(data stored in ACNUC7421 zone)

EMBL: CP000304

ID   CP000304; SV 1; circular; genomic DNA; STD; PRO; 4567418 BP.
XX
AC   CP000304;
XX
PR   Project:PRJNA16817;
XX
DT   21-APR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Pseudomonas stutzeri A1501, complete genome.
XX
KW   .
XX
OS   Pseudomonas stutzeri A1501
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-4567418
RX   DOI; 10.1073/pnas.0801093105.
RX   PUBMED; 18495935.
RA   Yan Y., Yang J., Dou Y., Chen M., Ping S., Peng J., Lu W., Zhang W.,
RA   Yao Z., Li H., Liu W., He S., Geng L., Zhang X., Yang F., Yu H., Zhan Y.,
RA   Li D., Lin Z., Wang Y., Elmerich C., Lin M., Jin Q.;
RT   "Nitrogen fixation island and rhizosphere competence traits in the genome
RT   of root-associated Pseudomonas stutzeri A1501";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(21):7564-7569(2008).
XX
RN   [2]
RP   1-4567418
RA   Yan Y., Jin Q., Yang T., Wang Y., Lin M.;
RT   ;
RL   Submitted (03-APR-2006) to the INSDC.
RL   The Biotechnology Research Institute, The Chinese Academy of Agricultural
RL   Sciences, 12 Zhongguancun South Street, HaiDian, Beijing, Beijing 100081,
RL   P. R. China
XX
DR   MD5; 5e34f3de7641a26d3eab0b02924038c4.
DR   BioSample; SAMN02603910.
DR   EnsemblGenomes-Gn; EBG00001165285.
DR   EnsemblGenomes-Gn; EBG00001165286.
DR   EnsemblGenomes-Gn; EBG00001165287.
DR   EnsemblGenomes-Gn; EBG00001165288.
DR   EnsemblGenomes-Gn; EBG00001165289.
DR   EnsemblGenomes-Gn; EBG00001165290.
DR   EnsemblGenomes-Gn; EBG00001165291.
DR   EnsemblGenomes-Gn; EBG00001165292.
DR   EnsemblGenomes-Gn; EBG00001165293.
DR   EnsemblGenomes-Gn; EBG00001165294.
DR   EnsemblGenomes-Gn; EBG00001165295.
DR   EnsemblGenomes-Gn; EBG00001165296.
DR   EnsemblGenomes-Gn; EBG00001165297.
DR   EnsemblGenomes-Gn; EBG00001165298.
DR   EnsemblGenomes-Gn; EBG00001165299.
DR   EnsemblGenomes-Gn; EBG00001165300.
DR   EnsemblGenomes-Gn; EBG00001165301.
DR   EnsemblGenomes-Gn; EBG00001165302.
DR   EnsemblGenomes-Gn; EBG00001165303.
DR   EnsemblGenomes-Gn; EBG00001165304.
DR   EnsemblGenomes-Gn; EBG00001165305.
DR   EnsemblGenomes-Gn; EBG00001165306.
DR   EnsemblGenomes-Gn; EBG00001165307.
DR   EnsemblGenomes-Gn; EBG00001165308.
DR   EnsemblGenomes-Gn; EBG00001165309.
DR   EnsemblGenomes-Gn; EBG00001165310.
DR   EnsemblGenomes-Gn; EBG00001165311.
DR   EnsemblGenomes-Gn; EBG00001165312.
DR   EnsemblGenomes-Gn; EBG00001165313.
DR   EnsemblGenomes-Gn; EBG00001165314.
DR   EnsemblGenomes-Gn; EBG00001165315.
DR   EnsemblGenomes-Gn; EBG00001165316.
DR   EnsemblGenomes-Gn; EBG00001165317.
DR   EnsemblGenomes-Gn; EBG00001165318.
DR   EnsemblGenomes-Gn; EBG00001165319.
DR   EnsemblGenomes-Gn; EBG00001165320.
DR   EnsemblGenomes-Gn; EBG00001165321.
DR   EnsemblGenomes-Gn; EBG00001165322.
DR   EnsemblGenomes-Gn; EBG00001165323.
DR   EnsemblGenomes-Gn; EBG00001165324.
DR   EnsemblGenomes-Gn; EBG00001165325.
DR   EnsemblGenomes-Gn; EBG00001165326.
DR   EnsemblGenomes-Gn; EBG00001165327.
DR   EnsemblGenomes-Gn; EBG00001165328.
DR   EnsemblGenomes-Gn; EBG00001165329.
DR   EnsemblGenomes-Gn; EBG00001165330.
DR   EnsemblGenomes-Gn; EBG00001165331.
DR   EnsemblGenomes-Gn; EBG00001165332.
DR   EnsemblGenomes-Gn; EBG00001165333.
DR   EnsemblGenomes-Gn; EBG00001165335.
DR   EnsemblGenomes-Gn; EBG00001165336.
DR   EnsemblGenomes-Gn; EBG00001165337.
DR   EnsemblGenomes-Gn; EBG00001165338.
DR   EnsemblGenomes-Gn; EBG00001165339.
DR   EnsemblGenomes-Gn; EBG00001165340.
DR   EnsemblGenomes-Gn; EBG00001165341.
DR   EnsemblGenomes-Gn; EBG00001165342.
DR   EnsemblGenomes-Gn; EBG00001165343.
DR   EnsemblGenomes-Gn; EBG00001165344.
DR   EnsemblGenomes-Gn; EBG00001165345.
DR   EnsemblGenomes-Gn; EBG00001165346.
DR   EnsemblGenomes-Gn; EBG00001165347.
DR   EnsemblGenomes-Gn; EBG00001165348.
DR   EnsemblGenomes-Gn; EBG00001165349.
DR   EnsemblGenomes-Gn; EBG00001165350.
DR   EnsemblGenomes-Gn; EBG00001165351.
DR   EnsemblGenomes-Gn; EBG00001165352.
DR   EnsemblGenomes-Gn; EBG00001165353.
DR   EnsemblGenomes-Gn; EBG00001165354.
DR   EnsemblGenomes-Gn; EBG00001165355.
DR   EnsemblGenomes-Gn; EBG00001165356.
DR   EnsemblGenomes-Gn; EBG00001165357.
DR   EnsemblGenomes-Gn; EBG00001165358.
DR   EnsemblGenomes-Gn; EBG00001165359.
DR   EnsemblGenomes-Gn; EBG00001165360.
DR   EnsemblGenomes-Gn; EBG00001165361.
DR   EnsemblGenomes-Gn; EBG00001165362.
DR   EnsemblGenomes-Gn; EBG00001165363.
DR   EnsemblGenomes-Gn; EBG00001165364.
DR   EnsemblGenomes-Gn; EBG00001165365.
DR   EnsemblGenomes-Gn; EBG00001165366.
DR   EnsemblGenomes-Gn; EBG00001165367.
DR   EnsemblGenomes-Gn; EBG00001165368.
DR   EnsemblGenomes-Gn; EBG00001165369.
DR   EnsemblGenomes-Gn; EBG00001165370.
DR   EnsemblGenomes-Gn; EBG00001165371.
DR   EnsemblGenomes-Gn; EBG00001165372.
DR   EnsemblGenomes-Gn; EBG00001165373.
DR   EnsemblGenomes-Gn; EBG00001165374.
DR   EnsemblGenomes-Gn; EBG00001165375.
DR   EnsemblGenomes-Gn; EBG00001165376.
DR   EnsemblGenomes-Gn; EBG00001165377.
DR   EnsemblGenomes-Gn; EBG00001165378.
DR   EnsemblGenomes-Gn; EBG00001165379.
DR   EnsemblGenomes-Gn; EBG00001165380.
DR   EnsemblGenomes-Gn; EBG00001165381.
DR   EnsemblGenomes-Gn; EBG00001165382.
DR   EnsemblGenomes-Gn; EBG00001165383.
DR   EnsemblGenomes-Gn; EBG00001165384.
DR   EnsemblGenomes-Gn; EBG00001165385.
DR   EnsemblGenomes-Gn; EBG00001165386.
DR   EnsemblGenomes-Gn; EBG00001165387.
DR   EnsemblGenomes-Gn; EBG00001165388.
DR   EnsemblGenomes-Gn; PST_0094.
DR   EnsemblGenomes-Gn; PST_0260.
DR   EnsemblGenomes-Gn; PST_0711.
DR   EnsemblGenomes-Gn; PST_0759.
DR   EnsemblGenomes-Gn; PST_0760.
DR   EnsemblGenomes-Gn; PST_0761.
DR   EnsemblGenomes-Gn; PST_0762.
DR   EnsemblGenomes-Gn; PST_0766.
DR   EnsemblGenomes-Gn; PST_0767.
DR   EnsemblGenomes-Gn; PST_0768.
DR   EnsemblGenomes-Gn; PST_0770.
DR   EnsemblGenomes-Gn; PST_1260.
DR   EnsemblGenomes-Gn; PST_1372.
DR   EnsemblGenomes-Gn; PST_1373.
DR   EnsemblGenomes-Gn; PST_1374.
DR   EnsemblGenomes-Gn; PST_1381.
DR   EnsemblGenomes-Gn; PST_1463.
DR   EnsemblGenomes-Gn; PST_1490.
DR   EnsemblGenomes-Gn; PST_1646.
DR   EnsemblGenomes-Gn; PST_1677.
DR   EnsemblGenomes-Gn; PST_1678.
DR   EnsemblGenomes-Gn; PST_1679.
DR   EnsemblGenomes-Gn; PST_1764.
DR   EnsemblGenomes-Gn; PST_1765.
DR   EnsemblGenomes-Gn; PST_1788.
DR   EnsemblGenomes-Gn; PST_1789.
DR   EnsemblGenomes-Gn; PST_1989.
DR   EnsemblGenomes-Gn; PST_2055.
DR   EnsemblGenomes-Gn; PST_2056.
DR   EnsemblGenomes-Gn; PST_2057.
DR   EnsemblGenomes-Gn; PST_2088.
DR   EnsemblGenomes-Gn; PST_2090.
DR   EnsemblGenomes-Gn; PST_2106.
DR   EnsemblGenomes-Gn; PST_2318.
DR   EnsemblGenomes-Gn; PST_2319.
DR   EnsemblGenomes-Gn; PST_2320.
DR   EnsemblGenomes-Gn; PST_2321.
DR   EnsemblGenomes-Gn; PST_2361.
DR   EnsemblGenomes-Gn; PST_2370.
DR   EnsemblGenomes-Gn; PST_2378.
DR   EnsemblGenomes-Gn; PST_2530.
DR   EnsemblGenomes-Gn; PST_2532.
DR   EnsemblGenomes-Gn; PST_2771.
DR   EnsemblGenomes-Gn; PST_2772.
DR   EnsemblGenomes-Gn; PST_2787.
DR   EnsemblGenomes-Gn; PST_2798.
DR   EnsemblGenomes-Gn; PST_2992.
DR   EnsemblGenomes-Gn; PST_2993.
DR   EnsemblGenomes-Gn; PST_2994.
DR   EnsemblGenomes-Gn; PST_2995.
DR   EnsemblGenomes-Gn; PST_2999.
DR   EnsemblGenomes-Gn; PST_3053.
DR   EnsemblGenomes-Gn; PST_3187.
DR   EnsemblGenomes-Gn; PST_3188.
DR   EnsemblGenomes-Gn; PST_3232.
DR   EnsemblGenomes-Gn; PST_3249.
DR   EnsemblGenomes-Gn; PST_3250.
DR   EnsemblGenomes-Gn; PST_3251.
DR   EnsemblGenomes-Gn; PST_3252.
DR   EnsemblGenomes-Gn; PST_3313.
DR   EnsemblGenomes-Gn; PST_3314.
DR   EnsemblGenomes-Gn; PST_3342.
DR   EnsemblGenomes-Gn; PST_3637.
DR   EnsemblGenomes-Gn; PST_3638.
DR   EnsemblGenomes-Gn; PST_3639.
DR   EnsemblGenomes-Gn; PST_3660.
DR   EnsemblGenomes-Gn; PST_3662.
DR   EnsemblGenomes-Gn; PST_4099.
DR   EnsemblGenomes-Tr; EBT00001732338.
DR   EnsemblGenomes-Tr; EBT00001732339.
DR   EnsemblGenomes-Tr; EBT00001732340.
DR   EnsemblGenomes-Tr; EBT00001732341.
DR   EnsemblGenomes-Tr; EBT00001732342.
DR   EnsemblGenomes-Tr; EBT00001732343.
DR   EnsemblGenomes-Tr; EBT00001732344.
DR   EnsemblGenomes-Tr; EBT00001732345.
DR   EnsemblGenomes-Tr; EBT00001732346.
DR   EnsemblGenomes-Tr; EBT00001732347.
DR   EnsemblGenomes-Tr; EBT00001732348.
DR   EnsemblGenomes-Tr; EBT00001732349.
DR   EnsemblGenomes-Tr; EBT00001732350.
DR   EnsemblGenomes-Tr; EBT00001732351.
DR   EnsemblGenomes-Tr; EBT00001732352.
DR   EnsemblGenomes-Tr; EBT00001732353.
DR   EnsemblGenomes-Tr; EBT00001732354.
DR   EnsemblGenomes-Tr; EBT00001732355.
DR   EnsemblGenomes-Tr; EBT00001732356.
DR   EnsemblGenomes-Tr; EBT00001732357.
DR   EnsemblGenomes-Tr; EBT00001732358.
DR   EnsemblGenomes-Tr; EBT00001732359.
DR   EnsemblGenomes-Tr; EBT00001732360.
DR   EnsemblGenomes-Tr; EBT00001732361.
DR   EnsemblGenomes-Tr; EBT00001732362.
DR   EnsemblGenomes-Tr; EBT00001732363.
DR   EnsemblGenomes-Tr; EBT00001732364.
DR   EnsemblGenomes-Tr; EBT00001732365.
DR   EnsemblGenomes-Tr; EBT00001732366.
DR   EnsemblGenomes-Tr; EBT00001732367.
DR   EnsemblGenomes-Tr; EBT00001732368.
DR   EnsemblGenomes-Tr; EBT00001732369.
DR   EnsemblGenomes-Tr; EBT00001732370.
DR   EnsemblGenomes-Tr; EBT00001732371.
DR   EnsemblGenomes-Tr; EBT00001732372.
DR   EnsemblGenomes-Tr; EBT00001732373.
DR   EnsemblGenomes-Tr; EBT00001732374.
DR   EnsemblGenomes-Tr; EBT00001732375.
DR   EnsemblGenomes-Tr; EBT00001732376.
DR   EnsemblGenomes-Tr; EBT00001732377.
DR   EnsemblGenomes-Tr; EBT00001732378.
DR   EnsemblGenomes-Tr; EBT00001732379.
DR   EnsemblGenomes-Tr; EBT00001732380.
DR   EnsemblGenomes-Tr; EBT00001732381.
DR   EnsemblGenomes-Tr; EBT00001732382.
DR   EnsemblGenomes-Tr; EBT00001732383.
DR   EnsemblGenomes-Tr; EBT00001732384.
DR   EnsemblGenomes-Tr; EBT00001732385.
DR   EnsemblGenomes-Tr; EBT00001732386.
DR   EnsemblGenomes-Tr; EBT00001732388.
DR   EnsemblGenomes-Tr; EBT00001732389.
DR   EnsemblGenomes-Tr; EBT00001732391.
DR   EnsemblGenomes-Tr; EBT00001732392.
DR   EnsemblGenomes-Tr; EBT00001732393.
DR   EnsemblGenomes-Tr; EBT00001732394.
DR   EnsemblGenomes-Tr; EBT00001732395.
DR   EnsemblGenomes-Tr; EBT00001732396.
DR   EnsemblGenomes-Tr; EBT00001732397.
DR   EnsemblGenomes-Tr; EBT00001732398.
DR   EnsemblGenomes-Tr; EBT00001732399.
DR   EnsemblGenomes-Tr; EBT00001732400.
DR   EnsemblGenomes-Tr; EBT00001732401.
DR   EnsemblGenomes-Tr; EBT00001732402.
DR   EnsemblGenomes-Tr; EBT00001732403.
DR   EnsemblGenomes-Tr; EBT00001732404.
DR   EnsemblGenomes-Tr; EBT00001732405.
DR   EnsemblGenomes-Tr; EBT00001732406.
DR   EnsemblGenomes-Tr; EBT00001732407.
DR   EnsemblGenomes-Tr; EBT00001732408.
DR   EnsemblGenomes-Tr; EBT00001732409.
DR   EnsemblGenomes-Tr; EBT00001732411.
DR   EnsemblGenomes-Tr; EBT00001732412.
DR   EnsemblGenomes-Tr; EBT00001732413.
DR   EnsemblGenomes-Tr; EBT00001732414.
DR   EnsemblGenomes-Tr; EBT00001732415.
DR   EnsemblGenomes-Tr; EBT00001732416.
DR   EnsemblGenomes-Tr; EBT00001732417.
DR   EnsemblGenomes-Tr; EBT00001732418.
DR   EnsemblGenomes-Tr; EBT00001732419.
DR   EnsemblGenomes-Tr; EBT00001732420.
DR   EnsemblGenomes-Tr; EBT00001732421.
DR   EnsemblGenomes-Tr; EBT00001732422.
DR   EnsemblGenomes-Tr; EBT00001732423.
DR   EnsemblGenomes-Tr; EBT00001732424.
DR   EnsemblGenomes-Tr; EBT00001732425.
DR   EnsemblGenomes-Tr; EBT00001732426.
DR   EnsemblGenomes-Tr; EBT00001732427.
DR   EnsemblGenomes-Tr; EBT00001732428.
DR   EnsemblGenomes-Tr; EBT00001732429.
DR   EnsemblGenomes-Tr; EBT00001732430.
DR   EnsemblGenomes-Tr; EBT00001732431.
DR   EnsemblGenomes-Tr; EBT00001732432.
DR   EnsemblGenomes-Tr; EBT00001732433.
DR   EnsemblGenomes-Tr; EBT00001732434.
DR   EnsemblGenomes-Tr; EBT00001732435.
DR   EnsemblGenomes-Tr; EBT00001732436.
DR   EnsemblGenomes-Tr; EBT00001732437.
DR   EnsemblGenomes-Tr; EBT00001732438.
DR   EnsemblGenomes-Tr; EBT00001732439.
DR   EnsemblGenomes-Tr; EBT00001732440.
DR   EnsemblGenomes-Tr; EBT00001732442.
DR   EnsemblGenomes-Tr; EBT00001732443.
DR   EnsemblGenomes-Tr; PST_0094-1.
DR   EnsemblGenomes-Tr; PST_0260-1.
DR   EnsemblGenomes-Tr; PST_0711-1.
DR   EnsemblGenomes-Tr; PST_0759-1.
DR   EnsemblGenomes-Tr; PST_0760-1.
DR   EnsemblGenomes-Tr; PST_0761-1.
DR   EnsemblGenomes-Tr; PST_0762-1.
DR   EnsemblGenomes-Tr; PST_0766-1.
DR   EnsemblGenomes-Tr; PST_0767-1.
DR   EnsemblGenomes-Tr; PST_0768-1.
DR   EnsemblGenomes-Tr; PST_0770-1.
DR   EnsemblGenomes-Tr; PST_1260-1.
DR   EnsemblGenomes-Tr; PST_1372-1.
DR   EnsemblGenomes-Tr; PST_1373-1.
DR   EnsemblGenomes-Tr; PST_1374-1.
DR   EnsemblGenomes-Tr; PST_1381-1.
DR   EnsemblGenomes-Tr; PST_1463-1.
DR   EnsemblGenomes-Tr; PST_1490-1.
DR   EnsemblGenomes-Tr; PST_1646-1.
DR   EnsemblGenomes-Tr; PST_1677-1.
DR   EnsemblGenomes-Tr; PST_1678-1.
DR   EnsemblGenomes-Tr; PST_1679-1.
DR   EnsemblGenomes-Tr; PST_1680-1.
DR   EnsemblGenomes-Tr; PST_1764-1.
DR   EnsemblGenomes-Tr; PST_1765-1.
DR   EnsemblGenomes-Tr; PST_1788-1.
DR   EnsemblGenomes-Tr; PST_1789-1.
DR   EnsemblGenomes-Tr; PST_1989-1.
DR   EnsemblGenomes-Tr; PST_2055-1.
DR   EnsemblGenomes-Tr; PST_2056-1.
DR   EnsemblGenomes-Tr; PST_2057-1.
DR   EnsemblGenomes-Tr; PST_2088-1.
DR   EnsemblGenomes-Tr; PST_2090-1.
DR   EnsemblGenomes-Tr; PST_2106-1.
DR   EnsemblGenomes-Tr; PST_2318-1.
DR   EnsemblGenomes-Tr; PST_2319-1.
DR   EnsemblGenomes-Tr; PST_2320-1.
DR   EnsemblGenomes-Tr; PST_2321-1.
DR   EnsemblGenomes-Tr; PST_2361-1.
DR   EnsemblGenomes-Tr; PST_2370-1.
DR   EnsemblGenomes-Tr; PST_2378-1.
DR   EnsemblGenomes-Tr; PST_2530-1.
DR   EnsemblGenomes-Tr; PST_2532-1.
DR   EnsemblGenomes-Tr; PST_2771-1.
DR   EnsemblGenomes-Tr; PST_2772-1.
DR   EnsemblGenomes-Tr; PST_2787-1.
DR   EnsemblGenomes-Tr; PST_2798-1.
DR   EnsemblGenomes-Tr; PST_2992-1.
DR   EnsemblGenomes-Tr; PST_2993-1.
DR   EnsemblGenomes-Tr; PST_2994-1.
DR   EnsemblGenomes-Tr; PST_2995-1.
DR   EnsemblGenomes-Tr; PST_2999-1.
DR   EnsemblGenomes-Tr; PST_3053-1.
DR   EnsemblGenomes-Tr; PST_3187-1.
DR   EnsemblGenomes-Tr; PST_3188-1.
DR   EnsemblGenomes-Tr; PST_3232-1.
DR   EnsemblGenomes-Tr; PST_3249-1.
DR   EnsemblGenomes-Tr; PST_3250-1.
DR   EnsemblGenomes-Tr; PST_3251-1.
DR   EnsemblGenomes-Tr; PST_3252-1.
DR   EnsemblGenomes-Tr; PST_3313-1.
DR   EnsemblGenomes-Tr; PST_3314-1.
DR   EnsemblGenomes-Tr; PST_3342-1.
DR   EnsemblGenomes-Tr; PST_3637-1.
DR   EnsemblGenomes-Tr; PST_3638-1.
DR   EnsemblGenomes-Tr; PST_3639-1.
DR   EnsemblGenomes-Tr; PST_3660-1.
DR   EnsemblGenomes-Tr; PST_3662-1.
DR   EnsemblGenomes-Tr; PST_4099-1.
DR   EuropePMC; PMC2396677; 18495935.
DR   EuropePMC; PMC2632904; 19056824.
DR   EuropePMC; PMC2772449; 19734336.
DR   EuropePMC; PMC2976230; 20817796.
DR   EuropePMC; PMC3067233; 21169432.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3416245; 22843599.
DR   EuropePMC; PMC3652814; 23675499.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC5594592; 28893188.
DR   EuropePMC; PMC6036183; 30013544.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02144; rsmX.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000304.
DR   SILVA-SSU; CP000304.
XX
CC   Bacteria available from Prof. Lin Min: linmin57@vip.163.com.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4567418
FT                   /organism="Pseudomonas stutzeri A1501"
FT                   /strain="A1501"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:379731"
FT   gene            380..1924
FT                   /gene="dnaA"
FT                   /locus_tag="PST_0001"
FT   CDS_pept        380..1924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PST_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Code: L; COG: COG0593"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77709"
FT                   /db_xref="GOA:A4VFF8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFF8"
FT                   /protein_id="ABP77709.1"
FT                   /translation="MGRVLVDNRPAHGYNGRLLTSTESIGASVSVELWQQCVELLRDEL
FT                   PAQQFNTWIRPLQVEGDGDELRVYAPNRFVLDWVNEKYLSRLLELLSERSTGLAPALSL
FT                   LIGSKRTSAAALPSAAAAARAQPQPAAAESAAPAAAVQQQAPRFEPLVAETPEPEPPRT
FT                   ERTVQVEGGLKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVG
FT                   LGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLI
FT                   DDIQFFAKKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIDGLEERLKSRFGWGLTVA
FT                   VEPPELETRVAILMKKADQAKVDLPHDAAFFIAQRIRSNVRELEGALKRVIAHAHFMGR
FT                   DITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
FT                   ALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAELRETDADIREDYKNLLRTLTT"
FT   gene            1958..3061
FT                   /gene="dnaN"
FT                   /locus_tag="PST_0002"
FT   CDS_pept        1958..3061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PST_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="Code: L; COG: COG0592"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77710"
FT                   /db_xref="GOA:A4VFF9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFF9"
FT                   /protein_id="ABP77710.1"
FT                   /translation="MHFSIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLT
FT                   GTDLEVELVGRVALEDAAEPGEITVPARKLMDICKSLPSDALISIRLDDQKVVIKSGRS
FT                   RFTLSTLPANDFPTVEEGPGSLSFTVAQGKLRKLIERSAFAMAQQDVRYYLNGMLIEVS
FT                   SGMLRAVATDGHRLAMCSMQAGIEQPDRHQVIVPRKGILELARLLNDQDAEVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQLLREAFSRTAILSNEKYRG
FT                   IRLQLESGLLKIQANNPEQEEAEEEVAVDYNGGSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDANSSALVQEFDNDDSAYVVMPMRL"
FT   gene            3071..4183
FT                   /gene="recF"
FT                   /locus_tag="PST_0003"
FT   CDS_pept        3071..4183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PST_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="Code: L; COG: COG1195"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77711"
FT                   /db_xref="GOA:A4VFG0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFG0"
FT                   /protein_id="ABP77711.1"
FT                   /translation="MSLSRLSVTGVRNLHPVTLSPSPRINILFGDNGSGKTSLLEAIHL
FT                   LGLARSFRSIRLNPVITYEQPACTVFGQVELPDQHSRALGVSRDRSGEVRIRIDGQSVR
FT                   SAAELADTLPLQLINPDSFRLLEGAPKLRRQFLDWGVFHVEHRFMSAWQRLQQALRQRN
FT                   SWLRHGTLDSASDAAWSRELSLASDEIDGYRRAYIQALKPVFETTLKALLDLDGLTLSY
FT                   YRGWDKDRPLVDVLASSLERDRAMGHTQSGPQRADLRLKVGSHNAAEVLSRGQQKLVVC
FT                   ALRIAQGHLVSEAKRGQCIYLVDDLPSELDAQHRLALCRLLEQLNCQVFITCVDSTVLQ
FT                   EGWGEQTPVSMFHVEHGQITQLHGPSGVKA"
FT   gene            4180..6594
FT                   /gene="gyrB"
FT                   /locus_tag="PST_0004"
FT   CDS_pept        4180..6594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PST_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /note="Code: L; COG: COG0187"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77712"
FT                   /db_xref="GOA:A4VFG1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG1"
FT                   /protein_id="ABP77712.1"
FT                   /translation="MSENHTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGYCSDISITIHTDESITVRDNGRGIPVDIHEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSEELLLTIRREGKVWEQLYRHGVPQAPLAAVGETDT
FT                   SGTQIHFKPSAETFQNIHFSWDILAKRLRELSFLNSGVGIVLRDERTAKEELFKYEGGL
FT                   SAFVAYLNTNKTAVNQVFHFNVQRDDGVGVEVALQWNDSFNENILCFTNNIPQRDGGTH
FT                   LAGFRSALTRNLNNYIEQEGLAKKHKIATTGDDAREGLTAIISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVEQEMGKYFADFLLEHPNEAKAVVGKMIDAARAREAARKAREMTRRKGALD
FT                   IAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKTQAILPLKGKILNVEKARF
FT                   DKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFRQ
FT                   LPELIERGYVYIAQPPLYKVKRGKQEQYIKDDEAMEEYLTQSALEEASLHVNEDAPGLA
FT                   GEALERLVNDYRTVMKTLQRLSRLYPLELTEHFIYLPRVTLEQLADHSAMQAWLEQYSA
FT                   RLKAGERSGLIYNLSLREDKERHLWLPEVEISSHGLASYITFNRDFFGSNDYRTVTALG
FT                   EKLNSLLEEGAYVQRGERKKPVASFKEALDWLMNEGTRRHSVQRYKGLGEMNPDQLWET
FT                   TMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRREFIETNALAVSNLDF"
FT   gene            6798..8360
FT                   /gene="ahpF-1"
FT                   /locus_tag="PST_0005"
FT   CDS_pept        6798..8360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF-1"
FT                   /locus_tag="PST_0005"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /note="Code: O; COG: COG3634"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77713"
FT                   /db_xref="GOA:A4VFG2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG2"
FT                   /protein_id="ABP77713.1"
FT                   /translation="MLDSNLKTQLKAYLEKVTQPFEIVASLDDGEKSRELLSLLQDIAG
FT                   LSDKITLKTDGDDARKPSFSLNRIGGNISLRFAGIPMGHEFTSLVLALLQVGGHPSKTA
FT                   PEVIEQIKALDGDYRFETYFSLSCQNCPDVVQALNLMAVLNPNVKHVAIDGALFQDEVE
FT                   ARQIMSVPSIYLNGELFTQGRMSEEEILAKLDTGSSARDAEKLKAKDAFDVLVVGGGPA
FT                   GAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYEV
FT                   DIMNLQRASQLIPAGEDGLHRVRFDNGGELKAKTLILATGARWREMNVPGEQEYRGRGV
FT                   AYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFGEDLRADAVLQRKLN
FT                   SLPNVRVLKMAQTTEVKGDGQKVTGLIYKDRSSEEMHSVELEGIFVQIGLLPNSEWLKG
FT                   TLELSRFGEIIVDAKGQTSIPGVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTS
FT                   APA"
FT   gene            complement(8434..9804)
FT                   /locus_tag="PST_0006"
FT   CDS_pept        complement(8434..9804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0006"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77714"
FT                   /db_xref="GOA:A4VFG3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039435"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG3"
FT                   /protein_id="ABP77714.1"
FT                   /translation="MQQIPNHQLVAEWLRLLDGYPAEAAAALQAVTAEKSQELAEHFYS
FT                   QMLADPHSASFLSHDQVKNRLGKSMQKWIVTVCSSTAHSDLNAVIDLQRKVGDIHARIE
FT                   IPVSLVLRGSRSLKGRLRQLLEQRELAEPIRRKAARMGADLIDLAVEIICFAYSQSHDR
FT                   NSRAEEAYRLFSVSQNIGVEKERQRAALLDWENQLMFDLAIGNLTGTLPQLAGSEFGLW
FT                   FRHKASHAFQGSPESASILEYITQIDEELKAIATLDDAAGRLGKLHQIREQTRSIKFLL
FT                   DSLFEQANDLEAGRDVLTRLLNRKFLPVVMAKEVLYARQSNNTFGVLAIDVDHFKRIND
FT                   THGHDAGDQILQQVGALLASNTRGGDYAFRLGGEEFLLVLVDIDTNKALAAAEKLRERI
FT                   AREHFRLSSGEVLQVTVSIGMAVHDGHPDYERLLQQADQALYQAKHGGRNRCVLYAG"
FT   gene            complement(9852..10601)
FT                   /locus_tag="PST_0007"
FT   CDS_pept        complement(9852..10601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0007"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase"
FT                   /note="Code: I; COG: COG0204"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77715"
FT                   /db_xref="GOA:A4VFG4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG4"
FT                   /protein_id="ABP77715.1"
FT                   /translation="MSLLFPLRIVLFYFLLAFTAFVWCLVSLVFAPFMAFRARYRFVVQ
FT                   NWCRCAIWLGKTLVGLRYEVHGAENVPARPCVILAKHQSTWETFFLSAYFEPLTQVLKR
FT                   ELLRVPFFGWAIMLLKPIAIDRDNPKAALRQVAKQGHERLEQGAWVLIFPEGTRVPVGQ
FT                   PAKFSRSGAALAVNAGLPVLPIAHNAGMFWPKAGWGKRPGTIQVVIGPPMMAESEGPRA
FT                   VAELNQRAEDWVNAQVSQLEVQGRPTH"
FT   gene            complement(10598..11176)
FT                   /locus_tag="PST_0008"
FT   CDS_pept        complement(10598..11176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0008"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="Code: E; COG: COG0241"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77716"
FT                   /db_xref="GOA:A4VFG5"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG5"
FT                   /protein_id="ABP77716.1"
FT                   /translation="MALPIFPHLAKPVKLIVLDRDGVINEDSDEYVKSVEEWIPIPGSL
FT                   EAIARLCKAGWTVAVATNQSGVARGKFDLSTLGDMHFKMQQLVMGQGGRIDLIVHCPHG
FT                   PDDGCDCRKPKPGMFRTIAEHFGLADLKGVPVVGDSHRDLHAGMLLGGVPYLVRTGKGL
FT                   RTLEGTLPPGTQVFDDLAAVVDHLLESSR"
FT   gene            complement(11145..13199)
FT                   /gene="glyS"
FT                   /locus_tag="PST_0009"
FT   CDS_pept        complement(11145..13199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PST_0009"
FT                   /product="glycyl-tRNA synthetase, tetrameric type, beta
FT                   subunit"
FT                   /note="Code: J; COG: COG0751"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77717"
FT                   /db_xref="GOA:A4VFG6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFG6"
FT                   /protein_id="ABP77717.1"
FT                   /translation="MSALDFLVELGTEELPPKALAKLADAFCAGIEKGLKDAGLGFAKA
FT                   QAYAAPRRLAVLVEQLATQQPDRSINLDGPPMQAAFDAHGEPTQAALGFARKCGVDLAE
FT                   IDRSGPKLKFSRTIEGQPATQLLPGIVEASLNDLPIPKRMRWAARKEEFVRPTQWLVML
FT                   FGEQVIDCEILAQRAGRESRGHRFHSPGQVHISKPSSYLEDLRGAHVIADFAERRELIA
FT                   KRVEQLASEQNGSAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALISTMQDNQK
FT                   YFCLLDTNGKLLPRFITVANIESKDPAQIVSGNEKVVRPRLTDAEFFFKQDKKQPLERF
FT                   NDRLKNVVFQAQLGTVFDKAERVSRLAGLIAERTGGDKARAMRAGLLSKADLATEMVGE
FT                   FPEMQGIAGYYYALNEGEPEDVALALNEQYMPRGAGGELPSTLTGAAVAVADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLNLVEAVNFAIGQFGTQVKSAGLAD
FT                   QVLEFIFDRLRARYEDEGVDVAAYLSVRAVQPGSALDFDQRVQAVQAFRTLPEAEALAA
FT                   ANKRVSNLLAKFEAKLPEAVEPRWFDNATEFSLYSALQQAEQAVQPLAAARQYREALER
FT                   LAHLRGPVDAFFEAVLVNAEDASVRANRYALLARLRGLFLGVADISALG"
FT   gene            complement(13196..14062)
FT                   /gene="glyQ"
FT                   /locus_tag="PST_0010"
FT   CDS_pept        complement(13196..14062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PST_0010"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /note="Code: J; COG: COG0752"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77718"
FT                   /db_xref="GOA:A4VFG7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG7"
FT                   /protein_id="ABP77718.1"
FT                   /translation="MVLQPYDMEMGAGTFHTATFLRAIGPETWNAAYVQPSRRPADGRY
FT                   GENPNRLQHYYQFQVVLKPNPDNIQDLYLESLRRIGVDTSVHDVRFVEDNWESPTLGAW
FT                   GLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLIWADG
FT                   PFGTVTYGDVFHQNEVEQSTYNFEHANVPKLFELFDFYESEANRLMAAELPLPAYEMVV
FT                   KASHTFNLLDARRAISVTARQQYILRVRSLARSIAQSYLLARAKLGFPMATPELRDEVL
FT                   AKLEAAE"
FT   gene            14251..14808
FT                   /gene="tag"
FT                   /locus_tag="PST_0011"
FT   CDS_pept        14251..14808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PST_0011"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /note="Code: L; COG: COG2818"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77719"
FT                   /db_xref="GOA:A4VFG8"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG8"
FT                   /protein_id="ABP77719.1"
FT                   /translation="MPRCAWCGTDPLYIDYHDREWGVPARDPQVLFEFLLLEAFQAGLS
FT                   WITVLRKRERYRQVLFGFDAERLARMSDAEIDERMQDPGIIRNRRKLEAARSNARAWLQ
FT                   LEDPVGFVWSFVGGEPKINRFERLDQVPAVSPEAEAMSRALKKAGFSFVGPTICYAYMQ
FT                   ACGMVMDHLIDCERHAALVGGD"
FT   gene            15010..15795
FT                   /locus_tag="PST_0012"
FT   CDS_pept        15010..15795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0012"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase,
FT                   putative"
FT                   /note="Code: M; COG: COG1560"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77720"
FT                   /db_xref="GOA:A4VFG9"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFG9"
FT                   /protein_id="ABP77720.1"
FT                   /translation="MWKLPNRSREVARINLHKCFPELSAAELDVLLGKTLRQTGMTFTE
FT                   SACAWIWPAEKTLGLIREVEGLEVLQAALASGKGVVGITSHLGNWEVLNHFYCAQCKPI
FT                   IFYRPPKLKAVDELLQQQRVQLGNRVAPSTREGILSVIKEVRRGGAVGIPADPEPSEGS
FT                   GIFVPFFATQALTSKFVPGMLAGGKAVGVFLHALRLEDGSGYKVILEAAPEGMYSEDAE
FT                   TGVAAMSAMIEKYVRAYPSQYMWTMKRFKKRPAGEKRWY"
FT   gene            complement(16105..16506)
FT                   /locus_tag="PST_0013"
FT   CDS_pept        complement(16105..16506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0457"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77721"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH0"
FT                   /protein_id="ABP77721.1"
FT                   /translation="MLTILPGSRFALQWRGLPGRPCSNQGPIMLESLEKMLSQGMDNPM
FT                   LRFGLGKGYLDAGQPGRAAQHLRRCVELDPKYSAAWKLLGKALQADGDKQGAHEAWESG
FT                   IAAANARGDKQAEKEMSVFLRRLDRLTPD"
FT   gene            complement(16570..17409)
FT                   /locus_tag="PST_0014"
FT   CDS_pept        complement(16570..17409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0014"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="Code: E; COG: COG1126"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77722"
FT                   /db_xref="GOA:A4VFH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH1"
FT                   /protein_id="ABP77722.1"
FT                   /translation="MNTPMPTTEESNTAAMAAAAPAQPMVRFASVTKRYGELTVLEGLD
FT                   LDVQEGEKVAIIGPSGSGKSTLLRVLMTLEGIDDGLIEVDGEPLTHMPDGHGRLVPANA
FT                   RHLRRVRGKVGMVFQSFNLFPHMNALQNVMEAPVQVLGLSKREARERAEELLAMVGLED
FT                   KLEHFPAQLSGGQQQRVAIARALAMRPKVMLFDEVTSALDPELCGEVLSVIRRLGEAHN
FT                   LTMLMVTHQMGFAREFADRVCFFHQGRIHEQGSPDALFNNPQEDRTREFLSAVNEAH"
FT   gene            complement(17406..18065)
FT                   /locus_tag="PST_0015"
FT   CDS_pept        complement(17406..18065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0015"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="Code: E; COG: COG0765"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77723"
FT                   /db_xref="GOA:A4VFH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH2"
FT                   /protein_id="ABP77723.1"
FT                   /translation="MNFFDWEFAREILPRLLDASLTTIGIALAGFAIAVVLGLFLAIGR
FT                   RSRHRWLSWPVTGLIEFIRSTPLLIQVYFLFYVFPNYGLNLSAMQAGIIGIALHYACYT
FT                   AEVYRAGLDAVPRSQWEAVTALNMKPWTAYRDVILPQALRPVMPALGNYLISILKDTPV
FT                   LSAITVVEIMQRAKNIGSESFRYLEPITMVGVFFLILSLGLAWCVRRLEHRMELAR"
FT   gene            complement(18062..18766)
FT                   /locus_tag="PST_0016"
FT   CDS_pept        complement(18062..18766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0016"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="Code: E; COG: COG0765"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77724"
FT                   /db_xref="GOA:A4VFH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH3"
FT                   /protein_id="ABP77724.1"
FT                   /translation="MRSLAQRSGQPDSATMIELLPLLLQGTWVTVKVTVFGSLLAIACA
FT                   LIAALARLSPLAPLRWLAVIYVEVFRGSSLLVQLFWLYFVLPLPPFNVEMSAFAVAVVG
FT                   LGLNIGAYGAEVLRGAIRSVHRGQHEACHALNMTPLTRMRRIILPQALLAAIPPGTNLL
FT                   IELLKNTSLVSLITLSDLAFRARQLDQATLMTLEIFGLALVIYFVLAQTINFAMRRLEQ
FT                   RLARGRMRGGLS"
FT   gene            complement(18841..19698)
FT                   /locus_tag="PST_0017"
FT   CDS_pept        complement(18841..19698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0017"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="Code: ET; COG: COG0834"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77725"
FT                   /db_xref="GOA:A4VFH4"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH4"
FT                   /protein_id="ABP77725.1"
FT                   /translation="MRNSPITTSPRRLLIACAALASIGFASVTQADTLEKIKDSNSVRI
FT                   GYANETPFAYTALDGSVTGESPEIVRKVFERMEIGTIKPVLTEWGSLIPGLRAGRFDLI
FT                   AAGMYITPERCKQVLFTDPHYRLLDTLLVAQGNPKELRSYEDIAGNPEVKIAIMSGTVN
FT                   LGYARKAGIKDSQILQVPDTTSQLQAVRSGRADAAIGTQLTMRGLAAKASNDVEAIADF
FT                   EDDPARAGYGALAFRPQDEALRDAVNAELKQWLGSEEHLKAVEPFGFDRSNLTDKTAAE
FT                   LCGA"
FT   gene            complement(20038..21411)
FT                   /gene="trkA"
FT                   /locus_tag="PST_0018"
FT   CDS_pept        complement(20038..21411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PST_0018"
FT                   /product="potassium uptake protein TrkA"
FT                   /note="Code: P; COG: COG0569"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77726"
FT                   /db_xref="GOA:A4VFH5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH5"
FT                   /protein_id="ABP77726.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTIQGRGSFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFHTPTKIARVREAAY
FT                   LVRSGLFNNEAIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAGGKAQLVAVRAYYGG
FT                   PLVGQELRQLRRHMPNVDTRVAAIFRRNHAILPQGDTVIEADDEVFFIAARGHIRAVMS
FT                   EMRRLDENYKRIVIAGGGHIGERLAEAIESRYQVKIIEMNPARCRYLSDTLDSTIILQG
FT                   SASDRDLLVEENINEADVFLALTNDDEANIMSSLLAKRLGARKVMCIINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLTHVRRGDIVSAHSLRRGAAEAIEVIAHGDPRSSKVVGRAIE
FT                   QIALPPGTTIGAVIRDDQVLIAHDDTRIESGDHVILFLVDKKHIRDVERLFQAGLTFF"
FT   gene            complement(21486..22808)
FT                   /gene="sun"
FT                   /locus_tag="PST_0019"
FT   CDS_pept        complement(21486..22808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="PST_0019"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /note="Code: J; COG: COG0144"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77727"
FT                   /db_xref="GOA:A4VFH6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH6"
FT                   /protein_id="ABP77727.1"
FT                   /translation="MNPRLAAARALSVVLSGKASLGSSLPEVLGKVDARDRGLTQELAF
FT                   GTARWQPRLAGLANKLLQKPFKAADRDVEALLLVGLYQLLHTRIPAHAAIGETVGCVDK
FT                   LKKPWAKGLLNAVLRRAQREGEALLAELEHDPVIRVAHPRWLQKALKAHWPEHWEAICA
FT                   ANNAHPPMMLRVNRRQTSRDVYLTELQTAGIDAFPCEFSEDGIRLASPCDVQQLPGFAE
FT                   GRVSVQDEAAQLAAGLLDLAPGQRVLDACCAPGGKTCHLLEREPQLAGLVALDLEPKRL
FT                   ARVRENLERLQLDAELLAADARATAQWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   AEDIAPLAALQGEMLDALWPTLEVGGVLLYATCSVLPTENREVIGAFLARTPGARELDL
FT                   PAGFGLTQPHGRQLLPQQDGHDGFYYAKLIKIAAQPRGHHQ"
FT   gene            complement(22805..23749)
FT                   /gene="fmt"
FT                   /locus_tag="PST_0020"
FT   CDS_pept        complement(22805..23749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PST_0020"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="Code: J; COG: COG0223"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77728"
FT                   /db_xref="GOA:A4VFH7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFH7"
FT                   /protein_id="ABP77728.1"
FT                   /translation="MTQPLRIVFAGTPEFAAQHLQALLDAGKSIVAVYTQPDRPAGRGQ
FT                   KLMPSPVKQLAVQHDIPVLQPQTLRDPAAQAELAALQADLMVVVAYGLILPQAVLDLPR
FT                   LGCINSHASLLPRWRGAAPIQRAIEAGDSESGVTVMQMEAGLDTGPMLLKVNTPISDED
FT                   TGGSLHDRLALLGAHAVVKAVDALAAGTLTPEVQDDSLATYAHKLSKDEARVDWTRPAV
FT                   ELERLIRAFNPWPICHSTLNGETLKIHAAQLGEGRGVPGLILDASKAGLTVACGEGALS
FT                   LTRLQLPGGKPLGFGDLYNSRREQFAPGLVLGQ"
FT   gene            complement(23802..24308)
FT                   /gene="def"
FT                   /locus_tag="PST_0021"
FT   CDS_pept        complement(23802..24308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PST_0021"
FT                   /product="polypeptide deformylase"
FT                   /note="Code: J; COG: COG0242"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77729"
FT                   /db_xref="GOA:A4VFH8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFH8"
FT                   /protein_id="ABP77729.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVDVVDDGIRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRVVVMDLSEDRSEPRVFINPEFEPLTDQMDQYQEGCLSVPGFYENVDR
FT                   PQKVRIKALDRDGKPYELIAEGLLAVCIQHECDHLNGKLFVDYLSSLKRDRIKKKLEKI
FT                   HRQQA"
FT   gene            24357..25481
FT                   /locus_tag="PST_0022"
FT   CDS_pept        24357..25481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1652"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77730"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFH9"
FT                   /protein_id="ABP77730.1"
FT                   /translation="MPSSMENGLMPRSKWVRGARALHVKAHNKGIHHMRKSLLALLLVA
FT                   VGGLAQAAVQLKDNHPERYTVVKGDTLWGISGRFLREPWKWPELWHANPQIANPHLIYP
FT                   GDTLSLVYVDGQPRLVLDRGTSRGTIKLSPTVRTTPMAEAIPTIPLEAINSFLLSNRII
FT                   DTAEQFQGAPYIVAGNAERVISGAGDRIYGRGAFEANMPAYGIFRQGKTYVDPDTGEFL
FT                   GINADDVGSVEIVEIEGDIATMQLTRTTQEARIGDRLFPGEERAVNSTFMPSAPSTQVE
FT                   GVILDVPRGVTQIGQFDVVTLNKGARDGLQDGNVLAVYKTGETVRDRVTGENVKIPDER
FT                   SGLLMVFRTYDKLSYGLVLQATRSLSVKDKVRNP"
FT   gene            25568..26665
FT                   /locus_tag="PST_0023"
FT   CDS_pept        25568..26665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0023"
FT                   /product="DNA processing protein DprA, putative"
FT                   /note="Code: LU; COG: COG0758"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77731"
FT                   /db_xref="GOA:A4VFI0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFI0"
FT                   /protein_id="ABP77731.1"
FT                   /translation="MPAISPAELEARLRLHLLPELGPRRLQRLLRAFPDAASALSAPAS
FT                   AWCSLGLPVSCAEPRRSSEIRERASAALAWLQAPGRHVICWDDPAYPALLAELPDAPPL
FT                   LFVAGDPTLLERPQLAVVGSRRASRNGLDNARAFSRSLAGAGFVITSGLALGIDGAAHQ
FT                   GALDANGKTVAVLGTGIERLYPQRHLSLAKEIVEHGGALVSELPLDCPPQASNFPRRNR
FT                   IISGLSLGVLVVEASPSSGSLITARLAADQGREVYAIPGSIHHPGARGCHQLIRQGAAL
FT                   VESVEDVLQALRGWQRLAPLAAEAPKPPQTDHPLLRELLAASRSSEALAAALDQPLGQV
FT                   LAQLTELEIEGQVSCDNGLWSVLMR"
FT   gene            26803..27360
FT                   /locus_tag="PST_0024"
FT   CDS_pept        26803..27360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: J; COG: COG0009"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77732"
FT                   /db_xref="GOA:A4VFI1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFI1"
FT                   /protein_id="ABP77732.1"
FT                   /translation="MIGDWRVQQVARVVRAGGVIAYPTEAVWGVGCDPWDEDAVLRLLA
FT                   LKERPVEKGLILIADTVEQFDFLLDDLPERWLDRLSGTWPGPNTWLVPHRGRLPEWITG
FT                   RHDSVALRVTDHPLVKRLCALTGPLVSTSANPAGRPAARSRLRVEQYFPQQLDAVFNGA
FT                   LGGRRNPSVIRDLRSGEVIRPA"
FT   gene            complement(27414..28166)
FT                   /gene="qor-1"
FT                   /locus_tag="PST_0025"
FT   CDS_pept        complement(27414..28166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor-1"
FT                   /locus_tag="PST_0025"
FT                   /product="quinone oxidoreductase"
FT                   /note="Code: CR; COG: COG0604"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77733"
FT                   /db_xref="GOA:A4VFI2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFI2"
FT                   /protein_id="ABP77733.1"
FT                   /translation="MQHLQPGDRVAYATGPLGAYAEYHTLPARHLVKLPDSISYEQAAA
FT                   VMLKGLTCQYLLRQTHALQAGETVLFHAAAGGVGSIACQWAHALGARLIGVVGSAEKAA
FT                   RAKALGAWATIDRSCEDVVQRVLELTEGKKCPVVYDSVGKNSWEISLDCVAPRGLLVSF
FT                   GNASGAVTGVNLGVLAQKGSLFVTRPTLAGYADTPERLQAMADELFEMIGSVKVKVEIG
FT                   QRYALGDAAEAQRKLAAGETTGSTILLP"
FT   gene            28544..29464
FT                   /gene="hemF"
