVEFGGFKINDTQEMNGISFAGVGSGTVVDHVQVHMNNDDGLEFWGGNVSVSH
FT                   VVLTENFDDSLDWTNGWQGSAQHVYIRQGDNSSNRGIEADSNSDAAASPMSKPALANIT
FT                   VQVGNGTNSNGDDAEGILFRKGTGVTAYNLLVKGDVNSGECLEVNDDNTVNNANTAELT
FT                   MEHSLIDCVEPFKNAKADAAEGRTLALDVKAWYQGQTGNLVGASDLTGYMPNSSSIALS
FT                   AGKANLSNLDDRLTNANYIGAFDGSTDWTKDWTTAIHSDTTPVPTALPTLTSCPVGTSA
FT                   ESVVAGTLKDSKINLVCRLEGNVLSNTTLLAGQNVMYKIDGGAVIVGGDKKDSATLAIQ
FT                   AGAQLFATPNSYIAVSRGSKIMAKGSAAHPIVMTSQQDVLMGAEGERGQWGGLVVLGKG
FT                   LTNTCPDKNACDASFEVGDFPYGGNDNSDNSGQISYVVIKYAGFKVNDTQEMNGISFAA
FT                   VGSGTQVDHIQVHANGDDGVEFWGGAVNLKYVYLTHNFDDSLDWTNGWTGKAQFVYITH
FT                   EDGQANRGIEGDSHKGASDTPISAPKLANFTILPGVDVENASGDKGEGILLRVATAGEL
FT                   YNVLVQGRKGSTSTTESGECLELDGSYAGLIDNVNNKTLTMSHSVIDCNEPFKYSSDNA
FT                   ATANAVNVETWFLGQTGNSTSAVTLTDGMPAATDTVLLGKGKDLSAQDSFFESTNYIGA
FT                   FDGKKDWRQGWVHIPQ"
FT   sig_peptide     734654..734746
FT                   /locus_tag="Sden_0636"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.834) with cleavage site probability 0.728 at
FT                   residue 31"
FT   gene            737587..740337
FT                   /locus_tag="Sden_0637"
FT   CDS_pept        737587..740337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0637"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53927"
FT                   /db_xref="GOA:Q12RJ9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ9"
FT                   /protein_id="ABE53927.1"
FT                   /translation="MKTKPSFTVNKLSLAIASLISVASVFPALPVYSQDAVKIEHSEIN
FT                   AQSTETAQSTQSTESSPSAQGESFPIEPIEVISVVGRLRTSASAATEERREQVNVTDIM
FT                   GAEQIARTGDGDAAAALRRVTGLTLKDGKFIYVRGLGERYSSTSLNGATVPSPDPTRNV
FT                   VPLDMFPASIIESLSVQKSASANAPAAFGGGHVDIRTKSIPADFFFKASVGGRYNTNDT
FT                   DDALGYSLDNSGLGKDDGKRAMPDAIANTTNQYGGISPIDIVTGSQGGINYPAAQQLNR
FT                   ELALGMHRDMTVQAQDSSPGFKGDIAIGDRWDLSDEMILGVISAFSYKKQQDNYRKKEL
FT                   ELDGDASNINIENQKDIMGTDSIVQVSGMVNLGLEIGYNHKIETFTTYLHDTSDDVSMG
FT                   IEETIDTLGEPNALQIFGIGYEERSLISNQIKGHHFIEYLNDAEFNWKFSDARSERYAP
FT                   NEMSYTYNVILDDANKVLSRNLNTQDAPKYVYSRLEDDSQNYGWDVSYPINFDGALVKI
FT                   TTGYEYFERSRESYATRLGFDVDLSPSDVNGGILSQDFNQIFSNANISSDVLGLELKDA
FT                   STDTEDYIAAEMNDAAFISLDIDFEDVWRVYAGVRYEDFRRVTLPIDPEGKISDEGGRY
FT                   QLDDYAIAEDAWFPSISVTWKQTDTTQWRLGASKTLVRPDLREVSPVRFQDPVTGFDFF
FT                   GNPELKSSDIYNLDLRWEYYSDSGNNLSVGAFYKDVDAPIEPIQRISEAGRQLKFYNAE
FT                   SGYIYGIETEFLQQLGFLGDEGSLWEDFFIAGNLTLGDSAIDIASNGEIDPTHHSRVMT
FT                   GHSKWVANMQLSYDSSDDYHSATLVYNIFGERIAYGGRGGLDDVFEQPFNSLDFTYSFF
FT                   PTDSISIKLKAKNMLDETTEYKQQGQLVYAKEPGTEYSLQFSYEY"
FT   sig_peptide     737587..737688
FT                   /locus_tag="Sden_0637"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            740960..742141
FT                   /locus_tag="Sden_0638"
FT   CDS_pept        740960..742141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0638"
FT                   /product="phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53928"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ8"
FT                   /protein_id="ABE53928.1"
FT                   /translation="MMKKTLLATALLGMFVSQTAAASEETQELRKIIEQQQKVLKDLEK
FT                   RLEQTEQRVEKTADVVESTASSKSATTIGGYGELHYNNISDNLKNTDKKEFDFHRFVLF
FT                   VGHEFNSTTRFFSELEVEHSIAGEGKKGEVELEQAYIEHDFNDMLTGKAGLFLMPVGII
FT                   NETHEPTTFYGVERNPVEKDIIPATWWEGGLNLNIKAAPGVAFDTAVTSGLYIPQGKEY
FT                   KIRDGRQKVSEAKGEDLAYTGRVKYTAVPGLELAATVQYQSDLTQGEAGVDTASATLVS