FT                   /locus_tag="PST_0026"
FT   CDS_pept        28544..29464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PST_0026"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /note="Code: H; COG: COG0408"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77734"
FT                   /db_xref="GOA:A4VFI3"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFI3"
FT                   /protein_id="ABP77734.1"
FT                   /translation="MNDRTEAVKAYLLDLQDRICAALEVEDGGARFVEDAWTRPGGGGG
FT                   RTRVIENGALIEKGGVNFSHVHGDSLPPSASAHRPELAGRSFEALGVSLVIHPHNPYVP
FT                   TSHANVRFFIAEKDGEEPVWWFGGGFDLTPYYGAEEDCVHWHRVARDACAPFGAEVYPR
FT                   YKEWCDRYFHIKHRNEPRGVGGLFFDDLNQWDFDTSFAFMRAVGDAYLQAYLPIVQRRK
FT                   ATPFGERERQFQLLRRGRYVEYNLVYDRGTLFGLQSGGRTESILMSLPPQVAWGYDKRP
FT                   EPGSPEARLTEYFLQDRDWLAAAPA"
FT   gene            29537..30367
FT                   /gene="aroE-1"
FT                   /locus_tag="PST_0027"
FT   CDS_pept        29537..30367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE-1"
FT                   /locus_tag="PST_0027"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="Code: E; COG: COG0169"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77735"
FT                   /db_xref="GOA:A4VFI4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFI4"
FT                   /protein_id="ABP77735.1"
FT                   /translation="MKQRYWMDRYGVFGNPIGHSKSPQIHALFAAQTGQALSYEPLLAP
FT                   LDDFPAFARDFFREGRGANVTVPFKEQAYRMADELTERARRAGAVNTLKKLEDGRLLGD
FT                   NTDGAGLVADLLNAGVTLSGRRILLLGAGGAVRGVLEPLLAHRPAALVIANRTASRAEQ
FT                   LVQEFAELGPLSASGFAELAEPVDLIVNGTSASLGGELPPLADSLIVAGRTFCYDMMYS
FT                   AEPTPFCRWAAALGATTRDGLGMLVEQAAEAFELWRGVRPDTAPVLAELRRQLG"
FT   gene            complement(30459..30965)
FT                   /locus_tag="PST_0028"
FT   CDS_pept        complement(30459..30965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0028"
FT                   /product="putative NADH-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77736"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFI5"
FT                   /protein_id="ABP77736.1"
FT                   /translation="MALLDDLNSLSARPGLRTKPGDPFDPLSVSESVAGMDAVICLYHT
FT                   PRLPSTDAITGESARRDFYQAVEALLLGLERVGVERLLLVADFPVIERQPEVEAALQRL
FT                   AAHPLKWTLVDAPPAGNQLTIETLAEAAGKGETNPFHELQRIAAGIVDELERPQHLHQR
FT                   IHFRS"
FT   gene            complement(31077..31382)
FT                   /locus_tag="PST_0029"
FT   CDS_pept        complement(31077..31382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4575"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77737"
FT                   /db_xref="GOA:A4VFI6"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFI6"
FT                   /protein_id="ABP77737.1"
FT                   /translation="MFSHKPTTREEVQREIDSLMRALDELKHDAARDSRHRLSALRSRA
FT                   ESLWHDQHWDEHYADLSKRTREASRAARDCAKEHPLGTLALAAGAFALIGYLVTRR"
FT   gene            31408..32580
FT                   /gene="pbpG"
FT                   /locus_tag="PST_0030"
FT   CDS_pept        31408..32580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpG"
FT                   /locus_tag="PST_0030"
FT                   /product="D-alanyl-D-alanine-endopeptidase"
FT                   /note="Code: M; COG: COG1686"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77738"
FT                   /db_xref="GOA:A4VFI7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFI7"
FT                   /protein_id="ABP77738.1"
FT                   /translation="MGLTPKRCRGAARSRLCWPSRPHQDVSGPAAALVDIRRTVHREQA
FT                   SRPSIPYTASQFRSALFRRIPRRSALFQRGNPIVKLRRTVASLLFACLASLPVIHAQAA
FT                   KPMVQELASGSALLVDLNTNEVLYSSNPDMVVPIASVTKLMTAMVVLDAKLPLDQALPV
FT                   TIRDAKEMQGVYSRVRIGSEISRREMLLLTLMSSENRAAASLAHHYPGGYAAFIQAMNA
FT                   KARALGMSRTHYVEPTGLSERNVSSANDLVKLIRASRQYPLIQQFSTTDEKTVAFRKPN
FT                   YTLGFRNTNALVRKNNWDIQLSKTGFTNAAGHCLVMSTTMKQRPVAFVVLDAFGKYTHM
FT                   ADANRLKKWLETGTVTPVPAAALAYKQQKQAQRQLAGQPADAAQALLDAR"
FT   gene            33154..35304
FT                   /locus_tag="PST_0031"
FT   CDS_pept        33154..35304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0031"
FT                   /product="TonB-dependent receptor"
FT                   /note="Code: P; COG: COG1629"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77739"
FT                   /db_xref="GOA:A4VFI8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFI8"
FT                   /protein_id="ABP77739.1"
FT                   /translation="MPRLNCLHLPMVACWRLPAAIRRTALSVAQGTCEMLDHPAHPSRR
FT                   PALPRLFIAVIAAAYLPASLADSAASALSLGSSTVTATQSGGGLPTSSVVSSVDLLGSD
FT                   ILEQQPVLYSWELFRRAPGVMLTEFGQGTSSGKLSFRGFNGEGEVNAVKLLIDGIPSNS
FT                   NDGNMPYLDMLFPLEIDGIEVVRGTNDPRYGLYNIAGNVAVQSRIGGDYGKARLRYGSY
FT                   DTQELQLAKGIESGNWTQNYFIGQQKSDGYRDHAGSERTSLSGKWFYSPDTGNWRLGLI
FT                   ARHYEAEADEPGYLSREDARHSPRQSYALSASDMGERRMNQLSLHLDSQLASDLSWATK
FT                   VWLNTLDDDRWVRFSQAQPQQRRSTEEKHYGARTSLTYRPDVSWLHDLALEGGLDTEQQ
FT                   RNRSERYTTVERQVVTQTRDQRFDYDSYGAYLQAVIQPVESLKIIPAFRVDRIRGDFTD
FT                   ELSGNDYAINDYGSIEQPKISLIYTPIEQLSLYGNWGRTFQIGTGAAAYKVPPRTSDLS
FT                   PSINDGWETGIKFSPVHWLDGRVAYWEQVATDEVRRRLNDPSGESENLGQTRRWGYDAQ
FT                   LNLYPASALNLWLAHSWQFSEIEKADPSLPASQGQEIDHVPRRLYSAGSSYQATPDLQL
FT                   SAWLNGQTDYYLERENTQGKYGGYVLFNLGASYQLTEQLAVDLQLKNLTDRYHEYVWYD
FT                   GAQTLHAPGDGRALYAAVTLDF"
FT   gene            35226..36827
FT                   /locus_tag="PST_0032"
FT   CDS_pept        35226..36827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0032"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77740"
FT                   /db_xref="GOA:A4VFI9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFI9"
FT                   /protein_id="ABP77740.1"
FT                   /translation="MVRRRADPACAGRWPRAVCRRDPGLLTGMKRYLYLMHRWLGIALG
FT                   LFVLAWVVSGVVMLFVGYPKLTPAEHLARLAPLDAGCCIAPGAALVASGDPRTPLSLRL
FT                   TGAGGSPRYLLDYGDGPLLAVDARSGRRIERIGPAEALASARQFTQGAEVRLLDQVEED
FT                   AWTRNHALARERPLYRVQADDAERHLLYVSSHSGLVVRDASAHERAWNLLGAWLHWLYP
FT                   LREVMPKAAWSPLLVYGALLGAVLVLLGMLIGLLRWRFTGRYRNGSHSPYPAGASRVHH
FT                   VGGLLVGVVLLVWLVSGMLSMEPWGLFEKRSSIDAAALRQAPLNAEALDADLASSLARF
FT                   RAAGFEAVELQWHMLGDQPYLVGLDARGDTRILPAASAGPAQEHLERAVLERQVREAWP
FT                   EQSLHFEWLEQEDFHYYARSEPSLYSHLPRRLPLLRVRFDDPAATWLHIDPYSGAVIEQ
FT                   LDQRRRAVRWAFKLLHSWDWLPLLQRPLLRDGLLLAFSAGALVISLSGVLLGWRRLRPR
FT                   ARRRQVRRPVQPPRLS"
FT   gene            complement(36806..38509)
FT                   /locus_tag="PST_0033"
FT   CDS_pept        complement(36806..38509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0033"
FT                   /product="predicted membrane protein"
FT                   /note="Code: S; COG: COG4425"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77741"
FT                   /db_xref="GOA:A4VFJ0"
FT                   /db_xref="InterPro:IPR012037"
FT                   /db_xref="InterPro:IPR027787"
FT                   /db_xref="InterPro:IPR027788"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ0"
FT                   /protein_id="ABP77741.1"
FT                   /translation="MLHLPVLYIWRSLSGFGLLLGTLFFCAALTPSLLPRSTLSQGVLA
FT                   GAALAVGYGLGVFWRWLWRYLELPERPGWQRERVNLLIAVGCLLLAGYFLSQVAGWQNA
FT                   VRALMGMPPVSSAHLLEVILTALATFLILLTLARLYRLVSRFVSRHADRVLPRRLANVI
FT                   GVLVALALFWSLLSDVLAARALRMLDASFAQYDALIEPETAPPVSPLKSGSRASLLRWE
FT                   ELGRTGREFIGSGPSAADISALSGRSALEPIRVYVGLRAAETPRQRARLALRELQRSGA
FT                   FERSVLVLVTPTGTGWIDPAAMNAVEYLHHGDIASVALQYSYLNSPLALLVEADYGRDV
FT                   ARALFAEIYGYWTELPAERRPRLYLHGLSLGALHSQRSWELHELLGDPIHGALWSGPPF
FT                   RSDLWRTLTDSRDPDSPEWRPRFRDGRFVRFMNQQGTAEPADAPWGPMRLLYLQYASDP
FT                   IIFFDHRYAWRRPDWLAEPRGPDVSPSLRWFPLVTMLQLAVDMAVTTPTPPGYGHVYAP
FT                   ADYVDAWRLVSSPPGWNADALQRLKLQLTHEQVRAGEQDSNEAAYDNRGG"
FT   gene            38674..40743
FT                   /locus_tag="PST_0034"
FT   CDS_pept        38674..40743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0034"
FT                   /product="trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77742"
FT                   /db_xref="GOA:A4VFJ1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012665"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ1"
FT                   /protein_id="ABP77742.1"
FT                   /translation="MSIPDNTYIEWLVSQSMLHAARERSRHYAGQARLWQRPYAQARPR
FT                   DASAIASVWFTAYPAAIITPEGGTVLEALGDDRLWSALSELGVQGIHNGPMKRSGGLRG
FT                   REFTPTIDGNFDRISFDIDPSLGTEEQMLQLSRVAAAHNAIVIDDIVPAHTGKGADFRL
FT                   AEMAYGDYPGLYHMVEIREEDWELLPEVPAGRDSVNLLPPVVDRLKEKHYIVGQLQRVI
FT                   FFEPGIKDTDWSVTGEVTGADGKVRRWVYLHYFKEGQPSLNWLDPTFAAQQLIIGDALH
FT                   AIDVTGARVLRLDANGFLGVERRAEGTAWSEGHPLSVTGNQLLAGAIRKAGGFSFQELN
FT                   LTIDDIAAMSHGGADLSYDFITRPAYHHALLTGDTEFLRMMLREVHAFGIDPASLIHAL
FT                   QNHDELTLELVHFWTLHAYDHYHYKGQTLPGGHLREHIREEMYERLTGEHAPYNLKFVT
FT                   NGVSCTTASVIAAALNIRDLDAIGPAEVEQIQSLHILLVMFNAMQPGVFALSGWDLVGA
FT                   LPLAPEQVEHLMGDGDTRWINRGGYDLADLAPEASVSAEGLPKARSLYGSLAEQLQRPG
FT                   SFACQLKRILSVRQAYDIAASKQILIPDVQAPGLLVMVHELPAGKGVQLTALNFSVEPI
FT                   SETICLPGVAPGPVVDIIHESVEGDLTDNCELQINLDPYEGLALRVVSAAPPVI"
FT   gene            40827..41432
FT                   /locus_tag="PST_0035"
FT   CDS_pept        40827..41432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0035"
FT                   /product="coserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77743"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ2"
FT                   /protein_id="ABP77743.1"
FT                   /translation="MSFTSLLRLALLPLALLALPVRAQTFCPPGQQPICLSGACLCMPA
FT                   AASDPQAVYDRVQRMATLGLQSWIQQSRDRLVAGGVEPIPLHIRSQLEPYFDLAVLESA
FT                   HFRVGDEVVLNAGNTLLRNPDVNAVTLIDVIVFRHEEDARDNVALWAHELKHVEQYLDW
FT                   GVAEFARRYTQDFRAVERPAYALEREVEEALRETQTRR"
FT   gene            complement(41544..42317)
FT                   /gene="metQ-2"
FT                   /locus_tag="PST_0036"
FT   CDS_pept        complement(41544..42317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ-2"
FT                   /locus_tag="PST_0036"
FT                   /product="D-methionine-binding lipoprotein MetQ"
FT                   /note="Code: P; COG: COG1464"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77744"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ3"
FT                   /protein_id="ABP77744.1"
FT                   /translation="MKKLIAALATVAAFSAQAAETLTVAATAVPHAELLEFVKPQLAEQ
FT                   GVTLNVKVFTDYVQPNIQVAEKRLDANFFQHQPYLDEFNKGKGTELVSVAGVHIEPFGA
FT                   YSSKVKSLDELANGATVVIPNDATNGGRALLLLDKAGVIGLKDGAGITATPKDIAENPK
FT                   KIKIRELEAATLPRVLTQVDLALINTNYALEAKLNPTQDALVVEGSDSPYVNILVARPD
FT                   NKDSDAMQKLAAALHSEEVRQFIEEKYKGAVVPAF"
FT   gene            complement(42376..43053)
FT                   /gene="metI-2"
FT                   /locus_tag="PST_0037"
FT   CDS_pept        complement(42376..43053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI-2"
FT                   /locus_tag="PST_0037"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="Code: P; COG: COG2011"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77745"
FT                   /db_xref="GOA:A4VFJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ4"
FT                   /protein_id="ABP77745.1"
FT                   /translation="MEALFSSLLGNVDWYEIWLATLDTLLMLGGSLLFTILLGLPLGVL
FT                   LFLSGPRQLFENGPLYAALSFVVNVLRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPL
FT                   VVGAAPFFARLVETALREVDRGIIEATQAMGATTRQIIFSALLPEARPGIIAAITVTAI
FT                   TLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQLLQSLGDRLVTHF
FT                   SRK"
FT   gene            complement(43053..44117)
FT                   /gene="metN-2"
FT                   /locus_tag="PST_0038"
FT   CDS_pept        complement(43053..44117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN-2"
FT                   /locus_tag="PST_0038"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Code: P; COG: COG1135"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77746"
FT                   /db_xref="GOA:A4VFJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ5"
FT                   /protein_id="ABP77746.1"
FT                   /translation="MPGFRRSSRQQTSHPQGSPVIEFHQVHKTYRTAGRDIPALQPTQL
FT                   EIASGEVFGLIGHSGAGKSTLLRLINRLEEPSGGRILVNGEDVTALDADGLRRFRQRVG
FT                   MIFQHFNLLMSKTVADNVAMPLRLAGIRSRSEIDARVASLLERVGLKDHARKYPAQLSG
FT                   GQKQRVGIARALATEPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMD
FT                   VIRRVCDRVAVMDGGAIVEQGPVTEVFLHPKHPTTQRFVLEDEAVDEGDMHDDFAHVPG
FT                   RILRLTFQGDATYKPLLGTVARETGVDYSILSGRIDRIKDTPYGQLTLALIGGDVAAAM
FT                   SRLQAADVHVEVLR"
FT   gene            44325..46460
FT                   /gene="katE"
FT                   /locus_tag="PST_0039"
FT   CDS_pept        44325..46460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katE"
FT                   /locus_tag="PST_0039"
FT                   /product="catalase"
FT                   /note="Code: P; COG: COG0753"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77747"
FT                   /db_xref="GOA:A4VFJ6"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ6"
FT                   /protein_id="ABP77747.1"
FT                   /translation="MTDKTPQQSELAGTDTVDRANHNAKLDQLEAFRSDATGEALRTNQ
FT                   GVKIADNQNTLKAGGRGPSLLEDFIMREKITHFDHERIPERIVHARGAAAHGVFVSYAD
FT                   HSWLTKASFLAAEGKETPVFVRFSTVQGSRGSADTVRDVRGFATKFYTDEGNFDLVGNN
FT                   MPVFFIQDAIKFPDFVHAVKPEPHNEIPQAQSAHDTFWDFVSLTPESAHMVLWTMSDRA
FT                   LPRSYRAMEGFGVHTFRLINAEGVSRFVKFHWKPVAGAFSLVWDETLKIAGKDPDFNRR
FT                   DMWESIEMGDYFEWELGVQVVEEADEHKFDFDLLDPTKIIPEELVPVQKLGKMTLNRNP
FT                   DNFFAETEQAAFHIGHIVPGIDFTNDPLLQGRLFSYTDTQLLRLGGPNFHEIPINRPLC
FT                   PFHNNQRDAFHRQTIHKGRANYEPNSIDNGWPKETPPAAQGGGFESYPERVEGHKIRNR
FT                   SESFGDHFSQATLFWNSMSGPEKEHIIGAYTFELGKVERVFIRERQVNEILANIDLELA
FT                   RRVAENLGLPAPAAPTVAAKVPTPQSSPALSLMNHAPGNIKSRKIAILVANGVDGAAID
FT                   AFKAKLAEQGALAKIIGPSPAPVKTADGKMLPVDAAMDGMPSVMFDAVFVPGGADAAAA
FT                   MAKSGEAKHYLLEAYKHLKPIVVLGAARPLLASLNLTADSGLLEGDDVDAVFGNFAQAL
FT                   GQHRVWAREAAAEAIPA"
FT   gene            complement(46605..47102)
FT                   /locus_tag="PST_0040"
FT   CDS_pept        complement(46605..47102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0040"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="Code: R; COG: COG1451"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77748"
FT                   /db_xref="GOA:A4VFJ7"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ7"
FT                   /protein_id="ABP77748.1"
FT                   /translation="MTDLKYLRGYPEPLLAQVRQLIAEDRLGDYLQRRYPGRHQVQSDK
FT                   ALYGYVQTLKQEYLKSTPPIDKVLYDNRLDLTHRALGLHTAVSRVQGGKLKAKKEIRVA
FT                   ALFREAAPEFLRMIVVHELAHLRESEHNRAFYKLCEHMLPGYGQIEFDLRLFLHWRELQ
FT                   DG"
FT   gene            complement(47102..47887)
FT                   /locus_tag="PST_0041"
FT   CDS_pept        complement(47102..47887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0041"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /note="Code: P; COG: COG1108"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77749"
FT                   /db_xref="GOA:A4VFJ8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ8"
FT                   /protein_id="ABP77749.1"
FT                   /translation="MPDFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALFG
FT                   VALGLMLDVNLTLAVTVGCVLLALLLVTLQQRQPLASDTLLGILAHSTLSLGLVSLSFM
FT                   DDVRIDLMGYLFGDLLAVGPSDLAWIIGGSALVLLMLIPLWRPLLAITVHEELAKVEGL
FT                   PVAGIRLALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARTPEQMALGASVLGI
FT                   VAVCLGLTLSWYEDTPAGPSIVVSAAALFLLSFAWPKRA"
FT   gene            complement(47889..48578)
FT                   /gene="znuC"
FT                   /locus_tag="PST_0042"
FT   CDS_pept        complement(47889..48578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="PST_0042"
FT                   /product="zinc transport protein ZnuC"
FT                   /note="Code: P; COG: COG1121"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77750"
FT                   /db_xref="GOA:A4VFJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFJ9"
FT                   /protein_id="ABP77750.1"
FT                   /translation="MHRGEIVTLIGPNGAGKTTLVRAVLGLLKPDHGQVWRKPRLRVGY
FT                   MPQKLHVDPTLPLSVLRFLRLVPGVDRARALAALGEVGAEHVIDSPLQKISGGEMQRVL
FT                   LARALLREPELLVLDEPVQGVDVAGQAELYRLIGVLRDRYGCGVLMVSHDLHLVMSATD
FT                   QVVCLNRHVCCSGHPEQVSSDPAFVELFGQDARSLAIYHHQHDHSHDLHGSVVIGKPHV
FT                   HGPNCKH"
FT   gene            complement(48656..49141)
FT                   /gene="np20"
FT                   /locus_tag="PST_0043"
FT   CDS_pept        complement(48656..49141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="np20"
FT                   /locus_tag="PST_0043"
FT                   /product="transcriptional regulator np20"
FT                   /note="Code: P; COG: COG0735"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77751"
FT                   /db_xref="GOA:A4VFK0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK0"
FT                   /protein_id="ABP77751.1"
FT                   /translation="MSKTPLACTPHDHHHCVSHALAEADSLCARQGVRLTALRKRVLEL
FT                   VWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFIGCNHPE
FT                   HPHQGQFLICRLCHTAIELERPAIAEAIDSAAGSVGFSVEGQTVEVVGLCSNCRNAA"
FT   gene            49200..50192
FT                   /gene="znuA"
FT                   /locus_tag="PST_0044"
FT   CDS_pept        49200..50192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="PST_0044"
FT                   /product="zinc ABC transporter, periplasmic zinc-binding
FT                   protein"
FT                   /note="Code: P; COG: COG4531"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77752"
FT                   /db_xref="GOA:A4VFK1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK1"
FT                   /protein_id="ABP77752.1"
FT                   /translation="MPVNRLFSLPLLAALLAGATCAQAEVRVLTSIKPLQLIAAAVQDG
FT                   VGQPDVLLPASASAHHYSLRPSDVRRLRDVELFYWIGPDLESFLPRALSAREGTTVAVQ
FT                   DLPKLTLRRFGDAHTHAEDDHHDHDHDHDHDHDDAHEHDHAAHADEHDHDHRPGSLDAH
FT                   LWLLPANAVVIAERMAADLAAADPANAGRYQANSSAFAERVEALDGRLRQRFAKVQNKP
FT                   FFVFHEAYDYFEAAYGLRHAGVFTAGGEAQPGARHVAAMRERLQQAGPSCVFSEPPARP
FT                   RLAETLTAGLPVKMAELDVLGVGLPTDAKGYEQLLEGLGDTLADCLESL"
FT   gene            complement(50331..51650)
FT                   /locus_tag="PST_0045"
FT   CDS_pept        complement(50331..51650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0045"
FT                   /product="probable pyridoxal-dependent aminotransferase"
FT                   /note="Code: H; COG: COG0161"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77753"
FT                   /db_xref="GOA:A4VFK2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK2"
FT                   /protein_id="ABP77753.1"
FT                   /translation="MSQDFATSPEHFWMPFTANRQFKASPRLLERAEGMYYTASDGRQV
FT                   LDGTAGLWCCNAGHGRREISEAVSKQIARMDFAPTFQMGHPLPFELAEKLAAISPEGLN
FT                   RVFFTNSGSESADTALKIALAYQRAIGQGSRTRLIGRELAYHGVGFGGMSVGGMANNRR
FT                   AFGPMLPGVDHLPHTLDLQRNAFSKGLPQHGVERADELERLVTLHGAENIAAVIVEPMS
FT                   GSAGVILPPVGYLQRLREITAKHGILLIFDEVITGFGRVGEAFAAQRWGVTPDILTCAK
FT                   GLTNGAIPMGAVFVADRLYDAFMQGPESVIEFFHGYTYSGHPVACAAALATQQIYQQEN
FT                   LFQKAIDLEPYWQEALFSLRDLPNVIDIRTVGLVAGIQFAAHADGVGKRGYEVFRECFE
FT                   NGLLVRASGDTIALSPALIVEKAEIDRMMELLADGIRKAG"
FT   gene            complement(51789..53336)
FT                   /locus_tag="PST_0047"
FT   CDS_pept        complement(51789..53336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77754"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK3"
FT                   /protein_id="ABP77754.1"
FT                   /translation="MPSELNPGRLELGVLVEGMQRLVTTVAGLLEAAERRGHVAAVVLI
FT                   DPHTAGAQRPCGAVRLGQVGGPHRGSEAVGRVVGDRHRFLGAVEADHREHRAKDFLLSD
FT                   LHRIVDAIEDGRLDVQPAGFFQRPLAADQHLRAGLAPGVDVAEHGVELLGVHQGADVGR
FT                   RVQRVARLPALERLHHHGQEALLDRTLHQQPRTGSADLALIEGDRTRRRLGSRLQVGRI
FT                   GEDDVRALAARLQPDALHVRLAGVDHQLLGHPRGAGKDQGIDVHVQRQRLADGVAVTWQ
FT                   DIEHAGRNAGVDRQLGDADGGQRRLLGRLEHHRVACGQCRAELPAGHHQREIPRHDGRH
FT                   HADRLAGDQAQLVVGRGRHLVVDLVDRLAAPAQRPRRTGDVHRQRIADRLAHVEGLQQG
FT                   QLLAVRFQQIGEANQHRLALGRRQLRPAACLECGACAGHRTLGIGQVAAGDLGQHPPVH
FT                   RADAVELATLRRGAILTLDKGATFDTQVTGTLLPIGEGQAGHGASSLSGLRVMENAP"
FT   gene            51837..53330
FT                   /locus_tag="PST_0046"
FT   CDS_pept        51837..53330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0046"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="Code: C; COG: COG1012"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77755"
FT                   /db_xref="GOA:A4VFK4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK4"
FT                   /protein_id="ABP77755.1"
FT                   /translation="MPSLTFADWQQRARDLRIEGRAFIQGEYCAAAQGGQFDCISPVDG
FT                   RVLAQVASCDLADAERAVASARAAFEAGSWAKLAPAKRKAVLIRFADLLEANREELALL
FT                   ETLDMGKPIGDSLTVDIPGAARALRWSGEAIDKIYDEVAATPHDQLGLVTREPVGVVAA
FT                   IVPWNFPLMMACWKLGPALATGNSVVLKPSEKSPLTAIRIAQLAIDAGIPAGVLNVLPG
FT                   YGHTVGKALALHMDVDTLVFTGSTRVAKQLMIYAGESNMKRVWLEAGGKSPNIVFADAP
FT                   DLQAAAQAAAGAIAFNQGEVCTAGSRLLVERSIKERFLPMVVEALKGWKPGNPLDPSTN
FT                   VGALVDTQQLNTVLGYIDAGRQAGAQVLIGGQRTLEETGGLYVEPTIFDGVDNAMKIAQ
FT                   EEIFGPVLSVISFDSAEEAVAIANDTPYGLAAAVWTADLSKAHRTARALRAGSVWVNQY
FT                   DGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKATWIQL"
FT   gene            complement(53432..54835)
FT                   /locus_tag="PST_0048"
FT   CDS_pept        complement(53432..54835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0048"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="Code: M; COG: COG1215"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77756"
FT                   /db_xref="GOA:A4VFK5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK5"
FT                   /protein_id="ABP77756.1"
FT                   /translation="MTVDWLWWLQVAFILYFLLLNGMYLLLNLLSMGSLMGYIRQRAET
FT                   GELAPYLGVEPPVSVLMPAFNEEATIRTSVRSMLQLQYPEFEIVVINDGSKDRTLAVLI
FT                   EEFDLVPHPEPLRQAVAHQPVQAIYRSRRYANLRVVDKANGGKADALNAGINAARYGLF
FT                   CGVDADSILQRDSLLRVVQPFLEDERTIAAGGTVRIANGSQVRGGFLIQAGLPRNWLAR
FT                   FQIVEYLRAFLFGRLGWSPLNAVLIISGAFGLFDRERVMAVGGYRTDTVGEDMELVVRL
FT                   HRYHREKRIPYRIRYLPDPICWTECPEDLGTLGRQRSRWQRGLAESLGRHARLAFSLRG
FT                   GTPGWLAWPFMALFEWIGPLIELVGYGFMLAGFAFGAVSYAALAAFLLVAIGMGILLSV
FT                   NGLLLETMSFRVYSRRRDMLQLFLMAVLENFGYRQLNTLWRCRGLWQWFSRRKHQWGVM
FT                   RRSGQWGQS"
FT   gene            complement(54832..55869)
FT                   /locus_tag="PST_0049"
FT   CDS_pept        complement(54832..55869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77757"
FT                   /db_xref="GOA:A4VFK6"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK6"
FT                   /protein_id="ABP77757.1"
FT                   /translation="MLQLALYCAFGLGALTLLVLLQVLLLGELSRRRAVRRQQFNEQWR
FT                   PYFALCSLSDDVPTSHAALPRRHQLWFLLQWNRTQLQLRGAARERMNRALVALGMDRQA
FT                   LLLLRGRVRSKLIGLTCLRHLADPAHWDAVQPLLLSRNAIVALAAAQTLVAMDPAKAMQ
FT                   LILPAAVERPDWALPRLVSLCQQAGEQAVTTPLLIVLSSSPDPRRERLVGLLVHGDPRH
FT                   AAPWARARLDQGAPVEQLQVALRCLSELGDPRDRPRLLRALGHEQEGVRLAALLALHKQ
FT                   ARREDSELFLPLLADRSWWVRQAAADSLATLPGASPDALQQLLEQVHDRYGRDALRRAI
FT                   AEVRR"
FT   gene            complement(57079..57468)
FT                   /locus_tag="PST_0050"
FT   CDS_pept        complement(57079..57468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0050"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77758"
FT                   /db_xref="GOA:A4VFK7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK7"
FT                   /protein_id="ABP77758.1"
FT                   /translation="MSESASKRILMVEDEEDIAFLIRYMLERHGFVVDHAADGRQALDH
FT                   FAQAAPPDLTLMDIMLPYHDGLELIERLRAQAGWESVPVLMLTAKAREVDIVRALELGA
FT                   DDYVTKPFQPEELLARIRRLLRGRR"
FT   gene            complement(57465..60371)
FT                   /locus_tag="PST_0051"
FT   CDS_pept        complement(57465..60371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0051"
FT                   /product="two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77759"
FT                   /db_xref="GOA:A4VFK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK8"
FT                   /protein_id="ABP77759.1"
FT                   /translation="MQSPPRKESGLPARLAIGWHSIAFLAAFALLAALGWQGKRTQETL
FT                   LQTNRAVSHSLEVITSVQAILSSLQDIETGSRGFILTGDASYLEPYERGLNQLEGYRRS
FT                   LEQLVEGRSYPDERWFRTLDATIAERLQVAAGNVQARRDAGLQAAAERLRGAGGNLLMD
FT                   RLRALLNAVEQQERRELKAASSAVAQTTERAQRLALIGSLVVVALLLIAFWAVHRNLRI
FT                   RQQLAGAAQAGEARLGALLQAIPDYLYAVDHRQQISSLAAGTARRTPQPAAIEPLLHDL
FT                   LQQHEDSGLRQNTWCEVQTRRTFEVRLMPTGLGDHLAIARDISELQRSRDSLHDQQLFL
FT                   RRVVDTDDNLIFVRDAQGRFLLCNTALSALLDVRPQDIEQRHPDEVASARLLRPLLLGD
FT                   DELAALASGSGELRTTEVALTDAHGTEHWFQVVKRPLRISARTCHVVTVAVDVSLRRRM
FT                   EQMKTEFISTVSHELRTPLTAIRGALGMLIGGIAGQLSDEARPLLTIAHKNSERLVRLI
FT                   NDILDIEKLEAGRLAFNLGRHDVRPLVQQALSDITPYGQDYGVTLEFLDAPELASSEAT
FT                   LDPDRFAQVMANLLSNAIKHSPAGGRVTVDLRRSGERLEIGVQDRGPGIPEAFRSRIFE
FT                   RFAQADSSDARQRGGTGLGLAITRSLVQQMNGKIGFDCQPDQGTRFWLQLPLEEHAQPL
FT                   QPQAPAQPLSLGSAPQQTPLILILEPDCHAAEQLAEALQQHGYATLIAHAAAEARELLG
FT                   QHRVQALTLSPALDDENSVAFLQSLRSQHHYRNLPVLIVSVQPQRRDEDDGLLRGGAVG
FT                   VIDWLHKPIDPSRVMEVIRACLQLGGSKPRILHVEDDDDLRVLLARQIAMLDVELAGAA
FT                   TLQEARQLISAQPFDLAIIDLMLPDGDGTELFDQLAQSIPPPPVIIFSALDTPIQDNRL
FT                   ALRQLVKSRHDGDELARLIQHLLQHWPPGHTHSDEVHA"
FT   gene            complement(60469..62109)
FT                   /locus_tag="PST_0052"
FT   CDS_pept        complement(60469..62109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0052"
FT                   /product="probable two-component response regulator"
FT                   /note="Code: T; COG: COG3706"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77760"
FT                   /db_xref="GOA:A4VFK9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFK9"
FT                   /protein_id="ABP77760.1"
FT                   /translation="MDERARLALQEQLTQLEQQFGERLQADLAELATLARDLQQTRATG
FT                   SRRQLMLSVRERLHRLAGAAGTFGFASLGDNARQLEQRADRWLDSAKPGSRAADAFAAA
FT                   LLQLASETPGQEREGAAALPVHHEEPAPGCRIYLMKRDPIAATSMAVTLRNFGYMVSQW
FT                   HDFAALEQALANELPDALIVGIEHEGEFDALAALQQSLEQPLPLLVIHDRNDFASQLAA
FT                   VRAGAQGFFVRPLDITQLENSLERCLDRQQGEPFRVLIVDDDAELAARYSLVLRNAQMQ
FT                   VQTLTEPTRVLDAMRSFNPEVVLLDVNMPECSGPELAQMIRLHDEWLRVTIIYLSAETD
FT                   THRQMAALLKAGDDFITKPISDSALVAGVYSHAQRARSLSTALARDSLTGLLKHADIKE
FT                   QLALEVQRSSRSGKPASVVMLDLDHFKQVNDTYGHAAGDNVIRALANLLRQRLRRIDSL
FT                   GRYGGEEFVAVLPECSALQARRIFDEIRVRFAALTFNAGDHQEFRVTFSAGICETDEHS
FT                   AASVLLERADQALYLAKHQGRNQVQVAER"
FT   gene            complement(62102..62491)
FT                   /gene="cheY-1"
FT                   /locus_tag="PST_0053"
FT   CDS_pept        complement(62102..62491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY-1"
FT                   /locus_tag="PST_0053"
FT                   /product="chemotaxis protein CheY"
FT                   /note="Code: T; COG: COG0784"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77761"
FT                   /db_xref="GOA:A4VFL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL0"
FT                   /protein_id="ABP77761.1"
FT                   /translation="MNRQLKRILHVEDVPSIQVVTRIALEKIGGFEVLSCPSGQAALDQ
FT                   VQAFAPDLILLDVMLPQMDGIELVRQLGDLVDLQQIPVVFLTGHLQPERLQELRQLGVR
FT                   QVLNKPFDPLQLASQLQQVWEAEHG"
FT   gene            complement(62488..64869)
FT                   /locus_tag="PST_0054"
FT   CDS_pept        complement(62488..64869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0054"
FT                   /product="probable signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77762"
FT                   /db_xref="GOA:A4VFL1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL1"
FT                   /protein_id="ABP77762.1"
FT                   /translation="MPSAAQPRELSRLAALLRYEILDTPEESAFDDFTALAAQMCDTPI
FT                   ALISLVDDRRQWFKSRVGLDVSETPRDISFCTYTITGEQIFEVPDALQDPRFRDNPLVQ
FT                   GDPHIRFYAGTPLTSPDGHNLGTLCVIDRKPRRLSSEQREILERLGRQVIRLFEQHLLA
FT                   HRHAEQAALQQAILDSASSAVLITRPDGIVTSVNPTAERLLGYSEQALAGHPLTTALFR
FT                   HEALERRAKLLSSELEMPVEAGFAVLTAPLHLGRREMSEWRLRHQSGSEVPVLLGVTAI
FT                   HDEQEQLRGYLINAYDLAYQEQLQLRLQQIAAQVPGMLFQFHWRGNGSSCFPYVSEGVE
FT                   QIYGLSPGQLASSFAPIVGRVHALDRSTLLSSIRKAAAELTPWHSEHRVDHPCKGLIWV
FT                   EARATPLRQVDGSVLWHGFVTDITARKAEQLELDKQQEMNRRLLEALSEAVIACDAEGN
FT                   LTLFNEKAKQWHGADAAPVSPDEWASHYQLYRADGVTPLQPEEIPLRRALGGEHVIDHE
FT                   MVLLSQGTPRHVLSNADPLYTSDGQLLGAVAVLHDITERKRIERLQREFISTVSHELRT
FT                   PLTSITGALALVCSNVMGEVPGQMRELLDIAQQNSQRLGALIDDLLDMDKLHAGKMRFD
FT                   LLEQPLLPQLELALRSNGSYAERHGVQLRLGDCPAVQVEIDAMRLQQVLSNLLSNAAKF
FT                   SPPGEQVELSARMRDGHVRVSVRDRGPGISDEFRERVFQKFAQADSSDSRQQGGTGLGL
FT                   AISKELIEHMGGQIGFESAPGQGACFWFELPVRGETKESS"
FT   gene            complement(64976..65362)
FT                   /locus_tag="PST_0055"
FT   CDS_pept        complement(64976..65362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0055"
FT                   /product="two-component response regulator"
FT                   /note="Code: T; COG: COG0784"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77763"
FT                   /db_xref="GOA:A4VFL2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL2"
FT                   /protein_id="ABP77763.1"
FT                   /translation="MAELRRILHVEDDPSIQAVTKLALEAIGGYEVLSCSSGAQALEEV
FT                   EAFAPDFILLDVMMPGMDGPQTLLKLRERIDLERIPVTFMTAKVQPGEIEHLRKLGARD
FT                   VIVKPFDPMQLAGQIRSIWLTGRY"
FT   gene            complement(65412..68450)
FT                   /locus_tag="PST_0056"
FT   CDS_pept        complement(65412..68450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77764"
FT                   /db_xref="GOA:A4VFL3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL3"
FT                   /protein_id="ABP77764.1"
FT                   /translation="MPWKVAAHAYVVRRAQHLAPMAGTRMNSADLSTPRWIFGLGSLLL
FT                   VLLFGSLAFNDYRARDVAWHLEIETHGELQSLALQSAQLNQRRQADMVATALAGNAEVL
FT                   RQMRLIDAALRDGRSLDDPRLERSRQRLRAALTPAWRSMQRHQALQLQLFWGDAGVTVL
FT                   RMQQSERFGDTQAAQRPMLQRVLRDGIEQFGLEVDALGASSRAIVPLRAVDRQDSEVIG
FT                   ALEVGYNVLPELPDLSAQLAAGLALIVNREALQASQTTPPSGVQLSEGSDWLLIGHSAT
FT                   QVLHWAQAGVLPEPGSGKGSRLLDADGRSYILNQIPLHDEQQAEPSTPPLAAALAWRDI
FT                   SAMQGEHLQAERRLLIKWGLAWLVAEALLLVLAFLLQRRISVQQQYQFAQQQQNRRRQR
FT                   LLDRAQKIASLLPGMVFQLKRFANGRYAFLYASEGARELYGIEPQRLLEDAAQALVHVH
FT                   PQDLPRLHRALLRLAVHPGSGAVEFRIQHPQRGLLWAEGRASAERLADGTVLWHGFVTE
FT                   ITELMEATRALQKSESRFRAMVGNLPGVVYRCRNDGRRRMSYLSEGIERLTGYPASDFV
FT                   GDRVRSYGSLIHPDDQAQAEQSPAQDSFERIYRITNAEGRTVYVREKARVLRERDDPVG
FT                   WCDGFIWDVTDQALAKQEMEERERYLSMLIDNVIDAIIIIDGRGIIETFNHAAEQIFGY
FT                   RSDEVIGRNLSMLMPEPDRSAHDGYLDHYTRRGTSRALEQNRELTALRRNGETFTIELR
FT                   VSQISHHGERRFIGLVRDITERKRIERMKSELVSIVSHELRTPLTSISGALGLIVGGAL
FT                   GEPSPTMLQMLTIAHQNSLRLGRLVDDLLDMDKLVAGKMTLQLHGHSLVRQMQLATEAN
FT                   QGYAAKHGVYLQLEPLPTLQLIADDDRLQQVLANLISNAVKFSPEGGTVSLGAQQRGAW
FT                   VRIWVRDQGPGIAPEFHARIFQKFSQADSSDTRQKGGTGLGLAISKELIEHMHGRIGFD
FT                   SEPGHGACFWCELPLAPAATDQP"
FT   gene            68677..69885
FT                   /locus_tag="PST_0057"
FT   CDS_pept        68677..69885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0057"
FT                   /product="probable fatty acid desaturase"
FT                   /note="Code: I; COG: COG1398"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77765"
FT                   /db_xref="GOA:A4VFL4"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL4"
FT                   /protein_id="ABP77765.1"
FT                   /translation="MRHPVTMWHTGLLDLSIWQLIATTLLLTHVTIVSVTVYLHRYSAH
FT                   RALELHPALKHFFRFWLWLTTAMNTREWTAIHRKHHAKCETPDDPHSPVHKGLATVVRK
FT                   GAELYMAEAKNEETLRIYGKNCPDDWVERNLYSRFPNLGIVLMLAIDLALFGALGLTVW
FT                   AVQMIWIPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSA
FT                   KLSVRKWEFDMGWAWIRLFSLLGLAKVNRTAPIAHRIEGKQQLDMDSAMAILNNRFQIM
FT                   AQYRKLVIVPLVRQELGRADATLRHQLRRAKRLLTREPSLLQQEQQAHIDVMLAQSQAL
FT                   KVIYEKRLALQQIWSKTSANGHDMLAAIKQWVHEAEASGIQSLRDFAEHLRTYSLRPSV
FT                   TPA"
FT   gene            70203..71012
FT                   /locus_tag="PST_0058"
FT   CDS_pept        70203..71012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0058"
FT                   /product="sensory box/GGDEF domain protein"
FT                   /note="Code: T; COG: COG2199"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77766"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL5"
FT                   /protein_id="ABP77766.1"
FT                   /translation="MIYVSPAYERIFGRSPALLLADYGEWRNAIYPDDVEYAQKSMLAV
FT                   LDEGAVETREYRIIRGDGQLRWLSDKCFLGRPGENGQSPIIVGIAEDITEKKQLEGELQ
FT                   RLATTDVLTQSSNRRHFFECARIEFERARQFASSLAFLLLDIDDFKRINDTHGHQMGDQ
FT                   VLQKVARCGAAVLRQSDLFGRIGGEEFAAVLPGCQPDLAEQIAERLQREIERVVFTAEN
FT                   GERFRVTASLGLTYLRASDAELSAVFARADAAMYTAKRLGKNQVIVG"
FT   gene            complement(71034..71438)
FT                   /locus_tag="PST_0059"
FT   CDS_pept        complement(71034..71438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0059"
FT                   /product="putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77767"
FT                   /db_xref="GOA:A4VFL6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL6"
FT                   /protein_id="ABP77767.1"
FT                   /translation="MDFLVNLDVDDLERGVDFYSSLFGLQVGRRLGGFAVELLGGPAPI
FT                   YLLHKDAGSAATPEGNQHRHYGRHWTPVHLDFVVEDIESATAKAIALGARLEKPITTEN
FT                   WGRLALLADPFGHGFCLIQFLGRGYDERLD"
FT   gene            complement(71485..72591)
FT                   /locus_tag="PST_0060"
FT   CDS_pept        complement(71485..72591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0060"
FT                   /product="peptidyl-arginine deiminase-like protein"
FT                   /note="Code: E; COG: COG2957"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77768"
FT                   /db_xref="GOA:A4VFL7"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFL7"
FT                   /protein_id="ABP77768.1"
FT                   /translation="MTTLTSTPRQDGYYMPAEWAPHSQTWMVWPQRPDNWRDNAAPAQA
FT                   AFAAVAKAIARFEPVTVCASAEQYLAARAALDDPRIRVVEMSSDDAWVRDTGPTFVIDD
FT                   NGGLRGVDWTFNAWGGKDGGLYADWQRDDEVARKILEIEYCDRYRTEGFVLEGGSIHVD
FT                   GEGTLITTEECLLNRNRNPQLSREQIEAVLREHLAVDSIIWLPHGLFNDETDGHVDNFC
FT                   CFVRPGEVLLAWTDDANDPNYARCQAAMAVLQRARDAKGRALIVHKIPIPGPLHASDAE
FT                   CAGVVALDGSQLRDPSIRLAGSYVNFLIVNGGIIAPAFGDPLDGEAERILREVFPEHDV
FT                   VMVPGREILLGGGNIHCITQQQPAPFVR"
FT   gene            complement(72692..73573)
FT                   /locus_tag="PST_0061"
FT   CDS_pept        complement(72692..73573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0061"
FT                   /product="probable hydratase"
FT                   /note="Code: R; COG: COG0388"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77769"
FT                   /db_xref="GOA:A4VFL8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL8"
FT                   /protein_id="ABP77769.1"
FT                   /translation="MSRVVTVAATQMACSWDRQANIANADRLVREAAAKGAQIILIQEL
FT                   FETPYFCQKPNPQYLQLATPVEQNPAIQHFQKLAAELQVVLPISFFELAGRARFNSIAI
FT                   IDADGKLLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWNTRYARIGVAICWDQWFPETA
FT                   RSMALMGAELLFYPTAIGSEPHDASITSRDHWQRVQQGHAGANLMPLIASNRIGREEQD
FT                   GYDITFYGSSFIADQFGAKVEEMDETSEGVLVHSFDLDQLEHIRSAWGVFRDRRPNLYG
FT                   SIKTLDGSLPSE"
FT   gene            complement(73698..74348)
FT                   /locus_tag="PST_0062"
FT   CDS_pept        complement(73698..74348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0062"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="Code: K; COG: COG1309"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77770"
FT                   /db_xref="GOA:A4VFL9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFL9"
FT                   /protein_id="ABP77770.1"
FT                   /translation="MTKPSPATASRRPRASSQARIRQILASARELLAEQGAATLSVYAV
FT                   AEHAGIPPSSVYHFFSGVPALLAALTADVHAAFRASLERPIEHDSLGSWHDLSRLIEQR
FT                   MLAIYQQDSAARQLILAQHGLGEVTQTDQRLDLELGQAMQAVFERHFALPPLPQDIDVF
FT                   ALALELGDRVYARSIQLYGSLTPRMAEEGMRVFDAYLGLYLPPWLPKREQAER"
FT   gene            complement(74423..75796)
FT                   /locus_tag="PST_0063"
FT   CDS_pept        complement(74423..75796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0063"
FT                   /product="glutamate--ammonia ligase"
FT                   /note="Code: E; COG: COG0174"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77771"
FT                   /db_xref="GOA:A4VFM0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM0"
FT                   /protein_id="ABP77771.1"
FT                   /translation="MAPPRAVQLNEANAFLKEHPEVQYVDLLITDMNGVVRGKRIERAS
FT                   LHKVYEKGINLPASLFALDINGITVESTGLGMDIGDSDRICFPIPNTLSKEPWQKRPTA
FT                   QLLMTMHERDGAPFFADPREVLRQVVSKFDELGLTICAAFELEFYLIDQENINGRPQPP
FT                   RSPISGKRPHSTQVYLIDDLDEYVDCLQDILEGAKEQGIPADAIVKESAPAQFEVNLHH
FT                   VADPIKACDYAVLLKRLIKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKNGNNIF
FT                   ATDNPLDSQPLRHAIGGLQQTMAASMAFLCPNVNSYRRFGAQFYVPNAPCWGMDNRTVA
FT                   LRVPTDSPDAVRIEHRVAGADANPYLLLAGILAGVHHGLTNKIEPDDPIEGNSYEQVEQ
FT                   SLPTNLRDALRELDDSEIMARYISPDYIDIFVACKESELAEFEHSISDLEYNWYLHTV"
FT   gene            76037..76783
FT                   /locus_tag="PST_0064"
FT   CDS_pept        76037..76783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0064"
FT                   /product="probable glutamine amidotransferase"
FT                   /note="Code: R; COG: COG2071"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77772"
FT                   /db_xref="GOA:A4VFM1"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM1"
FT                   /protein_id="ABP77772.1"
FT                   /translation="MSRKPLIGVSACTKQIGHHSFHIAGDKYLRAAAIAGVPLVIPALD
FT                   ELIDPATLLESFDGLLFTGSPSNVEPHHYGGPASEPGTHHDPFRDRLTLPLIRAAVDAG
FT                   IPVFGICRGFQEMNVAFGGSLHQKVHEAGLYQDHRERPDDPLEVQYGLSHALHVQPGGL
FT                   LERLGLPAQIQVNSVHGQGVERLGAGLRIEALAPDGLIEAFSVEAAQSFALGVQWHPEW
FT                   QVQSHPHYLALFRGFAEACQARARQR"
FT   gene            76826..78184
FT                   /locus_tag="PST_0065"
FT   CDS_pept        76826..78184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0065"
FT                   /product="putative glutamine synthetase, catalytic region"
FT                   /note="Code: E; COG: COG0174"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77773"
FT                   /db_xref="GOA:A4VFM2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM2"
FT                   /protein_id="ABP77773.1"
FT                   /translation="MSIQLDQLTGWLKERKITEVECLISDLTGIARGKISPTNKFLDEK
FT                   GMRLPESVLLQTVTGDYVEDDIYYELLDPADIDMFCRPDPNAVFLVPWAIEPTAQVIHD
FT                   TYDKMGNPIELSPRNILKRVLKMYADRGWQPIVAPEMEFYLTKRCEDPDLPFQPPIGRS
FT                   GRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGEALH
FT                   LADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSVIDLNTGRNIFSNDDG
FT                   SMSQLFLHHVGGLQKYIPELLPMFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPD
FT                   SDPQNRRVENRLAGADANPYLAIAASLLCGYIGMVEQLPPSQPVKGRGYERRNLRLPLT
FT                   LEAALERMETCRELEKYLSPKFITGYVAVKRAEQENYHRVISSWEREFLMLSV"
FT   gene            78252..79610
FT                   /locus_tag="PST_0066"
FT   CDS_pept        78252..79610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0066"
FT                   /product="probable aminotransferase"
FT                   /note="Code: H; COG: COG0161"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77774"
FT                   /db_xref="GOA:A4VFM3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM3"
FT                   /protein_id="ABP77774.1"
FT                   /translation="MSDSQTLHWQALSRDHHLPPFTDYKALNAKGTRIITRASGVYLWD
FT                   SEGHKILDAMAGLWCVNVGYGREELIEAATRQMRELPYYNLFFQTAHPPAVALAKAIAD
FT                   IAPAGMNHVFFTGSGSESNDTVLRMVRHYWAVKGQPEKKVIIGRWNGYHGSTVAGASLG
FT                   GMKAMHEQGDFPIPGIEHIDQPYWYGEGGDMSPEEFGVRVADQLEQKILEVGEDKVAAF
FT                   IAEPIQGAGGVIIPPASYWPRVKEILARYDILFIADEVICGFGRTGEWFGSDYYGLAPD
FT                   LMPIAKGLTSGYIPMGGVIVRDEVVQTLNEGGEFYHGFTYSGHPVAAAVALENIRILRE
FT                   EKIVERVKSKTAPYLQSRWQELVEHPLVGEARGVGLLGALELVKNKKTRERFADAGVGM
FT                   RCREHCFRNGLVMRAVGDTMIISPPLVISEEQIDELIGKVRLCLDATAKDVLG"
FT   gene            79827..80924
FT                   /gene="potF2"
FT                   /locus_tag="PST_0067"
FT   CDS_pept        79827..80924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF2"
FT                   /locus_tag="PST_0067"
FT                   /product="putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /note="Code: E; COG: COG0687"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77775"
FT                   /db_xref="GOA:A4VFM4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM4"
FT                   /protein_id="ABP77775.1"
FT                   /translation="MNPFAKTLLAMTLAGTVAGAAQAQEKVLHVYNWSDYIAEDTLENF
FT                   TKETGIKVVYDVFDSNEVLEAKLLAGSSGYDVVVPSNPFLAKQIKAGVFQKLDKSKLPN
FT                   WENLDKDLLKALDSSDPGNQYSIPYMWGTIGIGYNVDKVKAALGDNAPVDSWDLVFKPE
FT                   NIEKLKSCGVAFLDSPTEMLPAALHYLGYATDSGKADELKKAEDLFMQIRPHVAYFHSS
FT                   KYISDLANGNICVAIGYSGDIYQGKSRAEEAANGVNVGYKIPKEGAGSFFDMLAVPADA
FT                   KNVENAHVFLNYLMKPDVMASITNYVQFPNGNAAATPLLDEAIRTDEGIYPSQAVLQKL
FT                   YTFPDLDPKTQRAMTRSWTKIKSGR"
FT   gene            81202..82287
FT                   /gene="potF3"
FT                   /locus_tag="PST_0068"
FT   CDS_pept        81202..82287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF3"
FT                   /locus_tag="PST_0068"
FT                   /product="putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /note="Code: E; COG: COG0687"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77776"
FT                   /db_xref="GOA:A4VFM5"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM5"
FT                   /protein_id="ABP77776.1"
FT                   /translation="MRSTLKSLIVAAAVAGAATAQAASVHVYNWSDYIGETTLEEFEKE
FT                   TGIKPVYDVFDSNETLEGKLLAGRSGYDVVVPSNHFLGKQIRAGAFQQLDKSKLPNWEN
FT                   LDPSLLKQLQKNDPGNAHAAPYLWGTNGIGYNVEKVKAALGVDKIDSWSVLFEPENAQK
FT                   LASCGIAFLDSADEMIPAMLNYLGLDPNSENAADYQKAEEKLLAVRPHVRYFHSSKYIS
FT                   DLANGNICVAAGFSGDVFQAAARAEEAGKGIEIAYAIPKEGGNLWFDMLAIPADASNVE
FT                   EAHAFINYLLRPEVIAAVSDYVGYANPNLKASELMDQEVREDASVYPPQEVLDRLYVSA
FT                   ELPPKIQRLMTRTWTKVKSGK"
FT   gene            82435..83586
FT                   /gene="potG"
FT                   /locus_tag="PST_0069"
FT   CDS_pept        82435..83586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="PST_0069"
FT                   /product="putrescine ABC transporter, ATP-binding protein"
FT                   /note="Code: E; COG: COG3842"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77777"
FT                   /db_xref="GOA:A4VFM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM6"
FT                   /protein_id="ABP77777.1"
FT                   /translation="MAVASSAYKKALSGESKNKQVLLKIDRVTKKFDETVAVDDVSLSI
FT                   HQGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDMPPYERPINMMFQSYA
FT                   LFPHMTVEQNIAFGLKQDGLPKAEIEERVKEMLGLVQMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVQIIERVGVTCVMVTHDQEEAMTMAER
FT                   IAIMHQGWIAQVGSPMDIYETPASRLVCEFIGNVNLFEGELVEDMGDHAIIASPGLDNP
FT                   IYVGHGISTRAQDKHITYALRPEKLLIGTELPELERPGYNWAKGVVHDIAYLGGHSVYY
FT                   IKLPSGGVLQAFMANAERHVKLPTWEEEVYVYWWDDSGVVLQA"
FT   gene            83583..84479
FT                   /gene="potH"
FT                   /locus_tag="PST_0070"
FT   CDS_pept        83583..84479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="PST_0070"
FT                   /product="putrescine ABC transporter, permease protein"
FT                   /note="Code: E; COG: COG1176"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77778"
FT                   /db_xref="GOA:A4VFM7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM7"
FT                   /protein_id="ABP77778.1"
FT                   /translation="MSRSPLNTGRRLVIGVPFLWLFLFFLLPFAIVLKISFAEADVAIP
FT                   PYTEIFRYAEQQLQVLINLGNYIFLSEDELYLAAYLGSLKIAFFSTLLCLVIGYPMAYA
FT                   IARARKDLQTVLLLLIMMPTWTAILIRVYAWMGILSSNGLLNSLLLGMGLIDRPLQILN
FT                   TDVAVYIGVVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNLTSFWKITVPLSKNGI
FT                   IAGCMLVFIPVVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAILLV
FT                   PIILFNRNQAKALEGKL"
FT   gene            84476..85378
FT                   /gene="potI"
FT                   /locus_tag="PST_0071"
FT   CDS_pept        84476..85378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="PST_0071"
FT                   /product="putrescine ABC transporter, permease protein"
FT                   /note="Code: E; COG: COG1177"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77779"
FT                   /db_xref="GOA:A4VFM8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM8"
FT                   /protein_id="ABP77779.1"
FT                   /translation="MKRWSFSNLILVLGLLFIYLPMVILVIYSFNASRLVTVWGGWSLK
FT                   WYTGLLDNSQLMGAVMRSLEVAAYTAVAAVALGTMAAFVLTRIPVFRGRTLFGGLVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLVGWPAQRGLVTIWIAHTTFCSAYVAVVVMARLRELDL
FT                   SIEEAAMDLGARPWKVFFLITMPMIAPSLAAGGMLSFALSLDDLVLASFVSGPGSTTLP
FT                   MEIFSAVRLGVKPEINAVASLILLSVSLATFLAWYLTRRAEKRRIRAMQQAMDESNSNP
FT                   TWRQVIDSRKVMVPPSAHS"
FT   gene            complement(85463..86125)
FT                   /locus_tag="PST_0073"
FT   CDS_pept        complement(85463..86125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0073"
FT                   /product="thiol-disulfide isomerase and thioredoxins
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77780"
FT                   /db_xref="GOA:A4VFM9"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFM9"
FT                   /protein_id="ABP77780.1"
FT                   /translation="MDIDFLRLAGTPDIQLCSASWQACAPSQEPAMSARRKYLIAALIA
FT                   LLWGAAMLAAFWWFEARYLRTFEGERAELFSGDALRLPAELQGPGPVRFVHFWDPGCPC
FT                   NVGNQQHLQELLQRFAGQPVDFYEVRKPGSKGRLPQPLAALKPLDGLIGAEQLPASPAV
FT                   GIWDQSGELVYIGPYSEGAVCTSDNSFVEPILDAVLAGRKVRATHSLAVACFCDWQR"
FT   gene            86118..87056
FT                   /locus_tag="PST_0072"
FT   CDS_pept        86118..87056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0072"
FT                   /product="lysophospholipase"
FT                   /note="Code: I; COG: COG2267"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77781"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN0"
FT                   /protein_id="ABP77781.1"
FT                   /translation="MSTLIQPDRLRNSLPALSEATEASAEALHYQAYYGLDLPHRGKVQ
FT                   RRLGRFRVHDYDVVAQAWWPEQPHASLLVLHGYYDHMGLYRHVVDWGLEMGFAVLACDL
FT                   PGHGLSSGPRASINEFDEYQAVLSGLFEQARRLDLPRPWHLLGQSTGGAIALDHLLHQE
FT                   PLDDLGRTILLAPLVRPRAWLRSRISYELVRRFVQQIPRTFSENSSDPGFLEFVQTQDP
FT                   LQPDILPTAWVGALSRWIPRIERAADSAQAPLIVQGEADMTVDWQYNLPVLQRKFAGAE
FT                   VLRLPEARHHLVNEREELRRAYFDFLRERLK"
FT   gene            complement(87070..87834)
FT                   /locus_tag="PST_0074"
FT   CDS_pept        complement(87070..87834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77782"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN1"
FT                   /protein_id="ABP77782.1"
FT                   /translation="MRALLTCVLLTFSLASFADTYEELYETAGWTEQRANFADALTAAQ
FT                   QRYKDTLPPAVFQALVTNSNRRFASHAIDQRAQRALREHLADPQPALEFFQSPLGRKIV
FT                   SAEVLAARREQLARHTDGLPRVTAESNRQLLIRHLAQAIPASEAGAEVSLALAGVAADS
FT                   LSQMIPGLLGGNQAQNLLSSQRQRMIQQIEADLDNTLLYVYRELSDAELEEYVQFAQSE
FT                   DGKAYYQAALQALRAGLAVGMSGAELEPQQGI"
FT   gene            88065..88598
FT                   /locus_tag="PST_0075"
FT   CDS_pept        88065..88598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0075"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /note="Code: O; COG: COG3751"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77783"
FT                   /db_xref="GOA:A4VFN2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN2"
FT                   /protein_id="ABP77783.1"
FT                   /translation="MTHKLADECRKREAEGALAPAGVGRGEAQAVREGIRSDHIQWLEP
FT                   GQSPVCDDYLEVMDGLRQQLNRELFLGLEEFECHFAFYPPGAFYQTHLDRFRDDDSRSV
FT                   TAVLYLNPDWQPAHAGELRMHMPDGSQLDVPPLAGNLVVFLSGEFPHEVLVTQADRLSL
FT                   TGWFRRRPADPLAV"
FT   gene            complement(88681..89961)
FT                   /gene="dctM"
FT                   /locus_tag="PST_0076"
FT   CDS_pept        complement(88681..89961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctM"
FT                   /locus_tag="PST_0076"
FT                   /product="probable C4-dicarboxylate transporter"
FT                   /note="Code: G; COG: COG1593"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77784"
FT                   /db_xref="GOA:A4VFN3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN3"
FT                   /protein_id="ABP77784.1"
FT                   /translation="MTILFLFVALFALMFIGVPVAVSLGLAGSLTIMIFSQDSVRSLAI
FT                   KLFETSEHYTLLAIPFFLLAGAFMTTGGVARRLIDFANACVGHIRGGLAIGAVLACMLF
FT                   AALSGSSPATVAAVGSIAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSVVMVVYAAAT
FT                   ETSVGKLFMAGVVPGIMLGLALMVAIYIIAVKKNLPALPRASFREWLSAARKAIWGLLL
FT                   MVIILGGIYSGMFTPTEAAAVAAVYSAFVALFVYKDITLRDCPKVLLESGKLSIMLMFI
FT                   IANAMLFAHVLTTEQIPQAITAWVIEAGLQPWMFLLVVNIVLLVAGAFMEPSAIILILA
FT                   PILFPIAVQLGIDPIHLGIIMVVNMEIGLITPPVGLNLFVASAVTGMPVTQVIRAVLPW
FT                   LALMLSFLVIITYVPSISLALPNWLGM"
FT   gene            complement(89958..90587)
FT                   /gene="dctQ"
FT                   /locus_tag="PST_0077"
FT   CDS_pept        complement(89958..90587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctQ"
FT                   /locus_tag="PST_0077"
FT                   /product="probable dicarboxylate transporter"
FT                   /note="Code: G; COG: COG3090"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77785"
FT                   /db_xref="GOA:A4VFN4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN4"
FT                   /protein_id="ABP77785.1"
FT                   /translation="MNALWRVWDHFEEGFIAFLLAAMTLVTFVYVILNNLYTLFYDLGD
FT                   RFEGTADFWFAIGDFIIGLAQSMTWSTALTKALFAWLIFSGLAYGVRTAGHIGVDALVK
FT                   LAPRHIQRVIGIIACLFCLGYAGLLTVASFEWIQTLFIANIGAEDLGHIGVKQWHIGLI
FT                   VPFGFAMVFIRFAEIFVRILRNEQTGLGLADEAADALKHGEEEPKQ"
FT   gene            complement(90853..91923)
FT                   /gene="dctP"
FT                   /locus_tag="PST_0078"
FT   CDS_pept        complement(90853..91923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="PST_0078"
FT                   /product="probable C4 dicarboxylate binding protein"
FT                   /note="Code: G; COG: COG1638"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77786"
FT                   /db_xref="GOA:A4VFN5"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN5"
FT                   /protein_id="ABP77786.1"
FT                   /translation="MRLDLPSWLLPGCPEASHPQQEETSMFKLTAKALACALSLSIAGL
FT                   AHAADPITIKFSHVVAENTPKGQGALMFKKLVEERLAGKVEVQVYPNSSLFGDGKEMEA
FT                   LLLGDVQLIAPSLAKFEHYSKGVQVFDLPFLFDDIAAVDRFQQGEAGQSLLRSMEDKNI
FT                   TGLGYWHNGMKQLSANKPLREPKDARGLKFRVQASAVLDEQFKAVRANPRKMSFAEVYQ
FT                   GLQTGVVNGAENPYSNIYSQKMHEVQKYITESNHGLLDYMVITNTKFWNGLPADVRGEL
FT                   EKILDEVTVAVNKQADELNQADKQRIIDAGTTEIIDLTPEQREMWREAMKPVWKKFEGE
FT                   IGADLIKAAEAANQAN"
FT   gene            complement(92194..93588)
FT                   /gene="dctD"
FT                   /locus_tag="PST_0079"
FT   CDS_pept        complement(92194..93588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctD"
FT                   /locus_tag="PST_0079"
FT                   /product="C4 dicarboxylate transport response regulator
FT                   protein"
FT                   /note="Code: T; COG: COG2204"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77787"
FT                   /db_xref="GOA:A4VFN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN6"
FT                   /protein_id="ABP77787.1"
FT                   /translation="MSSDTPISTQAQVVLIDDDPHLRQALSQTLDLAGLKVASLGDARD
FT                   LAARLPADWQGVVVSDIRMPGIDGLELLQQLRARDSELPVILITGHGDIQLAVQAMRAG
FT                   AYDFLEKPFPSEALLDSVRRALALRQLVLDNRSLRLALADRQQLSARLLGQSRAMLRLR
FT                   EQIGALAGTQADVLILGETGAGKEVVARALHDLSNRRNGPFVAINAGALAESVVESELF
FT                   GHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRLLQERVVERLGGNQS
FT                   IALDIRVIAATKEDLRVAADQGRFRADLYYRLNVAPLRIPSLRERSEDILLLFQHFAEA
FT                   AAQRHGLPVRELQPEQRATLLQHTWPGNVRELQNTAERFALGLGLGLERPGSEPSAGLA
FT                   GGGSLGEQVEAFERALIAAELSRPHGSLRSVAEALGLPRKTLHDKLRKHGLSFTDAGGS
FT                   SPDEND"
FT   gene            complement(93585..95390)
FT                   /gene="dctB"
FT                   /locus_tag="PST_0080"
FT   CDS_pept        complement(93585..95390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="PST_0080"
FT                   /product="C4 dicarboxylate transport sensor protein"
FT                   /note="Code: T; COG: COG4191"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77788"
FT                   /db_xref="GOA:A4VFN7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN7"
FT                   /protein_id="ABP77788.1"
FT                   /translation="MTALLAPRRPRWRNLALLALLLAPLLWPLQQLAERYYRNELTEQN
FT                   RQTLDLYVANLLGTLNRYEVLPRILGDLPALRAVLQQDSPQVRDNANRLLKRLRNQTGA
FT                   DVIYLMATDGNTLAASNWDEEDSFVDRNFAFRPYFRQAMEGRLGRFFGLGTTSGKRGYY
FT                   FGAAVRDGDQVLGVLVVKVDLDHTETLWGSTPEQLLVTDNFGVVILTSRPDWRFRATRG
FT                   LGVDEREQIAFDQPYPTLYPQDLTLNIDAWLIQSRELKETGWTVRILAPVSLVERPVRT
FT                   VVAIGAATLLALLLWLGLLMQRRRHFLERLALDSQARQQLEQRVLERTRDLEALNSRLK
FT                   VEVLEREQAQQELVRAQDELLQAGKLSALGTMSASISHELNQPLAAIRSYADNARVLLD
FT                   HERVDEARDNLRLISELTARMASIIAHLRAFARRDQHAPERVALQPALDDALALLAKRR
FT                   QAMGVELIRDLPEATLWVQAGETRLRQILANLLANALDALGERPQPRRIWLRAELEGDG
FT                   VLLTLRDNGPGFSAEALQRAREPFFTTKTSTQGLGLGLAICDTLTRALGGELRMSNHAE
FT                   GGAQLGLFLRSAEPGVAFPTEDHFQ"
FT   gene            complement(95496..96410)
FT                   /locus_tag="PST_0081"
FT   CDS_pept        complement(95496..96410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0081"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="Code: M; COG: COG1091"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77789"
FT                   /db_xref="GOA:A4VFN8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN8"
FT                   /protein_id="ABP77789.1"
FT                   /translation="MKILITGSKGQLARELQSELAGTGKLLALGHNALDLAVPEQIREQ
FT                   VRLLRPDLIINAAAYTAVDPAETHREQAFAVNARGPQVLAEEAARLGVPLIHYSTDYVF
FT                   DGRKTEPYDEHDTPNPLGVYGASKLAGEQAIQAVGGEHLILRTSWVYSQHGKNFLLTMQ
FT                   RLLQERDALSVVSDEVGAPTWAATIARVTAELVRKRNAGQAGPSGLYHLTASGETSWYG
FT                   FACSIAERLRQEGRLRAEITPILSKDYPTAAQRPLNSRLNCARLQQDWGVQLPDWETAL
FT                   HECCTRARDLEADNARQPVAVGR"
FT   gene            complement(96407..96952)
FT                   /locus_tag="PST_0082"
FT   CDS_pept        complement(96407..96952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0082"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="Code: M; COG: COG1898"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77790"
FT                   /db_xref="GOA:A4VFN9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFN9"
FT                   /protein_id="ABP77790.1"
FT                   /translation="MKVVETSIPDVLIIEPKVFGDERGFFYESFNAAAFEAATGLKRQF
FT                   VQDNHSKSQRGVLRGLHYQIQQPQGKLVRVVAGEVFDVAVDLRKSSPSFGRWFGTHLSA
FT                   QNQRQLWIPEGFAHGFVVLSESAEFLYKTTDYYAPEHERSLLWNDPELGIEWPLDEAPQ
FT                   LSAKDIAGKLLRDAELFA"
FT   gene            complement(96949..97821)
FT                   /locus_tag="PST_0083"
FT   CDS_pept        complement(96949..97821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0083"
FT                   /product="glucose 1 ph thymidilate transferase"
FT                   /note="Code: M; COG: COG1209"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77791"
FT                   /db_xref="GOA:A4VFP0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP0"
FT                   /protein_id="ABP77791.1"
FT                   /translation="MKGIILAGGSGTRLHPITLGVSKQLLPIYDKPMAYYPISVLMLAG
FT                   IRDILVISTPQDLPQYQNLLGDGSQFGVNFSYAEQPSPDGLAQAFLIGEEFIGDDSVCL
FT                   ILGDNIFHGQHFTEKLQRAARQEKGATVFGYWVKDPERFGVIDFDENGKALSIEEKPKK
FT                   PKSSYAVTGLYFYDNDVIEIAKSIKPSPRGELEITDVNMAYLQRGDLNVERFGRGFAWL
FT                   DTGTHDSLLEASQYVQTIEHRQGLKVACLEEIAYQNKWIDREQLLRRADALGKTGYGQY
FT                   LFKLAGEDA"
FT   gene            complement(97818..98807)
FT                   /gene="rfbB-2"
FT                   /locus_tag="PST_0084"
FT   CDS_pept        complement(97818..98807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB-2"
FT                   /locus_tag="PST_0084"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="Code: M; COG: COG1088"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77792"
FT                   /db_xref="GOA:A4VFP1"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP1"
FT                   /protein_id="ABP77792.1"
FT                   /translation="MLNLDKLTYAGNLESLASVEGNPRYQFLQADIADRERVSEALLDF
FT                   QPDAIMHLAAESHVDRSIDGPAEFIQTNIVGTYQLLEAARAYWQTLPAERRAAFRFHHI
FT                   STDEVYGDLHGVDDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPVLITNCSNNY
FT                   GPFHFPEKLIPLVILNALDGKPLPVYGDGSQIRDWLFVEDHARALFKVVSEGKVGETYN
FT                   IGGHNEQKNIEVVRGICALLEELAPNKPAGLARYEDLITFVKDRPGHDLRYAIDASKIE
FT                   RELGWVPQETFQSGLRKTVQWYLNNLEWCRRVQDGSYQRERLGALENA"
FT   gene            complement(99085..100200)
FT                   /locus_tag="PST_0085"
FT   CDS_pept        complement(99085..100200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0085"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /note="Code: V; COG: COG0842"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77793"
FT                   /db_xref="GOA:A4VFP2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP2"
FT                   /protein_id="ABP77793.1"
FT                   /translation="MRTLGNVFQLGLKELRSLYRDPALLVLIVYAFTLAIYTAATALPE
FT                   APHRATLAVVDEDQSQASQRILNAFQLPYFLPPIPIDLRQMDSGMDAGFYTFTLNIPPD
FT                   FQADLLAGRSPTIQLNVDATQVSQAFTGAGHIQQIINDEISAFVQRYRADAALPVEAVV
FT                   RTAFNPNLTRSWFGAVNEVINQITMLSIILTGAALIREREHGTIEHLLVMPVTPFEIML
FT                   AKVWAMGLVVLLASGFALRVIVEGWLQIPIQGSLLLFMGGAALHLFATTSMGIFFGTVA
FT                   RSMPQLGLLIILALMPLQILSGGMTPRESMPELVQHIMLAAPTTHFIELAQAILFRGAG
FT                   VSVIWPQLLALVVIGAVFFVGALSRLRVSLR"
FT   gene            complement(100202..102973)
FT                   /locus_tag="PST_0086"
FT   CDS_pept        complement(100202..102973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0086"
FT                   /product="probable ATP-binding/permease fusion ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77794"
FT                   /db_xref="GOA:A4VFP3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP3"
FT                   /protein_id="ABP77794.1"
FT                   /translation="MASPPADQCRPMNPSSAPVAEISGVSLQYGKTRALDDLSLSLPAR
FT                   CMVGLIGPDGVGKSSLLALIAGARKLQQGHVQVLDGDMGDAGHRRAVCPRIAYMPQGLG
FT                   KNLYPTLTVFENLEFFGRLFGQDAAERRWRIAELTRSTGLAPFVERPAGKLSGGMKQKL
FT                   GLCCALIHDPDLLILDEPTTGVDPLSRAQFWELIERIRGERPQMSVLVATAYMDEAQRF
FT                   DHLVAMDAGRILATGTPAELLTRTNSDSLEEAFIRLLPEEKSSRHRALKIPPRQANDDI
FT                   AIEAHDLTMRFGDFVAVDRVNLRIERGEIFGFLGSNGCGKTTTMKMLTGLLPASEGHAL
FT                   LFGKPVDPHDLQTRQRVGYMSQAFSLYSELTVRQNLDLHARLFHLPAERREPRIREMLE
FT                   RFGLVDEADSLPEALPLGVRQRLSLAVAVIHAPEMLILDEPTSGVDPVARDGFWELLVQ
FT                   LSREDGVTIFISTHFMNEALRCDRISLMHAGRVLDSDTPRALMDKRGLPTLEQTFIAYL
FT                   EEAAAAHAGEQPATPPAAPSKPSQATGNNGRQARFSLRRLLSYTRRESMELRRDPIRAT
FT                   LAMLGTVLLMFIMGYGISLDVEDLTYAVLDHDQTTTSQAYALNIAGSRYFIEKAPLESP
FT                   DELDRRLRSGDISLAIEIPPDFGRDLKRGATPQVAFWIDGAMPMRADTIKGYVQGLHTS
FT                   YLQDLARSAGVSSAALADVAIRYRYNPDVQSLPAMVPAMIPILLMMIPAMLTALGVVRE
FT                   KELGSITNFYVTPVTRLEFLLGKQLPYIALGMVNFATLVLLAVFVFGIPIKGSLLTLVI
FT                   GALLYVTCATGLGLLMSSVLNSQIAAIFGTAIATLLPAVQFSGLTHPVSALEGASAFFG
FT                   QIYPTSHFLIISRGVFSKALGMADLYWYFIPLLLAIPLLTLLSVAGLRKQEK"
FT   gene            complement(102937..104046)
FT                   /locus_tag="PST_0087"
FT   CDS_pept        complement(102937..104046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0087"
FT                   /product="Type I antifreeze protein:HlyD family secretion
FT                   protein"
FT                   /note="Code: M; COG: COG0845"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77795"
FT                   /db_xref="GOA:A4VFP4"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP4"
FT                   /protein_id="ABP77795.1"
FT                   /translation="MPTLLHDKGTPMKAPAQKTLRRVLFALVALVVIGLLAWSELRTDG
FT                   LGDGFASGNGRIEATEIDVATKLGGRIREISVDEGDFVQPGQVIARMDTEVLEAQLNQA
FT                   RAQVRQAENAILTAQALVTQRESEKATAEAVVLQRRAELTAAQKRHQRTETLVGRNAMP
FT                   RQQLDDDLAAMQSAQAALAASRAQVLSADAGIAAARSQVIEAQSALEAAQASVVRLQAD
FT                   ITDSELKTDRVARVQYRVAQPGEVLGAGGKLLNLVDLADVYMTFFLPERQAGRVAMGSE
FT                   ARLVIDAAPQYVIPARITYVASVAQFTPKTVETESEREKLMFRVKARIDPDLLRKHMEQ
FT                   VKTGLPGVAYLKLDADAEWPAHLQINVGR"
FT   gene            complement(104132..104752)
FT                   /locus_tag="PST_0088"
FT   CDS_pept        complement(104132..104752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0088"
FT                   /product="lipoprotein, putative"
FT                   /note="Code: R; COG: COG3218"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77796"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP5"
FT                   /protein_id="ABP77796.1"
FT                   /translation="MSRLALFRPLALACVLGTLAACTLLPEAEPIRVYLLPTAEATGQQ
FT                   GERLQQALRIHTPHASRILAGPRIAVVPDGNQISSYQGARWSDAAPTLLRDRLIEQFRQ
FT                   SGPVAVSNEDSNLFAELELFSELRAFQSEYIDGQPQVLVRLDAQLASATDQRILASRRF
FT                   EIRQPSAGPQLESVVAAFGQASDELSRQLQRWTIEVAKSQSAQ"
FT   gene            complement(104749..105687)
FT                   /locus_tag="PST_0089"
FT   CDS_pept        complement(104749..105687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0089"
FT                   /product="ABC transporter permease"
FT                   /note="Code: Q; COG: COG1463"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77797"
FT                   /db_xref="GOA:A4VFP6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP6"
FT                   /protein_id="ABP77797.1"
FT                   /translation="METRAHHVLIGLFTVLAVGGALLFALWLGKSSMDREYNYYEISFN
FT                   RAVSGLSNGSAVEYSGIKVGDVEALWLEPDDPRKVRARIRIYSGTPIKQDTRARLALAN
FT                   ITGSMIIQLHSGTPQSPPLEGKRGEPPLIIADPSPLSALLENGEDLMTNINNLLRSANL
FT                   MLSEDNAGRIGRTLANLEQATSVLAEQRGDLSEALTQLSQLGQQTNTALAEITRLTQNA
FT                   NGLIDDEGRQLLSSAGESMAALERATSRLDELLSSNQGALNNGLQGFSELGPAINELRG
FT                   TLGALRRVTQRLEDNPSGFLLGREKIQEFTP"
FT   gene            complement(105689..106474)
FT                   /locus_tag="PST_0090"
FT   CDS_pept        complement(105689..106474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0090"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Code: Q; COG: COG1127"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77798"
FT                   /db_xref="GOA:A4VFP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP7"
FT                   /protein_id="ABP77798.1"
FT                   /translation="MTGNDALIQVRGLVNRFGSQTVHENLDLDIRRGEILGVVGGSGTG
FT                   KSVLLRSIVGLRRPNAGSVSVFGENLLELSAERRSQVERRFGVLFQRGALFTSLNLQEN
FT                   VALPLIEHAGLERRDAEHLARLKLALAGLPANAACKYPDELSGGMVKRAALARALALDP
FT                   EVLFLDEPTAGLDPIGAAAFDQLILTLRDALGLSVFLVTHDLDTLYTICDRVAVLSRKR
FT                   VLVADRLEVVEATDDAWIRDYFHGPRGRAAQQAADLQEN"
FT   gene            complement(106471..107559)
FT                   /locus_tag="PST_0091"
FT   CDS_pept        complement(106471..107559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0091"
FT                   /product="probable permease of ABC transporter"
FT                   /note="Code: Q; COG: COG0767"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77799"
FT                   /db_xref="GOA:A4VFP8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP8"
FT                   /protein_id="ABP77799.1"
FT                   /translation="MRARIVGDWTLAHYAALRREVQRLRARIDERSQIELSGLGALDTA
FT                   GAGLLAELLGPERIAAIEAWAPQLPAERLALLRTVATALDQPDAAESPRGYEFGYVLAH
FT                   IGRTVAAVWKQQRALLGFIGLTLQTLLLTLPRPRRWRLTSLAVHIEQTGLDAVPIVALL
FT                   TFLVGAVVAFLGATVLADFGATIYTVNLVGFSFLREFGVLLAAILLAGRSASAFAAQIG
FT                   SMKSNEEIDAIRTLGLSPIELLVLPRVLAMLITLPILTFVGMLSGIAGGLVVCVLALDI
FT                   SPTMFFNIMARDIAVSHFLVGLGKAPVFAFVIAVIGCLEGFKVTGSAQSVGEHTTSSVV
FT                   QAIFMVILLDAIAALFFMEMGW"
FT   gene            complement(107764..108900)
FT                   /locus_tag="PST_0092"
FT   CDS_pept        complement(107764..108900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0092"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77800"
FT                   /db_xref="GOA:A4VFP9"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFP9"
FT                   /protein_id="ABP77800.1"
FT                   /translation="MLTRLWLWIGRLLGRLLLAITALGLAGWAIAAVHFHFIHRGPVSS
FT                   EEVIAPSEAGDTQAIIADAIAVVEQHSENTRVLRDAHAKAHGCVRAEVSVRADLQPALR
FT                   QGVFSEPGKTWQAWVRLSNGNAYPQFDRIRDARGMAIKLLDVPGEKLTRDPRHAGEQDF
FT                   VMFNHPVFFVRDVAEYRSNFAAQAQGKKALAFFPSIDPRSWELRHLFIALQTLAPAPES
FT                   PVATTYSSVAPYELGPHNIKYRVVPTPENCPTYQLPEQNRDLPNFLRSALYQQLSLDRA
FT                   PACFALQVQRQNAEHYMPIEDTSIEWDEAIAPFETVADIRLLPQDFDSPEQNLACDNLS
FT                   FNPWHALPEHRPIGGINRLRKAVYEAISSYRLERNGAL"
FT   gene            complement(108928..110799)
FT                   /locus_tag="PST_0093"
FT   CDS_pept        complement(108928..110799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77801"
FT                   /db_xref="GOA:A4VFQ0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ0"
FT                   /protein_id="ABP77801.1"
FT                   /translation="MRLLRRALGAVLLLAVLAVGVGLYFVAYPNLPEYEAPEALHYLEQ
FT                   WDATQRQTYYYTPQGTQVKGLEYDWFRALELPFSRDKFATPDYLARFGFLVDPAQQATA
FT                   LNPGNLPVGFARHEDDETGRAYLDVTCAACHTGELRYGGQAIRIDGGAAMHSLASTVPT
FT                   LRGGAFGQALGMSMAFTYYNPLKFRRFAEQVLGERYEQDRAQLRHDFKQVLDRLLGTAY
FT                   NDWHRGLYPTEEGFGRTDAFGRIANSVFGDAIDPANYRVANAPVSYPHLWDIWKFDWVQ
FT                   WNGSAMQPMARNIGEALGVGATLRLLHENGQPVAEAERYASGVRVRDLHRLETTLMQLA
FT                   PPRWPEDVLGAIDLEQASLGRALYKENCAHCHDARPKPVDKRFAAERDPEWRMKVIPTS
FT                   FVGTDPTTADNIADHRFDLTRLGWTQDELDRLNVQLYGASSGPLDLASLSSAKGLAYIT
FT                   AYVEERAYRDAGIGEAERAEFDGFGLPIGVQELRGYKARPLDGIWATPPFLHNGSVPTL
FT                   FQLLSPVAERQKQFWVGSREYDPQHLGIRTERFDGGFLLNTAITGNSNRGHEFRAGCRG
FT                   NGVIGRALAPHERWALVEYLKVLGDPRFEPRLEELPARPHNPGPRCP"
FT   gene            complement(111101..111177)
FT                   /locus_tag="PST_0094"
FT   tRNA            complement(111101..111177)
FT                   /locus_tag="PST_0094"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   gene            111344..112039
FT                   /locus_tag="PST_0095"
FT   CDS_pept        111344..112039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0095"
FT                   /product="nickel-dependent hydrogenase b-type cytochrome
FT                   subunit"
FT                   /note="Code: C; COG: COG3658"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77802"
FT                   /db_xref="GOA:A4VFQ1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ1"
FT                   /protein_id="ABP77802.1"
FT                   /translation="MSGHIKLWDAPLRLFHWLFAGAVIATIVTGWVGGSLMPWHGRLGL
FT                   LVLGLLVFRLIWGFVGSTYARWPRIFAATFGVKDYLQGNWREAGHNPLGAFSVLAMLLL
FT                   VSFQVASGLMATDDIAFQGPLHALVSSETGSALSGLHRQAKWLLLVLIGMHIAAIIYYT
FT                   LVMRRPLVRAMIAGRTQREHPSQQDARGGSLPAAVLAIALGVACVWGVQAVGDWLRPEP
FT                   AAVAPSLDW"
FT   gene            112055..114289
FT                   /gene="gabD-2"
FT                   /locus_tag="PST_0096"
FT   CDS_pept        112055..114289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD-2"
FT                   /locus_tag="PST_0096"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="Code: C; COG: COG1012"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77803"
FT                   /db_xref="GOA:A4VFQ2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ2"
FT                   /protein_id="ABP77803.1"
FT                   /translation="MSAGCARSVGAELVVAGLAAAADVAEGLLDRGLIAFCGDLGELVG
FT                   GGREVAADLTGFVEVLEELRLQTSRLAQLFGRGIRAVEAAHAGIGDGGDGIGGGGHLGL
FT                   VVRLLAVDYLGLDLAHVPRHELIAGLAGFDHLFRFHLRLDGSAGQQDRGHGACHQCFHG
FT                   NSLSILGCRRLAPPARNYTPTRTQVWVTRRDRPRRHQAGQWHDNAERHELAGRPAAVLA
FT                   WSFAVQCGGRNRAAKDGSDDRRVRQTFRSGPAATMPEETAMQLKDTALFRQQAYIDGAW
FT                   LDADSGQTISVNNPATGEILGTVPKMGAAETRRAIDAAERALPAWRDLTAKERSQKLRR
FT                   WFELLMENQDDLGRLMTLEQGKPLAEAKGEIAYAASFIEWFAEEAKRIYGDTIPGHQKD
FT                   KRILVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVIKPASQTPFSALAMVELA
FT                   ERAGIPKGVLSVVTGSAGDIGNELTANPKVRKISFTGSTEVGAKLMEQCAPGIKKVSLE
FT                   LGGNAPFIVFDDADLDEAVKGAMQSKYRNAGQTCVCVNRIYVQDGVYDAFAEKFQAAVA
FT                   KLRVGNGLEEGTDIGPLIDDRAAAKVREHIEDAVAQGARLVAGGQAHQMGGSYFEPTVL
FT                   VDVPDSAKVAKEETFGPLAPLFRFKDEAEAISKANDTEFGLASYFYARDLGRVFRVAEA
FT                   LEYGMVGINTGLISTEVAPFGGVKSSGLGREGSKYGIEDYLEIKYLCMGI"
FT   gene            complement(112076..112528)
FT                   /locus_tag="PST_0097"
FT   CDS_pept        complement(112076..112528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0097"
FT                   /product="cytochrome c, class II"
FT                   /note="Code: C; COG: COG3909"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77804"
FT                   /db_xref="GOA:A4VFQ3"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ3"
FT                   /protein_id="ABP77804.1"
FT                   /translation="MTGAVAAVLLASTAVQAQMKPEEMVETRQAGYQFMSWNMGKIKAQ
FT                   VVDGKEPYDQAKVAAAANAIAAIANSGMGSLYSPDTTTEQLGKATRLKPEFFQNLDEAG
FT                   QIGRNFTAAANQLAKVAAEGDQAAIKKAFGDVGGSCKSCHDKFRAD"
FT   gene            114439..115644
FT                   /locus_tag="PST_0098"
FT   CDS_pept        114439..115644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0098"
FT                   /product="response regulator"
FT                   /note="Code: T; COG: COG1639"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77805"
FT                   /db_xref="GOA:A4VFQ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ4"
FT                   /protein_id="ABP77805.1"
FT                   /translation="MSVSAQVSFVLVAYNEPWRADQLCQLVRELRPGMRVQPAADGHAA
FT                   LAACQRQVPSLLIVDGELDGLDGRQLLRELRRHGPTQRLPCVLISARTDTASVRTVLPL
FT                   APAAYLGKPYDLADLRERLDKLLPRSAGHAGAPRRAAVDDLDSFLERMRPHNRGAPLLE
FT                   TVLSALQRLQGGDQDYAQLEELLARDPQVTARLISVASSATQPPKPCLSLAQAQRQLGL
FT                   ARSLQLVTELALQHNARLVEPRLAELAAQLSAQALRTARLASWLARQLKLDVELCFSAG
FT                   LLQNIGELALLRSLQEWLDSGGALDEAQLQRCLRGRAAGFGSALRAQWALPLELRQVIS
FT                   AYYALGAGVLRREALVLNVTRLLVELPEGAEPASLASERTVRLLRIDPDLLARAPRHAV
FT                   GG"
FT   gene            115867..117972
FT                   /locus_tag="PST_0099"
FT   CDS_pept        115867..117972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0099"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77806"
FT                   /db_xref="GOA:A4VFQ5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ5"
FT                   /protein_id="ABP77806.1"
FT                   /translation="MTDVIRLERRGDIALILVNNPPVNALGHAVRKGLLDAFRQADEAP
FT                   EVTAVVLVCEGPTFMAGADIKEFGKPPQAPSLPEVIEVIEGCRKPSVAVIHGSALGGGL
FT                   EVALGCHYRIARSDAKVGLPEVKLGLLPGAGGTQRLPRLAGVEKALEMIVSGQPIGAAE
FT                   ALEHHIVDELFEGDLIEAGLTYARRLVEEGRGPRRSGEQTRGLEGVDNEALIRAKHAEV
FT                   AKRMPGLFSPLRCIAAVEAATRLPLAEGLKRERELFTECLNSPQRGALIHSFFAERQAG
FT                   KIDDLPSDVKLRPIRTAAVIGGGTMGVGIALSFANTGVPVKLLEINDEALQRGLQRARE
FT                   TYAASVKRGSLTEDAMEQRLALIAGVTDYGALADADVVVEAVFEEMGVKQQVFEQLDAV
FT                   CKPGAILASNTSSLDLNAIAAFTKRPEDVVGLHFFSPANVMRLLEVVRGERTSDEVLAT
FT                   AMAIGKQLKKVSVVVGVCDGFVGNRMVFQYGREAEFLLEEGATPQQVDAALRNFGMAMG
FT                   PFAMRDLSGLDIGQAIRKRQRATLPAHLDFPTVSDKLCAAGMLGQKTGAGYYRYEPGNR
FT                   TPQENPDLAPMLEAASREKGIERKALDEQYIVERCIFALVNEGAKILEEGIAQRSSDID
FT                   VIYLNGYGFPAFRGGPMYYADSVGLDKVLARVKELHARCGDWWKPAPLLEKLAAEGRTF
FT                   TEWQAGQ"
FT   gene            118016..119212
FT                   /locus_tag="PST_0100"
FT   CDS_pept        118016..119212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0100"
FT                   /product="putative acyl-CoA dehydrogenase family protein"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77807"
FT                   /db_xref="GOA:A4VFQ6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ6"
FT                   /protein_id="ABP77807.1"
FT                   /translation="MNVNYTAEELAFRDEVRAFLKSELPADIAAKVKLGKHMSKEDHQR
FT                   WQQILVKRGWYAPGWPVELGGTTWGPVEKHIFDEECSAFGAPRTVPFGVNMVAPVIIKF
FT                   GTQQQIGHYLPRILSGEDWWCQGYSEPGAGSDLASLKTRAVRDGDHYVVNGQKTWTTLG
FT                   QHASMIFCLVRTDPEAQQQRGISFLLIDMKSPGISVRPIITLDGDHEVNEVFFDNVRVP
FT                   VENLVGEENQGWTCAKYLLTHERTGLAGIGSSKAVLAHLKRIAMKEVCDGKPMLEDPLF
FT                   RAQVAEVEMQLMAIEMSTLRILAAAKEGGVPGAESSILKIKGTEIRQAITHLLRKVIGP
FT                   YALPFLEEELQLDYEGELLHADYSASLAGDYFNMRKLSIFGGSNEIQKNIVSKMILEL"
FT   gene            119225..120367
FT                   /locus_tag="PST_0101"
FT   CDS_pept        119225..120367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0101"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77808"
FT                   /db_xref="GOA:A4VFQ7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ7"
FT                   /protein_id="ABP77808.1"
FT                   /translation="MDFKLTEEQQMLQDTAARLVRDAYPFEQREKFSESELGFSAEFWS
FT                   QLGELGLTAVPFSEDIGGFGGSGVETMLVMTELGRGLTLEPYLQSVILAGGLINQLGSD
FT                   AQKQDLLPQVAAGSLQLAVAFDEPQSHYNLNDVQTRAEAVDGGYRLSGRKAVVIGGHSA
FT                   GQIIVSARTAGDSRDETGISLFLVDPNAQGVSRRVYPTIDGRKGCDLFLDNVQVGADAV
FT                   LGEIGNELPALRYQQGRAIAAQCADALGSMDEACKLTLDYLKTRKQFGVPIGKFQVLQH
FT                   RMVDMQTELEQATSMAILAATFADGEDNDERSRIIAAAKYICARAARKVAEEAIQLHGG
FT                   IGMTWEYNLAHHAKRLVMIAHQFGDDDHHLKAYAKLMQVA"
FT   gene            complement(120531..121889)
FT                   /locus_tag="PST_0102"
FT   CDS_pept        complement(120531..121889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0102"
FT                   /product="probable MFS transporter"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77809"
FT                   /db_xref="GOA:A4VFQ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ8"
FT                   /protein_id="ABP77809.1"
FT                   /translation="MHNNNNGYPSSTRAWMTVAILMLAYVLSFVDRQILNLLVEPIRRD
FT                   LDITDTHMSLLMGFSFAVFYTICGVPIGRLADRKSRRGIIAIGVLVWSLMTALCGTAKT
FT                   FWHFLVFRIGVGVGEAALSPSAYSLIADSFPPKLRGTAMSVYSMGIYIGSGLAFLLGGL
FT                   VVKFASAQGDVELPVLGMVRPWQLIFLVLGAAGVLFAAVLLLIREPSRKGVGAGVEVPL
FT                   SEVAGYIRQNRRTVLCHNFGFACLAFAAYGSSAWIPTFFIRTYGWSASDVGVLYGSVVA
FT                   VAGSIGIIAGGRLSDLLHRRGYRDAPLRVGIISAALTLPLNLAYLAGTGELALALIALH
FT                   VFTIAMPFGVGPAAIQEIMPNSMRGQASAVYLFVITMVGLGIGPTAVALGTDFVFGDDN
FT                   ALRYSLLIVTGIALVGAMILLGMGLKHYRGSLDRLQEWKPQSAAGSDAQPKPV"
FT   gene            complement(122031..122798)
FT                   /locus_tag="PST_0103"
FT   CDS_pept        complement(122031..122798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0103"
FT                   /product="predicted alpha/beta hydrolase"