FT                   AHAIYNIENFTVKALYAQWNIDGKEAEALGRDKQNGFYIEPSYRINDQFGVFARYNEWD
FT                   NNAGDNAADTKKKQTNVGVNYWLHENVVFKADYENIGGAADSDGFNLGVGYQF"
FT   sig_peptide     740960..741028
FT                   /locus_tag="Sden_0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.924 at
FT                   residue 23"
FT   gene            742281..742811
FT                   /locus_tag="Sden_0639"
FT   CDS_pept        742281..742811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0639"
FT                   /product="FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53929"
FT                   /db_xref="GOA:Q12RJ7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ7"
FT                   /protein_id="ABE53929.1"
FT                   /translation="MKLISLLLLGISFLFTSAQAEQVQYSSSQEFIQHAFEGELPKAKV
FT                   FWLDDKAKAVIEEILSHSFNKMRLRYWQQGDASVWIMDEIGKEAPITVGVHVKAGAIVE
FT                   TKVLVYRESRGDEVRHAFFTDQFKAAKLQADNKLDKHIDGITGATLSVRALTKLSRIAL
FT                   WLDAHVNKTEASS"
FT   sig_peptide     742281..742343
FT                   /locus_tag="Sden_0639"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            742872..743681
FT                   /locus_tag="Sden_0640"
FT   CDS_pept        742872..743681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0640"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53930"
FT                   /db_xref="GOA:Q12RJ6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ6"
FT                   /protein_id="ABE53930.1"
FT                   /translation="MTKSSHPSQKFRRQDWKNQVLRALRPWHRRLGLCSALFIMLLVVT
FT                   GVAINHSQDFKLDTAQVRQGWLLDYYGISAPKSLSVFSVSPQVLAATDTQLWLNDKRIL
FT                   ESQRPLIGAVQLGTSLVAIDSQQAYLFSLSGELYETQGLSTGLPQGIEAMAYDESGVWL
FT                   KTAQGLFLSDEDLVEWQPASTVQSARSDIAWLTPIAKTELAKEQWQAIELNARSGHLTW
FT                   ERVMQDLHSGRLFGSLTVWLWDLFALALLMVVGTGCWIWWRQTPSRK"
FT   sig_peptide     742872..743024
FT                   /locus_tag="Sden_0640"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.615 at
FT                   residue 51"
FT   gene            complement(743682..743987)
FT                   /locus_tag="Sden_0641"
FT   CDS_pept        complement(743682..743987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0641"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53931"
FT                   /db_xref="GOA:Q12RJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ5"
FT                   /protein_id="ABE53931.1"
FT                   /translation="MQVTNDQGEVLAGAAARSFGDWLLLDTLWVSEALRGQDIGSKVLA
FT                   EIEAMGLARGCTKCLLDTLNFQAKPFYEQRGYQVQWVQEGYPKTGCKYFMIKQLSE"
FT   gene            744631..745527
FT                   /locus_tag="Sden_0642"
FT   CDS_pept        744631..745527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0642"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53932"
FT                   /db_xref="GOA:Q12RJ4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ4"
FT                   /protein_id="ABE53932.1"
FT                   /translation="MAFHHAQHAQSLNQSLSEVNGAINVSFEFFPPSTPEMEQLLWSSV
FT                   RRLEPLKPKFVSVTYGANSGVRDRTHSVIERIQQETQLVAAPHLTLVDASDEELVDLAK
FT                   QYWQSGIRDIVALRGDLPAGQPKPTRFAADLVRLLRSVADFDISVAAYPEGHPDARNAQ
FT                   ADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVTAGIDVEIIPGILPVTNFTQLKR
FT                   FAAMTNVALPQWLHQQFSGLEDDPATRQLVGANVAIDMVKVLSREGVKDFHFYTLNRAE
FT                   LTYAICHTLGVRPKVAV"
FT   gene            745952..746428
FT                   /locus_tag="Sden_0643"
FT   CDS_pept        745952..746428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53933"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ3"
FT                   /protein_id="ABE53933.1"