FT                   /note="Code: R; COG: COG4757"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77810"
FT                   /db_xref="GOA:A4VFQ9"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFQ9"
FT                   /protein_id="ABP77810.1"
FT                   /translation="MGVPQRFYTDFANWLAGQGYLAVTFDYLGMGRSRRMPLRQLNVDI
FT                   LDWGRHDCSAVLAAAAEVAGGLPLYWIGHSVGAQILPLVDGHERLTRIVTIAAGSGYWR
FT                   ENSPQIRNKAWLLWHGLAPVLTAVAGYFPGGRIGAVGDLPAGVIRQWRRWCLHPQYLVG
FT                   VEGEPVRQAFAAVRTPLTSLSFSDDEMMSARNTESLHGFYSSAPKTMQRIAPAEIGATR
FT                   IGHFGFFRRQFADSLWTRHLLPELVADKQGAVA"
FT   gene            123014..123592
FT                   /locus_tag="PST_0104"
FT   CDS_pept        123014..123592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0104"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG1309"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77811"
FT                   /db_xref="GOA:A4VFR0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR0"
FT                   /protein_id="ABP77811.1"
FT                   /translation="MARSSRKQEILQAALACFTEFGVEATTIEMIRDRSGASIGSLYHH
FT                   FGNRERIIAALYLEGIGEYAALLEAGLIETLDAEACVRLFVTSYIDWVVANPDWARFVL
FT                   HNRGRVEAGEMGEQLREVNRVHGERVGAILRRHRESGAFRRMPGDCFLAVVIGPCHDMA
FT                   RNWLAGRSRTSLADCRELLADIAWVSVRA"
FT   gene            complement(123606..124466)
FT                   /locus_tag="PST_0105"
FT   CDS_pept        complement(123606..124466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0105"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG1414"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77812"
FT                   /db_xref="GOA:A4VFR1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR1"
FT                   /protein_id="ABP77812.1"
FT                   /translation="MAALLAVGRSAIVRHRCPLARKTETMSDDIEDTGTPKDRKFVEAL
FT                   ARGLDVLRAFTHGSVVMGNQDIARITGLPKPTVSRMTYTLTKLGYLSYSQQLEKYQLDS
FT                   GVLALGYAYVSNLRVRQLAKPYMDDFARRTNTTVGLTCRDRLSMIYVENCRPAEVTTLR
FT                   MDAGVRLPLATTAAGRAFLAATPEKEREHLMAALAAKYGEGWVAIRDSLQASFEEFARH
FT                   GFCLSLGDWDRNVMAAGVPLHLADGSIMALTCGAPSFQLSEETLKGSLAHQLEMLARDI
FT                   ESLGV"
FT   gene            124561..126180
FT                   /locus_tag="PST_0106"
FT   CDS_pept        124561..126180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0106"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /note="Code: IQ; COG: COG0318"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77813"
FT                   /db_xref="GOA:A4VFR2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR2"
FT                   /protein_id="ABP77813.1"
FT                   /translation="MSAPVQGYVAAELARGGYQNVHDLLTLACAKHPHRTAFSCGDDRL
FT                   SYADLARQADAFARYLRHHAGLQPGDRLALQLPNSLQYPIATFGALKAGLVIVNTNPQY
FT                   TAAEARHQFRDSGARAILVLDRLLPLVRAVQADTALERIILTSVEDLQAPVYDSLEPAT
FT                   ERFMQALRLGEQSPALDCVVGLERLALLQYTGGTTGVSKGAMLSHRNLLANVLQTIELF
FT                   DKPGLLEPEKDVRIAPLPLYHIMAFATNCLSSVGMGLHTVFIRDGRNLDETIGAMQRHP
FT                   FSLLSGINTLFVGLMNHPQFRSIDFSHLKWATSGGAPLNSEVGRRWQVLTGAPIREGFG
FT                   LTEASPVVATGTALSPYREGYIGQALIDTELRTVDDDGNDVPAESPGELWLRGPQVMQG
FT                   YWQRPEETAKVITADGWLKTGDIALLDAEGFVKIVDRKKDMILVSGFNVFPNEIEDVLM
FT                   QHPSVRECVAVGIPDARKGEAVKVFVSLREATDDQALLEHCRQFLTGYKLPSAIEIRDE
FT                   LPKTAVGKLLRRQLRDEARAAG"
FT   gene            126477..126713
FT                   /gene="rpmB"
FT                   /locus_tag="PST_0107"
FT   CDS_pept        126477..126713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="PST_0107"
FT                   /product="50S ribosomal protein L28"
FT                   /note="Code: J; COG: COG0227"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77814"
FT                   /db_xref="GOA:A4VFR3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFR3"
FT                   /protein_id="ABP77814.1"
FT                   /translation="MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKR
FT                   FVRLRVSAKGMRVIDKRGIDVVLAELRARGEKV"
FT   gene            126725..126880
FT                   /gene="rpmG"
FT                   /locus_tag="PST_0108"
FT   CDS_pept        126725..126880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="PST_0108"
FT                   /product="ribosomal protein L33"
FT                   /note="Code: J; COG: COG0267"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77815"
FT                   /db_xref="GOA:A4VFR4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR4"
FT                   /protein_id="ABP77815.1"
FT                   /translation="MRDLIRLVSSAGTGHFYTTDKNKRTTPDKIEIKKFDPVVRKHVIY
FT                   KEAKIK"
FT   gene            126975..129212
FT                   /locus_tag="PST_0109"
FT   CDS_pept        126975..129212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0109"
FT                   /product="ribonucleotide reductase, alpha subunit"
FT                   /note="Code: F; COG: COG0209"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77816"
FT                   /db_xref="GOA:A4VFR5"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR5"
FT                   /protein_id="ABP77816.1"
FT                   /translation="MTRVICSPRKFAIVRASLSPTFRHEDAQRMAKTDGPIAADSKSTS
FT                   SIALQAASEDIWSQKYRLSSKDGTPIDQTVDDTWQRVARALADVEPAKQREHWYERFLW
FT                   ALRNGAIPAGRIISNAGAQDYKPATSTINCTVSGSITDSMDDILGKVHEAGLTLKAGCG
FT                   IGYEFSTLRPRGSFVSGAGAHTSGPLSFMDIFDKMCFTVSSAGGRRGAQMGTFDVGHPD
FT                   VREFIRAKREDGRLRQFNLSLLITDEFMQTVEADGEWPLIFPVHAKEAAELDLADDAQV
FT                   IWREWPVHDGYIVRDDGLVACKIYGRVKARHLWDMIMVSTYDYAEPGFILIDRVNQLNN
FT                   NWWCEAIRATNPCGEQPLPPYGSCLLGSINLTHFVIDPFGVEARFDWDKYREVVRVFTR
FT                   MLDNVVEINGLPLEQQRHEIESKRRHGMGFLGLGSTLTLLKLRYGSPEACVFTEEVSRE
FT                   MALVGWEQALELSKEKGPAPLLSQNFEVTAEMLRKRPEMAKDGYKVGDQIAGRVLHAKY
FT                   SRYMQKIAEYAPDLIEALAEQGARFTHHSSIAPTGTISLSLANNASNGIEPSFAHHYSR
FT                   NLIRPGRKAKEKIEVFSYELLAYRTLINARAKPGSDEPGEKLPDYFITADDVSPTQHVD
FT                   IQAAAQKWVDSSISKTANVPTDYPFEAFKDIYRYAWRQGLKGCTTFRFNPAAFQGVLVK
FT                   EADLEKTLYRFTLEDGSVVELKGNQEVEYDGEVNTAANLFDALKEGYYGKY"
FT   gene            129271..129978
FT                   /locus_tag="PST_0110"
FT   CDS_pept        129271..129978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0110"
FT                   /product="ribonucleotide reductase, alpha subunit"
FT                   /note="Code: F; COG: COG0209"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77817"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR6"
FT                   /protein_id="ABP77817.1"
FT                   /translation="MTVKITQRIKGFKVVDETLERPATATSGSDGTASKAVNVVEMDES
FT                   LQRPETLIGMTYKIKSPLFEHALYVTVNDIVLNAGTPHEQRRPFEIFINSKNMDHFQWI
FT                   VALTRIMSAVFRKGGDCTFLVEELKAVFDPRGGYLKKGGVYMPSIVAEIGAVLERHLIA
FT                   IGMLEGHALDETQLKYLAEKRAAYEASQGAVAVEPGEGFPAGAQLCNKCNTQAVVQMDG
FT                   CATCLNCGNSKCG"
FT   gene            complement(130055..131620)
FT                   /locus_tag="PST_0111"
FT   CDS_pept        complement(130055..131620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0111"
FT                   /product="decarboxylase family protein"
FT                   /note="Code: R; COG: COG1611"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77818"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR7"
FT                   /protein_id="ABP77818.1"
FT                   /translation="MARPSANPQCRASQVRWRTFFLPCSRPLAMRVPRHAMNRRPRSLA
FT                   APGLTIAMQPIRWHFRERRMTQRYVINASVSPKGSLETLSQREVQQLSEVGSGRTHKLF
FT                   RQCALAILNTGTRIDNAKTILEAYEDFEVRILQQDRGVRLELFNAPADAFVDGEMIAST
FT                   REMLFSALRDIVYTESELSSARIDLDSSQGITDYVFHLLRNARTLRPGVEPNMVVCWGG
FT                   HSISTEEYKYSKRVGHELGLRSLDVCTGCGPGVMKGPMKGATIGHAKQRRVGSRYLGLT
FT                   EPGIIAAEAPNPIVNELVILPDIEKRLEAFVRVGHGIIIFPGGVGTAEEFLYLLGILLH
FT                   PANRDVPFPVILTGPSDAADYLQQLHDFVGATLGEEAQQRYQIIFNDPTEVARQMTEGL
FT                   REVRRFRRERNDAFHFNWLLKIEEGFQRPFDPTHEAMANLQLRRDLPAHELAANLRRAF
FT                   SGIVAGNVKDKGIRRIEQYGRYEIHGDAAIMQPLDKLLQAFVEQHRMKLPGGVPYTPCY
FT                   RVVT"
FT   gene            complement(131670..132623)
FT                   /gene="thrB"
FT                   /locus_tag="PST_0112"
FT   CDS_pept        complement(131670..132623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="PST_0112"
FT                   /product="homoserine kinase"
FT                   /note="Code: R; COG: COG2334"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77819"
FT                   /db_xref="GOA:A4VFR8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR8"
FT                   /protein_id="ABP77819.1"
FT                   /translation="MSVFTPLQRDELEAFLAPYRLGRLRDFQGIAAGSENSNFFISLEQ
FT                   GEYVLTLIERGPRQDLPFFIELLDVLHRAGLPVPYALRTEQGEALRELAEKPALLQPRL
FT                   PGKHVVEPNPHHCAEVGRLLARLHLATRDHILERASDRGLDWMQEQGPSLALSLPEDQL
FT                   PLLRDGLAEIAELRPKLLALPRANLHADLFRDNVLFEGSHLTGVIDFYNACSGPMLYDL
FT                   AIAVNDWCSHPNGEIDGERSEPLLAAYSALRRFTPAEAELWQPMLRVACVRFWLSRLIA
FT                   AQRHEGKADVQVKDPGEFHRLLAARQRPQSVLPFAF"
FT   gene            complement(132648..132971)
FT                   /locus_tag="PST_0114"
FT   CDS_pept        complement(132648..132971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77820"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFR9"
FT                   /protein_id="ABP77820.1"
FT                   /translation="MRRTTYRQRDKVTMRALKHLMLASLLACAPLAGFAQESVEGEPDV
FT                   TIRQEGDRTVEEYRVNGFLYAVKVTPKHGKPYFLVRADGNDGNFVRSDQPDMLIPAWKI
FT                   FSW"
FT   gene            132958..135753
FT                   /gene="polA"
FT                   /locus_tag="PST_0113"
FT   CDS_pept        132958..135753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="PST_0113"
FT                   /product="DNA polymerase I"
FT                   /note="Code: L; COG: COG0749"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77821"
FT                   /db_xref="GOA:A4VFS0"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS0"
FT                   /protein_id="ABP77821.1"
FT                   /translation="MVLRILAPGPPKRLIPLMSQAPLVLVDGSSYLYRAFHALPPLTTS
FT                   TGKPTGAVKGVLNMLLSLRRQYPDSPFAVVFDAKGPTFRDALFENYKSHRPPMPDDLRV
FT                   QVEPLHASVRALGLPLLCVEGVEADDVIGTLARQCAALGRDVVISTGDKDMAQLVCPHV
FT                   TLVNTMTGSVYDIEGVKAKFGVGPELIIDFLALMGDKVDNIPGVPGVGEKTACGLLNGI
FT                   PGGLKGLYEHLDQVAGLPIRGAKSLGAKLEEHRDAAFMSYELATIKIDVALDVEVGDLM
FT                   PGEPHREALIALYRELEFKQWLDELLREAKAAGENCEVQPEGCSIQAEAQYETLLEQAD
FT                   FERWLARLKAAECFAFDTETTSLDAQRAELVGVSFAVEPGQAAYVPLRHSYMGVPQQLE
FT                   LDAVLSALKPLLEDPAKTKICQHGKYDMNVLMHYGIEMRGMAFDTMLESYVLDATATRH
FT                   DMDSLALKYLGRGTIRFEDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTLRLHQTLLGK
FT                   LEQTPSLLKVLTEIEMPLVPVLARIERNGALVDAQLLGQQSVELGDKLVQLEREAFDIA
FT                   GEEFNLGSPKQLCAILYDKLGCPVISKTAGGQPSTAESVLAELAEQDYPLPKVIMQHRS
FT                   LSKLKGTYTDKLPQQINPRTGRIHTSYHQAVTATGRLSSSDPNLQNIPIRTAEGRRIRQ
FT                   AFVAAPGYKLLAADYSQIELRIMAHLAQDAGLLHAFQNDLDVHRATAAEVFGVPLEQVS
FT                   NDQRRSAKAINFGLIYGMSAFGLAKQIDVGRKEAQEYIDRYFARYPGVLAYMERTRTQA
FT                   AEQGYVETLFGRRLYLPEINSKNGAMRKGAERTAINAPMQGTAADIIKRAMIAVDGWLQ
FT                   DSGLDARVILQVHDELVLEVREDLVEQVREAICPLMSGAAQLDVPLLVEAGVGNNWDEA
FT                   H"
FT   gene            complement(136037..137989)
FT                   /locus_tag="PST_0115"
FT   CDS_pept        complement(136037..137989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77822"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS1"
FT                   /protein_id="ABP77822.1"
FT                   /translation="MTRLGAWLLASGLSLASIAAHAELRLVLDSRTLDAEQRAASQALL
FT                   DEAMAALPPRLVQSLDREVRVQWRDNLPEQAYGRAGGKRLELNRRLLPALTDGSAAEEK
FT                   TNRPHGTVRRELLATVIHEVAHLYDRARLWSPDQHLLQGHCRQRASNLGQIGLPDDCRG
FT                   QTDRRFTLSDDPRLLDLAGWPQRVGKRGLREQDNAQLARSPDPYELTSPLEFVAVNLEY
FT                   FLLDPSYACRRPSLHRYFSEHFGWAPEPADCTPGYPFLNAGREFGRTPLLSLDPARVYE
FT                   VDYLFAEANDAWVSRWGHSMLRLVICAPGREPGPACRLDLDHHLVLSFRAFVDDVQLSS
FT                   WDGLTGVYPSRLFILPLGQVIDEYTKVELRGLASVPLRLHPEEIRQLVERSAELHWSYD
FT                   GDYYFLSNNCAVETLKLLRSGTARSDLVALDSIMPNGLLEVLIYRGLADASVLDDAREA
FT                   LRLGYRFDSYRDRYQAMFAVLKERLGLPQHSVEQWLELDAAERQLWIDRADLRAAAALL
FT                   LVEQAALRRQLLLAQDELKNRYLGGRGRDASLNKADGALQEILASSGYLSRPAELLDGD
FT                   GYGLPQTREWTRLERESEQRQLRLNQLTEELDQEVRVLLGDERREELEAIEVNLAQIGE
FT                   RLRGLHKAGGGLELP"
FT   gene            complement(137986..138333)
FT                   /locus_tag="PST_0116"
FT   CDS_pept        complement(137986..138333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77823"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS2"
FT                   /protein_id="ABP77823.1"
FT                   /translation="MPRPVRDSSMNKLLLAAPLALAVAAGTAQAQTLVATSNIVVRALD
FT                   RSINFTSDVTSRISDMKVVVEAREDAASFVASAGEIRGAHLEAAIGSLRSEFPAARNAS
FT                   DLQLAEAILAL"
FT   gene            complement(138349..138645)
FT                   /locus_tag="PST_0117"
FT   CDS_pept        complement(138349..138645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0117"
FT                   /product="holliday junction resolvasome, helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77824"
FT                   /db_xref="GOA:A4VFS3"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS3"
FT                   /protein_id="ABP77824.1"
FT                   /translation="MRSFSIALLLFGCSAGSAMAFDVTTAAVVRTSYVSSQLTSAPFDN
FT                   KLIAEAREDAAGFVASEGQLVAARLQAALSRLRQEHPELAASDLELAEAILVQ"
FT   gene            complement(138754..139071)
FT                   /locus_tag="PST_0118"
FT   CDS_pept        complement(138754..139071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77825"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS4"
FT                   /protein_id="ABP77825.1"
FT                   /translation="MSRILLPFLAAGLLLSGAASAASFTATTDVVVGGLINTVDATSDL
FT                   TSSLRDDKLVLDARDDAARFVASRGDLRGAHLEAALQHIRSQQPQLQASDLQLAEAILA
FT                   L"
FT   gene            complement(139533..140333)
FT                   /locus_tag="PST_0119"
FT   CDS_pept        complement(139533..140333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0119"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Code: K; COG: COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77826"
FT                   /db_xref="GOA:A4VFS5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS5"
FT                   /protein_id="ABP77826.1"
FT                   /translation="MSRKGQASLAQRSIPVMDALPRPLFARSESLAERTTTPRHSHPWA
FT                   QLSYAISGVLRVHTERGRFLAPPQRAILIPPGLLHEVISSPQTEMRSLYIDQRAMPWAP
FT                   AHCQVLAVSPLLRELIRAFGTLPVDYDEQGADGRLAAVILDQLRAAPELGYSLPWPDDV
FT                   RLRGICETLYEQPDLSFSLAQWSEQLHISEKTLTRQFQRDTGLSFRAWRQRLRLLSALP
FT                   LLERGQPVTDVALACGYDSTSAFIAAFGQQFGTTPGALTRSPRP"
FT   gene            140422..141411
FT                   /locus_tag="PST_0120"
FT   CDS_pept        140422..141411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0120"
FT                   /product="transporter, bile acid/Na+ symporter family"
FT                   /note="Code: R; COG: COG0385"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77827"
FT                   /db_xref="GOA:A4VFS6"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS6"
FT                   /protein_id="ABP77827.1"
FT                   /translation="MARPRLLPDNFTLALLGAVAIATLLPARGQGVVVFEWITNLAIGL
FT                   LFFMHGAKLSGSAILAGMGHWRLHLLVFSCTFVLFPLLGLALRPLLTPMIGAELYLGML
FT                   YLCALPATVQSAIAFTSLARGNIPAAVCSAAASSLIGIFLTPLLVLLLMGAQGEGGSTL
FT                   DAIGKIVVQLLLPFIAGQIARRWIGDWVARNKGWLKNVDQSSILLVVYTAFSHAVVEGI
FT                   WQQVPLPQLLGLVLACCLLLALALLSTWLIARWLGFDLEDRITILFAGSKKSLATGIPM
FT                   AQVLFAGGALGTLILPLMLFHQIQLMVCAVLAQRYASRPETATVAKAG"
FT   gene            141533..142123
FT                   /locus_tag="PST_0121"
FT   CDS_pept        141533..142123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0121"
FT                   /product="oxidoreductase, putative"
FT                   /note="Code: R; COG: COG2249"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77828"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS7"
FT                   /protein_id="ABP77828.1"
FT                   /translation="MKKILLLNGGKAFAHSAGQYNATLHQAAIETLMAAGFEVRTTEID
FT                   AGYDVQQEVEKILWADALIYQMPGWWMGAPWTVKKYLDEVFTAGHGSLYANDGRTRSDA
FT                   SQKYGSGGLLQGKRYMISATWNAPQQAFDDPSDFFAGKGVDSVYLPFHKANEFLGMQGL
FT                   PTFLCVDVMKRPQVEADVERYRRHLGEVFGFSV"
FT   gene            complement(142193..143623)
FT                   /gene="pntB"
FT                   /locus_tag="PST_0122"
FT   CDS_pept        complement(142193..143623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PST_0122"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /note="Code: C; COG: COG1282"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77829"
FT                   /db_xref="GOA:A4VFS8"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS8"
FT                   /protein_id="ABP77829.1"
FT                   /translation="MNLITLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGIAVLT
FT                   TVGLIFKLGSELATAGIGYVIVGLLIGGSVGTVMAKRVEMTKMPELVAFMHSMIGLAAV
FT                   FIAIAAVVEPQSLGIVEQIGYAIPVGNRLELFLGAAIGAITFSGSVIAFGKLSGKYKFR
FT                   LFQGAPVVFKGQHMVNLAVGLAIIGLGLVYTFTGNLTAFAILVALAFVIGVLIIIPIGG
FT                   ADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFFNV
FT                   ILGGFGADADAGGPAGAQLERNVKSGSADDAAFLLTNADTVIIVPGYGLAVARAQHALM
FT                   ELAEKLMHMGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINSEFGQADVVL
FT                   VLGANDVVNPAAKTDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYMDKTM
FT                   MVFGDAKKVVEDMVKAVD"
FT   gene            complement(143633..143950)
FT                   /gene="pntAB"
FT                   /locus_tag="PST_0123"
FT   CDS_pept        complement(143633..143950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAB"
FT                   /locus_tag="PST_0123"
FT                   /product="NAD(P) transhydrogenase, alpha subunit part 2"
FT                   /note="Code: C; COG: COG3288"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77830"
FT                   /db_xref="GOA:A4VFS9"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFS9"
FT                   /protein_id="ABP77830.1"
FT                   /translation="MDLISDGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKDRSAAKAEG
FT                   K"
FT   gene            complement(143964..145085)
FT                   /gene="pntAA"
FT                   /locus_tag="PST_0124"
FT   CDS_pept        complement(143964..145085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAA"
FT                   /locus_tag="PST_0124"
FT                   /product="NAD(P) transhydrogenase, alpha subunit part 1"
FT                   /note="Code: C; COG: COG3288"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77831"
FT                   /db_xref="GOA:A4VFT0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT0"
FT                   /protein_id="ABP77831.1"
FT                   /translation="MHIGVPLETHSGETRVAATPETVKKLIGQGHRVTLQSGAGLLSSV
FT                   PDSAYEAVGATIGDAAAAFAAELVLKVNAPDDAELAQMQSGSVLLGMLNPFDNDCIARM
FT                   AARGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLVGAHHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVVEASDVRPAVKEQIESLGAKFVDVPLETDEERE
FT                   CAEGVGGYARPMPASWMARQAQAVHERALQSDIVITTALIPGRKAPTLLQEATVEQMKP
FT                   GSVIVDLAAGHGGNCPLTEIDQVVVRHGVTIVGHANLATLVPADASALYARNLLDFLKL
FT                   VIDKDGQFQLNLEDDIVAACLMCRDGQVVRTNG"
FT   gene            145398..147119
FT                   /gene="xcpR"
FT                   /locus_tag="PST_0125"
FT   CDS_pept        145398..147119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpR"
FT                   /locus_tag="PST_0125"
FT                   /product="general secretion pathway protein E"
FT                   /note="Code: NU; COG: COG2804"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77832"
FT                   /db_xref="GOA:A4VFT1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT1"
FT                   /protein_id="ABP77832.1"
FT                   /translation="MNDAPLTWYSSAVPGVCDLGAGLSRLIRKNARTLKCHPILVVQLG
FT                   WLDPIGVFRARRRRVVAYRRWSCTMPELDVNDVTTLLEQPAQRRLPFAFARRHGVLLLE
FT                   RGGELRLALREGAALTAVQEAQRVVGMRLPMQWLAQADFDQALGAAYQHDSSAAMLMVE
FT                   GLGNDLDLASLADQIQETEDLLEQEDDAPIIRLINAILGEAIAENASDIHIETFEKRLV
FT                   IRFRVDGILREVVQPKRELAALLVSRIKVMAKLDIAEKRIPQDGRISLRVGGREVDIRV
FT                   STLPSANGERVVLRLLDKQAGRLTLRHLGMNEQDRRQLEQAVKKPHGIILVTGPTGSGK
FT                   TTTLYAALTTLNDRTRNILTVEDPIEYHLEGIGQTQVNTKVDMTFARGLRAILRQDPDV
FT                   VMVGEIRDQETADMAVQASLTGHLVLSTLHTNSAIGAVTRLVDMGVEPFLISSSLLGVL
FT                   AQRLVRVLCNDCKRAYIADAAECELLGVSPAEAPTLYHAEGCEQCRGLGYRGRTGIYEL
FT                   VLFDDTLRTMVHTRASEQDMLRHARELGPSIREDGLRKVREGVTTIEEVLRVTREE"
FT   gene            147270..148484
FT                   /gene="xcpS"
FT                   /locus_tag="PST_0126"
FT   CDS_pept        147270..148484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpS"
FT                   /locus_tag="PST_0126"
FT                   /product="general secretion pathway protein F"
FT                   /note="Code: NU; COG: COG1459"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77833"
FT                   /db_xref="GOA:A4VFT2"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT2"
FT                   /protein_id="ABP77833.1"
FT                   /translation="MAAFEYLALDPRGREQKGLIEADSPRQARQLLREKQWAPLEVKQA
FT                   NSKEDVSRGGFSFGRGLSARDLALVTRQLATLVQAALPIEEALRAAAAQSTSAKIKSML
FT                   LAVRARVMEGHSLAAALREYPSAFPELYRATVAAGEHAGHLGLVLDQLADYTDQRQQSR
FT                   QKIQLALLYPVILMVASLAIVVLLLGYVVPDVVKVFVNTGQELPALTRGLIATSDVVKN
FT                   WGWLIVLGLIGAFLAMRAALRDPALRLRWHAFILRIPLIGRLSRATNTARFASTLAILT
FT                   RSGVPLVEALSIAAAVIANLRIRERVVEAAQKVREGSSLTRALDATGEFPPMMLHMIAS
FT                   GEKSGELDQMLARTARNQENDLAAQVSLLVGLFEPFMLVFMGAVVLVIVLAILMPILSL
FT                   NQLVG"
FT   gene            148490..148930
FT                   /gene="xcpT"
FT                   /locus_tag="PST_0127"
FT   CDS_pept        148490..148930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpT"
FT                   /locus_tag="PST_0127"
FT                   /product="general secretion pathway protein G"
FT                   /note="Code: NU; COG: COG2165"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77834"
FT                   /db_xref="GOA:A4VFT3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT3"
FT                   /protein_id="ABP77834.1"
FT                   /translation="MTTRLQRRTQGGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKV
FT                   TVAKGDIKAIAAALDMYKLDNFAYPSTQQGLDALVKKPSGNPQPKNWNRDGYLKRLPKD
FT                   PWGNDYQYLSPGTQGQFDLYSFGADGKPGGSDLNADIGNWDL"
FT   gene            148934..149503
FT                   /gene="xcpU"
FT                   /locus_tag="PST_0128"
FT   CDS_pept        148934..149503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpU"
FT                   /locus_tag="PST_0128"
FT                   /product="general secretion pathway protein H"
FT                   /note="Code: NU; COG: COG2165"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77835"
FT                   /db_xref="GOA:A4VFT4"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT4"
FT                   /protein_id="ABP77835.1"
FT                   /translation="MRQRARAFTLIELLVVIVLLGILVSVAVLSVGGSSTSRELRDEAR
FT                   RLAALIGVMSDEAVLDSREYGLLINSEGYRVLRYDETAMRWLEVERRKTHKVPAWMRLD
FT                   LELDGTPLELVAPTRREDDRAGLSREGERTERRAPQLEPQLLILSSGELSPFSLRLSER
FT                   KPGGGTWLIASDGFRLPEAEPLGERR"
FT   gene            149500..149916
FT                   /gene="xcpV"
FT                   /locus_tag="PST_0129"
FT   CDS_pept        149500..149916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpV"
FT                   /locus_tag="PST_0129"
FT                   /product="general secretion pathway protein I"
FT                   /note="Code: NU; COG: COG2165"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77836"
FT                   /db_xref="GOA:A4VFT5"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT5"
FT                   /protein_id="ABP77836.1"
FT                   /translation="MRVSLARAGRGFTLLEVLVALAIFASVSAVVLTAAGRSLSNAGRL
FT                   EELTLAGWIADNRISELQLQQVPPAIGRETRELEFGGRQWQTLSEVEASADPGLLRVTV
FT                   WVALQTPRARSDSLAERAVTSLTGFIGVEPGAAP"
FT   gene            149916..150629
FT                   /gene="xcpW"
FT                   /locus_tag="PST_0130"
FT   CDS_pept        149916..150629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpW"
FT                   /locus_tag="PST_0130"
FT                   /product="general secretion pathway protein J"
FT                   /note="Code: U; COG: COG4795"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77837"
FT                   /db_xref="GOA:A4VFT6"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT6"
FT                   /protein_id="ABP77837.1"
FT                   /translation="MIDRMRADAGFTLLELLIAIALFALLGLGTYRMLEAVLQSDEAVR
FT                   AQEQQLRELSRAVWAFERDLQQVVGRPIRDGFGDERNAFIGQLGGDDGAPVLELTRAGW
FT                   RNPTGLRRANLQRVRWRLAGQNLERVYWVVLDRDLDSEPRVQRVLENVQGLQLRYLDEE
FT                   AVWHEEWPPFDFGRGSPENAAERLPVALELSVDHARYGRISRLLRLPDAAEQTMQQALP
FT                   GAEGVPEPFEGELPQ"
FT   gene            150626..151615
FT                   /gene="xcpX"
FT                   /locus_tag="PST_0131"
FT   CDS_pept        150626..151615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpX"
FT                   /locus_tag="PST_0131"
FT                   /product="general secretion pathway protein K"
FT                   /note="Code: U; COG: COG3156"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77838"
FT                   /db_xref="GOA:A4VFT7"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT7"
FT                   /protein_id="ABP77838.1"
FT                   /translation="MSRQRGVALITVLLVVAIVTVVSAAMMARQQLSIRATSNQLQARQ
FT                   AWHYALGGEALAQAILARDLRTGATGEPGASGEAAAVDHLLEPWAQPLPAFEIDQGEIL
FT                   VRIEDMAGRFNLNDLLRDQQPNTAAVEQFRRLLLRLQISAPYAERLVDWLDPDQQPSGE
FT                   FGAEDNAYLALDPPYRNAGRRLHDLSELRLLLDMREEDFQRLAPYVAALPPNVPLNVNT
FT                   ASAMVLSSLSDNLSLGAAESLVELRRVAPFRNSAAFLAQPAMAGTTLQGTALAVGSQFF
FT                   QATSEVRLGDRRLALVSLLQREQDGSVRVLARNLGQPARLASPNRSRP"
FT   gene            151816..152748
FT                   /gene="xcpY"
FT                   /locus_tag="PST_0132"
FT   CDS_pept        151816..152748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpY"
FT                   /locus_tag="PST_0132"
FT                   /product="general secretion pathway protein L"
FT                   /note="Code: U; COG: COG3297"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77839"
FT                   /db_xref="GOA:A4VFT8"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT8"
FT                   /protein_id="ABP77839.1"
FT                   /translation="MQQALAYAAEELLAENVDELHLAVGETLPDGRQRVVAIRRQLLAG
FT                   WLEQLRELGLLIVAIHVDADLLPREATQLLFIGERGLLGGEGETRLAFATVDWPQLATL
FT                   CPAPWHAQGNVAEPPLALDDYRQLDDPYAFLAAQRSAALNLAQGDFAVEVGNTGLGYWK
FT                   PLFAVAGLILLVQLGFNLGQAWYFQRQGDAYAEASLALYRELFPEDIRIVNMRAQFDDH
FT                   LARGSGGQAGFLRLLDHAAAALEDGIPVTIGQLDYNQDRGDLALQVQAMDFATLETLRR
FT                   RLGDARQSVQLGSASREGDGVSARVVIGG"
FT   gene            152751..153266
FT                   /gene="xcpZ"
FT                   /locus_tag="PST_0133"
FT   CDS_pept        152751..153266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpZ"
FT                   /locus_tag="PST_0133"
FT                   /product="general secretion pathway protein M"
FT                   /note="Code: U; COG: COG3149"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77840"
FT                   /db_xref="GOA:A4VFT9"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFT9"
FT                   /protein_id="ABP77840.1"
FT                   /translation="MNLKQQLAVRLADSPLWQRWQRLAPRERTSLSLLGAFLLAVLFYL
FT                   WLWLPAQRQAAEARDYYQAQRELHAYMEQNTELARQMERSNQVELAPEQLQGVITESAQ
FT                   QGNLSIESFDNGSDGSLQVSLPGASYALLLRWFDTLQGQGVSVTEVSLERAGEGLVNAR
FT                   VSFRAGNG"
FT   gene            complement(153304..154707)
FT                   /locus_tag="PST_0134"
FT   CDS_pept        complement(153304..154707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0134"
FT                   /product="probable signal transduction protein"
FT                   /note="Code: T; COG: COG1639"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77841"
FT                   /db_xref="GOA:A4VFU0"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014627"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU0"
FT                   /protein_id="ABP77841.1"
FT                   /translation="MNTAVDTESCSELPLLITKLLKDLGVDYQIQRDRPNIPAAQRVQA
FT                   VLLDDSIGAMLVLFPQDHLLDLTRLTELTGRELAAVKPERLARMLAKHELSRLPGLPPL
FT                   TSSPCLYEERLLQQPRLLVESGQPGLLVEVAGADFKRLLSKASAGNFAVPLSDIRPNLD
FT                   RPHDDRAEITQAVQSFTARRIQKRLEETIEIPPLPHTAQKIIKLRVNPEATVDDITGVV
FT                   ETDPALAAQVISWAASPYYAAPGRIRSVEDAIVRVLGFDLVINLALGLALGKTISLPND
FT                   KPQDATPYWQQAIYTAAVIEGLTRAIPREQRPEPGLSYLAGLLHNFGYLVLAHVFPPHF
FT                   SLICRHLEANPHLSHGHVEQHLLGITREQIGAWLMRLWGMPEELAAALRFQNDPGYDGE
FT                   DAAYPNLVCLAVRMLRNRGIGSGPDAEVPQQLFDRLGITREKANDAIAKVLAAEAALRA
FT                   LAMQFNPSH"
FT   gene            complement(154783..156855)
FT                   /gene="recG"
FT                   /locus_tag="PST_0135"
FT   CDS_pept        complement(154783..156855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="PST_0135"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="Code: LK; COG: COG1200"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77842"
FT                   /db_xref="GOA:A4VFU1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU1"
FT                   /protein_id="ABP77842.1"
FT                   /translation="MSELATIPVTALKGVGAALAEKLARVGLETLQDVLFHLPLRYQDR
FT                   TRVVPIGSLRPGQDAVIEGIVAGADIVMGRRRSLLVRLQDGSGTLSLRFYHFSQAQKEA
FT                   MKRGTQLRCYGEARPGASGLEIYHPEYRALTGEPAPVEQTLTPIYPTTEGLTQQRLRNL
FT                   SEQALSRLGPHSLPDWLPAELAREYRLGPLDQALRYLHRPPPDADLEELAEGRHWAQHR
FT                   LAFEELLTHQLSLQRLRERVRAQQAPQLPPAKRLPQRFLANLGFSPTGAQQRVGAEIAY
FT                   DLAQDEPMLRLVQGDVGAGKTVVAALAALQALEAGYQVALMAPTEILAEQHFLNFSKWL
FT                   EPLGIEVAWLAGKLKGKARAAALEQIAGGCPMVVGTHALFQDEVAFKRLALVIIDEQHR
FT                   FGVQQRLALRQKGIDGRLCPHQLIMTATPIPRTLAMSAYADLDTSILDELPPGRTPVNT
FT                   LVIADSRRLEVIERVRIACNEGRQAYWVCTLIEESEELTCQAAETTFEDLSAALVGLRV
FT                   GLIHGRMKPAEKAAVMEQFKRGELQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLH
FT                   QLRGRVGRGSAASHCVLLYHPPLSQLGRERLAIMRETCDGFLIAEKDLELRGPGEMLGT
FT                   RQTGLLQFKVADLMRDAELLPAVRDAAQELLTRWPQHVSPLLERWLRHGQEYGQV"
FT   gene            complement(156860..157789)
FT                   /locus_tag="PST_0136"
FT   CDS_pept        complement(156860..157789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0136"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77843"
FT                   /db_xref="GOA:A4VFU2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU2"
FT                   /protein_id="ABP77843.1"
FT                   /translation="MLTMTLTELRYIVTLAQEQHFGRAAERCHVSQPTLSVGVKKLEDE
FT                   LGVLIFERTKSAVRLTPVGEGIVTQAQKVLEQAQSIRELAQVGKNQLAAPLKVGAIYTV
FT                   GPYMFPHLIPQLHRVAPDMPLYIEENFTHVLRDKLRTGELDAIIIALPFQEADVLTKPL
FT                   YDEPFYVLMPADHPWTAKETIDAEMLNDKSLLLLGEGHCFRDQVLEACPTVRKGEAASH
FT                   TTVESSSLETIRHMVASGLGVSILPLSAVESHHYSPGVLEIRPLTPPVPFRTVAIAWRA
FT                   SFPRPKAIEILADSIRLCSVGKPPSAKA"
FT   gene            157912..158772
FT                   /locus_tag="PST_0137"
FT   CDS_pept        157912..158772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0137"
FT                   /product="epimerase/dehydratase-related protein"
FT                   /note="Code: MG; COG: COG0451"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77844"
FT                   /db_xref="GOA:A4VFU3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU3"
FT                   /protein_id="ABP77844.1"
FT                   /translation="MGKRLSVLIAGCGDVGSRLGLQLGRDGWRVYGLRRNAAELPVPIL
FT                   PVKGDLTDPTCPRCWPNGGLDYLVYAASATEHDEAGYRQAYVEGLRNVLRWLRQHEQQP
FT                   RRLLFVSSTGVYAQRDGEWIDEDSPTEPTGFTGQVMLEAEQLALGCGLPATCVRMGGLY
FT                   DPSRPWLQNQVRAGLRVERDPPQYSNRIHRDDAAALLSFLLQADASGTALQSCYLGVDD
FT                   EPAPLHEVVDWLRERLGVTHWAEQSMTRRAGSKRCSNARARALGWKPRFASYRDGYASL
FT                   GRNRH"
FT   gene            158956..160128
FT                   /locus_tag="PST_0138"
FT   CDS_pept        158956..160128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0138"
FT                   /product="zinc-containing dehydrogenase"
FT                   /note="Code: ER; COG: COG1063"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77845"
FT                   /db_xref="GOA:A4VFU4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU4"
FT                   /protein_id="ABP77845.1"
FT                   /translation="MRALRWHGKHDIRCDNHVPDPSIEDPRDAIIKVSSCAICGSDLHL
FT                   YDGFMPGMQHGDIMGHEFMGEVMEVGSANKKLKVGDRVVVPFTIVCGECDQCRRGNFSV
FT                   CERTNRNKDIADKVFGHTTAGLYGYTHLTGGYAGGQAEYVRVPYADVGPVVIPNGLTDE
FT                   QVLFLGDILPTGWQAAAQCDIQPTDTVAIWGAGPVGQFAIRSAIMMGAEQVICIDNVPE
FT                   RLSMARAGGAITINFDEESVLERLKELTRGKGPEKCIDSVGMEAHAARSIDSMYDRAKQ
FT                   ALMLESDRPHVLREMIYVCRPAGIISIPGVYGGLIDKIPFGAAMNKGLTFRMGQTHVNR
FT                   WTDDLLNRIQEGQIDPSFVITHSVSLEQGPEMYKTFRDKHDGCIKVVLKP"
FT   gene            160188..160706
FT                   /locus_tag="PST_0139"
FT   CDS_pept        160188..160706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0139"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77846"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU5"
FT                   /protein_id="ABP77846.1"
FT                   /translation="MSIPRQVTRPNHLARSLARGLGWFSIGLGVVQLVAPRQVARFIGM
FT                   PGSDGVIRACGLREIATGVGILLADDPKPWIYGRIGGDALDLAGLGWSIEHGNEPANAA
FT                   IAAGAVAGITALDLSCAKGLDAERVPAVEWDYSDRSGFPAGTQQARGCVEAEFAAARAE
FT                   PNGYSPSLH"
FT   gene            160825..161757
FT                   /locus_tag="PST_0140"
FT   CDS_pept        160825..161757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0140"
FT                   /product="putative membrane protein"
FT                   /note="Code: R; COG: COG0679"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77847"
FT                   /db_xref="GOA:A4VFU6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU6"
FT                   /protein_id="ABP77847.1"
FT                   /translation="MSSVINVVLPVFALILLGYLCRRSGRMGPTGASELNRFVVWLGLP
FT                   ALLFSVVATSTWEQLWQPGFIAAFAIGCLGVFAFTLAYRLLQKQPLVDASLDALGASYA
FT                   NTGYVGIPLCMLVLGDEALQPAMVASIIVVCVLFAIALACVETGLHAGQGLLRTLGKVS
FT                   GALVRNPLVIAPMLGALWAAGGVQLPVPLATLLKLLGAAAAPCALVSLGLFLAQPQPAG
FT                   RVQGVWPLVGLKLVVQPLITWYLAFQVFELPTLWAYSALLLSALPTGTGPYMLAEFYGR
FT                   EGSRVSRVVLYSTLGSLLTLSLILLLLPV"
FT   gene            complement(161828..162775)
FT                   /locus_tag="PST_0141"
FT   CDS_pept        complement(161828..162775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0141"
FT                   /product="modification methylase, HemK family"
FT                   /note="Code: J; COG: COG2890"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77848"
FT                   /db_xref="GOA:A4VFU7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU7"
FT                   /protein_id="ABP77848.1"
FT                   /translation="MTMDTAQDRALLHLGQALRDRGYHFITPTPLTHERVNQRPENALA
FT                   DDLHGVFGWSRPFQHELLPGPLFSLMDQAQVLEACGSRWRSKVRLSSLDGQLFLHSAFP
FT                   TNASDAVFFGPDTYRFANAIRCHLNQHTGMIRRAVDIGCGSGAGAILTALARPQAEVLA
FT                   VDINPEALRLTHINAALAGADNLRALHSDLLSAVDGEFDLILANPPYLVDADQRAYRHG
FT                   GGPLGAGLSLAILDAALQRLAPGGTLLLYTGVAMLDNQDPFLAEVRRRLQGGATSWTYR
FT                   ELDPDVFGEELLGGAYVKCDRIAAVVLEVTRPAS"
FT   gene            complement(162799..164220)
FT                   /locus_tag="PST_0142"
FT   CDS_pept        complement(162799..164220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77849"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU8"
FT                   /protein_id="ABP77849.1"
FT                   /translation="MQLTSRSLPITPAITPEPDQPSRALYFALVREVDEHARENAADYL
FT                   RTQLEAAAALPCDLPADPADLDAWVLQRTEAVGHQYQAYLEQRRAGGPRRYFPSKAHAL
FT                   HFLRGVAPTKLVDGAWLYGLLQRWDDARFTALIQTYLEELGDGLPEKNHVVLYRKLLAS
FT                   QGCDDWQELDDEHFVQGAIQLALAEHAEQFLPEIIGFNLGYEQLPLHLLITSYELTELG
FT                   IDPYYFTLHVTVDNADNGHAKKAVQGLLDAWPQVGDSAEFYRRVRDGYRLNDLGASTVS
FT                   VIGNFDLGREVQRIFEKKAAVGQFVHSDYCRFEGRTVNQWLGEDVEQFLAVLDKRGWIK
FT                   RGHDPQESRFWQLIVGEQAPMFGVFSAYEQQMIHDWIADDWQADGKRSPRGALLQRQAL
FT                   FNGRRAASAPAMPQPAEHVSGNDFDEELQLLEQQVARLPDRAARMRLLLPLLAPQRHHS
FT                   AAGLLATRLFNGLFN"
FT   gene            complement(164739..165932)
FT                   /locus_tag="PST_0143"
FT   CDS_pept        complement(164739..165932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0143"
FT                   /product="3-carboxymuconate cyclase"
FT                   /note="Code: G; COG: COG2706"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77850"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFU9"
FT                   /protein_id="ABP77850.1"
FT                   /translation="MTSSTKGKRPMRLRLALALLTGALLANGAQAESNDMQILIGSYTH
FT                   DSDSPGVLRLRFDPSQGRLEPEPLQALTSHNPSWLVLDERRGRLYATHENGPAHADPVG
FT                   RVGAWQRDAKGDYQPIGQAISLGDEPTHASLSADGRYLFVSNYGSRPNPGGSLAVLPLD
FT                   EDGRPLPVTQIAAHQASGVHPERQASPHVHSAVPSPDGTRLLVSDLGADRVFVYRYDPS
FT                   HAERPLRPDEPASIELPAGSGPRHLVFHPNGKHAYLALELSAQVAGFDYTNGTLTRRQL
FT                   LDLKESDSEVRHSPGAIHTSADGRFLYVSDRGDYNHIIVFAIEADGTLREIQRRPSEGR
FT                   EPREFAITPDGRFMLIANQLSDALVVIRRDPESGKLGETLQTLAVGRPSDIKLLTPN"
FT   gene            165956..167218
FT                   /locus_tag="PST_0144"
FT   CDS_pept        165956..167218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0144"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77851"
FT                   /db_xref="GOA:A4VFV0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV0"
FT                   /protein_id="ABP77851.1"
FT                   /translation="MALPTWSRRVRTRSDQNGQIFGWVDAGLPKIPGRLMDHLLPVQLV
FT                   ELQSIATDLAENVIAPLAAEVDAECRWPAHSMRALAEAGLLGLQVPVDQGGLGQGLLGL
FT                   CVLTEAIARACPSSALCYGMHCVATAVIAAKATDHQREHYLKEIAAGRHVTTLALSEQG
FT                   TGAHFYLPETRLDADGEDFIVEGTKQFVTNGGHADSYVVSTVAAGAEAGDFSCLIVDKG
FT                   GEGMHWLDAWAGFGMRGNSSRPLQLDRVRVPARNLLGEPGDQVWYVFEVVAPFFLMAMA
FT                   GTYLGIAQAALDEAGLHLHSRRYSHSGESLRDVETLQVRYGELWTDLVKTRALVREAAR
FT                   RGDAAHPEALPYILACKTEAAETAVRLANEAMTLCGGAAYRENSRAARLLRDARAGHVM
FT                   TPTTGLLKLWTGRSLLGVPLL"
FT   gene            167215..170001
FT                   /locus_tag="PST_0145"
FT   CDS_pept        167215..170001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0145"
FT                   /product="two-component hybrid sensor and regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77852"
FT                   /db_xref="GOA:A4VFV1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV1"
FT                   /protein_id="ABP77852.1"
FT                   /translation="MSDLLLDRVALLEVDDSGLHEQVARWAAAHGLQLSRLDAGALPPD
FT                   DEQPALVLLAAALPRPVTLARQLRNHWKTAQILFLSEDGEADALHRALGPAPLLGPHWS
FT                   IVNLGANPQQQLDQALASVRRRARLRTTLDRANATVHGSQSSRRPLPTAELYLHHFIDA
FT                   ARDAIVGLDRAGAVLYWSAGAAELFGLARAEVLGRTASGLPFWSPELGQALARALDCDT
FT                   TQTLQHEDAVSGRALEIVVAAVCAADGAVVGAALTLRDVSALVAERRASELHGRRLDEE
FT                   RAHLQRLFDQAPGFIAITEGPRHELKIANRAFHQLVGARELLGRPAFKAFPQLESRALS
FT                   ELLQQVYVTGRPYLGRDLAVRVRPQTGGKAERRYLNFVFQPVFSEDERVTGIFCQGHDV
FT                   TAQVLAQQALQRSSERLQELVEERTRELELSRQALYQSQKLEAIGKLTGGVAHDFNNVL
FT                   QVIAGNLQLLQPLVEEHRSAAKRVDAASSAVERGAKLARQLLAFARRQPLRPQPTNLGR
FT                   LLRDLDELLRQAIGEHIEIETVVAGGLWTTMVDPHQLEQVVLNLAINARDAMPEGGKLT
FT                   LELGNAMLDELYAGTQADVTPGQYVLLAVSDTGIGMPAEIIEQAFEPFFTTKPEGHGTG
FT                   LGLSMAYGFAKQSGGHIRLYSEPGSGTTVKLYLPRTEQPEVQALPATVGPVVGGSETIL
FT                   VVEDDLPVQATVIELLTGLGYSVLRANDAQSALSILQSGIGIDLLFTDVVMPGPLSSTE
FT                   LARQARLLQPDVAVLFTSGYTRNAVVHGGRLDPGVELLSKPYRQEDLARKVRQLLGAQH
FT                   GDDKTAPRQWVMVVEDQPQLLTLTCEMVEELGYGVRGYPDAETAAKALHEQRFDQLLLD
FT                   VNLPGRSGPEFAAEALKAQPWLRLVFVSGEGRIDSRLPARSLPKPFSFDQLAEVLRP"
FT   gene            complement(170182..171153)
FT                   /locus_tag="PST_0146"
FT   CDS_pept        complement(170182..171153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0146"
FT                   /product="putative membrane protein"
FT                   /note="Code: S; COG: COG3182"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77853"
FT                   /db_xref="GOA:A4VFV2"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV2"
FT                   /protein_id="ABP77853.1"
FT                   /translation="MPEGTPRAPVDQVAAKAVEAYPGLVPLYFFAEEDDPDVWYVKLDT
FT                   RVDTDESGSTLILSDARTAEVLGAPNFDEGFMSIMYRLHVDLYAGLAGKLFLGFMGLLL
FT                   MVAIISGVVLYAPFMRKLRFGEVRQERTARTRWLDLHNLLGIVTLVWTLAVGFTGVINT
FT                   WADLIFQAWQAEQVAALQAGKTRVLLPKDASDAPAADGSLQTAVDRVLAAAPGMAVAMI
FT                   AYPGTLRATPEHVAVMLHGDTPLTSRLSQALLVDPANGEVLEASARPWYVTALQLSEPL
FT                   HFGDYGGLPLKVLWALLDILTIVVLGSGLYLWLKRGATEVRT"
FT   gene            complement(171309..173591)
FT                   /locus_tag="PST_0147"
FT   CDS_pept        complement(171309..173591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0147"
FT                   /product="TonB-dependent ferric siderophore receptor"
FT                   /note="Code: P; COG: COG1629"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77854"
FT                   /db_xref="GOA:A4VFV3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV3"
FT                   /protein_id="ABP77854.1"
FT                   /translation="MAQALIVRRAVPFTPLTVQRPVRSAMPTLRFPRKTALLPVCLAAS
FT                   FAGSPLMAQEQLEEGAQSSAAEPVELQSVEITASADASADGLTQPYAGEQVARGGRVGI
FT                   LGNQDYMETPFTSTAYTSKLIQDQQARSVSDIVQNDPSVRVARGFGNMQELYVVRGFTL
FT                   FSDDISYNGLYGLLPRQYVAAEFIERAEVFRGASAFLNGAAPGGTGLGGAINLLPKRAP
FT                   NEPLTRMTVGANSGGQGTVAADLGRRFGEGNQFGIRLNAAKRAGETGVEDENQTLDMFA
FT                   LGLDYQGDRLRLSADVGHQYHFLDNPRPSVTPNGGIPSAPDADDNFAQPWTYSKEKQTF
FT                   GTFRAEYDFADAITGWAAAGVRDGEEQNRLSNPRATSEGSTTASRFDNHRKDRVYTGEI
FT                   GMRFRVQTGAVSHEIVTSAAMHDFEEKNAFTFFGPVIGNIYDPFAAPLPTTVTFPGGDL
FT                   SDPKRTEQVSTQSLAIADTLGFLDDRLRVTLGARRQGIETRSYAPVTGDRIDRYDAYET
FT                   TPVAGILYQLNDELSVYANYIEGLTKGDTAPAESGGQQVLNSGTSLAPYVAKQTEIGLK
FT                   YDGGNLGGSIAVFSTERPFGIVENQVFREGGEQRNRGIELSVFGEPAYGTRLLGGLTLL
FT                   DAEQKKTLNGVNDGNDAIGVPKAQANIGGEWDVPGVQGLTLTSLVVHTGKQYASASNDL
FT                   RLPSWTRLDLGARYRMTIDDRDVTFRARLDNATGRDYWASTGGYPGSNYLVLGAPRTLS
FT                   VSATVDF"
FT   gene            173813..174274
FT                   /locus_tag="PST_0148"
FT   CDS_pept        173813..174274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0148"
FT                   /product="ketosteroid isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77855"
FT                   /db_xref="GOA:A4VFV4"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV4"
FT                   /protein_id="ABP77855.1"
FT                   /translation="MNNTTRQDETAIRQLHDAFEQAIGAKDLDRIMAQYAPDVVAFDAV
FT                   GALQFKGVAEYRAHWQRCFEFCQGEGFFETHELHVDVGGELACSRMLTHCGGPNAEGEM
FT                   QTAWMRGTRVWARRDGEWKVIHEHFSMPFDMETGQVCMSSTPSATQQVG"
FT   gene            174360..174716
FT                   /locus_tag="PST_0149"
FT   CDS_pept        174360..174716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3795"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77856"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV5"
FT                   /protein_id="ABP77856.1"
FT                   /translation="MKYLCLIYYDEQRVDALTDEQWQALVARCLSCGEELRASGHMLAG
FT                   EPLQSVRTARTVRVRDGITSVVDGPFAETREQLAGFYLIEAADQREAEAIAAKIPPASL
FT                   GCVEVRPLRQLPQR"
FT   gene            174719..175960
FT                   /locus_tag="PST_0150"
FT   CDS_pept        174719..175960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0150"
FT                   /product="probable sigma-70 factor, ECF subfamily"
FT                   /note="Code: K; COG: COG4941"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77857"
FT                   /db_xref="GOA:A4VFV6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV6"
FT                   /protein_id="ABP77857.1"
FT                   /translation="MPLTGAIAAAQVEAVYRRESRRVLATLIRLLGDFDRAEEALQDAF
FT                   AAALQQWPRDGVPDNPRAWLVSTGRFKAIDALRRRARFDASLRLLAEQLEDAAEAAEVD
FT                   EMEDDRLRLIFTCCHPALPADGRVALTLREVCDLTTEEIARAFLAPPSTIAQRIVRAKA
FT                   KIRDAQLPYRVPERAELPARLESVLRVIYLVFNEGYSASAGASLTRADLCAEAIRLGRL
FT                   LYELLPDVEVAGLLALMLLHDARRAARTDACGELVRLDEQDRSLWDRQQIAEGALLVQR
FT                   ALSTRAFGPYALQAAIVAVHAEAPSAAQTDWAQIVRLYDVLLQLSPSPVVRLNRAVAVA
FT                   MRDGAEAGLLLVDELLAQGELQDYHLSHAARADLLRQLARPDEAREAYRSALRLVQLEP
FT                   ERRFLQRQLDGLDS"
FT   gene            complement(176173..177516)
FT                   /locus_tag="PST_0151"
FT   CDS_pept        complement(176173..177516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0151"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /note="Code: T; COG: COG2204"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77858"
FT                   /db_xref="GOA:A4VFV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV7"
FT                   /protein_id="ABP77858.1"
FT                   /translation="MSGQVIFIDDEAAIRQAVQQWLELSGFQVRTFSRAREALTALDRD
FT                   FPGVLISDVRMPDLDGLGLLEQLVALDADLPVIMVTGHGDVPMAVQALRQGAYDFIEKP
FT                   FTPERLLDSVRRAMDKRRLVCENRQLREQFARKGRIESQLLGVSRAMVNLRRQVLELAG
FT                   TDVNVLIRGETGSGKEQVARCLHDFSPRAGGPFVALNCAAIPETIFESELFGHESGAFT
FT                   GAQGKRIGRIEHAAGGTLFLDEIESMPLAQQVKLLRVLQEKTLERLGSNRSIEVDLRVI
FT                   SAAKPDLLEEVRGGRFREDLLYRLNVAELHIPPLRERREDIPLLFEHFASQAAQRHGRA
FT                   APPMTPGELTQLLAHDWPGNVRELINAAERHALGLSAPAPATSGGQSLAEQMEAFEAQC
FT                   LHNALQQCKGNIAEVMTQLQLPRRTLNEKMQRHGLSRSDYLPAGSCDN"
FT   gene            complement(177548..179431)
FT                   /locus_tag="PST_0153"
FT   CDS_pept        complement(177548..179431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0153"
FT                   /product="sensor histidine kinase"
FT                   /note="Code: T; COG: COG4191"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77859"
FT                   /db_xref="GOA:A4VFV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV8"
FT                   /protein_id="ABP77859.1"
FT                   /translation="MMALCLHWSRSSLWCYPEARQCATAAGFRLPSTRPFASQAMPALP
FT                   NRFRVSLIVALILVGLLLSMYWAGRLAEQRAWAERGQESQGQLELYAQAIHTQVERFRS
FT                   VPALLALDSDIQALLADPGNRQLRRQLNQRLEQQNHAAGSSVLYLLDRNGETIAASNWR
FT                   DWSSFVGNNYAFRPYFRDAVANGSGRYFAVGVTTGIPGYFLSSSVKNAAGELLGVLVVK
FT                   LELEDMQRDWVGQPGILLIADSLDIVILTNRPAWRFRYLSPLSDEVRSRLVDVRRYAEQ
FT                   TLQPLPSSQVQQLGEGSERRLVDGPDGRREYLWQRLALPEEDWTLHLLHDPQSVSASVR
FT                   SYRLAAAGVWMTLAFLLLYLAQRRKTHRVELRSRSELERLVQERTRELHTAQDELVHAA
FT                   RMAALGQMSAALAHEINQPLTALRMQLASLRLLLDSGREGEVREGLGHVEGLLERMAAL
FT                   TSHLKTFARKSPAGLQQHLALADVLEQALQLLSPRIRSEQVEVFRQVPAEARVNGDAIR
FT                   LEQVLINLLHNALDAMAERPQRRLRILCERAGDAWQLSVADNGGGIPGEQLDQVFEPFF
FT                   TTKPVGQGLGLGLAVSYGIVRDMGGTLEVSNDEQGAVFTLTLPAAEAHAAE"
FT   gene            179422..180726
FT                   /locus_tag="PST_0152"
FT   CDS_pept        179422..180726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: T; COG: COG2206"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77860"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFV9"
FT                   /protein_id="ABP77860.1"
FT                   /translation="MPSSVYCDELPPAQQGLLVRNGQPLQSRSVLLRKILVSQLRFGMY
FT                   VHGLDGSWFDHSFWRSKFLLTDPADLQALRSSGVKALWIDTGKGVDVETATPPAAEAPQ
FT                   LVSDVMPITPRPAAQSAQQCSVQEEMQRAAQVLKRSKQQVTSLFNEARLGKAVDPQQCL
FT                   PLVEQISASLARNGSALLSLARLKTKDEYTYMHSVAVCALMVALGRQLGLNEQEVQEAG
FT                   FAGLLHDIGKMAMPLDVLNKPGKLSDDEYAVMRSHPERGHAILLGAGAALPEAVLDVCL
FT                   HHHEKMDGTGYPHRLAGEQISRLARMGAICDVYDAITSNRPYKTAWDASGSLARMAQWQ
FT                   GHFDTQILHAFVRTVGIYPLGSLVRLQSGRLGVVIEHNAQQLTAPRLKLFYSTRARAAI
FT                   VPVELDLSSPQCSDRIVGREDPAAWGFSNLDALWS"
FT   gene            181021..182508
FT                   /locus_tag="PST_0154"
FT   CDS_pept        181021..182508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0154"
FT                   /product="probable sulfate transporter"
FT                   /note="Code: P; COG: COG0659"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77861"
FT                   /db_xref="GOA:A4VFW0"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW0"
FT                   /protein_id="ABP77861.1"
FT                   /translation="MLQTIKQNWFSNLRGDLLSGLVVALALIPEAIAFSIIAGVDPRVG
FT                   LYASFCIAVVIAFVGGRPGMISAATGAMALLMVTLVREHGLQYLLAATLLCGLLQIGAG
FT                   YLRLGSLMRFVSRSVVTGFVNALAILIFMAQLPELTGVTWHVYAMTAAGLGIIYLFPHV
FT                   PKLGKVIPSPLVCILSMTAVAVYFGLDIRTVGDMGELPDTLPVFLWPEVPLNLETLAII
FT                   FPYSAALAVVGLLESLMTATIVDELTDTSSDKNRECKGQGVANIVSGLFGGMAGCAMIG
FT                   QSVINVKSGGRTRLSTFVAGVVLLLMVVFLSDWVGQIPMAALVAVMIMVSIGTFSWDSV
FT                   RNLKHYPLSTNIVMVVTVVVVVFTHNLAYGVLAGVLLAAMFFANKVGHYLSIDSELDAD
FT                   PSGRRYQVVGQVFFSSADKFTAAFDFKEALSRVTIDLSRAHFWDITAVSALDKVVLKFR
FT                   REGTEVEVLGLNEASATIVDRFGVHDKPDAIDKLMSH"
FT   gene            182523..183374
FT                   /locus_tag="PST_0155"
FT   CDS_pept        182523..183374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0155"
FT                   /product="UspA-related nucleotide-binding protein"
FT                   /note="Code: T; COG: COG0589"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77862"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW1"
FT                   /protein_id="ABP77862.1"
FT                   /translation="MTHVMACIDGSPQAAAVCDCAAWASQRLGAPLTLLHVLDRRQFPV
FT                   SGDLSGIIGLGSREFLLQELATLDEKRAKLALEEGRMMLDAARQRAISAGVAEPECRQR
FT                   HGDLVETLRDLQNDTRLLVIGRQGEDSGDDIQHIGSQLESVIRTMHRPILVTVGQFTPP
FT                   RSLMLAFDGSATTLKGVEMLAASPLFKGLPIHLVMVGNEDDAVLAQLNAARDALAAGGL
FT                   EVHTAIRAGEVEPTLHAYQAEHGIDLLVMGAYGHSRIRQFFVGSTTTSMIRTTRTPLLL
FT                   LR"
FT   gene            complement(183406..184587)
FT                   /locus_tag="PST_0156"
FT   CDS_pept        complement(183406..184587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0156"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="Code: M; COG: COG2230"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77863"
FT                   /db_xref="GOA:A4VFW2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW2"
FT                   /protein_id="ABP77863.1"
FT                   /translation="MLATLLPALKDLGLPLKLQLWDGKEMDIGPAPSVTLVIKDPNLVT
FT                   QLARPSLDVLGAAYVEGHIDLLGPVEEVIYIGDVISRALSVDDFATPTREAHDKATDAE
FT                   AISYHYDLSNDFYRLWLDRDMVYSCAYFETGEEDIDQAQQAKLRLICRKLRLKPGDRLL
FT                   DVGCGWGGLARFAAREFGAEVFGITLSREQLALARERVAAEGLQDRVQLELMDYRDLPQ
FT                   DGRFDKVVSVGMFEHVGHANLPLYCQRLFGAVRPGGLVLNHGITSRHLDGRPVAHGAGE
FT                   FIDRYVFPHGELPHLVGISSCISEAGLEIVDVESLRLHYARTLQLWSERLEARLAEAQA
FT                   LVPERALRIWRLYLAGCSYGFRRDWIDLHQILATKPLPDGGHELPWTRADLYR"
FT   gene            184742..185116
FT                   /locus_tag="PST_0157"
FT   CDS_pept        184742..185116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG2044"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77864"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW3"
FT                   /protein_id="ABP77864.1"
FT                   /translation="MSEPSPRRVLILVASGPSTPARCAAPFHIGTLLACMDAEVTLYLT
FT                   GEGVQLARREVAETLRAVNGGEPLLHFIRNAKQAGARLLMCRQPGVQLDPATLIAELDE
FT                   VSSGGELAQMILEYERVLTL"
FT   gene            185113..185577
FT                   /locus_tag="PST_0158"
FT   CDS_pept        185113..185577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0158"
FT                   /product="glycine cleavage system H protein"
FT                   /note="Code: E; COG: COG0509"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77865"
FT                   /db_xref="GOA:A4VFW4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW4"
FT                   /protein_id="ABP77865.1"
FT                   /translation="MNVHGLEFPDSLRYAPEHSLWLREEADGSVTLGLTAYGCALYGEI
FT                   FAFTPKRVGARIERERSFGVVEFAKAASSARSPVSGELLAVNEALLERPALINQDCYGD
FT                   GWMVRLKPEGWATVREEFPLGKAAEAAIDERMRLDNFDPANAHVQALQWK"
FT   gene            complement(185662..186165)
FT                   /locus_tag="PST_0159"
FT   CDS_pept        complement(185662..186165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77866"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW5"
FT                   /protein_id="ABP77866.1"
FT                   /translation="MSDAWLSQPSANCPTSPAVLLPRQPRFGMRQSDLASDIKTLSQYR
FT                   AKRVTIAAFLSRDRRDVLSDRIDERRALHALRDHIDCLLAAGASLVGRDPVQLNFQGRT
FT                   LIVQHGMLLNENGHQDLIETLAELEWANKRTRDLAIDICIRQLDHAIKRSCDKVLDSST
FT                   PDKS"
FT   gene            186289..187056
FT                   /locus_tag="PST_0160"
FT   CDS_pept        186289..187056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0160"
FT                   /product="NAD-dependent 7-alpha-hydroxysteroid
FT                   dehydrogenase"
FT                   /note="Code: IQR; COG: COG1028"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77867"
FT                   /db_xref="GOA:A4VFW6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW6"
FT                   /protein_id="ABP77867.1"
FT                   /translation="MYRPEDFRLDGQVAVVTGAGAGIGQAIAQTFAAAGAAVLVSDLSL
FT                   AAAEGVRDEIVAAGGQAAACACDVADETQLAQLVEHCVDDFGKLTLLVSNAGGGGPKAF
FT                   DMPMADFRRAYELNVFSLFRLAQLAAPHMEQAGGGAMLAITSMAGENRNQHMASYGSSK
FT                   AAANHLIRNIAFDLGPRGIRVNGIAPGATLTHALKGVLTEDIERQMLAHTPLQRLGDPQ
FT                   DMANAALFLCSPAAAWISGQILTVSGGGVQELG"
FT   gene            complement(187322..189238)
FT                   /gene="selB"
FT                   /locus_tag="PST_0161"
FT   CDS_pept        complement(187322..189238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="PST_0161"
FT                   /product="selenocysteine-specific elongation factor"
FT                   /note="Code: J; COG: COG3276"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77868"
FT                   /db_xref="GOA:A4VFW7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFW7"
FT                   /protein_id="ABP77868.1"
FT                   /translation="MIVGTAGHIDHGKTALLHALTGQQGDRRREERERGITIDLGYLYA
FT                   DLGEGSLTGFIDVPGHERFVHNMLAGASGIDCVLLVVAADDGVMPQTREHLAIVELLGI
FT                   RRALVALTKIDRVEPARIAEVEQQIENLLATGPLAGAPIFPVSSIRGDGIDALRAALID
FT                   EAARTAARSDSGHFRLAIDRVFSVTGAGVVVTGTAFAGRVRIGDELLLGPAGKRVRVRG
FT                   LHAQNREADEAHAGQRVALNLAGERLAVEQIHRGDWLLHPLLHAPTQRIDVDFQLLPGE
FT                   AHELKHWTPVHVHLGAQDVTARVALLEGTSLAPGERAFAQLLLNAPSHAVHGDRIVLRD
FT                   QSAQRTLGGGRVLDPYAPPRNRRRAARLEQLRALDQPSLEQALPPLLASATNGIDPQGL
FT                   ERQFNRPREGWQLPHGVLEISTRLGPRLFDQARWRELENALLDSLQRFHEEQPDELGPD
FT                   RDRLRRYALPQLERPVFIALLEQALAAGRIETSGPWLHRPDHRVRLSDAEEDLKARLWP
FT                   LLEAGHFDPPWVRDLARDLGVDETQMRNLLRKLARLGLLQQVVKDLFYPEFTIRQLAGH
FT                   VLQLEAQSGVIRAAAFRDRIQLGRKRSIQLLEHFDRIGLTRRFGNERKVRQDSALAIQS
FT                   GLG"
FT   gene            complement(189235..190644)
FT                   /gene="selA"
FT                   /locus_tag="PST_0162"
FT   CDS_pept        complement(189235..190644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="PST_0162"
FT                   /product="L-seryl-tRNA(ser) selenium transferase"
FT                   /note="Code: E; COG: COG1921"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77869"
FT                   /db_xref="GOA:A4VFW8"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFW8"
FT                   /protein_id="ABP77869.1"
FT                   /translation="MSSSHLPSVDKLLRDPACQPLQQRYGRQALLATLRDLLDELREPA
FT                   RRGQLAALELSEAVLAGRAGERLATQHKSRVRRVFNLTGTVLHTNLGRALLPDEAIEAI
FT                   TLAARYPLNLEFDLATGKRGDRDDLIEELIRELTGAEAVTVVNNNAAAVLLALNSLGAR
FT                   KEGIISRGELIEIGGAFRIPDIMARAGVKLHEVGTTNRTHAKDYEAAINPRSGLLMRVH
FT                   TSNYSVQGFTASVATAELARIAHAHDLPLLEDLGSGSLLDLSRWGLPKEPTVQEALRDG
FT                   ADIVTFSGDKLLGGPQAGLIVGSKALIQKIKKNPLKRALRVDKLTLAALEAVLNLYRDP
FT                   DRLAERLTSLRLLSRPQAEIRTQAERIAPTLAAVLGESWQVAVTDALGMIGSGAQPVAR
FT                   LPSAALCIRPQQPKRLRGRSLRQVEEALRCLPIPVLGRIDDDALWLDLRQLDDEPAFLQ
FT                   QLAHLQEELAR"
FT   gene            complement(190641..191558)
FT                   /locus_tag="PST_0163"
FT   CDS_pept        complement(190641..191558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0163"
FT                   /product="formate dehydrogenase accessory protein"
FT                   /note="Code: O; COG: COG3058"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77870"
FT                   /db_xref="GOA:A4VFW9"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFW9"
FT                   /protein_id="ABP77870.1"
FT                   /translation="MAGTILEPGQIEAAASKPPFTNLPPRDLFALRSARLAKLAEDHPL
FT                   ADYLRLLAGVCQAQQQVLDNPPASAPLDPARTRECFKHAMPPLAADTLVREGAWLPLLD
FT                   AWLDAFAVPDNLSVIAAVDQLRRADSGQRKAWAVALVSGQYDSLPPALVPFLGAALQLA
FT                   WTHWLLQLDLSDLREREDQTLCPCCGAPPMAGVIRHRGQLNGLRYLVCSLCACEWHYVR
FT                   LKCSHCRSTKKLDYLHFEGSPQGIKAEACPECNGYLKQLYLELAPDGESLSADLATLDL
FT                   DLLLADQGYNRQAPNLLLAPGHEA"
FT   gene            complement(191685..192308)
FT                   /gene="fdnI-1"
FT                   /locus_tag="PST_0164"
FT   CDS_pept        complement(191685..192308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnI-1"
FT                   /locus_tag="PST_0164"
FT                   /product="nitrate-inducible formate dehydrogenase, gamma
FT                   subunit"
FT                   /note="Code: C; COG: COG2864"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77871"
FT                   /db_xref="GOA:A4VFX0"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX0"
FT                   /protein_id="ABP77871.1"
FT                   /translation="MNNNEIERYNPSQRTNHWIVAILFVLAALSGLALFHPALFGLSGL
FT                   FGGGTWTRILHPFIGVAMFVFFLWLAIRFAGHNRIEARDRQWLRQINDVVHNREEQLPE
FT                   VGRYNAGQKVLFWVLILSMLVLLLSGIVIWREYFSSFFGIVSLRWASLLHAAAAFVLIV
FT                   SIIVHIYAAIWIKGSMGSMLYGTVSRAWARKHHPAWYREINQRK"
FT   gene            complement(192366..193301)
FT                   /gene="fdnH-1"
FT                   /locus_tag="PST_0165"
FT   CDS_pept        complement(192366..193301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnH-1"
FT                   /locus_tag="PST_0165"
FT                   /product="nitrate-inducible formate dehydrogenase, beta
FT                   subunit"
FT                   /note="Code: C; COG: COG0437"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77872"
FT                   /db_xref="GOA:A4VFX1"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX1"
FT                   /protein_id="ABP77872.1"
FT                   /translation="MATQDVFARSATTTERPSIREVGEVAKLIDTSKCIGCKACQVACS
FT                   EWNELRDEVGTSHGTYDNPIDLTAESWTVMKFAEYENPGSGNLEWLIRKDGCMHCADPG
FT                   CLKACPAPGAIVKYANGIVDFNQDHCIGCGYCITGCPFDIPRISEKDKKAYKCTLCSDR
FT                   VSVGLEPACVKTCPTGAIVFGSKEDMKEHAAGRIADLKERGFDQAGLYDPDGVGGTHVM
FT                   YVLHHADQPSLYNDLPDEPTISPLVSLWKGVTKPLALLGMGAAVLAGFFHYTRVGPIRV
FT                   EEDDKAELSEPVVHQVDPSVHVVDPKEPRP"
FT   gene            complement(193301..195736)
FT                   /locus_tag="PST_0166"
FT   CDS_pept        complement(193301..195736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0166"
FT                   /product="formate dehydrogenase-O, major subunit"
FT                   /note="Code: C; COG: COG0243"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77873"
FT                   /db_xref="GOA:A4VFX2"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX2"
FT                   /protein_id="ABP77873.1"
FT                   /translation="MTNHWSDIQNADLVLIMGGNAAEAHPCGFKWVTEAKARNKARLVV
FT                   VDPRFTRSASVADLYAPIRTGTDIAFLGGLINYLLENDKIQHEYVVNYTDVAFIVKEGF
FT                   GFEDGLFNGYDAEKRSYPDKSTWSYELDEDGFARVDKSLTHPRCVYNLLKQHYSRYTPE
FT                   VVSNICGTPQDRMLQVWETIAETSAPGKAMTIMYALGWTQHSVGSQMIRTGAMVQLLLG
FT                   NIGMPGGGMNALRGHSNIQGLTDLGLLSNLLPGYLTLPLEAEQDYNAYIAKRTAKPLRP
FT                   GQLSYWQHYEKFHVSLMKAWYGKNATAENNWGYDWLPKLDIPGYDVLKVFDMMYQGQVN
FT                   GYFCQGFNPIASFPNKAKVSAALAKLKYLVVMDPLATETSEFWRNAGEYNDVDTASIQT
FT                   TVFRLPTTCFAEEDGSLVNSGRWLQWHWKAAEPPGQAKTDVVIMGGLFHRLRELYRKEG
FT                   GAYAEPLLNIDWSYRQPEEPSAEEIAQEYNGKALGDVLDPQSGALLAKAGEQLPGFGLL
FT                   RADGSTSCGCWIFSGAWTQAGNQMARRDNADPYGMGQTLGWAWSWPANRRILYNRASAD
FT                   PAGNPWDPQKKRLVWWDGSKWGGTDVPDFKVDSPPEAGMNPFIMNPEGVARLFAVDKMN
FT                   EGPFPEHYEPFETPIGRNPLHPENRQATSNPAARVFKNDMELFGTAEEFPYAATTYRLT
FT                   EHFHFWTKHCRLNAITQPEQFVEIGEVLAKELGIAAGERVKVSSNRGYIKAVAVVTKRI
FT                   KPLTVDGKTVHQIGIPLHWGFAGVARNGYLTNTLTPFVGDANTQTPEFKSFLVNVEKA"
FT   gene            complement(195785..196375)
FT                   /locus_tag="PST_0167"
FT   CDS_pept        complement(195785..196375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0167"
FT                   /product="formate dehydrogenase-O, major subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77874"
FT                   /db_xref="GOA:A4VFX3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX3"
FT                   /protein_id="ABP77874.1"
FT                   /translation="MDMNRRQFFKVCGVGLGASSMAALGMAPPTAYAESIRHFKLTNTR
FT                   ETRNTCPYCSVGCGLILYSQGSGGKNVAQNIIHIEGDSDHPVNRGTLCPKGAGLLDFVH
FT                   SPNRLTHPEVREAGSNEWKRIEWSDALDRIARLMKDDRDANFIERNDKGQTVNRWLSTG
FT                   FLAASASSNEAGYITHKVVRSLGILGFDNQARV"
FT   gene            complement(196527..197363)
FT                   /locus_tag="PST_0168"
FT   CDS_pept        complement(196527..197363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0168"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Code: K; COG: COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77875"
FT                   /db_xref="GOA:A4VFX4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX4"
FT                   /protein_id="ABP77875.1"
FT                   /translation="MSDRLAALMTHFPMHAQVFNAGPLCGINTLQSDGVHGQLHLIRRG
FT                   EVEVRYGREVLQVSQPSLLLFPRPLTHRFITAPGCEVDMVCANLAFEGGSANPIASALA
FT                   DLVCLPLDGVMGAEPVLSLLFEEAFEQRCGRMALIERLVEVVMIQILRQLMESDEVSGG
FT                   LLSGLAHPRLRNALVAMHEAPAQDWTLEELARVAGMSRSVFATTFRETLGQTPGQYLQG
FT                   WRVRLAQKALQRGRPLKVIATEVGYGSEAALSRAFKAQAGQSPREWKNQLARPAGA"
FT   gene            197483..197911
FT                   /gene="ohr"
FT                   /locus_tag="PST_0169"
FT   CDS_pept        197483..197911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="PST_0169"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /note="Code: O; COG: COG1764"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77876"
FT                   /db_xref="GOA:A4VFX5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX5"
FT                   /protein_id="ABP77876.1"
FT                   /translation="MSIEKILYTATATATGGREGRATSSDQALDVQLSTPRELGGAGGA
FT                   GTNPEQLFAAGYSACFLGALKFVAGKQKVALPADTRITGKVGIGQIPTGFGIEAELTIS
FT                   APGIARDVLQALVEQAHVVCPYSNATRGNIDVTLILAD"
FT   gene            197950..198900
FT                   /locus_tag="PST_0170"
FT   CDS_pept        197950..198900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0170"
FT                   /product="non-heme chloroperoxidase"
FT                   /note="Code: R; COG: COG0596"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77877"
FT                   /db_xref="GOA:A4VFX6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX6"
FT                   /protein_id="ABP77877.1"
FT                   /translation="MNSITRTFAFSLLAIALQPAFAAEAAQPVKPASSVVAAQTASTIT
FT                   TADGVQLYYKDWGPKDGPVVTFSHGWPLSSDSWESQMMFLASQGYRVVAHDRRGHGRSS
FT                   QPWEGNDMDHYADDLAAVIEALDLQDVTLVGFSTGGGEVARYIGRHGTGRVKKAVLVSA
FT                   VPPMMLKTADNPGGLPLEVFDGIRKASLEDRAQLYLDLASGPFYGFNRPGAKVSQGLID
FT                   NWRAQGMQAGHKNTYDSIAAFSATDFREDLKKFDVPTLVIHGDDDQIVPLDSSGKASAA
FT                   LIEGAQLIVYPGAPHGLTDTHKERFNNDLLAFLKK"
FT   gene            complement(199032..199874)
FT                   /locus_tag="PST_0171"
FT   CDS_pept        complement(199032..199874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4395"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77878"
FT                   /db_xref="GOA:A4VFX7"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX7"
FT                   /protein_id="ABP77878.1"
FT                   /translation="MQRVLSIFMALCISLTFALDAHAKRFGGGKSFGSAPSHQTRQAPQ
FT                   QTQAAPSQAGKQAAAAPSGASRWLGPLAGLAAGGLLASMFMGDGFEGIQFMDILIFGLI
FT                   AFLLFRFLAARRRQQQPAMAGHAPMQREMPQQPATSIFGGSAAPVAAAPVINAPAWFNE
FT                   QNFVAAAREHFLSLQQHWDANEMDKIAEFVTPQLLGFLKQERAEIGDAYQSTYIDDLQI
FT                   QLDGVDDNAEKTTATLTFSGVAKTSRFDQGEPFSESWRMERVQGENQPWLVAGIRQNA"
FT   gene            complement(200060..201250)
FT                   /locus_tag="PST_0172"
FT   CDS_pept        complement(200060..201250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0172"
FT                   /product="TRAP-type mannitol/chloroaromatic compound
FT                   transport system, periplasmic component"
FT                   /note="Code: Q; COG: COG4663"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77879"
FT                   /db_xref="GOA:A4VFX8"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX8"
FT                   /protein_id="ABP77879.1"
FT                   /translation="MKPCEVDANVNPSYQPATPIRRIFQGYRPMKRRHLFGAAAALLAT
FT                   LGLAGCNDDKKVETTGQQAASEPAKTYTWKMVTAWPKNYPGLGTAAERLAERVKVMSDG
FT                   RLTIKVYAAGELVPALEVFDAVSRGTAELGHGAAYYWKGKVPTAQFFTSVPFGLSAIEM
FT                   NAWLSKGEGQKFWDEAYAPFGVKPMVVGNTGMQMGGWYNKEINSLDDLKGLKIRMPGLG
FT                   GEVLTRLGATTVNLPGGEVFTALQTGAIDATDWVSPYNDLAFGLHKAAKYYYYPGWQEP
FT                   QAVLELLVNQKALDTLPEDLQAILTEATRAASRDMMDDYVYNNALALDQLKQQGVELKR
FT                   FPDEVLGAMQEQSELVLGELAAQSELNGRIWASMKAFQAQVKPMHEISEKELYNWR"
FT   gene            complement(201237..203426)
FT                   /gene="uvrD"
FT                   /locus_tag="PST_0173"
FT   CDS_pept        complement(201237..203426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="PST_0173"
FT                   /product="DNA helicase II"
FT                   /note="Code: L; COG: COG0210"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77880"
FT                   /db_xref="GOA:A4VFX9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFX9"
FT                   /protein_id="ABP77880.1"
FT                   /translation="MHDDLSLLLNSLNDAQRQAVAAPLGRQLVLAGAGSGKTRVLVHRI
FT                   AWLHQVERASLHSILSVTFTNKAAAEMRQRIEQLLHVNPQGMWVGTFHGLAHRLLRAHW
FT                   REAKLAENFQILDSDDQQRLVKRVIRELGLDEQRWPARQAQWWINAQKDEGLRPRNIQP
FT                   GGDLFLATQLKIYEAYEEACARAGVIDFSELLLRALDLWRDHPGLLEHYQRRFRHVLVD
FT                   EFQDTNAVQYAWLRLLAKGGESLMVVGDDDQSIYGWRGARIENLHQFSADFPDAETIRL
FT                   EQNYRSTACILKAANALIANNQGRLGKELWTSGCEGEPISLYAAFNEHDEARYVVESIE
FT                   KAIRDGMSRSEIAILYRSNAQSRVLEEALLREKIPYRIYGGQRFFERAEIKNAMAYLRL
FT                   IQTRDNDAALERVINVPARGIGEKTVECLRQLAREQGLSMWAALHQAVGTKAVSGRAAS
FT                   ALNGFVELVDTLALKVEKLPLHSMAQLVIEESGLLAYHRDEKGEKAQARVENLEELVSA
FT                   ARAFDSYSEEEDDIQSPLAAFLDHASLEAGEQQAGDHEDSVQLMTLHSAKGLEFPLVFL
FT                   VGMEEGLFPHKMSLEESGRLEEERRLAYVGITRAMQQLVITYAETRRLYGSETYNKVSR
FT                   FVREIPPALVQEVRLSNTVTRSFSGKSMSGSSLFDGAGVPETPFNLGQRVRHSLFGEGT
FT                   ILNFEGSGAQARVQVNFEDEGSKWLMLSYAKLEAL"
FT   gene            203733..206528
FT                   /locus_tag="PST_0174"
FT   CDS_pept        203733..206528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77881"
FT                   /db_xref="GOA:A4VFY0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY0"
FT                   /protein_id="ABP77881.1"
FT                   /translation="MAPSDHIAERTRLLYLGSRVPALLLLLSTLICGVVLWEDNGGIEL
FT                   GGWIGWMLALGLLWLQQVMAFGKASPEGQADAHWRWRFFLGSSICAVSLSYAMVALIPA
FT                   DAFATQALLYGLIGSVVVAASVAYGVCLPAFFCFAVPSLLPTGLLLMTSGHPLQQGWGL
FT                   LAMIVLATLCLIGWQISRLVNDGLEQRLHKQQLIERLETAGREADQLNRRLASEVEQRR
FT                   HAEKQLRSAYDGLEQRVAERTAELAQLAEELGESETRLNLALDASGLGLWDWDLQNNHV
FT                   HHSRLEVVFGIGRQHRHDEDGSPLPDIHPKDLEGVRAILIAHLKGETEQFAVEYRALRA
FT                   DGSEIWLEDRGRVIQRDAGGRALRMIGTRRDISELRSQAEQQRLAATVFEAASEGMVIM
FT                   NDHYRVLAVNDACCALSGYSREELIGHSVARIAGSQESQRQYQTMREALELHGHWQGEL
FT                   IETRKSGEVYPQWVQLREVRDANDSVTHVVAFISDLSVRRKIEERLRYLTHYDDLTGLA
FT                   NRGLLKERLHEACQRVRRNGRNMAVLYIDLDRFKLLNESLGHEAADALLREMSRRITQT
FT                   LSEADTIARLSGDEFVVLIDAYGSLSSLAHLGSRLLQRIRKPVIIDEQELVISASIGVS
FT                   LMPDNSRDAEVLLRQANMAMQQAKHLGGNTLQFFTDRPQASSMQYLQLENQLRKALDSG
FT                   QLEVFYQPRLTLANDALDAAEALVRWRHPERGLVAPAHFIPLAEETGLIIPLGEFVLRE
FT                   ACRQARQWQQQGLAEIRISVNLSVKQLRQGNFVSLVRQVLEETGLPATMLELELTESQL
FT                   LDDIDNAISISEQLRALGVRLAIDDFGTGFSSLSYLKRFPVDYVKIDRSFISELEHSSQ
FT                   DAAITRAIIAMVHSLERKVVAEGVETQAQMDFLKANQCDEIQGYLLSPPVPAEQFAELL
FT                   R"
FT   gene            complement(206562..208013)
FT                   /locus_tag="PST_0175"
FT   CDS_pept        complement(206562..208013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0175"
FT                   /product="putative protease"
FT                   /note="Code: O; COG: COG0826"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77882"
FT                   /db_xref="GOA:A4VFY1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY1"
FT                   /protein_id="ABP77882.1"
FT                   /translation="MRTTLDAQSPGKRSKMPRFRYPCESRAMNTPNRTELLSPAGTLKS
FT                   MRYAFAYGADAVYAGQPRYSLRVRNNEFDHANLKVGIDEAHALGKQFYVVVNIAPHNAK
FT                   LKTFIKDLEPVVAMGPDALIMSDPGLIMLVRQHFPQQTIHLSVQANAVNWATVKFWESQ
FT                   GVSRVILSRELSLEEIGEIREQVPGMELEVFVHGALCMAYSGRCLLSGYINKRDPNQGT
FT                   CTNACRWEYKTHEAKEDELGNSVHLYEPIAVQQVEAQGNPTLGVGAPTDKVFLLEDVSR
FT                   PGEFMEATEDEHGTYIMNSKDLRAVQHVERLVQMGVHSLKIEGRTKSHYYVARTAQVYR
FT                   KAIDDALAGRPFDRSLMDTLESLAHRGYTEGFLRRHVHDEYQNYERGFSLSERQQFVGE
FT                   LTGERRNGLAEVKVKNRFAVGDRLELMTPQGNLNLRLERLENKRGEAIEVAPGDGHTVY
FT                   LPVPEDVDLRYALLMRELDGSTTRG"
FT   gene            complement(208056..208274)
FT                   /locus_tag="PST_0176"
FT   CDS_pept        complement(208056..208274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2841"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77883"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY2"
FT                   /protein_id="ABP77883.1"
FT                   /translation="MFPEYRDLITRLKAENKTFARLFDEHNDLDQRVKNIEAHIVPGTD
FT                   SEVENLKKQKLQLKDRLYDMLKEASVA"
FT   gene            complement(208459..209757)
FT                   /locus_tag="PST_0177"
FT   CDS_pept        complement(208459..209757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0177"
FT                   /product="putative aspartokinase"
FT                   /note="Code: E; COG: COG0527"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77884"
FT                   /db_xref="GOA:A4VFY3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFY3"
FT                   /protein_id="ABP77884.1"
FT                   /translation="MTNLLLEHKKTGEPGVYQRFADAQSEGAWREALEGVRQRMLAKNA
FT                   ELFSSEYELHAANQFINSRIDDASECMHSLQKLCAYGHFQLSEHLMKVREMLASLGEAH
FT                   SAFNSVLALKQRGVNARLADLTGWQQEAPLPFEEMISSHFAGFDFSRELVVATGYTHCA
FT                   EGLMNTFDRGYSEITFAQIAAATGAREAIIHKEFHLSSADPNLVGADKVVTIGRTNYDV
FT                   ADQLSNLGMEAIHPRAAKTLRRAGVELRIKNAFEPEHGGTLISQDYKSEKPCVEIIAGR
FT                   KDVFGIEVFDQDMLGDIGYDMEISKLLKQLKLYVVNKDSDANSITYYASGSRKLINRAA
FT                   RLIEEQYPAAEVTVHNLAIVSAIGSDLKVKGILAKTVAALAEAGISIQAIHQSIRQVEM
FT                   QCVVNEEDYDAAIAALHRALIEPENHGDVIAAA"
FT   gene            complement(210042..210950)
FT                   /locus_tag="PST_0178"
FT   CDS_pept        complement(210042..210950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0178"
FT                   /product="putative L-proline 4-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77885"
FT                   /db_xref="GOA:A4VFY4"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR012774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFY4"
FT                   /protein_id="ABP77885.1"
FT                   /translation="MQADLYPSRQEDQPSWQERLDPVVYRSDLENAPIAAELVERFERD
FT                   GYLVIPNLFSADEVALFRAELERMRQDPAVAGSGKTIKEPDSGAIRSVFAIHKDNELFA
FT                   RVAADERTAGIARFILGGDLYVHQSRMNFKPGFTGKEFYWHSDFETWHIEDGMPRMRCL
FT                   SCSILLTDNEPHNGPLMLMPGSHKHYVRCVGATPENHYEKSLRKQEIGIPDQNSLSELA
FT                   SRFGIDCATGPAGSVVFFDCNTMHGSNGNITPSARSNLFYVYNHVDNAVQAPFCEQKPR
FT                   PAFVAERENFKPLDIRPQQYL"
FT   gene            complement(211019..211339)
FT                   /gene="ectC"
FT                   /locus_tag="PST_0179"
FT   CDS_pept        complement(211019..211339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ectC"
FT                   /locus_tag="PST_0179"
FT                   /product="L-ectoine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77886"
FT                   /db_xref="GOA:A4VFY5"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY5"
FT                   /protein_id="ABP77886.1"
FT                   /translation="MLLKDDKVGFSFHITTIYAGSETHIHYQNHFESVYCISGNGEIET
FT                   IADGKIYKIEPGTLYVLEKHDEHLLRGGSEDMKLACVFNPPLNGREVHDESGVYPLEAE
FT                   TV"
FT   gene            complement(211431..212708)
FT                   /gene="ectB"
FT                   /locus_tag="PST_0180"
FT   CDS_pept        complement(211431..212708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ectB"
FT                   /locus_tag="PST_0180"
FT                   /product="diaminobutyrate--pyruvate aminotransferase"
FT                   /note="Code: E; COG: COG0160"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77887"
FT                   /db_xref="GOA:A4VFY6"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY6"
FT                   /protein_id="ABP77887.1"
FT                   /translation="MKTFELNESRVRSYCRSFPVVFKQAQGAELVTQDGKRYIDFLAGA
FT                   GTLNYGHNHPVLKQALLEYIESDGITHGLDMYTEAKERFLETFNRLILEPRGMGDYRMQ
FT                   FTGPTGTNAVEAAMKLARKVTGRNNIISFTNGFHGCSIGALAATGNQHHRGGSGIGLTD
FT                   VSRMPYANYFGDKTNTIGMMDKLLSDPSSGIDKPAAVIVEVVQGEGGLNTASAEWMRKL
FT                   EKLCRKHEMLLIVDDIQAGCGRTGTFFSFEEMGIQPDIVTLSKSLSGYGLPFAMVLLRQ
FT                   ELDQWKPGEHNGTFRGNNHAFVTAAAAVEHFWQNDAFANSVKAKGKRIADGMQRIIRRH
FT                   GPDSLFLKGRGMMIGISCPDGEIAAAVCRHAFENGLVIETSGAHSEVVKCLCPLIISDE
FT                   QIDQALSILDKAFAAVMSEQTENQAS"
FT   gene            complement(212705..213286)
FT                   /gene="ectA"
FT                   /locus_tag="PST_0181"
FT   CDS_pept        complement(212705..213286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ectA"
FT                   /locus_tag="PST_0181"
FT                   /product="L-2,4-diaminobutyric acid acetyltransferase"
FT                   /note="Code: KR; COG: COG0454"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77888"
FT                   /db_xref="GOA:A4VFY7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012772"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY7"
FT                   /protein_id="ABP77888.1"
FT                   /translation="MPTLKRNSINNPKGIVLSFPTVMLRRPTDGDGYNLHQLVARCQPL
FT                   DTNSVYCNLLQCSDFADTAIAAENAQGELVGFISGYRPPSRPDTLFVWQVAVDSSMRGQ
FT                   GLALRMLLALTARVAREYGVRYMETTISPDNGASQALFKRAFDRLDANCTTRTLFARDT
FT                   HFAGQHEDEVLYRAGPFTVSHLEEELKEHA"
FT   gene            complement(213857..215299)
FT                   /gene="zwf-3"
FT                   /locus_tag="PST_0182"
FT   CDS_pept        complement(213857..215299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf-3"
FT                   /locus_tag="PST_0182"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /note="Code: G; COG: COG0364"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77889"
FT                   /db_xref="GOA:A4VFY8"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY8"
FT                   /protein_id="ABP77889.1"
FT                   /translation="MSISCDMLVFGGTGDLTLHKLLPALYHLHRDGRLHADVRILALAR
FT                   KKLDRDGYLALAERHCRAQVARGDFSPDTWQTFAQRVDYFAMDASQRSDYLRLAQHLGQ
FT                   ANGRVRVYYLATAPDLFEPIAANLESAGLAGDDARIVLEKPIGHSLDSALEINEAIGAV
FT                   FPEARIYRIDHYLGKETVQNLMALRFANALFEPIWRAGHIDHVQITVAETLGVENRGGY
FT                   YDNAGAMRDMLQNHLLQLLCLVAMEAPVRFDAKHIRGEKVKVLEALKPITGNDVLDKTV
FT                   RGQYGAGRIGGHDVPAYYFEPNIDNDSDTETFVAVKAEIDNWRWAGVPFYLRTGKRMAR