FT                   /translation="MAREAILKKIIMFLCGFALSGLVEAGDKNLEDFAKSYFKAWQTSQ
FT                   SPNASKKDLEHYLSFLADDVGHQHLPYDPDDSRSPEGKEQFRKGMTYYLGTHTSYEAKL
FT                   DKVVTGHNVIVITYSTSSSGKHAHTGQVINQSYDTMEVLEIDKEKVSVIRKYSK"
FT   sig_peptide     745952..746029
FT                   /locus_tag="Sden_0643"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            746621..746980
FT                   /locus_tag="Sden_0644"
FT   CDS_pept        746621..746980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0644"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53934"
FT                   /db_xref="GOA:Q12RJ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ2"
FT                   /protein_id="ABE53934.1"
FT                   /translation="MNGFNERHTGAVYRETISSFVKDEDDKTVDGILGEIKWGWLYIEG
FT                   LWIADDVRGSGLGAKLLQQLEAYALSKGVSNVRLETTSFQALDFYVKQGYTVFGQLPDM
FT                   PPTFTSYFLKKQTGI"
FT   gene            747106..747357
FT                   /locus_tag="Sden_0645"
FT   CDS_pept        747106..747357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53935"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ1"
FT                   /protein_id="ABE53935.1"
FT                   /translation="MSAEMTAEVTKFSPKESLTQTADTCPLCQQANLCAATTNTPIAAC
FT                   WCQSQTFPPKAVLATSQQAKLTAPACICQSCLVVLKQQ"
FT   gene            complement(747436..748308)
FT                   /locus_tag="Sden_0646"
FT   CDS_pept        complement(747436..748308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0646"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53936"
FT                   /db_xref="GOA:Q12RJ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RJ0"
FT                   /protein_id="ABE53936.1"
FT                   /translation="MIYKNYAILFAIGFIWGSQFIFQELALNSFSPIWLGSCRAILGTI
FT                   TLSLICKMMGLKGASNQWRLFTLIGLLEASIPFVLIPWGQQHLTSSITAILMGTIPFYT
FT                   LMFAPLFIKDARISMGSTLSLIVGFCGLLILFYPELSSGTGTINLTSSIAIIIAAVCFA
FT                   LALLLLNRVRDEHPLIVARNVLSMASIQLMVIALIMLPMEFTQASLTSVFSLLYLGVIC
FT                   AGAVYYLYMVSIKNAGAVFTSMTNYLVPAVGVLIGALIANESIQTTTWVALAVIIFALI
FT                   INQSMTIKK"
FT   gene            complement(748404..748817)
FT                   /locus_tag="Sden_0647"
FT   CDS_pept        complement(748404..748817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0647"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53937"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RI9"
FT                   /protein_id="ABE53937.1"
FT                   /translation="MTINLPNYSNPAELFDPTPFGFCHTVKVPSNGELVYISGQSGGEG
FT                   PEHILNEDFRHQVQVLLSNLNIALTAHELHFDDVIKITILIVDHNVDKLEIWSEEMQKR
FT                   WSTTLPASTLIPVPNLAITGMKIEVDAIAFKSA"
FT   gene            749101..749730
FT                   /locus_tag="Sden_0648"
FT   CDS_pept        749101..749730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53938"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q12RI8"
FT                   /protein_id="ABE53938.1"
FT                   /translation="MLKKIILALAVIIALPLIAALFLKTHYSVVRSITVERPNAQVFDY
FT                   IKHLKNQDNFSKWAMMDPDMKKTYRGEDGMAGFVSAWASENPDVGVGEQEIIKITPNER
FT                   VDFELRFLSPFEATEPAYMSTKPVSDTSTQVDWGFSGHMDYPMNLMLAVMDFETMIGND
FT                   LQEGLNNLKQVLEAKPVKESLPEPVEPEVFDSLEEQAAPLELKAAH"
FT   sig_peptide     749101..749160
FT                   /locus_tag="Sden_0648"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            749784..751154
FT                   /locus_tag="Sden_0649"
FT   CDS_pept        749784..751154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sden_0649"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sden_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE53939