FT                   KRSEIIITFKQVPHLLFAKGEVNRLVISLQPEESISLQLMAKAPGKGMQLEPVELDLNL
FT                   AHAFSSTRRWEAYERLLLDVIEGDSTLFMRRDEVEAAWNWVDPILRGWSSYYRKPRPYP
FT                   AGEDGPEQAHQFIERQGHSWWQ"
FT   gene            215537..216307
FT                   /locus_tag="PST_0183"
FT   CDS_pept        215537..216307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0183"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="Code: K; COG: COG1737"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77890"
FT                   /db_xref="GOA:A4VFY9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFY9"
FT                   /protein_id="ABP77890.1"
FT                   /translation="MHSSMADLAHTVGVSEPTIVRFCRAIGCLGFQDLKLKLAQSLAAG
FT                   ASFGQFAISENDSVADFALKIFDTTLHTLMEVRERLDPDALQRAITAMAKAERVEFYGF
FT                   GASGAVATDAQHKFFRLLLSAAAYSDPHMQAMSAVTLKPTDVAICISQSGRSKDLLITA
FT                   NVVRESGATLITLCPSQTPLAELATINLAIDVQEDTEIYTPLTSRIAHLVVIDVLAMGV
FT                   AMARGPSLVNHLKSVKRSLRSLRLSPKTVKTHEE"
FT   gene            216405..216617
FT                   /locus_tag="PST_0184"
FT   CDS_pept        216405..216617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77891"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ0"
FT                   /protein_id="ABP77891.1"
FT                   /translation="MLRHNDVTAPLDSKARRKQQDERRMRFRRAIESYTEQRQLHAELD
FT                   DYADTLVFNSLIESSAGRRSAPPAH"
FT   gene            complement(216562..217428)
FT                   /locus_tag="PST_0185"
FT   CDS_pept        complement(216562..217428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0185"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77892"
FT                   /db_xref="GOA:A4VFZ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ1"
FT                   /protein_id="ABP77892.1"
FT                   /translation="MALTQPAVSLQIRQLEELVGQPLFEYVGKKLYLTDAAEALQRAST
FT                   DIFGRLDSLDMQLSDLQGSLQGQLNLAVESSAKYVTPHLFAAFKRLHPEVSLQLVVVNH
FT                   AQAVKRLSVSRDDLLIMSQVPTDMDLEFMPFLNNPIIAVAPAEHPLCHAATLSLQDLTS
FT                   YPLLVREPGSGTRKAAEDYLRQKRAHFTQTIQVASLDALRECVVAGLGLALLPRHAVHL
FT                   ELAAGLLRELPVAELPLYRSWCVVHPRGKRLSPVAQAFFAFLREERAQISALAERFAGP
FT                   PTTRSAS"
FT   gene            217499..219175
FT                   /gene="accC-2"
FT                   /locus_tag="PST_0186"
FT   CDS_pept        217499..219175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC-2"
FT                   /locus_tag="PST_0186"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="Code: I; COG: COG0439"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77893"
FT                   /db_xref="GOA:A4VFZ2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ2"
FT                   /protein_id="ABP77893.1"
FT                   /translation="MRINDFRIVLPVVRLHFAEQSNLRRFCLTGQETVIPDTHISKYLS
FT                   QRKQLFIFSNPPHGRRVKRIASKASDPDPLAGRLLNDPREDSVIKKLLIANRGEIAVRI
FT                   VRACAEMGVRSVAVFSEADRHALHVKRADEAYFIGEDPLAGYLNPRKLVNLAVETGCDA
FT                   LHPGYGFLSENAELAEICAERGIKFVGPSADVIRRMGDKTEARRSMIKAGVPVTPGTEG
FT                   NVKDLAEALREAERIGYPVMLKATSGGGGRGIRRCNSQAELESAYPRVISEATKAFGSA
FT                   EVFLEKCIVEPKHIEAQVLADSFGNTVHLFERDCSIQRRNQKLIEIAPSPQLTPEQRAY
FT                   IGDLAVRAAKAVGYENAGTVEFLLADGEVYFMEMNTRVQVEHTITEEITGIDIVREQIR
FT                   IASGQPLSVKQEDIQHRGFSLQFRINAEDPRNNFLPCFGKITRYYAPGGPGVRTDTAIY
FT                   TGYTIPPYYDSMCLKLVVWALTWEEALARGSRALDDMRVQGVKTTATYYQQILANPDFR
FT                   SGQFNTSFVDNHPELLNYSIKRKPGELALAIAAAIAAHAGL"
FT   gene            219186..220997
FT                   /gene="oadA"
FT                   /locus_tag="PST_0187"
FT   CDS_pept        219186..220997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="PST_0187"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /note="Code: C; COG: COG5016"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77894"
FT                   /db_xref="GOA:A4VFZ3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ3"
FT                   /protein_id="ABP77894.1"
FT                   /translation="MTAQKKITVTDTILRDAHQSLLATRMRTEDMLPICDKLDRVGYWS
FT                   LEVWGGATFDACVRFLKEDPWERLRQLKAALPNTRLQMLLRGQNLLGYRHYSDDVVEAF
FT                   CARAAENGIDVFRIFDAMNDVRNLETAIRAVKKSGKHAQGTIAYTTSPVHTVELFVEQA
FT                   RQMAAMGVDSIAIKDMAGLLTPFATGDLVRALKAEIDLPVFIHSHDTAGVASMCQLKAI
FT                   ENGADHIDTAISSMAWGTSHPGTESMVAALKGTPYDTGLDLELLQEIGLYFYAVRKKYH
FT                   QFESEFTGVDTRVQVNQVPGGMISNLANQLKEQGALHRMDEVLAEIPKVRKDLGYPPLV
FT                   TPTSQIVGTQAFFNVLAGERYKTITNEVKLYLQGRYGQAPAPVCERLRFMAIGSEEVIE
FT                   CRPADLLAPELDKLRKDIGGLAKSEEDVLTFAMFPDIGRKFLEEREAGTLQPEVLLPIP
FT                   DGNVAAASVEGTPTEFVIDVHGESYRVDITGVGVKGEGKRHFYLSIDGMPEEVVFEPLN
FT                   AFVGGGGSGRKQASAPGDVSTTMPGNVVDVLVAVGDVVKAGQTVLVSEAMKMETEIQAP
FT                   IAGTVKAVHVAKGDRVNPGEVLIEIEG"
FT   gene            221187..222128
FT                   /locus_tag="PST_0188"
FT   CDS_pept        221187..222128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0188"
FT                   /product="sodium bicarbonate cotransporter"
FT                   /note="Code: R; COG: COG3329"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77895"
FT                   /db_xref="GOA:A4VFZ4"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ4"
FT                   /protein_id="ABP77895.1"
FT                   /translation="MGIDPVVLFFVFGLFAGLVKSELKLPPALYETLSIVLLLAIGLHG
FT                   GVELAEQASAALLGQSLLVLALGVLLPILAFGLLRGLRFDRVNAAAVAAHYGSVSAGTF
FT                   AVVVAYLAAREVFFESYMPLFVAILEIPAILVGILLAKGVSKDTDWKELGREIFLGKSI
FT                   MLLLGGLLIGAIAGKEAIKPLEPLYTSMFKPVLAFFLLEMGLIASGQLGSLKRYGAKLA
FT                   AFALVMPLIGALIGALLARFMGLSLGGTAMLATLAASASYIAVPAAMRLAVPEANPSLS
FT                   LTASLGITFPFNILIGIPLYLALAERLIAWGF"
FT   gene            222130..222432
FT                   /locus_tag="PST_0189"
FT   CDS_pept        222130..222432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77896"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ5"
FT                   /protein_id="ABP77896.1"
FT                   /translation="MNAHNRTLLTVICEAALEHKLEADLKTLGAPGWTLSDARGSGSRG
FT                   VRSAGWETDGNIRLEVICSRDVAERIAEHLQARYYANFAMVCYLSEVEVLRPEKF"
FT   gene            222498..223406
FT                   /locus_tag="PST_0190"
FT   CDS_pept        222498..223406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0190"
FT                   /product="glutaminase, putative"
FT                   /note="Code: E; COG: COG2066"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77897"
FT                   /db_xref="GOA:A4VFZ6"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VFZ6"
FT                   /protein_id="ABP77897.1"
FT                   /translation="MHALLQEILDEVRPLLGRGRVADYIPALADVPADQLGIAVCSAEG
FT                   ELFEAGDARTPFSIQSISKVFSLVQAIGHRGESLWERLGHEPSGQPFNSLVQLEFERGR
FT                   PRNPFINAGALVICDVNQSRFATPELSMRDFVRHLSGNPLIVSDTKVAESEYQHRARNA
FT                   AMAYLMQAFGNFHNDVEAVLRSYFHHCALRMNCVDLARAFGFLARDGICPQGGEAVLSP
FT                   RQTKQVNAIMATSGLYDEAGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNAAG
FT                   NSLIGMAALEALSQRIGWSVF"
FT   gene            223451..224149
FT                   /locus_tag="PST_0191"
FT   CDS_pept        223451..224149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0191"
FT                   /product="carbonic anhydrase"
FT                   /note="Code: P; COG: COG0288"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77898"
FT                   /db_xref="GOA:A4VFZ7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ7"
FT                   /protein_id="ABP77898.1"
FT                   /translation="MSDDKTGETAQEALDHIVSGVKRFREEVYPQQRELFEKLAYEQKP
FT                   RAMFITCADSRIIPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEFAVMALGVQ
FT                   HIIVCGHSDCGAMKAVLNPAQLERMPTVKGWLRHAEVAKIVVEQNCGCADHNTLGILTE
FT                   ENVVAQLDHLRTHPSVAARLASGQLFIHGWIYNIGTSEIRAYDAEKGEFRMIGDGPLPM
FT                   ATPRARYQAS"
FT   gene            complement(224154..224963)
FT                   /locus_tag="PST_0192"
FT   CDS_pept        complement(224154..224963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: ET; COG: COG0834"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77899"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ8"
FT                   /protein_id="ABP77899.1"
FT                   /translation="MARSRTARALFALLVSAAFSVRAELPANYPITLQTDSFPPFNMGP
FT                   NSKGFARGDDVQGIAADTVRDIFRRAGVSYNLTLRGPWSRLYEQTQQQPAHGLFSVART
FT                   PQNAGQFKWVGPLAHHDSVLLAPAGKGLKFDSLAQAQGYQIGGHANGTVSLFLESQGIR
FT                   TSNSLNDAENLRKLLTGRIDLWAAADPVWRYFARQQGVEEGQLQVALSFRSEPLYLALS
FT                   PDTPDAVVNRLQKALDEVIAEGYAGCSKTPDLCYVIQNRGKTLAGSR"
FT   gene            complement(225091..226221)
FT                   /gene="ansA"
FT                   /locus_tag="PST_0193"
FT   CDS_pept        complement(225091..226221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="PST_0193"
FT                   /product="L-asparaginase I"
FT                   /note="Code: EJ; COG: COG0252"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77900"
FT                   /db_xref="GOA:A4VFZ9"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:A4VFZ9"
FT                   /protein_id="ABP77900.1"
FT                   /translation="MPLPRRTPPRGADRDATGRSPAAPLTCDGGWPAHPPDFPTTCADQ
FT                   RGARVNPSIQRLLVLYTGGTIGMQQSAAGLMPASGFEARMREQQAHEAGPLPDWTFDEL
FT                   QPLLDSANMHPRHWQQMAERIRSAVTAGGCDAVLLLHGTDTLAYSAAALSFLLLDLPVP
FT                   VLLTGAMLPAGSEGSDAWPNLFGAMRALQAGRVSGVQLYFNGALLHGARVSKLRSDAFD
FT                   AFAEAPRQRLANATAERPPALLPRRPAQVMVLPLYPGVGATQVQALVASGAQALLLECY
FT                   GSGTGPADDAEFVAALRQAHRQGVVLAAISQCPGGHVDFGVYAAGSALRDAGLVSGGGM
FT                   TREAALGKLFALLAAGLDQAQVEHWFCRDLCGEMAG"
FT   gene            complement(226184..227605)
FT                   /locus_tag="PST_0194"
FT   CDS_pept        complement(226184..227605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0194"
FT                   /product="probable AGCS sodium/alanine/glycine symporter"
FT                   /note="Code: E; COG: COG1115"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77901"
FT                   /db_xref="GOA:A4VG00"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG00"
FT                   /protein_id="ABP77901.1"
FT                   /translation="MLDLLNDLIWSKLLIVMLIGLGLLFTIRSGFVQFRYFGNMFSIFG
FT                   HAFERQPGQLSSFQALMLSVAGRVGAGNIAGVSVAIMLGGPGAIFWMWVVALVGMATSY
FT                   FECSLAQLYKRREPDGTYRGGPAFYIQHGLGQRWLGILVSILLLMTFGFGFNAVQSFTV
FT                   ASSLHDTFGVPTVASGIALTLVIGGIIFGGIRRIAKWADVLVPVMAFSYLGMALFVIGS
FT                   NFSAIPETFGLIFRSAFGLEQAFAGGIGAAILMGVKRGLFSNEAGLGSAPNVAAVAEVK
FT                   HPVAQGIVQSLSVFIDTIILCSCTALIILLSGVYEPGMDQAGVVLTQTAVAAVVGEWGR
FT                   VFVSVALLLFVFTTLIYNYYLGENALGFFTEKRTPVVIYRVLVIILVLWGSVQDLGTVF
FT                   AFADVTMGLLAIANLIAVALLFKVGLRLMRDYDSQIRAGIEQPVLDPKNYADLDLDPAV
FT                   WQANASATTDASARR"
FT   gene            227777..228595
FT                   /locus_tag="PST_0195"
FT   CDS_pept        227777..228595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0195"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /note="Code: K; COG: COG1396"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77902"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG01"
FT                   /protein_id="ABP77902.1"
FT                   /translation="MTSHLAENLKLLCSHYRSIAEVCRKLAINRAQFNKYLGGQSRPTP
FT                   FNLKRIGDFFGVEGYELEMPPEQFARLVGARHPEAQALPRTDPLLALLLPLRDQTTSLS
FT                   RYCGYYFEYANCMSVPGSVLISLVHLREENGLYLFERQERQERASPTLGQAEDWVRCRY
FT                   LGAAFGLQDRLFLIDYESLTLNEMSQTILIPSFKSRITRLNGLKTGVSSGDRRTPACTS
FT                   VVWEYLGREINRVSAYRQVMLYSPDDPRIDPEIRERLATPRVEAGLFQID"
FT   gene            complement(228607..229923)
FT                   /locus_tag="PST_0196"
FT   CDS_pept        complement(228607..229923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0196"
FT                   /product="proton-glutamate symporter"
FT                   /note="Code: C; COG: COG1301"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77903"
FT                   /db_xref="GOA:A4VG02"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG02"
FT                   /protein_id="ABP77903.1"
FT                   /translation="MLYGPPARPVRTIKTTGRPMTQSTTLSAPLRLLVRLPLWQQILIG
FT                   LALGVAAGMAFGADAQLLAPIGTLFLNAIKMLIVPLVFVSLVAGITSMQDSAKLGRISL
FT                   KTIAIYLVTTAFAVSIGLVFGALFSPGEGMNMVASGTQEAKQAPSLVSILVGLVPSNPV
FT                   TAFAEGNILQIIVFAIALGVSINLIGERGAPAVRLFNALAETFYKLTDLVMRVAPIGVF
FT                   ALTAGVVGSHGAEVLLPLAGVIGVIYLASIAHVLLVYGGLLGLLARLNPLRFFQGIAPA
FT                   LAVAFSTSSSSGTLPVSIECARKNLGVSEGVAGFVLPVGATINMDGTAIYQGVLALFIA
FT                   QAFGIDLSAGQYAMIILTATLASIGTAGIPGAGLIMLGLVLTAAGLPLEGVALIAGIDR
FT                   ILDMARTTVNVAGDLMTTTLVGRSEQELDRAVYDSSTKE"
FT   gene            complement(229958..231382)
FT                   /gene="aspA"
FT                   /locus_tag="PST_0197"
FT   CDS_pept        complement(229958..231382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="PST_0197"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="Code: E; COG: COG1027"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77904"
FT                   /db_xref="GOA:A4VG03"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG03"
FT                   /protein_id="ABP77904.1"
FT                   /translation="MSEIASPRIEKDLLGTLPVPSDAYYGIQTLRALHNFRLSGVALSH
FT                   YPKLIVALAMVKQAAADANRELGYLPEAKHVAISQGCARLIRGEFHEQFVVDMIQGGAG
FT                   TSTNMNANEVIANLGLEAMGHAKGEYQHLHPNNDVNMAQSTNDAYPTAIRLGLLLGHDT
FT                   LLASLDSLCEALTTKGHAFAHVLKMGRTQLQDAVPMTLGQEFHAFATTLGEDLQHLRRF
FT                   APELLLEVNLGGTAIGTGINADPRYQAIAVQRLAEISGQPLRQAADLIEATSDMGSFVL
FT                   FSGMLKRLAVKLSKICNDLRLLSSGPRTGFNEINLPPRQPGSSIMPGKVNPVIPEAVNQ
FT                   VAFEVIGNDLALTMAAEGGQLQLNVMEPLIAYKLFDSIRLLQRAMDMLREHCIEGITAN
FT                   EDRCRELMESSIGLITALNPYIGYDNSTRLAREALLGGRSVLELVREERLLDDAMLAEI
FT                   LRPENMIAPRLAPLAV"
FT   gene            231545..232477
FT                   /locus_tag="PST_0198"
FT   CDS_pept        231545..232477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0198"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77905"
FT                   /db_xref="GOA:A4VG04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG04"
FT                   /protein_id="ABP77905.1"
FT                   /translation="MNLETKWLEDFVALAATRSFSQAAQRRFVTQPAFSRRIRSLEEAL
FT                   GLQLINRSRTPIELTEAGQLFLVSARNMVEQLGEVVRHLHHVEGQQGEVLQISAAHSLA
FT                   LGFFPAWIAGLRNDGLNLATRLIATNVGEAVHVLREGGCDLILAYYDPDAALQLDPELF
FT                   PSLHLGRTEMLPVCAVGADGVPLYDVDSGQTVPLLAYSAGAFLGRSVNLLLRQRALRST
FT                   TVYETAMADSLKSMALQGLGIAWVPRLSVEPELERGELAICGGEQWRVPLEIRLYRCSL
FT                   MRKGAVRLLWRRLENRTVDAQRAADEAAG"
FT   gene            232677..235361
FT                   /locus_tag="PST_0199"
FT   CDS_pept        232677..235361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77906"
FT                   /db_xref="GOA:A4VG05"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG05"
FT                   /protein_id="ABP77906.1"
FT                   /translation="MPAPATASIAPVTLHAALTRIAQASPDRAAVLSTRFAPLDHRGLQ
FT                   QMIERTHRQLRLAGFDRDARIGVLLPEAPQAAVAIIAIACSAVAVPLDPRLGPAELDQF
FT                   LQQLPLDALLIASDGDQQGLRAAERHGLPLISAEAAEDGSPALQLAMPVAARPAPDELP
FT                   EPDAPAFILRSSGTTALPKLIPFTHRNMLTAARKWQRWFGLNDGDRCLCVSAPYYSHGL
FT                   KVTILTPLLGGGSVAFPLSPAVVDVHEWFETLRPSWYSAGPALHLAILEAARAHPEGLG
FT                   RQRPRFASSGGAPLGQEIIGSFERTLGFPLLEHYGSSEAAQIAANTPDARKPGTVGRPW
FT                   PETLSIVGEDGQPVAPGERGEIRVRGATVMPGYLGDEALNREVLRDGWFHTGDIGSLDE
FT                   EGFLHLHGRLREVINRGGEKVSLSEVDAALLRHPAVAEAAAFGVPHQRLGQDVAAAVVL
FT                   RAAMEVTGAELQRFLRDELVYFKVPRRVQIIEALPRGLTGKVLRHRLADAYVQQRNERA
FT                   RLATGAVAASQLEQDVLAIWRRLLKTEAVGPEDNFLDSGGDSLLATEMLTELEQMLGRV
FT                   IPESLLIEAETARELAARLENLANHVIPVIDFNAQPGRTALFWFHGDFAHGGYYIRRLA
FT                   RLLGPQQPLTAIAPHGMANEPIPASVQQMARERLPLILERQAQGPYRIGGYCNGALVAF
FT                   EAARLLIEAGHEVEIVALIDPPTANVRPWSRAILRSLDRVLPDMHLARAYEALSRFGET
FT                   SKWPYPKRIANLVWKISRRSVRMVRQRLAGHVPTPPTARDREVRVRFLHYSLVMARYLP
FT                   ERIDAPVVYFSADYTSRAWRDMGTSFESYDVLGGHHRCVKDYTASIATPLRALLEDSAA
FT                   AMPGQSGLMLPLTEPGERDGLVP"
FT   gene            235429..237354
FT                   /locus_tag="PST_0200"
FT   CDS_pept        235429..237354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0200"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /note="Code: ER; COG: COG3185"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77907"
FT                   /db_xref="GOA:A4VG06"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG06"
FT                   /protein_id="ABP77907.1"
FT                   /translation="MKRSIATVSLSGTLPEKLEAVAAAGFDGIELFENDLLYHSGSPQD
FT                   IRRRCEDLGIEITLFQPFRDFEGCPRERLQRNLDRAERKFDLMQELGAELMLLCSNVQA
FT                   DALGDRETLLGDLALIAERAGARGLRVGYEALAWGRHVKTWRDVWTLVQQVDHPALGVI
FT                   LDSFHTLALRDDPNAIVEIPGERIFFVQLADAPLLSMDVLEWSRHFRCFPGQGEFDLAG
FT                   FLAPVLQAGYGGPLSLEVFNDGFRAAPPRGVAADGLRALLHLEELTGQRLSATARPAPA
FT                   AQTLFTPPPAPRYEGIDFLEFAVDEPHAARLGDWLQRLGFAHVGQHRSKAVQLYRQGEI
FT                   NIVLNAEPYSFAHNYFEAHGPSVCAMALKIDDEASALARACAFGGQPYRGLIGPNERQI
FT                   PAVRAPDGSLIYLLESGAPGQSNYDIDFRLHAVAPVGAGLQRIDHMATALPAESLASWV
FT                   LFYRSLFDFEADDELVLPDPYGLMKCRAMRSPCGRVRLPLNTSQDRHTVIGQTLSSYRG
FT                   AGVHHVAFACDDIFAEVARAQAAGVPLLKIPRNYYDDLAARFDFDDASLAELARYNVLY
FT                   DRDADGGELFHVYTEPFEGRFFFEILQRCNDYAGYGTANVAVRLAAMAKQCRRAAPATR
FT                   VMASAG"
FT   gene            237402..239957
FT                   /locus_tag="PST_0201"
FT   CDS_pept        237402..239957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0201"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77908"
FT                   /db_xref="GOA:A4VG07"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG07"
FT                   /protein_id="ABP77908.1"
FT                   /translation="MIASGPPPCGLPVSCGRWSPVVPTPKPIGLRQWIWRAFVRSALIP
FT                   LVLVEAGLIAIYLLTNSAIRDAQIEHLRETALNDLQASASLESRLISEQLEQVASLTEL
FT                   YRNLTAQALLGDAPVAPPELALSGDGVRYSPENNGGAAVFYSNATPAERHDMEKIARLR
FT                   QLEPLMKEIEARNPLVASLYFNSWDSFNHIYPWFFTLDQYPADMDIPQYNFYYLADAEH
FT                   NPGRGVVWTDVYLDPAGHGWMMSAVAPVYRDDFLEGVVGIDITVSGILEQIGQLQVPWG
FT                   GYAMLVSDDLSIMALPEPGEEDFGLAELTEHSYLDAIRSEMFKPEDFRLDRRRETAELA
FT                   AAISGADRGVQQVMLGGRPQLVAWTTVAQTGWHLLTVVDEAAVFRQTNALASRYRQIGY
FT                   LLIAGLLLFYIGFYAVMWLRARQLSQALRDPIAGISQMMKEIGRGRWRPAAVHADIREL
FT                   DDMSRQTLELGNRLATSEVQRGDTQRRLELVLESATESLWEYDMVNQSLRVRGNLVARF
FT                   GLPAAELPDSQFRQRIHPDDLPQALAQIERIKLGLQSRYEAKYRFADALGEYRWLLSRG
FT                   RVLERDPDTGAPRVLAGTHVDIDALKRVEEELRAATAQAQAASEAKGRLLSGISHELRT
FT                   PLNAILGFAQLMRMDCDDESQAEAAEYLDEILLASRHLNQLLGEILEWSSLQQEAPQLE
FT                   LQAVDVCGLMRECAELVSLEVQQRGLQLELSLPDEDLQVLAEPRRLRQVVLNLLSNAMK
FT                   YNIPEGRIALRAETTPTLVRLLVEDTGLGIDPAQQGQVFEPFQRLGRENSMIQGTGIGL
FT                   SLCLEFARLMNGQMGLHSEPGVGSRFWIELPRLVPHPAR"
FT   gene            240143..240607
FT                   /gene="purE"
FT                   /locus_tag="PST_0202"
FT   CDS_pept        240143..240607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="PST_0202"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /note="Code: F; COG: COG0041"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77909"
FT                   /db_xref="GOA:A4VG08"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG08"
FT                   /protein_id="ABP77909.1"
FT                   /translation="MGSKSDWSTLSHTADMLEKLGIPHEVTVVSAHRTPDLLFQYAEQA
FT                   EARGLRVIIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSIVQMPAGVPVA
FT                   TLAIGKAGAINAALLSASILGHEFPEYHQALKKFRDEQTQTVLDNPDPRG"
FT   gene            240684..241769
FT                   /gene="purK"
FT                   /locus_tag="PST_0203"
FT   CDS_pept        240684..241769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="PST_0203"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /note="Code: F; COG: COG0026"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77910"
FT                   /db_xref="GOA:A4VG09"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG09"
FT                   /protein_id="ABP77910.1"
FT                   /translation="MKIGVIGGGQLGRMLALAGTPLGMSFAFLDPAPDACAQALGEHIR
FT                   ADYDDKDHLRRLADEVDLVTFEFESVPAETVAFLSQFVPVYPSAESLRIARDRWFEKSM
FT                   FKDLGIPTPEFADIQSQADLDAAVASIGLPAVLKTRTLGYDGKGQKLLRKPADVAGAFA
FT                   ELGSVPCILEGFVPFTGEVSLIAVRGRDGETCFYPLVHNSHESGILRLSVASSNHPLQA
FT                   LAEDYVGRVLAKLDYVGVLAFEFFEVDGGLKANEIAPRVHNSGHWTIEGAECSQFENHL
FT                   RAVAGLPLGSTAKLGESAMLNFIGEVPPVDKVIAIEDCHLHHYGKAFKTGRKVGHATLR
FT                   CPDRATLDRQITAVETLIPHS"
FT   gene            241854..242105
FT                   /locus_tag="PST_0204"
FT   CDS_pept        241854..242105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2261"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77911"
FT                   /db_xref="GOA:A4VG10"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG10"
FT                   /protein_id="ABP77911.1"
FT                   /translation="MGIIGTIIIGLIVGLIARFLKPGDDSMGWIMTILLGIGGSLLATY
FT                   GGQALGLYQAGEGAGFIGAVVGAIILLVIYGMVTSRKH"
FT   gene            242158..242694
FT                   /locus_tag="PST_0205"
FT   CDS_pept        242158..242694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3495"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77912"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG11"
FT                   /protein_id="ABP77912.1"
FT                   /translation="MRSFLASLFCCLALIATVHAAPSELDWLELMPPEDRQALEEMPEI
FT                   DHATPEDLGFSDQGGLKQEAGLPPVMYSAKTVAELNGREIRLGGYPVPLESDARGRSTE
FT                   FFLVPYPGACIHVPPPPPNQIVLVRYPKGIALEDIYAPLWVDGRLQIEPVSNDMADAAY
FT                   ALDAAAVELVEEDDY"
FT   gene            242700..243371
FT                   /locus_tag="PST_0206"
FT   CDS_pept        242700..243371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0206"
FT                   /product="probable uracil-DNA glycosylase"
FT                   /note="Code: L; COG: COG1573"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77913"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG12"
FT                   /protein_id="ABP77913.1"
FT                   /translation="MPASLRQALRDLAADTDGIDTAIYATYERDPLEPIIGLGDADAPL
FT                   CFFGRDPGREEVRHGEPFIGSGGQIVRRVLYRHLHGAEMPDFEAGRALGRHYFWINTVP
FT                   YKPIGNKAWSMAVKRCFQPLMRQLLIDSWHGRHIVTLGREAFLWFAIGQPREARQRLEA
FT                   FWQREDRFTANLDIDLQDAQGHARTFTLHSLPHPSPLNQTWFKRFPALLEARLRQLDAS
FT                   R"
FT   gene            complement(243361..244443)
FT                   /gene="ldhA"
FT                   /locus_tag="PST_0207"
FT   CDS_pept        complement(243361..244443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="PST_0207"
FT                   /product="D-lactate dehydrogenase (fermentative)"
FT                   /note="Code: CHR; COG: COG1052"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77914"
FT                   /db_xref="GOA:A4VG13"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG13"
FT                   /protein_id="ABP77914.1"
FT                   /translation="MPPVISGDRSDLAAAGNCRTLSAVAPYREAPMRITLFSSKPYDRD
FT                   SFQAANRSRGFELHFLETRLDPDTAALATGAEVVCPFVNDVLSAPVLEQLAAGGTRLIA
FT                   LRSAGYNHVDLPCARRLGLPVVRVPAYSPHAVAEHTVALILALNRRLPRAYNRTREGNF
FT                   SLQGLTGFDLVGKRVGVVGSGQIGAVFARIMQGFGCEVQLYDPYPNPELERLGMRYVAI
FT                   DELLAGSDIVSLHCPLTEETHHLINQQSLATMKPHAMLINTGRGALIDTPALIGALKSG
FT                   QLGYLGLDVYEEEAGLFFEDHSGLPLQDDVLARLLSFPNVIVTAHQAFLTEEALAAIAG
FT                   TTLGNVAAWQAGQLANQVSD"
FT   gene            complement(244447..245433)
FT                   /gene="cysA"
FT                   /locus_tag="PST_0208"
FT   CDS_pept        complement(244447..245433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PST_0208"
FT                   /product="sulfate transport protein CysA"
FT                   /note="Code: P; COG: COG1118"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77915"
FT                   /db_xref="GOA:A4VG14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG14"
FT                   /protein_id="ABP77915.1"
FT                   /translation="MSIEVRDVNKRFGQFQALQAIDLHIQSGELVALLGPSGCGKTSLL
FT                   RIIAGLETPDSGSIVFHGEDVSSRDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   KLRPSEAVIAAKVHELLNLVQLDWLADRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDVHLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGTPA
FT                   EVYRNPASEFVYHFLGDANRLQLDDERSVLFRPHEVSLSREALAEHLAGEVRDIRPLGA
FT                   LTRVTLKVAGQAEPIEAEVGNDHASLVGVQRGSTLYFQPKGQALRAG"
FT   gene            complement(245430..246305)
FT                   /gene="cysW"
FT                   /locus_tag="PST_0209"
FT   CDS_pept        complement(245430..246305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PST_0209"
FT                   /product="sulfate transport protein CysW"
FT                   /note="Code: P; COG: COG4208"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77916"
FT                   /db_xref="GOA:A4VG15"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG15"
FT                   /protein_id="ABP77916.1"
FT                   /translation="MTTASLPVSANARATTTRRGKQTARRLLIGAAWLTFALFLLLPLL
FT                   IVLGEAFKQGVGTFFTAILEPDALAALKLTLVAVGISVPLNLVFGVAAAWCVSKYEFRG
FT                   KSLLVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSDRDIQIVFAVPGIVLATLFVT
FT                   VPFVARELIPLMQEQGSTEEEAARLLGASGWQMFWHITLPNIKWGLIYGVVLCTARAMG
FT                   EFGAVSVVSGHIRGLTNTLPLHVEILYNEYNHVAAFSVASLLLALALVILLLKQWSESR
FT                   IARLKTGAQP"
FT   gene            complement(246316..247131)
FT                   /gene="cysT"
FT                   /locus_tag="PST_0210"
FT   CDS_pept        complement(246316..247131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PST_0210"
FT                   /product="sulfate transport protein CysT"
FT                   /note="Code: O; COG: COG0555"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77917"
FT                   /db_xref="GOA:A4VG16"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG16"
FT                   /protein_id="ABP77917.1"
FT                   /translation="MSRSTSVIPGFGLTLGYTLVYLSLLVLIPLGALFLKTTELSWAQF
FT                   IAIVSAPRVLAALKLSFGTAFAAAVLNGVIGTLLAWVLVRYRFPGRKLIEAMIDLPFAL
FT                   PTAVAGIALTALYAPNGPIGQFATQMGFKIAYSPLGITLALTFVTLPFVVRTLQPVLAD
FT                   IPREVEEAAACLGARPLQVVRHVLLPALLPAWLTGFALAFARGVGEYGSVIFIAGNMPM
FT                   KTEILPLLIMVKLDQYDYVGATAIGVLMLVVSFILLLAINLLQRRIAHG"
FT   gene            complement(247271..248269)
FT                   /gene="cysP"
FT                   /locus_tag="PST_0211"
FT   CDS_pept        complement(247271..248269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysP"
FT                   /locus_tag="PST_0211"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="Code: P; COG: COG1613"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77918"
FT                   /db_xref="GOA:A4VG17"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG17"
FT                   /protein_id="ABP77918.1"
FT                   /translation="MSIRRFALAALASALIAGPALAADTLLNVSYDPTRELYVEFNDAF
FT                   NKHWQAQGHELIKIQQSHGGSGKQARAVIDGLRADVVTLALAGDIDELHRLGKLIPEDW
FT                   QTRLPDASTPYSSTIVFLVRKGNPKGIKDWDDLVKPGVEVITPNPKTSGGARWNFLAAW
FT                   AYAQQKFGDEQQAHAFVEKLYKNVPVLDTGARGSTVTFVNNGIGDVLLAWENEAFLALK
FT                   EQGGEDFEIIAPSLSILAEPPVAVVDKNVERKGTRALAEAYLNYLYSEEGQRIAAKNFY
FT                   RPRNEAVAAEFKDQFPALKLVTIDGDFGGWKAAQPKFFNDGGIFDQIYQTH"
FT   gene            complement(248540..248719)
FT                   /locus_tag="PST_0212"
FT   CDS_pept        complement(248540..248719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77919"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG18"
FT                   /protein_id="ABP77919.1"
FT                   /translation="MTATIRNLEGQDEASILREIHSALSGLKFGSVEITVHNGQVVQIE
FT                   RKEKFRLQPTGKNA"
FT   gene            248977..249552
FT                   /locus_tag="PST_0213"
FT   CDS_pept        248977..249552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG3545"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77920"
FT                   /db_xref="GOA:A4VG19"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG19"
FT                   /protein_id="ABP77920.1"
FT                   /translation="MRSIRYLIVPGWHGSPDEHWQSHWQRTLPGSARVEQQDWLLPRRE
FT                   DWVAELQRSIAAHAEPVILVAHSLGCITVAHWAAQAPAQLLQRVRGALLVAPADVERSG
FT                   CPEPLRNFAPIPRQPLPFASLLIGSDNDTAASAARAVEMGHAWGSETTILAGAGHINVA
FT                   SGHRRWEQGFASLYRLQSRIERQAQRRA"
FT   gene            249617..250255
FT                   /gene="lsfA"
FT                   /locus_tag="PST_0214"
FT   CDS_pept        249617..250255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lsfA"
FT                   /locus_tag="PST_0214"
FT                   /product="antioxidant protein LsfA"
FT                   /note="Code: O; COG: COG0450"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77921"
FT                   /db_xref="GOA:A4VG20"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG20"
FT                   /protein_id="ABP77921.1"
FT                   /translation="MSIRLGDIAPDFEQDSSEGRIRFHEWLGDSWGVLFSHPADFTPVC
FT                   TTELGFTAKLKDEFAKRNVKAIALSVDPVDSHIKWIDDINETQNTRVNFPILADADRKV
FT                   SELYDLIHPNANDTLTVRSLFVIDPNKKVRLTITYPASTGRNFHEILRVIDSLQLTDNH
FT                   KVATPANWQDGDEVVIVPSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR"
FT   gene            complement(250288..250512)
FT                   /locus_tag="PST_0215"
FT   CDS_pept        complement(250288..250512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77922"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG21"
FT                   /protein_id="ABP77922.1"
FT                   /translation="MDNYHINVTDSGWELRKQGATRASKTAATKDEMLQVTAAFLEGRT
FT                   ASVKIHKKDGTIQEERTYPRSADPRRSEG"
FT   gene            250643..251200
FT                   /locus_tag="PST_0216"
FT   CDS_pept        250643..251200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3575"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77923"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG22"
FT                   /protein_id="ABP77923.1"
FT                   /translation="MPTHAQLRDIIAADPLRMRCLAHVRALALPDCWVAAGFVRSAVWD
FT                   HLHRHGRSALPADIDVIWFDRARCDAAVDAEIEARLRRADASLEWSVKNQARMHLHNGD
FT                   RPYRTAADAMCHWPETATAIGVRLSAEGEIEVAAPLGLDDLFALIVRPTAAFRGRKRQV
FT                   YLDRLAAKRWSETWPDLRIVQG"
FT   gene            complement(251221..251640)
FT                   /locus_tag="PST_0217"
FT   CDS_pept        complement(251221..251640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77924"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG23"
FT                   /protein_id="ABP77924.1"
FT                   /translation="MIHYSASNGNVACGRTGSSLNSSADATQVSCKLCLRSVEKAVSEP
FT                   VRKTPSLAELRAAAKAAKTVAVAPAAVATTATTAAVKPASTRTPAAAIKAAPTAPDAAA
FT                   KPGAVPSVRAEWHKRLEQLPGRNRQPRGVARQTFI"
FT   gene            complement(252182..254146)
FT                   /locus_tag="PST_0218"
FT   CDS_pept        complement(252182..254146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0218"
FT                   /product="alkyl sulfatase"
FT                   /note="Code: Q; COG: COG2015"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77925"
FT                   /db_xref="GOA:A4VG24"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG24"
FT                   /protein_id="ABP77925.1"
FT                   /translation="MNLPYRWMLTSTLLLLSACSDGPAPSHSAATPRTQAAQAEVAQSY
FT                   DLSHVEGLAQARRGLIATPQGQVRDAEGEVIWDFDSFAFIQGEAPTTVNPSLWRQALLN
FT                   NQVGLFKVSDKIYQLRGFDLANMTLIEGDSGWIVIDPLTSRETAAFAMDFVAQHLGSRP
FT                   VSAMIFSHSHVDHFGGALGVISAEDAKVRQLPVIAPAGFMEEATSENLMMGIAMARRAT
FT                   FMYGKRLPRSAEGLVDNGLGKAVAFGHMGILPPTQLIDGREQTLDVDGVRFVFYNVPES
FT                   EAPAEMTFSLPELNAFGGAELLSQTLHNLYTLRGAKVRDALQWANYIDASRAQAAGAEV
FT                   LFNQHHWPVWGQDNIQTFLTTQRDAYRYLHDQTVRLMNAGLTAPEIAEQLHLPPSLDRH
FT                   LNVHDYYGTLKHNVRGIYQFYLGWFDANPANLDPLPPVAAAAKYVALAGGREPLLAAAE
FT                   QAYAEGDYRWAAELGKHLLYADPDNQGARDLQARSFEQLGYQAESGPWRNFYLSGTYEL
FT                   RHGLPEEGFTPVMMLDMLKHTAPERFLDVMATKLNGTAAADSALRINLNFTDSGARYHL
FT                   WIENAVLHHRRMNEGEVAEADASLNLSKDFFLQIISGQAGAAALLSSDQVSIDGNPLAL
FT                   GRFFSLLDQPDGRFPIVTR"
FT   gene            254239..255186
FT                   /locus_tag="PST_0219"
FT   CDS_pept        254239..255186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0219"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77926"
FT                   /db_xref="GOA:A4VG25"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG25"
FT                   /protein_id="ABP77926.1"
FT                   /translation="MNIEFRHLRHALALVEHGNFARAAEALHLSQPALTRSLQALEAQV
FT                   GEQLFDRSHREVTPTTMGELLLQHARQLLLHAQDLQRDLQLARGLEQGELRVGVGPFAG
FT                   AALVAPVLAILNRAHPGVHLEVVLAPWQELPARLQRREIDLLVADLHEIEDDPSYTIQA
FT                   LGEHHTLPMCRAGHPLLEHPEPSLEMLLKYPLAGPNLPEDIREQLLKRLPRALQNTWRE
FT                   QWKLAITCDSSAIIKQLLQGCEALAILPWFMVEDELRRGDLQALRSLDPGLRGRFGIAH
FT                   LRGRRLSLAAQCFIEVLLAHDTTVRQRQDAWLAR"
FT   gene            complement(255265..256695)
FT                   /locus_tag="PST_0220"
FT   CDS_pept        complement(255265..256695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77927"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG26"
FT                   /protein_id="ABP77927.1"
FT                   /translation="MATSIRRPTATSSHSPLAPSSEDLSMLNSPISRHTLLALSLMISM
FT                   PAFCAVSAEQAAQLDQQLTPMGAERAGNTDGSIPAWDGGYKPSTSGGALVDPYAAEQPL
FT                   QRIDSGNMAQFAQWLSPGTQAMLRQYPQSFHLQLYPSHRSAAYPESILKQSRQNATRIR
FT                   LNASGSGLEGGYTSGVPFPVPLRAEEVIWNHVTRYRGGAVKREVHRMPVQTSGAYQASL
FT                   IRQTQVFASNVRDNTPDSNLLFYFIGQTLAPARQAGNIALIHEPLDQVQTPRQAWAYNA
FT                   GQRRVRRAPTLAYDSPQNSSDGLATSDNMDMYNGAFDRYDWTLKGKRELLIPYNNYRLH
FT                   DKGLKYAQIIQPAHLNSDYVRYERHRVWEVEGKLKAGQRHIYDKRTFFIDEDTWQIALA
FT                   DHYDARGELWRVSAAYQLNFYNDLVPWMTAEAIHDLQSRRYLVSGLSNETPSEASFGHE
FT                   ALRQDFKPDALRRLGGKN"
FT   gene            complement(256631..258622)
FT                   /locus_tag="PST_0221"
FT   CDS_pept        complement(256631..258622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0221"
FT                   /product="type V secretory pathway, adhesin AidA"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77928"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG27"
FT                   /protein_id="ABP77928.1"
FT                   /translation="MRAKKQGTYAAYLKPPGKRGNRLHSQQQKQFPRHTMHQLRRGHGA
FT                   LVFTLLAVNSTLCHAATFELDNGISGRWDTSLSTGMSISTSDPDRNLLPTVYDGRAAGI
FT                   NGNDGRMNFKAGDTISRVVKGTTELALSRDNLGLQISGKFWHDDLLENGDARFKDFDDS
FT                   GFDSLAKFSGAELMDAYVWGEFQLNDRPLDLRLGQQVLSWGESTFIQGGLNVINPIDAN
FT                   ALTTPGVEIKEALIPVNLFNLSLGISENLSTSAFYQLEWRATVQPGCGTFFAQSDASQP
FT                   GCGPLYAVSGRTEAQQENMQLVNPLLPAGANMVIPRISDDTPADAGQWGVRLDYFAEEL
FT                   NSTELAFYVMNYHSRLPYTNAITADYSKRPGSGFFLPGVTNNPLYGGSNAKPLAQAPLY
FT                   QMAFPEDIRLYGISFNTSGPWGISMSGELSHRPNQPIAINGQDFLYASGFLDTESPIVD
FT                   ELFGLDIQAPGSGPILAKAAGLYGTQVQGYRRKPVSQLQLTAMQTFSDIWGADNLLLIA
FT                   EVGTVHVADLEPVETLAYGRDAVYGSGVEGAAIACKNPALKQDYCQREGYTTPWSWGYA
FT                   ARANLTYNDLLPGTVVTPSLAWRYDVEGYAPSPAPQFVEGRQAVTLAVNFDYLERYNAA
FT                   VSYTDFFGGDFNPQTDRDFISFTLGAKF"
FT   gene            258760..259698
FT                   /locus_tag="PST_0222"
FT   CDS_pept        258760..259698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0222"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Code: K; COG: COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77929"
FT                   /db_xref="GOA:A4VG28"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG28"
FT                   /protein_id="ABP77929.1"
FT                   /translation="MLEAGIDPRVIRDPELRVAVVNMWKLWRLCVERTGDDSFGLQVAA
FT                   NLYPTHLNALIFALQASSTLREALDRLQRYVRVVTTIAAIEVVESPVGVALILGSDSSG
FT                   SAQRPFFPVDAFMGVLFRTFRELLGASAAEGLLEVRLCRPVPHRLEAFEQFFGVPVYFG
FT                   AEANVMLMASGVLDRELPAANAMIAGMNEQLLRDYLGRMRHEQVSLQVRKEIIALLSSD
FT                   KLGLEHIAERLNMSGRNLHRKLAEEGTSFKELQDEIRQDLALRYLGMSGMSLNEIAFNL
FT                   GFIDQSSFNRAFKRWTGGSPGQYRRALRERH"
FT   gene            complement(259736..261220)
FT                   /locus_tag="PST_0223"
FT   CDS_pept        complement(259736..261220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77930"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG29"
FT                   /protein_id="ABP77930.1"
FT                   /translation="MKLKLLATVLVGAALTAGYQYLAVPDLQKKDPDAGLSRDEIRQRD
FT                   ERAQENWAYSLGLQAYVWGLPLTITDRERLLRLNERKLKFVTERQICPCAPINQIGHMT
FT                   KLATSQDELPYTPNNDTIYSGVMLELKDDPVILSLPDVQDRYWSVQVADAYLENLPYIG
FT                   TRATQGKGGHYLFAGPDWQGEVPTGVELRRLSTNSGALALRYGVSKEDPQDLPRVLELQ
FT                   KQVHTTSLSNWGKPDGFGKVTTVKMSRKEYSGDLALFERMVDLLNENPPRSEQRAAVSM
FT                   FQSIGIELGKPFDASRLHPATVAGLKRALADSQDLMTWKVKYRGTPYPTRWNNLHEGSY
FT                   GFHFINRAEGALEGLMVHDREEGVYFSTYEDGTGQLLDGQQRYILHFERDALPQLQDKG
FT                   FWSITLYGTNFQLVDNAIDRYSIGDRTPGLTYNPDGSLTLYIQHQPPTGLESNWLPSPD
FT                   KGLFRLNYRIYLPDEKTRNPKTLQQFIPPIQPQARS"
FT   gene            261656..263431
FT                   /locus_tag="PST_0224"
FT   CDS_pept        261656..263431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0224"
FT                   /product="TniA transposase"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77931"
FT                   /db_xref="GOA:A4VG30"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG30"
FT                   /protein_id="ABP77931.1"
FT                   /translation="MCIRLLTARYQDSSARNSSMLNTRVHQSEMSMATDTAPITEHGVA
FT                   TLPEQAWERARRRAEIIGPLAQSETVGHEAADAAAQALGLSRRQVYVLIRRARLGSGLV
FT                   TDLALGQSSGGKGKGRLPESVERIIRELLQKRFLTKQKRSLAAFHREVVRACKLQKLRV
FT                   PARNTVALRIAGLDPREVTHRREGQDAARDLQGVGGVPPPVSAPLEQVQIDHTVIDLIV
FT                   VDERDRQPIGRPYLTLAIDVFTRCVVGMVVTLEAPSAVSVGLCLVHAACDKRPWLEGLN
FT                   VEMDWPMSGKPRLLYLDNAAEFKSEALRRGCEQHGIRLDYRPLGQPHYGGIVERIIGTA
FT                   MQMIHDELPGTTFSNPDQRGEYASEKMAALTLRELERWLTLAVGTYHGSVHNGLLQPPA
FT                   ARWAEAITRTGVPTVITRATAFLVDFLPIIRRTLTRTGFVIDHIHYYADALKPWIARRD
FT                   RLPAFLIRRDPRDISRIWVLEPEGQHYLEIPYRTLSHPAVTLWEQRQALAKLRQQGREQ
FT                   VDESALFRMIGQMREIVTTAQKATRKARRDADRRQHLKATATPVKTTPPPGADMDGQQA
FT                   DNQPPAKPFDQIEEW"
FT   gene            263434..264342
FT                   /locus_tag="PST_0225"
FT   CDS_pept        263434..264342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0225"
FT                   /product="TniB, putative NTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77932"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG31"
FT                   /protein_id="ABP77932.1"
FT                   /translation="MEEYPIIDLSHLLPAAQGLARLPADERIHRLRADRWIGYPRAVEA
FT                   LNRLEILYTWPNKQRMPNLLLVGPTNNGKSMIVEKFRRTHPARADADQEHIPVLVVQMP
FT                   SEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSV
FT                   NRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRFEPMMLPVWEANHDCCSL
FT                   LASFAASLPLRRPSSIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHRT
FT                   LSMADYTGPSERRRQFERELM"
FT   gene            264339..265556
FT                   /locus_tag="PST_0226"
FT   CDS_pept        264339..265556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0226"
FT                   /product="TniQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77933"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG32"
FT                   /protein_id="ABP77933.1"
FT                   /translation="MKPAPRWPLHPAPREAEALSSWLNRVALCYHMEVSELLEHDLGHG
FT                   QVDDLDTAPPLALLAMLSQRSGIELDRLRCMSFAGWVPWLLDSLDDQIPAALETYAFQL
FT                   SVLLPRLRRKTRSITSWRAWLPTQPIHRACPLCLNDPENQAVLLAWKLPLMLSCPLHGC
FT                   WLESYWGVPGRFLGWENADAEPRTASDAIAAMDQRTWQALTTGHVELPRRRIHAGLWFR
FT                   LLRTLLDELNTPLSTCGTYAGYLRQIWECCGHPLRAGQSLWRPYETLNPAVRLQMLEAA
FT                   ATAISLIEVRDISPPGEHAKLFWSEPQTGFTSGLPAKAPKPEPVDHWQRAIQAIDEAII
FT                   EARHNPETARSLFALASYGRRDPASLEQLRATFAKEGIPPEFLSHYEPSLPFACLRQND
FT                   GLSDKF"
FT   gene            265617..266231
FT                   /locus_tag="PST_0227"
FT   CDS_pept        265617..266231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0227"
FT                   /product="TniR protein"
FT                   /note="Code: L; COG: COG1961"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77934"
FT                   /db_xref="GOA:A4VG33"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG33"
FT                   /protein_id="ABP77934.1"
FT                   /translation="MLIGYMRVSKADGSQATDLQRDALVAAGVDPAHLYEDQASGKRED
FT                   RPGLAACLKALRPGDTLVVWKLDRLGRDLRHLINAVHDLTGRGIGLKVLTGHGAAIDTT
FT                   TAAGKLVFGIFAALAEFERELIAERTIAGLASARARGRKGGRPFKMTAAKLRLAMAAMG
FT                   QPETKVSDLCQELDITRQTLYRHISPKGELRPDGAKLLNRA"
FT   gene            complement(266687..267601)
FT                   /locus_tag="PST_0228"
FT   CDS_pept        complement(266687..267601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0228"
FT                   /product="probable cation efflux system protein"
FT                   /note="Code: P; COG: COG1230"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77935"
FT                   /db_xref="GOA:A4VG34"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG34"
FT                   /protein_id="ABP77935.1"
FT                   /translation="MSAEHDHSHTPASFDKAFAVGIALNLSFVGIEAFYGWKIDSLALL
FT                   ADAGHNLSDVAGLVLAWGGALAGKLQANLRHTYGWKKGSILAAFANALLLLVAMGALGW
FT                   EAVGRLMSPEEANGHEGATIMAVAGVGILINAATALLFMRGRDTDLNIRGAFLHMAADA
FT                   LVSAGVVVAGALTLWMGWPWLDPVVSLLIAAIIVWGTWGLFKQSLHLLFDGVPDDIDAQ
FT                   AVHDYLAGLPGVQFVHDLHIWGLDTKQAAMTAHLVMPDGSADDAFFQNIAETLHERFGI
FT                   THSTVQVVRQPYSLTCASWGKAL"
FT   gene            complement(267602..267850)
FT                   /locus_tag="PST_0229"
FT   CDS_pept        complement(267602..267850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77936"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG35"
FT                   /protein_id="ABP77936.1"
FT                   /translation="MEFAIHRFHDLFVQLGLPNQPHEIHQFLAEHRPVAPDIELPNAPF
FT                   WTPAQASFLREALEQDSNWSELADQLSEALRSPEGVR"
FT   gene            complement(267861..268280)
FT                   /locus_tag="PST_0230"
FT   CDS_pept        complement(267861..268280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0230"
FT                   /product="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77937"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG36"
FT                   /protein_id="ABP77937.1"
FT                   /translation="MSDTPVKMRFHVESRRIDAHRSESTCKLASITLDTDMGGNPHAFN
FT                   PAELLLAALSACMIKGIERVVPILKFELRGVQVIVDGVRQDVPPKMESIRYEIVVDTDE
FT                   SDRRIDLLHDNVKKYGTVFNTVTPGTDLAGVMRRA"
FT   gene            complement(268285..268773)
FT                   /locus_tag="PST_0231"
FT   CDS_pept        complement(268285..268773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0231"
FT                   /product="putative transferase/hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77938"
FT                   /db_xref="GOA:A4VG37"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG37"
FT                   /protein_id="ABP77938.1"
FT                   /translation="MIDHQTLGEAKQVCPTTTQRLVREGALLVDVRERTEVASLAFDVP
FT                   AIVNIPLFEMEQRWGELPKDRELVLVCESGERSLKATYYLQFQGFTRVSNMEGGLLKWM
FT                   RKGFAVIGQRYEAPAATATSSCCGGEAAEPVSAASTFCGSTAPAASSTGCCAPSPTKE"
FT   gene            complement(268785..269021)
FT                   /locus_tag="PST_0232"
FT   CDS_pept        complement(268785..269021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0232"
FT                   /product="thiol-disulfide isomerase and thioredoxins family
FT                   protein"
FT                   /note="Code: OC; COG: COG0526"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77939"
FT                   /db_xref="GOA:A4VG38"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG38"
FT                   /protein_id="ABP77939.1"
FT                   /translation="MKEIKVLGTGCANCKSTIALIDQVAKAKGVEVKLEKVEELRDIMG
FT                   YGVMSTPGVVIDGKVVHAGGVPGREKIEQWLTA"
FT   gene            complement(269032..270069)
FT                   /locus_tag="PST_0233"
FT   CDS_pept        complement(269032..270069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0233"
FT                   /product="permease"
FT                   /note="Code: R; COG: COG0701"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77940"
FT                   /db_xref="GOA:A4VG39"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG39"
FT                   /protein_id="ABP77940.1"
FT                   /translation="MTTLAMRWTQRNPTAFLVVAALLWWGLYQSLIPASEALVAALPVA
FT                   RDSHLGGALQFFFYDTPKVLLLLTGVVFVMGMVNSYFTPERTRALLVGRSEGVANMMAA
FT                   SLGIVTPFCSCSAVPLFIGFVQAGVPLGVTFSFLISAPMVNEVALTLLFSLFGWKIAAL
FT                   YLGLGLSVAVVAGWIIGRLKMEAHLEDWVRDMPKMSAGFEAAETTLADRVQAGFASVRD
FT                   IVGKVWPYILAGIAIGAGIHGWVPEDFMASFMGKDAWWSVPLAVLIGVPMYTNAAGVIP
FT                   IVQALLAKGAALGTVLAFMMSVIALSLPEMVILRKVLKVRLIATFIGVVATGIMIVGFV
FT                   FNWVL"
FT   gene            complement(270154..270720)
FT                   /locus_tag="PST_0234"
FT   CDS_pept        complement(270154..270720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0234"
FT                   /product="sigma-70 factor region 2"
FT                   /note="Code: K; COG: COG1595"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77941"
FT                   /db_xref="GOA:A4VG40"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG40"
FT                   /protein_id="ABP77941.1"
FT                   /translation="MAGSNTSFECVLRAWEAHERELLAFLILRARDRNAAEDLLQEVFL
FT                   KAMRQGKGFCSLENPRAWLFQVARNAVVDATRLAKPNAELTDELAESLVASPTSERVPV
FT                   DELDACVERNLPALEAEDRHIIAACDLQGQTVRAYAEANQLTLAAAKSRLLRARKRLRD
FT                   SLIVNCQVRFDDTGQVCCHTPRPSA"
FT   gene            complement(270723..271742)
FT                   /locus_tag="PST_0235"
FT   CDS_pept        complement(270723..271742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0235"
FT                   /product="sodium bile acid symporter family protein"
FT                   /note="Code: P; COG: COG0798"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77942"
FT                   /db_xref="GOA:A4VG41"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG41"
FT                   /protein_id="ABP77942.1"
FT                   /translation="MSVFERYLTVWVFLCIVIGIALGQFFPAAFQSIGRMEIAQVNLPV
FT                   GLLIWVMIIPMLVKVDFGALHEVRQHVRGIGVTLFVNWLVKPFSMAFLGWFFIRNLFAP
FT                   MLPADQLDSYIAGLILLAAAPCTAMVFVWSRLTNGDPLFTLSQVALNDSIMVIAFAPLV
FT                   GFLLGISAITVPWDTLITSVVLYIVIPVILAQLLRKQLLAKGPDAFEATMAKIGPWSIT
FT                   ALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFFNSALAYWLNRLVGEKHNVACPS
FT                   ALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVMLLVVRVVNASKPWYEAR"
FT   gene            complement(271805..272308)
FT                   /locus_tag="PST_0236"
FT   CDS_pept        complement(271805..272308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0236"
FT                   /product="arsenate reductase, putative"
FT                   /note="Code: T; COG: COG0394"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77943"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG42"
FT                   /protein_id="ABP77943.1"
FT                   /translation="MENKIYNVLFICTGNSARSIKAEVIMNHLGRERFKAYSAGSHPRG
FT                   EVHPMTLEVLSEQCYDLGGLRSKSWTEFAEPDAPQMDFIMTVCDQAAGEACPAWPGQPI
FT                   TAHWGFADPTKIEGDREKQLKAFSNAQFQIANRIRLFMSLPIEKIDRMSLQTKLRELGQ
FT                   QRDA"
FT   gene            complement(272310..274082)
FT                   /locus_tag="PST_0237"
FT   CDS_pept        complement(272310..274082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0237"
FT                   /product="arsenical pump-driving ATPase"
FT                   /note="Code: P; COG: COG0003"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77944"
FT                   /db_xref="GOA:A4VG43"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG43"
FT                   /protein_id="ABP77944.1"
FT                   /translation="MHFLNQPPRYLFFTGKGGVGKTSIACATAVQLASEGKRVLLVSTD
FT                   PASNVGQVFGESIGNHITAIPAVPNLWALEIDPQAAAQAYRDRIVGPVRGVLPETVVNG
FT                   IEEQLSGACTTEIAAFDEFTALLIDSTLTADYEHIIFDTAPTGHTIRLLQLPGAWSGFL
FT                   EEGKGDASCLGPLAGLEKQRTQYKAAVDALADPQRTRLVLVARAQRATLREVARTHEEL
FT                   AAIGLSQQYLVVNGVLPAREAAHDELAAAIHQREQTALTAMPDVLKALPRDQIDLKPFN
FT                   LVGLDALRHLLVATTSGSATSSIELPAQLDAPSLSSLVDEIAVDGHGLVMLMGKGGVGK
FT                   TTLAAAVAVELAHRGLPVHLTTSDPAAHLSETLEGSLSSLTVSRIDPHEETERYRKHVL
FT                   DTKGAQLDAEGRALLEEDLRSPCTEEIAVFQAFSRIIREAGKKFVVMDTAPTGHTLLLL
FT                   DATGAYHREVTRQMGNTGMHYTTPMMQLQDPKQTKVLIATLAETTPVLEAANLQSDLRR
FT                   AGIEPWAWIVNNSVAATRPDSLLLRQRAQNELREIDSVATHHAKRFAVVPLLKHEPVGV
FT                   DRLRDLANPITEEA"
FT   gene            complement(274098..274457)
FT                   /locus_tag="PST_0238"
FT   CDS_pept        complement(274098..274457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0238"
FT                   /product="arsenic operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77945"
FT                   /db_xref="GOA:A4VG44"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG44"
FT                   /protein_id="ABP77945.1"
FT                   /translation="MATIQIFDPALCCSTGVCGVEVDQALVSFAADVDWAKQNGAQVER
FT                   FNLAQQPLAFAENSTVKAFLERSGQDALPLILVDGEVALAGRYPNRTELARWTGIAAVS
FT                   APQSQGACCSGSRCC"
FT   gene            complement(274475..274912)
FT                   /locus_tag="PST_0239"
FT   CDS_pept        complement(274475..274912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0239"
FT                   /product="predicted protein-tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77946"
FT                   /db_xref="GOA:A4VG45"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG45"
FT                   /protein_id="ABP77946.1"
FT                   /translation="MQKQYHELIAGRIYFGGASDIQQIADVEHIDVVVDLREESTGCAA
FT                   SNPALIWQQIPLGDNAEQPQAPLFQDAIQAVVSAYRDGKKVAFHCGGGKGRTGTVAAGV
FT                   LLELGLCSTLEEAAATAKTIRPVVNIKPDQRAALESLYPNA"
FT   gene            complement(274937..275416)
FT                   /gene="arsC-3"
FT                   /locus_tag="PST_0240"
FT   CDS_pept        complement(274937..275416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC-3"
FT                   /locus_tag="PST_0240"
FT                   /product="arsenate reductase"
FT                   /note="Code: T; COG: COG0394"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77947"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG46"
FT                   /protein_id="ABP77947.1"
FT                   /translation="MNVLFLCTGNSCRSILGEATFNHLAPAGWKAMSAGSQPTGQVHPR
FT                   SLALLAREGISTEGYHSKSWDNLPTTPDIVITVCSSAAGETCPAYLGPVLRTHWGVEDP
FT                   AHATGTDEEIDAAFVTAYRILRARIEAFLALPLDDLQQDKAKLKAELDRIGTLLA"
FT   gene            complement(275413..275850)
FT                   /locus_tag="PST_0241"
FT   CDS_pept        complement(275413..275850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0241"
FT                   /product="arsenic resistance transcriptional regulator"
FT                   /note="Code: K; COG: COG0640"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77948"
FT                   /db_xref="GOA:A4VG47"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG47"
FT                   /protein_id="ABP77948.1"
FT                   /translation="MTDRHQDLISLFQLLLYSWTMEKNTATTIFESLSSGLRLDVYRLL
FT                   VRRGTEGMVAGEIASTLDVPPTNLSFHLKALTQAGMLTVEQEGRFQRYRANIPLMLDLI
FT                   AYLTEECCSGHPEQCADMRAVSKCSDAVLPPLSSTQKTPER"
FT   gene            276075..276632
FT                   /locus_tag="PST_0242"
FT   CDS_pept        276075..276632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0242"
FT                   /product="probable DNA invertase"
FT                   /note="Code: L; COG: COG1961"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77949"
FT                   /db_xref="GOA:A4VG48"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG48"
FT                   /protein_id="ABP77949.1"
FT                   /translation="MKIGYARVSRDDQQLDLQHDALSAAGCERIFSDKMSGAKASRPGL
FT                   DEALAFARPGDVLVVWRLDRLGRSMSELLRLTASLESTGVGLESLKEQIDTTNAAGRLV
FT                   FHVFAAMAEFERNLIRERTFAGLEAARARGRQGGRPGVPPETIAAIQALAGDQNRTPDE
FT                   ICKALKISRSTLYKYRQQASKS"
FT   gene            276629..276889
FT                   /locus_tag="PST_0243"
FT   CDS_pept        276629..276889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77950"
FT                   /db_xref="GOA:A4VG49"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG49"
FT                   /protein_id="ABP77950.1"
FT                   /translation="MIEIEFEVLYLGALLLLVDCICCLIAAYRRAPVLGAVAGGGTAGA
FT                   LALVLITRVMPFALAAVASIVIGGVIACVFRPTVTGRFGRS"
FT   mobile_element  276845..279483
FT                   /mobile_element_type="insertion sequence:RP6"
FT   gene            277095..278753
FT                   /locus_tag="PST_0244"
FT   CDS_pept        277095..278753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0244"
FT                   /product="ISPsy14, transposase"
FT                   /note="Code: L; COG: COG4584"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77951"
FT                   /db_xref="GOA:A4VG50"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG50"
FT                   /protein_id="ABP77951.1"
FT                   /translation="MRNIKECLRLKFEGGLSHEKIARALQLSKGVVSKYVTAANETGLE
FT                   WPVLAALDEVALAAALLPTAKVRQTRGERVLPDLITIHRELRRKGVTLQLLWEEYVAAH
FT                   PEQPTYRYTQFVEHYRRYASTLKRSMRQQHRAGEKLFIDYAGPTLPVIDPATGEISRAH
FT                   IFVAALGASNYTYACATPGEAQVDWLTALGQAFSYFGGVSEMVVPDNPRALIAHPDRYE
FT                   PGLNRAALECARHYDTVMLPARPRKPQDKAKAEVAVQIVERWIMARLRHQQFFSLHALN
FT                   QAIAELLEDLNQRPFKKLDGCRREWFERLDQPVLRPLPQHPYEVVTFKRCKVNIDYHIE
FT                   VNGGFYSVPSALARQSVDVRLSAHTVEILHGNRRVASHLRLQRRGAYSTQSEHMPASHK
FT                   AHREWTPQRLLDWGERIGPHARQIVEYQLTHKPHPEMGYRACLGLLSLARQYGNARLEA
FT                   AASRAVQLRALNGRTVRNLLKQGLDQQPLPKPATPAAQPSSHENVRGADYYTQEELFDD
FT                   DPTHPEPAAPTAAERHGPSAGRAVDAAGQPQLELR"
FT   gene            278740..279390
FT                   /locus_tag="PST_0245"
FT   CDS_pept        278740..279390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0245"
FT                   /product="ISPsy14, transposition helper protein"
FT                   /note="Code: L; COG: COG1484"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77952"
FT                   /db_xref="GOA:A4VG51"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG51"
FT                   /protein_id="ABP77952.1"
FT                   /translation="MSFDERLGLLLDRELAWRDDKRLERLRKQAKLKYAGACLEDLDRR
FT                   RGRTLDERLIATLASGDWLRQRHNLLLTGPTGVGKTWLACALGHQACRQGYSALYLRTP
FT                   RLLEQLRIAHGDGSFGRTLQQLAKVDVLILDDWALAPLEENARHDLLEVIDDRAGSRST
FT                   ILTSQLPVEHWHGWINDPTLADALLDRLVHNAYRIMMKGESLRRKNTEEEAAS"
FT   gene            279536..279787
FT                   /locus_tag="PST_0246"
FT   CDS_pept        279536..279787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77953"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG52"
FT                   /protein_id="ABP77953.1"
FT                   /translation="MDKNLSTTEEAPLLLSDGMSKAEIEVHLAIANYLIPRIAGTPVAR
FT                   EAFNALVGRFQGRYPQHKLLTQLLIAPEYLEHAPDTQQ"
FT   gene            280257..280721
FT                   /locus_tag="PST_0247"
FT   CDS_pept        280257..280721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77954"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG53"
FT                   /protein_id="ABP77954.1"
FT                   /translation="MLSGIQADDYRQRRARLLGLPEHATDVDVHSHIINGIPVAHLATL
FT                   LSNGDINAHACEQVTPALGQKQRPTDRITAPDASSDNRLSADESDRLFRVVHAIVVAEI
FT                   LFGSRDKAQRWLSKPKDRFSGNSPIQMLTSTAGAWLVQELLTQLAEGFVL"
FT   gene            complement(281474..284533)
FT                   /locus_tag="PST_0248"
FT   CDS_pept        complement(281474..284533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0248"
FT                   /product="type I restriction-modification system
FT                   endonuclease"
FT                   /note="Code: V; COG: COG0610"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77955"
FT                   /db_xref="GOA:A4VG54"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG54"
FT                   /protein_id="ABP77955.1"
FT                   /translation="MLGWLEDSQPAAMDKLRAMNGAGTRDVVVDRLVKQLENKVDGGTV
FT                   NVLRYGFAVAGGGTLAMSQALPEDARNDTVIARYAANRLRVVPQLRYSLDKADEIDLAF
FT                   FINGIPVATVELKTDFTQSVQAAMQQYRMDRRPERKSGGLEPLLTFKRGAVVHFAMSDS
FT                   DIRMTTKLAGDSTFFLPFNRGNDGAAGNPPGENGHYPVSYLWERVLQKDNWLHIFHRFV
FT                   LQERKETQNAEGKTYFKEGLIFPRFHQWEGVTKMIDAVRVEGAGQPYLIQHSAGSGKTN
FT                   TIAWTAHSLIRVRRPDGEPYFHSVIVVTDRQVLDQQLQDAIQQIEHQAGVVCAIDRQQS
FT                   SLPKSQQLAKAMLDGVPIIVCTLQTFPYAQKAILGEQSLRNRRFAIIIDEAHSSTGGST
FT                   ADDLRYVLTGQSEAEWEKLSKEERLSVWQSSRSRPGNASYFAFTATPKHSTLSLFGRPR
FT                   NPTQPVSTDNPPAPFHLYTMQQAIDEGFILDVLKNYTSYEVAFKIGSEMVDDKRVDEKS
FT                   AGRKLAKWLSLNPVNVGQKVELIVEHFRKNVAHLLGGQAKAMVVTSSRAAAVKYHLALE
FT                   DYCKRKGYDNVLAMVAFSGEVPNTDVQAPSLPADHQFSETNLNPGLHGRDMRKVFDAPD
FT                   YRVMIVANKYQTGFDQPKLVAMYLDKKISGVEAVQTLSRLNRTFPGKDKTFVIDFANKA
FT                   EEILASFKTFYRDAQVADIQDPNIVYDIKQRLDGMFIYEQAEVEAFGDAIVDPKVTHQK
FT                   LFSLTQAPTDRFNGKLKTLNDAIDQWEKAWEKAHDEGNDKDMEYADVQRSEYCKARDEL
FT                   MIFSESLTKFVRSYEYIAQLIDFGDPSLETFASYARLLRKRLKGITAEQVDLGDLKLSH
FT                   YKIKKGDNLSGVGVQAETPGLYGMTDNGLRDARDREKKYLTELIEKLNNAFGKDITDTD
FT                   QVAFAVHVSEKLRADSVVMAQVQNNTMEQAMKADLPSKAISAIAAAMSSHNSMATKLLS
FT                   DESTRDVFLTVVYELLKKDAGADLLGAARD"
FT   gene            complement(284731..286293)
FT                   /locus_tag="PST_0249"
FT   CDS_pept        complement(284731..286293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77956"
FT                   /db_xref="GOA:A4VG55"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG55"
FT                   /protein_id="ABP77956.1"
FT                   /translation="MISYLSAIANMEGGHLVIGVEDATLRIVGIQDFNNQTVDNVRQRL
FT                   LERCRALDSEAFRVEPYTTDDTGKTVWVFHIPKHRPRMPVYAHDKAWQRLDDSLVEMRQ
FT                   ERLEAILHEPLDTSDWSAQIVEGATLDDLDSSAIALAREKFAEKHYRAPFAAEIAGWDV
FT                   ATFLDKAKITIQGGVTRTALLLLGKPEASHFLPALAQITWKLMGEEQAYEHFGPPFLLS
FT                   TTQVLHRIRNIGYKLFPQNQLLATEVSKYDTRVILEALHNCIAHQDYQLRSRILVTERV
FT                   DRLVFENAGGFFEGKPEDYFSGEVTPSRYRNPWLAQAMVSLSMIDTMGFGISTMTQSQR
FT                   KRYFPLPDYSKSTPDKVVLEIYGHVIDENYTRLLLERQDLPLNTVMLLDRVQKKQAITD
FT                   DAAALLRKQGLIEGRKPNYYPAAQVAQATGNKGEYIRNRAFDDAYYKDLILDYLRKFGS
FT                   ASPHDLKGLVLDKLSDALDEKQKQNKFRNLLNAMSQRDKTIEKQGSQQKGRWVLSGSRQ
FT                   DKV"
FT   gene            complement(286406..287350)
FT                   /locus_tag="PST_0250"
FT   CDS_pept        complement(286406..287350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77957"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR025579"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG56"
FT                   /protein_id="ABP77957.1"
FT                   /translation="MSQGRSLRLFLVDGTPNGLLTAEIMNWTGHVLTGPRSKLAELVLR
FT                   PECARTGVYFLVGPDPDNSLRSKVYIGESDDVAKRLKSHNRPEEAGGKDFWERVCLVTS
FT                   KDQNLTKAHVKYLESLLIGIAGNLGRCELVNGTAHEYVSLPESDRADMAFFLEQIRTVL
FT                   PVLGFDFLRELTKPSAPAAASTAASVSRSPLFSLEVPRYRLSAQGQEIDGEFFVLKGSK
FT                   ARAEWVGTERGYQGLFKQLVDEGVLVADGGEHLTFSDDYAFSSPSAAAAVVCGRAANGR
FT                   TSWVVEETGQTYAAWQEQQLNISELPAGAEACE"
FT   gene            complement(287347..288612)
FT                   /locus_tag="PST_0251"
FT   CDS_pept        complement(287347..288612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0251"
FT                   /product="type I restriction-modification system, S
FT                   subunit"
FT                   /note="Code: V; COG: COG0732"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77958"
FT                   /db_xref="GOA:A4VG57"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG57"
FT                   /protein_id="ABP77958.1"
FT                   /translation="MSHYKPYPAYKDSGVEWLGRVPEHWTIGPYKATIQIENGSDYKEV
FT                   EADDGYPVIGSGGPFAYSSKLMYDGESVLLGRKGTIDKPLYVNGAFWAVDTMYWSIIKP
FT                   GAHGRFAYYTATTIPFDMYSTNTALPSMTKSVLGSHVVAFPGFEEQQAIAGHLDRETAR
FT                   IDALVEKKIRFIELLREKRQALITHAVTKGLDPSVKMKDSGVEWLGAVPEHWVIKRFRD
FT                   ICISISTGPFGTALGNEDYITGGIPVINPSHIIDEQCSPDPDITVSTETALRLSFWAMR
FT                   AGDLVTARRGELGRAAIIFGEQDGWICGTGSLRVRPNPSQALTEYLHTVLQSRYAREWL
FT                   NLASVGATMANLNEGILGSLPLALPPSTAEQEKLLSSLAAQSERLIKIEQKAALSVALL
FT                   KECRSALITAAVTGQIDLREAV"
FT   gene            complement(288609..290528)
FT                   /locus_tag="PST_0252"
FT   CDS_pept        complement(288609..290528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0252"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="Code: V; COG: COG0286"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77959"
FT                   /db_xref="GOA:A4VG58"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG58"
FT                   /protein_id="ABP77959.1"
FT                   /translation="MNQQTLAPFIWNIADLLLGAFKPSEYGRIILPFTVLRRLECVLEP
FT                   TRDKVRSQFESMKASGVDMDLILPTTAGATFYNVSQFSLGSVGSTSTRANLEDYIAKFS
FT                   ANARQVFEHFAFDTWLAKLENRNLLYLVTQKFAAVDLHPDKISNHEMGLVFEHLIRKFA
FT                   ESSNDDAGQYFTPRDVVRLATTLVFAPDHQALNGEGVVRTVYDCAAGTGGFLSSAIEQV
FT                   YEWNPNARLVPYAQELNPETYAISVADKLIQGYDTRNIKLGNTLSDDHLPHEQFDYCLA
FT                   NPPFGVKWENVQKQVQAEHSQQGFAGRFGAGLPRVGDGSLLFLMHLLSKRKPVELGGSR
FT                   IGIVLSGSPLFNGGAGSGESEIRRWILENDWLEAIIALPTDLFYNTGIGTYIWVLSNHK
FT                   DALRKGKVQLIDASAMHAPMRKSLGSKRKYLSDEQIAEIAKLHEAFEEGPNSKIFATTD
FT                   FGYRRITVERPLRLRFSITPERLKIYQDIKGADQAEAFATVRGEYDNLSAFLKAAGIKK
FT                   LGKGALKAALSCFGERDANAQPVLDDKGNQQADSDLREFENVPLNQNIDDYFAREVLPH
FT                   VPDAWIDTGKTDAKDGQVGIVGYEINFNRYFYVYQPPRPLAEIDADLKAVEAEIAALLG
FT                   EVTA"
FT   gene            complement(290727..291857)
FT                   /locus_tag="PST_0253"
FT   CDS_pept        complement(290727..291857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77960"
FT                   /db_xref="GOA:A4VG59"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG59"
FT                   /protein_id="ABP77960.1"
FT                   /translation="MSAVRSFLGTVWSYGVSLPLYVMWSLIVSALRAAFDFVYPRGYRP
FT                   RNELADAFVEACANRPVGQSVRLPWVDSSATHSLVMNNTGRLLSYVAIASGWFGVAERN
FT                   SGTQYQPKRTYRYYYRRSLTGNWFAEIWSVPKSGFIAAALAIPFVDMARDVMRGRTFVK
FT                   QDSFSIGEWVPLPGYEGLMLLVAGLLLVICFLPRAILGRGTHFAAIAPINGGAFGGYGC
FT                   AQIINWAAAMAGLSYLWLAMGVEWNLGAVVSFITSGLSAFVSEFMASLADPGPHVLLMI
FT                   PVVITVGILFGMAWTVIPAAAFWYVSLRFIAARNAKAQLEALPFNSTQAAMYLGSDFEK
FT                   LAELRAPQVTLGYWVYMGLMVGIILYPIQTWVRSLF"
FT   gene            complement(291906..292235)
FT                   /locus_tag="PST_0254"
FT   CDS_pept        complement(291906..292235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77961"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG60"
FT                   /protein_id="ABP77961.1"
FT                   /translation="MPMEATLLPELQGFSYWGRTFHEILQEVNPHLMCQLAEGQALQVY
FT                   IERRQCYLQSEAARLEREWRRLHPLSIDAGYLARANWQRHCKLAVREMLIDELAKSLSG
FT                   STADM"
FT   gene            complement(293203..293883)
FT                   /locus_tag="PST_0256"
FT   CDS_pept        complement(293203..293883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77962"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG61"
FT                   /protein_id="ABP77962.1"
FT                   /translation="MNGGALFNAEFGIRHRGSTVPERSGVALSFCRRPLIAFAQPFPLG
FT                   DPVLLNRKQLLRKIKRGAIGSSQYEWLYRSMKRLREATLFLEALKPDGSTRYTVGRMES
FT                   FNILKSLSYDSETYRYTLDPHWILMFGNREYSLIDWEKRLQIRRGLDMAKTLQRLIATS
FT                   SDRVQRYALERLRAQMAYGGRLRDFRDSLGRAVCELERLEIIARGCIQESSRGNQQLVL
FT                   WLTP"
FT   mobile_element  293785..294897
FT                   /mobile_element_type="insertion sequence:RP10"
FT   gene            293839..294867
FT                   /locus_tag="PST_0255"
FT   CDS_pept        293839..294867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0255"
FT                   /product="putative transposase"
FT                   /note="Code: L; COG: COG2826"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77963"
FT                   /db_xref="GOA:A4VG62"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG62"
FT                   /protein_id="ABP77963.1"
FT                   /translation="MSYTELSVEERATIQIGRTQGFSLRRIACLINRSPSTISRELRRN
FT                   RGACGGYSARLAQQQMQARRQVCRPMRKLLPGSERFELVTHMLRERLSPEQIAGKLRSM
FT                   NIPNLRDAYVCRETIYNAIYALPVGELRKELIICLRQGKTTRRPRSGGVDRRGQIPEMV
FT                   SIHVRPPEIEDRLMPGHWEGDLIKGKANASSVGTLVERTSGYLMLVKMNDATATSALEG
FT                   FSAALNSMPLEMRKSMTYDQGREMARHAEITQRTGVAIYFCDPHSPWQRGSNENINGLI
FT                   RQYLPKGTDLSVHSQEELDAIALQLNMRPRKRFDFKCPIEVMGEVMQNAMAMRHDAPVS
FT                   IQ"
FT   gene            complement(294856..295149)
FT                   /locus_tag="PST_0257"
FT   CDS_pept        complement(294856..295149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77964"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG63"
FT                   /protein_id="ABP77964.1"
FT                   /translation="MVAPRHRHENSRDGKEEAVSRYMFLPGFAIGAFPNHLNRSSLIAP
FT                   IARNERKQHSKTKMVTRRDCFLEYSGEQLDEADGDLIMARRLQELSATRLLN"
FT   gene            complement(295523..296281)
FT                   /locus_tag="PST_0258"
FT   CDS_pept        complement(295523..296281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77965"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG64"
FT                   /protein_id="ABP77965.1"
FT                   /translation="MSCMTSPQTAPSKRRPLVTRFDPLRLCDFIGYYRQELGCSHEEAA
FT                   FATADIFRRLETKNPQLSASTCWAAEVLDPTARRSTWGFQTARIVRYFELQALNKSKRE
FT                   PFILIEDGMGAELLASDAAVYFSPSALTRLLEEYWSWDQIPHFIHSDISGSKQSENAQP
FT                   VARAHLNTKELLTVQRLTGALMAMLTASANQESARRTILNSTLCTKGVQNQGPFSAAQG
FT                   LTYIADRLGISDLPDTDTLAKYLPPKQNEA"
FT   gene            complement(296265..297440)
FT                   /locus_tag="PST_0259"
FT   CDS_pept        complement(296265..297440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0259"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="Code: L; COG: COG0582"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77966"
FT                   /db_xref="GOA:A4VG65"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG65"
FT                   /protein_id="ABP77966.1"
FT                   /translation="MPLTALQVKSAAPRESDYGLADGGGLFLWIRAAGGKSWRFRFRLD
FT                   GKQSHISLGTIDKVTLVQARQLASDARQLVAQGRHPGLERKAMRAQAAMSRANTFKSLA
FT                   LEWHQHKAPRWSVGYAGDVMEAFELDVFPQVGNLPLTDIKPMQWLQVFRRIESRGALEK
FT                   LRKVRQRCQEVYRFAIATGRAEYNPIADIGGALQTPTSRHYPFLPIAELPALIRSIQAC
FT                   PGHDVVKIATRLLILTGVRTAELRGAPWSEFDLDQALWLIPAARMKMRRAHLVPLSNHA
FT                   VAALRELERITGGYTLAFPGRNDPAKPMSEAAINQLLKRSGYDGRATGHGFRHTMSTTL
FT                   HEQGYPSEWVETQLAHVDKNSIRGTYNHAQYLEGRREMLQWYANHLDELHD"
FT   gene            complement(297607..297682)
FT                   /locus_tag="PST_0260"
FT   tRNA            complement(297607..297682)
FT                   /locus_tag="PST_0260"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            complement(297783..298985)
FT                   /locus_tag="PST_0261"
FT   CDS_pept        complement(297783..298985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0261"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77967"
FT                   /db_xref="GOA:A4VG66"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG66"
FT                   /protein_id="ABP77967.1"
FT                   /translation="MSTAPSLHERFHALDRFLTEHQSLWRPRPFVCRTLPWEADYPELA
FT                   GWLRARSLADAEAAHNQPAALAAPAPFPQLAAIAQRLSQTDELPADDWRPADHRQSVDV
FT                   PGRKSLQIHAFGARLRFREKPLHWLDWCAGKGHLGRHLARDGAALTCLEWDEPLVEAGA
FT                   QLSQRLGIAASHHCQDVLAASAAERLHASHTAVALHACGDLHVRLLQLAIDKQCRQLAV
FT                   APCCYNRTADERYTPLSQAGRTSSLLLSRDDLGLPLSETVTAGARERRNRDQSMAWRLA
FT                   FDMLQRRLRQQDDYLPTPSLPSAWLKKDFAEYCRDLAMLKQLPAPGEENWAALERAGWQ
FT                   RLAEVRNLELVRGLFRRPLELWLLLDRALLLEEQGFRVRLGTFCASELTPRNLLLLAER
FT                   D"
FT   gene            complement(299076..300452)
FT                   /locus_tag="PST_0262"
FT   CDS_pept        complement(299076..300452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0262"
FT                   /product="hypothetical permease component of C4
FT                   dicarboxylatetransporter"
FT                   /note="Code: Q; COG: COG4664"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77968"
FT                   /db_xref="GOA:A4VG67"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG67"
FT                   /protein_id="ABP77968.1"
FT                   /translation="MGEIMAILLFISICFALMSGYPVAFTLGGMALLFAGIGVVTGSFD
FT                   VGYLHALPNRIFGIMNNQTMLAVPLFVFMGVMLEKSRVAEDLLESMSRLFGTLRGGLAI
FT                   SVCVVGALLAASTGIVGATVVTMGLLALPTMLRRGYDPAIATGTLAATGTLGQIIPPSI
FT                   ILVLLGDVMSSAFQQAQLKMGIFSPKTVSVGDLFVGALIPGLVLVGLYILYLIAVAVFQ
FT                   PKKLPALPQEELGPIEWGKLISALLPPLALITAVLGSILAGYATPTEAAAIGALGATVL
FT                   SIAKGQLNFAQLKQVAFGTTEITSMVFLILIGASLFSLVFRGFGGEALIEDALHSLPGG
FT                   VLGAFLVVMLVIFLLGFILDFIEIIFVVVPIVGPILLAMGLDPVWLGVMFAINLQTSFL
FT                   TPPFGFSLFYLRGVTPRSVPTSVMYKGVLPFIMIQIGMLVVAYMWPGLVTWLPEQVYGK
FT                   "
FT   gene            complement(300445..300996)
FT                   /locus_tag="PST_0263"
FT   CDS_pept        complement(300445..300996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0263"
FT                   /product="probable tripartite transporter, small subunit"
FT                   /note="Code: Q; COG: COG4665"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77969"
FT                   /db_xref="GOA:A4VG68"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG68"
FT                   /protein_id="ABP77969.1"
FT                   /translation="MSQSPPPLLRVAGLIDALNMRLGQLCAWITLFLVIGTAIVVVLRY
FT                   GFGIGAIALQEAVMYGHALVFMGAAAWTLQRNGHVRVDIFYQKFSSRRQTAVDGLGHLL
FT                   FLLPVCLFLGWNSWDYVSSSWATYEGSNESGGLKFVYLQKSIILLLVASLALQGISDLI
FT                   KAGYRLAGRLPEAEQEVKHG"
FT   gene            301292..302398
FT                   /locus_tag="PST_0264"
FT   CDS_pept        301292..302398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0264"
FT                   /product="hypothetical extracellular solute-binding
FT                   protein"
FT                   /note="Code: Q; COG: COG4663"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77970"
FT                   /db_xref="GOA:A4VG69"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG69"
FT                   /protein_id="ABP77970.1"
FT                   /translation="MKRRDILTAAGVGLAATALAGCNDKSEKPAAGESAQASEQQTFNW
FT                   KMVTSWPKNFPGVGVGAENFAKLVNEMSNGRLTVKVYAAGELVPALEVFDAVSRGTAEM
FT                   GHGAPYYWKGKVPAAQFFCALPFGPNAQEMNAWLHRGGGMELWEEVYKPFGVLPMACGA
FT                   TGVQTAGWFNKEINSVDDFKGLKMRTPGLGGEVLTKMGGTVVNMPAGEIFTALQTGAID
FT                   ATEWIGPYNDLALGLHKASKYYYTPGWQEPNVTFELDVNLKAWETLPDDLKAIVRAAAR
FT                   AVNGDMLDDYNAKNMEAMEQLREQGVEVRRLPDDVLARLKEVAAEVVDASANADPVAAK
FT                   VWEQQSAYLKRLYEYAELNEKDIYNIRG"
FT   gene            complement(302480..302905)
FT                   /gene="osmC"
FT                   /locus_tag="PST_0265"
FT   CDS_pept        complement(302480..302905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PST_0265"
FT                   /product="osmotically inducible protein OsmC"
FT                   /note="Code: O; COG: COG1764"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77971"
FT                   /db_xref="GOA:A4VG70"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG70"
FT                   /protein_id="ABP77971.1"
FT                   /translation="MKKSASAVWQGGLKDGKGTISTESGALKDNPYGFNTRFEGAPGTN
FT                   PEELIGAAHAGCFSMALSMMLGQAGLTAERIETHAEVTLDKDGEGFSITAIDLTLKARI
FT                   PGANDAQFQQIANQAKEGCPVSKVLNARISLNATLEG"
FT   gene            complement(302947..303255)
FT                   /locus_tag="PST_0266"
FT   CDS_pept        complement(302947..303255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0266"
FT                   /product="ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77972"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG71"
FT                   /protein_id="ABP77972.1"
FT                   /translation="MRKTFIAAFALALAPLGSAMADGLVRDILSSGATTASTYLTFKDN
FT                   KLVIPAREDAGTFVASNGEIRGPYLEAMLQQLRSEQPQLQATDMELASAILAAEQPR"
FT   gene            complement(303325..308079)
FT                   /locus_tag="PST_0267"
FT   CDS_pept        complement(303325..308079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77973"
FT                   /db_xref="GOA:A4VG72"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG72"
FT                   /protein_id="ABP77973.1"
FT                   /translation="MLNYRNRLNYSVPWIAEQDTLNAEHCAPAATWNEAERLIALARYT
FT                   ALDALCITDLEALAAMAADFCACPAAAIHFVDDQYQHCMAAFALEREAVVRERSPSAWA
FT                   IRQEGALVLPHTDTLAQFELPRLADGQTTGFYVAVILRSSDGLPLGTMSVFDHQPRELT
FT                   PRQGTQLLAVARQVMALLELSRLRGEQERSRQIIDSAQDYAILATDLQGRITSWNSGAQ
FT                   RLLGWSPEEAIGRDVACIFSEADRTAQVPQAEMRTALEQGRAGDERWHLRKDGSRFWAS
FT                   GILTPLLHDGQTQGFVKILRDLTESRQQQAAARETEERYRALVDLSPQIIWQCDAAGGL
FT                   TFCNSYWCEFTGLGEASSTGEGWLAAVSTSDRQRVAEQWQAALRRELPFKLELPLRDVD
FT                   GNLRWFQANAAPTYDADGQLLRWVCVAQDIDSRRRSEMQRLESEAFTRLLLDSANEGFY
FT                   SIDRNGAVTLCNDAFLKILGFASREEVLGRHLHHVIHHSRPDGSPYPVQECPIQHTAVT
FT                   GQPRHVEHELFFRVDGSSLPVEYRVAPIFRDGELQGAICTFSDISERTQHQALQAFLLE
FT                   LSDCLQANSDQVDLCCVLDERLARLTRSDCIAWACLEQDALVVQQQWLAPGTPSRLGRH
FT                   ALADGATLTGRLRREHLVVLDRDESQPGLHERLASMGLLMAELPAIGTQPLVLLFMRGQ
FT                   AQAWTSDDVTLVREVLERLRSSAERIRANKALREAEQRISLANEIASIGVWEYRDHQHS
FT                   LHWDAQLKAMAGIPPEQPGLDVHEVLARVHPDDRGKLIRALGETLAGEGDGEFQLDYRI
FT                   YDTRIDDFVWLANRGRRLLDPSGEVRILGTARNITAERNAAERMLRMNEMLEEQIKDRQ
FT                   QAEQRQTALIELGDLLREQHDSQTIAHAAVSVIGRTIGVSRVLFASVDASSQSATIERY
FT                   WSDGGSDSSNEMVYFADYGDFFYDLQENELVVIEDVLHDARTASHAENFAESLIRSIVC
FT                   VPLFEQGRISAVMMLLEEQPRAWLDEDISFIREVADRAWTADERMRAERALRESEEQFR
FT                   TLADNMSQFAWMADPAGRIYWYNKRWYDYTGTTSEAMRALGWRAVNHPDHHERVSASMK
FT                   RAFAIGSIWEETFPLRGKDGKYRWFLSRALPIRDDFGQVTHWFGTNTDVTAQVAAEEAL
FT                   RELNESLERRVAERTRELAAINSRLHIEMAERERAEEALRHAQKMEAIGQLTGGLAHDF
FT                   NNMLTGVLGSLDLIQRRVASGSTGDLDRYIDAATTSANRAAALTHRLLAFARRQSLDPK
FT                   PVDVNMLVVSMEDMLRRTMGEHIQLEVDLQADAWLAYTDGHQLENALLNLVINARDAMP
FT                   NGGRLGVHTENQRIEQHQPDAPEPGDYVVLCVTDNGAGMSAQTIAKAFDPFFTTKPIGQ
FT                   GTGLGLSMVYGFAKQTGGHVRIDSALGEGTRVTLYLPRNLSDDQAQPGPAQATDMPGAR
FT                   SGEIVLVVEDEAAVRMLVVEVLQELGYQVLEACDATSALPYLHGDQRLDLLVSDFGLPG
FT                   LNGRQLVESARQHRPELKVLFITGYVPDEEMRNDFIGPGMDILAKPFSIDILAARIRSL
FT                   IDTGV"
FT   gene            complement(308201..309688)
FT                   /locus_tag="PST_0268"
FT   CDS_pept        complement(308201..309688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0268"
FT                   /product="putative periplasmic protein"
FT                   /note="Code: S; COG: COG2989"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77974"
FT                   /db_xref="GOA:A4VG73"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG73"
FT                   /protein_id="ABP77974.1"
FT                   /translation="MQSVLEGLPQSCPQLPVRSAISEHLNAFYQARQFQPAWTSRSLLE
FT                   GLLQQLAQLADDGLDPAYYQPERIREQLYPVASSPRRPECDDLLASQAYLQALHHLARG
FT                   RLRQADIEPIWRSPDAPEADDRQRLLQIAVQGLADLPTAFDRARPPHALYRDLRAAYAR
FT                   QRQAALPAWRPLPSGPTLRPGMRDERSPLLRELLLAGAGSTPALDLRYDDELVEAVRGF
FT                   QLQHGLEADGVVGAATLVALNVSPASRLDQLRINLERLRWISRDLEPQSLLVDIAGARL
FT                   IYFRDSCPFWQTRTQVGREARQTPLLKSRISRLTLNPTWTVPPTILKQDKLPLIREDIA
FT                   YLARHQMRVIDAQGNAVDPYAVDWANPRGILLRQDAGPANPLGQVAIRFANPFSVYLHD
FT                   TPSKPLFERAARAVSSGCVRVESALQLVDLLLEEDERDTVARLLQSGETHEYRLARQTP
FT                   ILMAYWTADADDSGLPRYRPDIYKRDAALLRALDAAR"
FT   gene            309998..310711
FT                   /locus_tag="PST_0269"
FT   CDS_pept        309998..310711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77975"
FT                   /db_xref="InterPro:IPR032676"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG74"
FT                   /protein_id="ABP77975.1"
FT                   /translation="MISVLRRACLAAGLLVFAAPLWAATATYQPMVDSLARLAPKLDRQ
FT                   VLTHAVAAMQCAVNNGAGAAQRLAVIDYSLPSSEKRLWIFDLEREQLLLEDLVAHGQKS
FT                   GDNHATRFSNAVGSHQSSIGLFRTAESYSGKHGYSLRMDGLEPGINDRARERAIVIHPA
FT                   DYVNPSWIATQGRIGRSQGCPAVRPEVARMVVDSLKGGQFMFSWYPDQQWLQSSAYLNC
FT                   KPNQVASILAARSDG"
FT   gene            complement(310809..312593)
FT                   /locus_tag="PST_0270"
FT   CDS_pept        complement(310809..312593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0270"
FT                   /product="probable secretion pathway ATPase"
FT                   /note="Code: NU; COG: COG2804"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77976"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG75"
FT                   /protein_id="ABP77976.1"
FT                   /translation="MSVLNSPTQDRPLDLADLLRELVAQGRVAQDSAEQCLTVRRSAVA
FT                   NQQHPLEFLAAQQLDDLQRPGKKLDLETLTVWLAERAGQPYLRIDPLKIDVAAVTPLMS
FT                   YAFAQRHSILAVAVDASAVTIASSQPFVHGWEANLTHVLKRPIKRVVANPTDIQRFTVE
FT                   FYRLAKSVSGASSTDQKISGVGNFEQLLNLGASDQEPDANDSHIVNIVDWLFQYAFQQR
FT                   ASDIHIEPRREQGTVRFRIDGVLHNVYQFPPQVTMAVVSRLKSLGRMNVAEKRKPQDGR
FT                   VKTKTPDGGEVELRLSTLPTAFGEKMVMRIFDPEVLLKGFDQLGFSGDDLRRWQSMTSQ
FT                   PNGIILVTGPTGSGKTTTLYTTLKQLATPEVNVCTIEDPIEMIEGAFNQMQVQHNIDLT
FT                   FASGVRALMRQDPDIIMVGEIRDLETAEMAIQAALTGHLVLSTLHTNDAPSAITRLLEL
FT                   GVPHYLLKATLLGVMAQRLVRTLCPHCKAPMQLDAEDWSALTRPWNAPLPSTAQRAVGC
FT                   LECRDTGYRGRAGVYEIMLLNDAIKPLITADTDIVALRRQAFKDGMRSLRLSGAQKIAA
FT                   GLTTVEEVLRVTPQSEQK"
FT   gene            complement(312691..314055)
FT                   /locus_tag="PST_0271"
FT   CDS_pept        complement(312691..314055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0271"
FT                   /product="adenylate cyclase"
FT                   /note="Code: S; COG: COG3025"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77977"
FT                   /db_xref="GOA:A4VG76"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG76"
FT                   /protein_id="ABP77977.1"
FT                   /translation="MQKETEIKLRASRETLLALREHPLLKKRNKSGWSRHELFNQYYDT
FT                   PDRALAQARVALRLRRDGEQFIQTLKSRGQSVAGLSERNEWDWYLDKAKLDIKKLGDDC
FT                   WPASLADLDKKTLKPIFTTDFVREKAEIAWGRGKTRVVIEAALDLGQVKAGKQSEEICE
FT                   LELELRQGEPEALLELAAELAADLPLMPCDISKAERGYRLYDADGYSLQLPAPELTASM
FT                   PLDDAVVALGWQLLGNSQRLAEQYRFNGRWKLLGEWLQQLVELRALLGSLGQAAPRASS
FT                   RELRELLDMLIQDWRPRVEAGQDDEGVRKAAPTQFTEELGQTRWGLLSLKASLWLLQRS
FT                   WTQGRNARGDRQGAAELGKWLPHLLAEEAKALQLPRYQQQPEDLAEQSPRMERMLVWLH
FT                   LARGVLELPEADRLYGELAKLHEMARHPLDEAAREQRVEQAHRVWTLKAWKLLEK"
FT   gene            314169..314846
FT                   /locus_tag="PST_0272"
FT   CDS_pept        314169..314846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0272"
FT                   /product="phosphate transport regulator"
FT                   /note="Code: P; COG: COG1392"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77978"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG77"
FT                   /protein_id="ABP77978.1"
FT                   /translation="MPVNPFVSLFGRSPIGPMQQHMAKSHECAANLVPLFQAVMAEDWE
FT                   KVEQIQQQMAQLENEADKLKKSVRQHLPKSLFLPVPRSDLLDLLSVQDKIANRAKDIAG
FT                   LMLGRCMTIPQALQPQMLAYVQRSVDASAQALKALKELDSLLETGFSGREATLVEKMVE
FT                   ELEEIERETDRMQITVRRALFHLEKDLPAVNVIFLYKIIEWIGDVADRAERVGNRLEQL
FT                   LAR"
FT   gene            314888..316153
FT                   /locus_tag="PST_0273"
FT   CDS_pept        314888..316153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0273"
FT                   /product="probable phosphate transporter"
FT                   /note="Code: P; COG: COG0306"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77979"
FT                   /db_xref="GOA:A4VG78"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG78"
FT                   /protein_id="ABP77979.1"
FT                   /translation="MSLIADYGFVLLILACAFGFFMAWGVGANDVANAMGTSVGSRALT
FT                   IKQAIIVAMIFEFCGAYLAGGEVTETIKNGIVDAEVIPPDLMVLGMMSALLAAGTWLLI
FT                   ATMKGWPVSTTHSIIGAVIGFAAVGVSADAVHWEAIGPIVASWVVTPMLSGVVAFGLFM
FT                   SVQKLIINTDHPFENAKRFVPLYMFLTGFMVALMTVTKGLKHVGLHLSSQQGVVIAFGI
FT                   GLLVALLGVALLSRIKLDVEADKTFHFASVEKVFAVLMIFTACSMAFAHGANDVANAVG
FT                   PLAAIVGVIESGGAADIAAKSAVPGWVLLLGALGIVIGLATYGYKVIATIGKEITELTP
FT                   SRGFAAELATATTVVSASAIGLPVSTTHTLVGAVLGIGIARGIGALNLGVVGSIFMSWL
FT                   ITLPAGAFLAIVFFTVLKFIFT"
FT   gene            316272..317423
FT                   /gene="argE"
FT                   /locus_tag="PST_0274"
FT   CDS_pept        316272..317423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="PST_0274"
FT                   /product="acetylornithine deacetylase"
FT                   /note="Code: E; COG: COG0624"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77980"
FT                   /db_xref="GOA:A4VG79"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG79"
FT                   /protein_id="ABP77980.1"
FT                   /translation="MPIPSLKEQFAALIAAPSVSCTQPGWDQSNRPVIELLAAWLGELG
FT                   FACETPEVAPGKFNLLASYGSGPGGLVLAGHSDTVPFDGELWTADPLRLREADDRWYGL
FT                   GSCDMKGFFALIIEAVRPLLEQPFRRPLLILATCDEESSMSGARALAAAGQPLGRAALI
FT                   GEPTGLRPVRLHKGIMMERIDILGQSGHSSNPAYGHSALEAMHGVIGEMMTLRRQWQAE
FT                   YDNPLFDVPKPTLNFGCIHGGDNPNRICGQCALEFDLRPLPGMDPQQLRGIIRQRLQPL
FT                   AEQHQVKIDLAPLFPAVPPFEQPAESELVRLAERLTGHRAEAVAFATEAPYLQQLGCET
FT                   LVLGPGDIACAHQPDEYLQLERIEPTVQLLRRMIEHYCLQPQA"
FT   gene            317562..318767
FT                   /gene="argA"
FT                   /locus_tag="PST_0275"
FT   CDS_pept        317562..318767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="PST_0275"
FT                   /product="N-acetylglutamate synthase"
FT                   /note="Code: E; COG: COG0548"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77981"
FT                   /db_xref="GOA:A4VG80"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG80"
FT                   /protein_id="ABP77981.1"
FT                   /translation="MEHANFANIVHDLVLLHSLGVRLVLVFGSRPQIEARLAARGITPR
FT                   FHRDLRITDGPTMECVIDAVGQLRIALEARLSMDKAASPMQGARLRVASGNFVTARPIG
FT                   VLDGVDLHHTGEVRRIDRKGIGRLLDERTIVLLSPLGYSPTGEIFNLACEDVATRAAID
FT                   LQADKLVLYGAETGLLDESGKLVRELRPQQIPAYVERLGSQYQAELLDAAAQACRGGVR
FT                   RSHVVSYVDDGALLNELFTRDGAGTLVTQEQFEQLREATIEDVGGLIDLITPLEEQGIL
FT                   VRRSREVLEREVEQFSIVERDGLIIACAALYPIADSDAGELACLAVNPEYRHGGRGDEL
FT                   LERIEERARALGLKKLIVLTTRTAHWFQERGFEPISVDRLPAARASLYNFQRNSKIFEK
FT                   PL"
FT   gene            complement(318802..320379)
FT                   /gene="gshA"
FT                   /locus_tag="PST_0276"
FT   CDS_pept        complement(318802..320379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="PST_0276"
FT                   /product="glutamate--cysteine ligase"
FT                   /note="Code: H; COG: COG2918"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77982"
FT                   /db_xref="GOA:A4VG81"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VG81"
FT                   /protein_id="ABP77982.1"
FT                   /translation="MSALLTHRLALLAKAPHLPLLNQCLHGIERECLRVDAHGHLAMTP
FT                   HPIALGSALTHPQITTDYSEALLEFITGTDQDPRNTLAELEAIHRFTYAKLGDEYLWSP
FT                   SMPCPLPSEADIPIAEYGSSNIGRLKHVYRQGLALRYGKTMQCIAGIHYNFSLPEALWP
FT                   VLQADDGDTRTERDYRSARYIGLIRNFRRYSWLLMYLFGASPALDAGFLRGRPHQLEAL
FT                   DADTLYLPYATSLRMSDLGYQNNAQAGLTPCYDDLSSYTESLYRAVSTPYAPYEAMGIK
FT                   DAAGNWQQLNTNVLQIENEYYSNIRPKRVTATGERPLQALRARGIQYIEVRCLDINPFL
FT                   PLGIDLAESRFLDAFLLFCALADSPCLADGECGAATDNFLKVVKEGRRPGLQLQRCGEA
FT                   VPLGEWAGQLLDEIAEVAALLDRSHGDSRHAEALAEQRAKVADSSLTPSARVLEQLRTN
FT                   GESFSQFAMRQTLAHADYFRSQAPSADELQQFETAARQSLERQAAMEATDTLDFDSFVA
FT                   DYQRSLSL"
FT   gene            complement(320506..320895)
FT                   /locus_tag="PST_0277"
FT   CDS_pept        complement(320506..320895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0277"
FT                   /product="phenylacetic acid degradation-related protein"
FT                   /note="Code: Q; COG: COG2050"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77983"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG82"
FT                   /protein_id="ABP77983.1"
FT                   /translation="MSIQVEAVGNSSAFGRLLGLEIHQVGNGEAVLGLSMHDGLRNLHG
FT                   KLHGGALFSLIDTAMGQASHSLGDGSPNSVTLECKVNYIRPVTDGELRCRAWVVHGGRR
FT                   TQVLEAEVHQGDKLIAKAQATFACL"
FT   gene            complement(320898..323216)
FT                   /locus_tag="PST_0278"
FT   CDS_pept        complement(320898..323216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0278"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="Code: K; COG: COG2183"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77984"
FT                   /db_xref="GOA:A4VG83"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG83"
FT                   /protein_id="ABP77984.1"
FT                   /translation="MDSINSRIANELGVRPQQVAAAVALLDEGSTVPFIARYRKEVTGS
FT                   LDDTQLRNLEERLRYLRELDERRVSILASIEEQGKLTPELKREIDLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADALFGNPELNPESEATRFIDAEKGFADVKAVLEGAKYI
FT                   LMERFAEDADLLAKLRDFLKHNATLSARVVPGKETEGAKFSDYFEHDEVLKNTPSHRAL
FT                   AIFRGRNEGILSVSLKVGDETPGSMHPGEGMIGERFGIANRGRAADKWLAEVVRWTWKV
FT                   KLYTSLETDLLGELRDKAEDEAISVFARNLHDLLLAAPAGPRATLALDPGLRTGCKVAV
FT                   VDATGKLLETATVYPHAPRNDWDGTLAILAKLCAKHAVDLIAIGNGTASRESDKLAGEL
FT                   IKKVPGLKLTKIMVSEAGASVYSASELAAKEFPDLDVSLRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARSLDAVVEDCVNAVGVDVNTASAALLARISGLNATLAQN
FT                   IVQFRDANGAFKSRSELKKVPRLGEKTFEQAAGFLRVMNGENPLDASAVHPETYPLVQR
FT                   IAQDTGRDIRSLIGDSAFLKRLDPKQFTDETFGLPTVTDILGELDKPGRDPRPEFKTAE
FT                   FQDGVEKLSDLEPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVK
FT                   AGDIVKVKVMEVDIPRNRVGLSMRMSDTPGAKTDGPQRSGGKPRGNAPRSERHAREDKP
FT                   APANAAMAALFANAKQLRK"
FT   gene            complement(323314..326772)
FT                   /locus_tag="PST_0279"
FT   CDS_pept        complement(323314..326772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0279"
FT                   /product="cellulose synthase operon C protein, putative"
FT                   /note="Code: R; COG: COG0457"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77985"
FT                   /db_xref="GOA:A4VG84"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG84"
FT                   /protein_id="ABP77985.1"
FT                   /translation="MRKPPLLLLAALLPIWSHAEIPADRAEQAQWLLAQVRAAEAVNRD
FT                   ELVRDALTRLQRVAPGHAQATLAQMRLALRQRDLQQLEALQQNLQRTAAGSEAERTGRM
FT                   LVELSSEAGQQRLQQARLAALAGRLDDALQGFKALYGDQPPTLELAVEYWRLRSAQPGQ
FT                   RTSAIGALRRLDDEYPGNPQLRQLLANLLFADGQDKAALALLAELGRNPVATDAAAQRE
FT                   FEYLATRRIDDNGPKAWKAFLGRYPNGRFAGDARQHLERQQRLLADPLWRAGQEGLRLL
FT                   DQGQDEAAEAKLRQALRGYPKDPELLGGLGLALMRPGHRPEALVYFQRAKDNEADIDNL
FT                   SKWSDLIDSTRYWLALEQADQALEQQRPREAAALYTRALRQQPDSLFAALGLAQVAEAE
FT                   GRTDEAEAAYRRLLARDPANGGAIRGLVRLYRAESAERALAFIETLAAPQRQEFNELRN
FT                   ALLLARYQLQADQALERGDQAAASEALRQARRLDPNDPWLTYRLANSLRTQGAFYEADS
FT                   TFDDLLARKPADPTTRYAHALYLAAAERDAQALTSLQQIQASDWNDDIRALATRVERRE
FT                   FMSRVAKLRAAGRETAAADLMQQRLRSHGDSVDDLLLLADWAVERGEPAAAQSYLARAL
FT                   RIDPEHAAARLAQIELLLAAGQVNEASQALHDAPPQFGNDEPNAIRRLANSWAAVGEVA
FT                   KARQMLEQLEAQVEEPDPLLRRDTARLLARTEPDRAMAYYRKAMVDAELVPEGASDADL
FT                   TQATRENETDDWLIRSLRSDVANLHQQQDVTVTLLHDHGWRNDDGTPGISELLTDTTLL
FT                   HVEWPAANGRSFVRAERLALDAGTLESDAPFGTCAFDDGKCVDKRQQTEAAVLAGGWRD
FT                   ERWEADLGLTQGFEINNVYGGITGRGDAGPFGLSLTASRRPMSNSLLSYGGSRDPVTGE
FT                   QWGAVTANGSSLGLSWDQGGAHGVWASLGYHWLLGDNVARNNRTTAMTGYYYKLVDSPS
FT                   ERVRTGLTFIHFGYDKDLSGYTLGQGGYWSPQNYNSISVPVSYAWRNEEWSVLLESSVG
FT                   WSVSQSDGGPDYPLRSLLSTEQRAAAAANGESKGSTNRGISYRLQGLFERRLSDHFVLG
FT                   GGVSLLHSDDYAPSRALLYLRYNLMPWRGNLPLPVEPLTPYADFR"
FT   gene            complement(326779..329001)
FT                   /locus_tag="PST_0280"
FT   CDS_pept        complement(326779..329001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0280"
FT                   /product="cellulose synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77986"
FT                   /db_xref="GOA:A4VG85"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG85"
FT                   /protein_id="ABP77986.1"
FT                   /translation="MITRTYSRTLLTALLWAFSAAAFAEPSLDADSTPPSWNSSRSFSD
FT                   LGRPRDQLLLGIRNAEQVEFRLRHDRIATAATLHLDYTPSPALIPVLSHLRVYLNDELM
FT                   GTLPITQEQIGQRVRQELALDPRLLGDFNRVRIEFVGHYSDVCEDPAHSGLWLNLGRQS
FT                   RVSLHEQALDVTGDLAWFPLPFFDERDTQQLNLPVVFTGTPTLGEQRAAGILSSYFGSL
FT                   AAWRSATFPVLFDALPSTQERPQPALVFATNDRRPSFLAEHPAAEGPTVELIDHPQDRY
FT                   SKLLLISGRNDDDLVVAATALALDRGQLRGNRVRLEQVEPPARKPYDAPNWIRTDRAVQ
FT                   LAELIDYPQQLQVSGLQPYPITLDVNLPPDLFVWRNQGIPLQTRYRYTPPATTDESRLN
FT                   ISVNDQYISSIPLQGSDSRSSVENLRLTVLASDSTAESEKLLVPALKMGMRNKVRFEFN
FT                   FASKLGNAQRDRCQTYLPTNIQAAIDEQSTIDLSGYHHYMAMPDLKAFSRSGFPFSRMA
FT                   DLSETLVLTSAQPDETQVGTLLDTLALIGSHTGYPAFGVRITDNWKSAAQADADLLLLG
FT                   PLPNELVNDASLPFLLESPRSWLQHGAAGTDERSAGGKLGMSANGPLAAVVGQQSPFHA
FT                   QRSLVALLASTPTDYGLLRDALTDSGKQEAFAGAVTLIRTSGVSSHVVGEPYYVGKLPW
FT                   WLLLWFHLSAHPVLLAFLAAASVVLFAIVLWRALRWAAGRRLSDAG"
FT   gene            complement(328998..331595)
FT                   /gene="wssB"
FT                   /locus_tag="PST_0281"
FT   CDS_pept        complement(328998..331595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wssB"
FT                   /locus_tag="PST_0281"
FT                   /product="cellulose synthase, catalytic subunit"
FT                   /note="Code: M; COG: COG1215"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77987"
FT                   /db_xref="GOA:A4VG86"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG86"
FT                   /protein_id="ABP77987.1"
FT                   /translation="MPNPLSYYQYIRYRRGASPIAALSWLIAYMTAWLLLRLDAPGWQW
FT                   VMAERRRLYPHVAGKRPTAGDPLRIVIQSIWLLVARAPGSAPARSLGDRLRSTWQRLRS
FT                   VAQQLPRPPRPRHRRTFDLPGLRNAEARVGKAERWLSSLSRPVRYAFNIAIGALAILLG
FT                   ILCITEPFGYTAQVTFVLLLWGLALLVRRVPGRFAVLMLIVLSAIISCRYLWWRYTATL
FT                   HWDSYFDLACGITLLVAETYSWIVLILGYVQTCWPLDRKPAPLPEDSSSWPSVDLFIPT
FT                   YNEDLSVVRTTVLAALGLDWPRDKLNVYICDDGRRDSFKQFAEQVGVGYIVRPDNKHAK
FT                   AGNLNHALTVTHSELIAIFDCDHIPVRSFLQVTTGWFLRDPKLALVQTPHHFFSPDPFE
FT                   RNLGSFRRKPNEGELFYGLVQNGNDMWNASFFCGSCAVLRRDAVESIGGFAVETVTEDA
FT                   HTALRLHRAGWNSAYLGTPQAAGLATESLSAHIGQRIRWARGMAQIFRTDNPLLGPGLT
FT                   IFQRLCYANAMLHFLAGLPRLIYLTAPLAFLLLHAYIIYAPALMIVLYVLPHMIHASLT
FT                   NARMQGEYRHSFWGEVYETVLAWYIARPTTVALFNPGKGKFNVTAKGGLIDHDQFDWRI
FT                   ARPYLVLAALNVAGLGFAVWRLFTGPVSEIGTVLVSSAWVIYNLLIIGAAVAVASEVRQ
FT                   IRRAHRVMAQLPASLKLADGHAYPCTLLDFAEGGAGLQIPPGLKVDMDQPVSLILQRGD
FT                   RSFMFPGQASRQIGERLGIRLDNLDLAQQIDLVQCTFARADVWLNRHQDFETDRPLHSF
FT                   IEVLRIGGRGYHRLYEQLPSVLSRPLRPLLRLAAWLLSYCPRTPVSKSLVTPS"
FT   gene            complement(331597..332331)
FT                   /locus_tag="PST_0282"
FT   CDS_pept        complement(331597..332331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0282"
FT                   /product="cellulose synthase, putative"
FT                   /note="Code: D; COG: COG1192"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77988"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG87"
FT                   /protein_id="ABP77988.1"
FT                   /translation="MKQLVLRGLRGGIGATSLLAGLGIALHEQGERVLLIDLSPDNMLR
FT                   LHFSVDIAYASGWARAQLDAAPWHESALELLPGLHLLPYGELGGAEISQIEGQLCADSS
FT                   CWAQRCDLIGHNYDWVLFDLPQRLPGHRAVVSEANRADVLIDLATPDPGCHVLLQQRPR
FT                   PDADLLLINRFNPASQLQRDLLLLWRSQPRGNRQPQLIHEDEALPEALAHKLPIGHYAP
FT                   KSQAASDLRSLALWCLAQRAKC"
FT   gene            complement(332569..334194)
FT                   /locus_tag="PST_0283"
FT   CDS_pept        complement(332569..334194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0283"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77989"
FT                   /db_xref="GOA:A4VG88"
FT                   /db_xref="InterPro:IPR017744"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG88"
FT                   /protein_id="ABP77989.1"
FT                   /translation="MNAPERLIVPAPPVTRWPGLGVWNLYFLLKFLLLGLGLLNFQALP
FT                   NLVFAAFLVVPLPGAPWRIVRQLIAIPVGIALLYHDTWLPPFDRLLAQPGVLDFSPAYL
FT                   VELAGRFVDWTVLGLCALLVIGYSYMANWIRLSTICLGGLIWLNLGSIPLLASPPRADA
FT                   APVVASAQGNDAPALQDNVALDTWLENFFRTEATRQTQFPLRSEQTAAFDVLFINVCSL
FT                   AWDDLDAVELRDNALLKRMDVIFDRFNSATSYSGPAAIRLLRASCGQPRHQALYEPAPE
FT                   QCLLFQNLANLGFHAETLMNHNGKFDGFAGEIEAQGMPQPVLASQKFARALAGFDGSPI
FT                   ARDFDVLNGWWQRRQALPEPQVSLFYNSISLHDGNRIVGADGNAQSAAYRPRAQRLLDD
FT                   LNRFIDELERSGRPVALLLVPEHGAALHGDRMQIAGMREIPRPSITQVPVGLKLIGMDA
FT                   PHGTQPVHIQQPTSFLALSELVSRLYAARQQGSTPNLGALVADLPQTELVSETAGAQVI
FT                   ERAGKPYVRLSGQTIWLPYPNRFE"
FT   gene            complement(334370..335908)
FT                   /locus_tag="PST_0284"
FT   CDS_pept        complement(334370..335908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0284"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77990"
FT                   /db_xref="GOA:A4VG89"
FT                   /db_xref="InterPro:IPR017745"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG89"
FT                   /protein_id="ABP77990.1"
FT                   /translation="MLLFRQNQQLPAPLGLDGIEWPIFALNDGRLHWIMAEKASDAALL
FT                   TRQVIGNMAAGQRAAMIADAARQRHALADLPADAGPGELLALTLTPDHFEAMLQRLDSE
FT                   LDRSGNMRTRYILLNLPTQAWERLAGPRLSSWLTRIGAWLLERRATLLIISDGVSDALS
FT                   EGLLRLSHCLAGFASLTQTPSGTRLYLHHWQNERGMTSARQFALRHQADGFQLTACGEL
FT                   GEVLEHPDQGRFYAERSVLEGVHNLSTQWRLFESRAALLTHAETARAASILFAITDNEQ
FT                   VDQLAHQLNGLRRTCGNQLKLIIRETAPCLRYRDEQLLLAGGASLVVPFGTSLPRFLTM
FT                   VESAQGHIWQRQLSDIDASLDKLKPLPLRGQLSPRRFAEAAQEMWAGSTTGEIVHQLVR
FT                   LQPVPGLSLEQVLGQAHLRRNGDIACIVDKALYLFLFACRAESLEAALDNIFGVTWQEL
FT                   FLGLEQLADLEPLSGPGFHGETLSLPGNETLVNEPAPGRQLQPRPLTLSLVTQP"
FT   gene            336125..336511
FT                   /locus_tag="PST_0285"
FT   CDS_pept        336125..336511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0285"
FT                   /product="diacylglycerol kinase"
FT                   /note="Code: M; COG: COG0818"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77991"
FT                   /db_xref="GOA:A4VG90"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG90"
FT                   /protein_id="ABP77991.1"
FT                   /translation="MKVETTNEATAFKSKPGLGRIAKAAGYSFAGLAAAWRHEAAFRQL
FT                   ALLACVLIPVAFMVGSTPVERALLVLPVLMSLAIELVNSAIEAVVDRVSLEIHPLSKRA
FT                   KDLGSAAQLLGLISIAVVWLAVLL"
FT   gene            336626..337360
FT                   /gene="ompR"
FT                   /locus_tag="PST_0286"
FT   CDS_pept        336626..337360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="PST_0286"
FT                   /product="two-component response regulator OmpR"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77992"
FT                   /db_xref="GOA:A4VG91"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG91"
FT                   /protein_id="ABP77992.1"
FT                   /translation="MSSTAQANEGEKILIVDDDARLRRLLERFLDEQGYRVRTVENTEQ
FT                   MDRLLSRELFQLVVLDLMMPGEDGLSACRRLREANNQIPIIMLTAKGDEASRIQGLEQG
FT                   ADDYLAKPFNPRELLARIRAVLRRQAPQVPGAPASEDETVTFGEYELSLATRELKKGNE
FT                   VHMLTTGEFAVLKALVQHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGNK"
FT   gene            337437..338768
FT                   /gene="envZ"
FT                   /locus_tag="PST_0287"
FT   CDS_pept        337437..338768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="PST_0287"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77993"
FT                   /db_xref="GOA:A4VG92"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG92"
FT                   /protein_id="ABP77993.1"
FT                   /translation="MKTPLWFPQSFFARTLWMVLIVVLFSKVLTLVYLMTNEDVLVDRQ
FT                   YSHGAALTLRAYWAADLEDRDRIGRAAGLQLVAEQNVPRSEYHWPYTEIFQRQMRDELG
FT                   DDTEVRVRIQPSTAIWVRAPNLGPDWVQVPLYAYPLRGQRIWSVLGWFLGIGLLSTGAA
FT                   WIFVSQLNLPLKRLVFAARQIGKGRRVRLPISDTPSEMTEVYRAFNQMAEDVEQAGRER
FT                   ELMLAGVSHDLRTPLTRLRLSLELMASDDELTEDMIRDVEDMNAILDQFLAFVRDGSDE
FT                   PVETTDLAELIREVVAPYNQQQETVRLCVEPMPPFALRRVSIKRLLVNLIENALRYAGG
FT                   GVEVAAYVSGDQHAPYVVLSVLDRGPGVDPAELEGIFNPFIRGDRARGGQGAGLGLAIV
FT                   KRIASQHGGVVELRNREGGGLEARVSLPLGLLLPRDAVQGKPAE"
FT   gene            complement(338791..339696)
FT                   /gene="rimK"
FT                   /locus_tag="PST_0288"
FT   CDS_pept        complement(338791..339696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="PST_0288"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="Code: HJ; COG: COG0189"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77994"
FT                   /db_xref="GOA:A4VG93"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VG93"
FT                   /protein_id="ABP77994.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGEQRGHEVVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMQGVFPLNESVAIARSRDKLRAL
FT                   QLLSRRGVGLPVTGFAHSPDDIPDLIRMVNGAPLVIKVLEGTQGIGVVLCETEKAAESV
FT                   IEAFMGLKQDIMVQEYIKEAGGADIRCFVVGDKVIAAMKRQAKPGEFRSNLHRGGSASL
FT                   IKITPEERMTAIRAAKVMGLNVAGVDILRSNHGPLVMEVNSSPGLAGIEETTGKDVAGL
FT                   IIQYLEKNGGPHLTRTKGKG"
FT   gene            complement(339693..340160)
FT                   /locus_tag="PST_0289"
FT   CDS_pept        complement(339693..340160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: O; COG: COG4067"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG94"
FT                   /protein_id="ABP77995.1"
FT                   /translation="MKKLDPHTVIGLREWIALPDLGVVGLRAKVDTGASTSALHATDIS
FT                   EFERDGQRWVRFTAHLGTLVQRRHRCEAPLVTRKLIKSSNGQVQTRYVVRTLLALGSHV
FT                   WPVEFTLTCRKTMRYRLLLGSKALVDGQWLIDPSRTYIQDKPQILTSSGAQ"
FT   gene            340262..340660
FT                   /gene="hslR"
FT                   /locus_tag="PST_0290"
FT   CDS_pept        340262..340660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="PST_0290"
FT                   /product="probable heat shock protein"
FT                   /note="Code: J; COG: COG1188"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77996"
FT                   /db_xref="GOA:A4VG95"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG95"
FT                   /protein_id="ABP77996.1"
FT                   /translation="MAEKDDDKVRLDKWLWAARFFKTRALAKAAIEGGKVHCRGERCKP
FT                   SKEPKVGDELVIRSGFDERTVVIRALSAVRRGAPEAQTLYEETAQSLAAREEAAALRKA
FT                   GALGMQTDGRPSKKQRRQIQLLRDFKPG"
FT   gene            complement(340657..341448)
FT                   /locus_tag="PST_0291"
FT   CDS_pept        complement(340657..341448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: I; COG: COG0671"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77997"
FT                   /db_xref="GOA:A4VG96"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG96"
FT                   /protein_id="ABP77997.1"
FT                   /translation="MPVTTPQARWRPLSWFISHLLAGLLLLSWLSPVSRPFWDALDESA
FT                   FHLLNGSLGHQAWWDWLWALASVRVFDILVGALLLTLLIRRDWLFAQHQLRPALFTFVA
FT                   LLLVLLVIRVLVTKLAGHFGWQHASPSLGIAGAYHLSDHFPLLERVFELKDRSSRSFPG
FT                   DHASVLLIWGLFMALFARGGRLALVLGITVLFMLPRLVAGAHWVSDDFVGGLLIALLAI
FT                   GWGYCTPLGAHLAALLQWLARAPMQLAARLPLLRQLAVLRD"
FT   gene            341728..342531
FT                   /gene="yrfI"
FT                   /locus_tag="PST_0292"
FT   CDS_pept        341728..342531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrfI"
FT                   /locus_tag="PST_0292"
FT                   /product="heat shock protein HSP33"
FT                   /note="Code: O; COG: COG1281"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77998"
FT                   /db_xref="GOA:A4VG97"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG97"
FT                   /protein_id="ABP77998.1"
FT                   /translation="MLAKHTYPEPVAQLLGELLAAAALLVGTLKFDGLLILQARSSGAV
FT                   PLLMVECSSAREVRGIARYHAEQIQPDATLTELMPEGMLAITIDPANGQRYQGIVDLEG
FT                   ATLAECLTNYFAASEQLPTRFWLNADSRRACGLLLQQLPADRLKDPEERDASWEHLRTL
FT                   ADTLTAEELLGLDSETLLHRLYHQEQLRLFDALPIRFRCSCSRERSARALVSLGEEDAL
FT                   QLVAEQGGSVSIDCQFCNEKYTYDAADVAQLFAGGGSDAPSDTRH"
FT   gene            342580..344295
FT                   /gene="pckA"
FT                   /locus_tag="PST_0293"
FT   CDS_pept        342580..344295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="PST_0293"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /note="Code: C; COG: COG1866"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP77999"
FT                   /db_xref="GOA:A4VG98"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG98"
FT                   /protein_id="ABP77999.1"
FT                   /translation="MRQGWTCTRAVNYLAITASYPARRIIWHNRAHFFRCSSSLGGLQQ
FT                   HGGIGPRPTGTLMTQATNAVYTDISTAQLIEEAVKRGEGELSANGSLVVKTGHRTGRSP
FT                   ADRFIVEEPSTQHKIAWGPINRPFPAGNFEALWSRVEAYIGERDSFVSHVHVGADPEHY
FT                   LPVKMTTETAWHNLFGRCLFITPEQFNPAGLSEWRILNAPFFQCVPERDGTNSDGCVII
FT                   NFAEKKVLIAGMQYAGEMKKAMFSVQNFLLPDVDVLPMHCAANIGEDGDTTLFFGLSGT
FT                   GKTTLSADESRYLIGDDEHGWGVGRVFNIEGGCYAKCIDLSEKNEPVIWKAIKFGAVLE
FT                   NVVLDERTRLPDYADASLTQNSRAAYPLQHVEKRSEKNLGGEPNAVIFLTCDLTGVLPP
FT                   VSILNNEQAAYHFLSGYTALVGSTEMGSGSGIKSTFSTCFGAPFFPRPAGEYAELLIKR
FT                   INGFGSKVYLVNTGWTGGGYGVGKRFNIPTTRAVIAAIQSGALIGAETEHLSIINLDVP
FT                   KAVAGVDTQLLNPRNTWADKSAYDQAAKELAGKFIENFKKFDVSDAIRNAGPQL"
FT   gene            344459..345061
FT                   /locus_tag="PST_0294"
FT   CDS_pept        344459..345061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0294"
FT                   /product="probable nitroreductase"
FT                   /note="Code: C; COG: COG0778"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78000"
FT                   /db_xref="GOA:A4VG99"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4VG99"
FT                   /protein_id="ABP78000.1"
FT                   /translation="MHTEEAIRTRRAVKAYDPSFQLSREEQDELLQLALLAPSAFNLQH
FT                   VRFVEVSDPALRAQIREVGWNQAQMTDASMLVVICAQVDSWEKNVRRVWEGAPSEVQDY
FT                   MAGAIDAYYRGKPQVQRDEAMRSCGLMAQTLMLAARAKGLDSCPMDGFDFDAVGKLINL
FT                   PDNHVIALMVAVGKRAAEPKPRVGKLPFDEVVIRDRF"
FT   gene            complement(345137..345379)
FT                   /locus_tag="PST_0295"
FT   CDS_pept        complement(345137..345379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78001"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA0"
FT                   /protein_id="ABP78001.1"
FT                   /translation="MRATLIATALLFTSLAQADDAKAQPYTYGTRLDVASVLSVKIKPI
FT                   PYCEVTDAEMTYRDSTGTERKLAYRTLSEACRNQN"
FT   gene            345674..347599
FT                   /locus_tag="PST_0296"
FT   CDS_pept        345674..347599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0296"
FT                   /product="ATP-dependent DNA helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78002"
FT                   /db_xref="GOA:A4VGA1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA1"
FT                   /protein_id="ABP78002.1"
FT                   /translation="MIEQTLRQTFGYDGFRAGQEQAIRAVVAGRSAAAIFPTGSGKSLC
FT                   YQLPALLLPHLTLVVSPLLALMQDQLAFLHRHGIAAASIDSAQSREQTSQTMARAKSGE
FT                   LKILMISVERLKNERFRHFISQVPISLLVVDEAHCISEWGHNFRPDYLKLPDYQRQFNI
FT                   PQVLLLTATATPPVIADMQAKFSIAADDVVTTGFYRPNLNLLVEPVSGFNKQRRLVEWL
FT                   TDRAGQPTIVYVTQQKTAEQIAEHLAQRGFPASAYHAGMAHELRESIQRRFMAGELNCI
FT                   VATIAFGMGIDKADIRNVVHYDLPKSVENYSQEIGRAGRDGQPSDCLVLANRDSLSVLQ
FT                   NFVYGDTPEREGIRCVLDELLQAGAGGQWELMLNQLSEQSNIRQLPLKTLLVQLELRGI
FT                   IAPRFAYFAEYRFKYLLEPEALVAKFEGERRQFVEAIVDTSARARTWCTLDFEALYGQH
FT                   GADRARVVKALEYFQEKGWIELESKQMTEVYALFNQRFDAEALSGELHAYFKQHEASEI
FT                   TRIDNMLALFESAECLSQRLAAYFGDRQAPQRCGHCSVCRGQVAKLPEPPTLAPLEQID
FT                   LAARCAEFSQRYTQLKGGAPSAECLTRFLCGISVPVFTKLKARQLPGFASLEAYPYAEV
FT                   RARLAG"
FT   gene            complement(347596..349617)
FT                   /locus_tag="PST_0297"
FT   CDS_pept        complement(347596..349617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78003"
FT                   /db_xref="GOA:A4VGA2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA2"
FT                   /protein_id="ABP78003.1"
FT                   /translation="MISFSRFKPGHTQSSGTASLLCTASQLSQQLTALRFEPTYIAGFV
FT                   SPHIDLDAVARQVSQRFPRATISLCTTAGELSSKGQRLYCAAGAQWDRVVLQLFDASVI
FT                   AAAEIVRVPLECEDIRGQGQRLPMSERIARLTASIKRVQVSMKIDYRDTLANIFFDGLS
FT                   ASESFFMEALYESGRFPCLFVGGSAGGKLDFQRTQLHDGQRSYQNHALIVFLKCARNVR
FT                   FGVFKSQNFEPTPLSLSVLSASLEDRYISQVVDARGNIRSMVQALCEALRCAPQELEQR
FT                   LADYSFAIRVGEEVFVRSISQIDFANERVHLFCDVAPGEELIMVKRTPLAETTRRDYQQ
FT                   FMRNKPGKPLVGILNDCILRRLNNEQALGGMDPVFDDVPVAGYSTFGEILGLNLNQTLT
FT                   AVFFFRTNGKDDFHDEYTDNFIAYHGEFKAFFLRRQIKKLTGLSQVVVKQIEQFKRQDY
FT                   SSAVDINGLDEHIRPVFRGLADLGQVLSQADEERRSMSEQLSQCATELHGSMDDLTLNI
FT                   NQQGTVIEQAGSSVKQMVHQADEVVSSARDLAQSSQRIQSVVQTIQQIAGQTNLLALNA
FT                   AIEAARAGDMGRGFAVVADEVRKLAEITGRNAEEIGTDIDRLASEIRAVAQHIEAQSAG
FT                   VGSLTGLLDALENSSNLTADTSRQTKGVADRLIGLTAR"
FT   gene            349958..351592
FT                   /locus_tag="PST_0298"
FT   CDS_pept        349958..351592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0298"
FT                   /product="probable chemotaxis transducer"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78004"
FT                   /db_xref="GOA:A4VGA3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA3"
FT                   /protein_id="ABP78004.1"
FT                   /translation="MTRLFSDLGFRWKITLPISALAILLVLMGAVGMRGIERVADSSEL
FT                   LATRHLPAIGLLLNADRDLYQAFVAERSLLDSDAGAHAQALKASHAENLKQAYDRVQKY
FT                   AAMQPGRDALALVEQFNRGFEQWSTVSKRVIEQVEQNPQAASALSFGDSESRFDAMRDV
FT                   IDKLGELEEAAADAEGQAALAEGAATATQQGVVLLIGLLGCVVLVLGLPLVVLRPMRRL
FT                   LDRLQQIAEGDGDLRARLEVRSADELGQLGTAFNRFLDKLQPLIAEVGRVTAEVETAAR
FT                   GMASMAETNDRLISSEHAAVDQVTTAATEMSAAVHEVALNAQHASDAAHAAHMQSNQGA
FT                   AVVGSTIQSIRQLAQDVEGASQTIGALADETASIGAVLEVIRGIAEQTNLLALNAAIEA
FT                   ARAGEQGRGFAVVADEVRALAARTQDSTKDIQSRIERLQSGVDKAVQAMHTGSSKARDS
FT                   VERAEGVDQVLAEASASVQRINDMAAQIATACEEQSCVTEEIARNITDIRDLSNEAATY
FT                   SSQGKLASQQLSGLAKTLADLVGRFRT"
FT   gene            352043..352960
FT                   /locus_tag="PST_0299"
FT   CDS_pept        352043..352960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0299"
FT                   /product="oxidoreductase, putative"
FT                   /note="Code: R; COG: COG0656"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78005"
FT                   /db_xref="GOA:A4VGA4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA4"
FT                   /protein_id="ABP78005.1"
FT                   /translation="MFTRRQLLQRSALIATLSALGPLLPALSFAAQGVLRRAIPATGET
FT                   LPVIGLGTSITHNVSLDDPQMERLLEVLRVLVEGGASLIDTAPSYGNAERVVGELVNRL
FT                   GQRDRVFLASKASSTGRERGLAQIEASFEALQTDTIDLIQVHNLQDTRTQLGLLRELKQ
FT                   EGRVRYIGVTHYVESAHDRLLDTLKQEQVDFVQFNYSVSERNAEKQLLPYCADNGIATL
FT                   INRPFTRGNLLSKVRDKPLPDWAAEIDASSWAQLLLKFILAEPAVTAVIPATSNPRYMA
FT                   DNLLAGQGRLPDARQRQMIVDAFR"
FT   gene            352971..354269
FT                   /locus_tag="PST_0300"
FT   CDS_pept        352971..354269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0300"
FT                   /product="transporter, putative"
FT                   /note="Code: C; COG: COG3202"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78006"
FT                   /db_xref="GOA:A4VGA5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA5"
FT                   /protein_id="ABP78006.1"
FT                   /translation="MPVASAALINARPGELRAALAGFGLFFCLFAGYFMLRPIRESMGI
FT                   QGGVENLQWLFTATFVAMLVAVPLFAWLNSRVARIHYIDWVYGFFCLNLLLFAALFFAL
FT                   RDSVWLARVFYVWISVYNLFVVSVAWSLMADVFDAPQARRLFAFIAAGASVGGLVGPAA
FT                   SALLVGVLGQFGLMLLAALLLLAAVALKHFLMTWREVHGAGRPGAEHAESPKRPVAGNP
FT                   FSGLTRVLGSRYLLGVAVFVLLLTTASTFLYFEQARLVAELFPDRVGQVRVFGAIDFVV
FT                   QAGALLSQLFITGRIAQRLGVRVLLAAVPALVCLGFVGLALAPTFAVLAAVMIVRRIGE
FT                   YAFVRPGREMLFAPLDAQSKYKAKNFIDTVVYRGGDALSGWAKSLLDSLGHGAWLVAVV
FT                   GAVCAAIWGVVGWFIGGQADRKAAVQSAPGRSR"
FT   gene            354330..354752
FT                   /locus_tag="PST_0301"
FT   CDS_pept        354330..354752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0301"
FT                   /product="ribosomal subunit interface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78007"
FT                   /db_xref="GOA:A4VGA6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA6"
FT                   /protein_id="ABP78007.1"
FT                   /translation="MHVQVNSNHIPGSVELHEWVGTTVEDRLERFDDFLTRVEVHISDE
FT                   NAQKAGADDKRCQIEARPKGHQAVSVTHKAESLQLAVDGAADKMQHALENLMGKLDTRV
FT                   QSSGELNDPLLDEPPQSVKDAMLEEEFLEKQSELDK"
FT   gene            354864..355424
FT                   /locus_tag="PST_0302"
FT   CDS_pept        354864..355424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78008"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA7"
FT                   /protein_id="ABP78008.1"
FT                   /translation="MQIILVRHGRPDHGAARWSTPIGMKAWVARYNAAAVATGERPDSL
FT                   VELAGSVGIVVCSSLQRCVESRSQLACDCCQEPDPLFAEAHLPYPDWGLPLLPSRFWRL
FT                   VFRGAWFLGFSSHTEPVGESTERARAAADRLIALAEEHGSVLLMGHKIMNALIARELRR
FT                   RGWKGPMFPLLSGYWQPSRYTRA"
FT   gene            355550..356761
FT                   /locus_tag="PST_0303"
FT   CDS_pept        355550..356761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0303"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78009"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA8"
FT                   /protein_id="ABP78009.1"
FT                   /translation="MTRLQRLLGLSICLATPAMAWEQVLIDHDKPAKNWRVTSEELGID
FT                   SAKPFSVSMRTLHGGRQEGVSLIEIDNGTMRMTVVPTRGMNVLEAVAGDVRLGWDSPVQ
FT                   EVVNPAFIELNGRGGLGWLEGFNELVTRCGFEWVGHPGEDNGELLTLHGRAANIPASRV
FT                   VLTIDEKPPYAIRLRGELQEKAFKKLDVAIHTELSTEPGRAGFSLHDTLTNQGDYAKEY
FT                   QALYHTNFGTPLLEEGARFVAPVKQVSPFNPRAAKELNDWQRYRGPTRDYDETVFNLVP
FT                   YADEQGETLTMLHNRAGSLGVSVGFNTGELPVFSLWKNTDTEQQGYVTGLEPGTSYSYN
FT                   RRYQRALGLVPKIEPGEQKHFRVSYELLADSAAVERVRQRIEALQAGRETEVREQPLVD
FT                   LSKD"
FT   gene            complement(357308..359257)
FT                   /locus_tag="PST_0304"
FT   CDS_pept        complement(357308..359257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0304"
FT                   /product="histidine kinase-response regulator hybrid
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78010"
FT                   /db_xref="GOA:A4VGA9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGA9"
FT                   /protein_id="ABP78010.1"
FT                   /translation="MGRESRLLIVDDNATTRYAMRRVLERHGYQVLEAGTGSDGLALVA
FT                   GAMPDALILDVNLPDMSGFDIARQLRTDPNTALLPLIHVSAASIETGDIITGLDAGGDA
FT                   YLIHPVDPDVLLATLRTLLRVRDTERALRESEARFREIFIHVAAPIAVLDAQLQLHECN
FT                   HAFERLIGTEDRSAPLADCILPGQDAVLDELRTQLQAGNRWRTSLAMRVNGETRETEWQ
FT                   ISPYRTQGLGLVFVEDVTEQRHRERAQRQEIATTTSQLAHEVAERARTEEQLLQAQKMD
FT                   ALGKLTGGIAHDFNNLLTGIITGIELMKQRIIEGRADSVLRFADAALSSARSAASLTNR
FT                   LLAFARKQPLDARALDINERIRSLEDLLRRTIGERITLSFDFTAGPAVARVDVSQFESA
FT                   LLNLVINARDALPEGGHIGIRTFSTDASQHPELAAGRYIGLCVSDDGTGIDPAVVDKVF
FT                   DPFFTTKPQGRGTGLGLSSIYGFALQSGGDAHIRSTLGVGTDVTLLLPAADGETSLAPS
FT                   AAPEDSARLAGHEHVLVVEDMPSVRMLIAETLIEAGYRCSQAGDVETAQALLEADPSID
FT                   LLLTDVGLPRLSGRQLAEWARRSRPALPVVLMTGYAEKASSREGFVDERMELVLKPFEG
FT                   ADLLGKIRALLDNG"
FT   gene            complement(359247..360116)
FT                   /locus_tag="PST_0305"
FT   CDS_pept        complement(359247..360116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0305"
FT                   /product="two-component system sensor protein"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78011"
FT                   /db_xref="GOA:A4VGB0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB0"
FT                   /protein_id="ABP78011.1"
FT                   /translation="MADPIATTGEAELLEQLRRENESLRAELEETNQGVLALYAELDTQ
FT                   AEQLRQASELKSRFLSYMSHEFRTPLGSILSITRLLSDELDGPLSPEQHKQVRFVSSAA
FT                   SELSEMVDDLLDLAKIEAGRVSISPAWFDMLDLFSALRGMFRPIVEGSPVDLIFEEPQG
FT                   LPRFYTDDKKLAQILRNFISNALKFTTQGEVRVSARMETPQQVRFAVTDTGIGIAPQLH
FT                   DRLFEDFAQVDSPLQKRLRGTGLGLALCKRFAELLGGRVGLQSEPGKGSEFYVIIPFSI
FT                   EAEGSDGA"
FT   gene            complement(360109..361119)
FT                   /locus_tag="PST_0306"
FT   CDS_pept        complement(360109..361119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0306"
FT                   /product="two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78012"
FT                   /db_xref="GOA:A4VGB1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB1"
FT                   /protein_id="ABP78012.1"
FT                   /translation="MNIPGSMTQVLPLEDSSQVGHARRVTQRLAEQHGFDATDAGRVAL
FT                   LTTELCTNVLKHAGIGELHLRIIPGQDKPGVEIIAVDRGPGFQLDQCLTDGYSTGGTKG
FT                   IGLGALVRLAQVFDAYSDRRGSVVLAQLFPRGSRPCAWRFGVSQHPHPGETACGDVWQL
FT                   ALDGSHCSVLVLDGIGHGESAQQAARAGAEAFGEAPFDAATSVFTRMHQAMNGSRGGAA
FT                   AIAQYDGERQTLAFAGIGNIGASLIGSEGSRGLASHPGIVGVRFRKAHVFDYPQGEAQL
FT                   LLLFSDGLQSRWSLRDYPGLIQRHPAIIATLLHRDFCRGRDDVTVLALNLEAPRG"
FT   gene            complement(361116..361934)
FT                   /locus_tag="PST_0307"
FT   CDS_pept        complement(361116..361934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78013"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB2"
FT                   /protein_id="ABP78013.1"
FT                   /translation="MPSRSLCAVPASPSPGPPDGSNSYSADGRVPARHHPGRHARPTGA
FT                   DPAGRFGRAHQRNLGARRADGHLRTGHGRFLHWPDDRQHFRPRANHGCRNGGGGHAARR
FT                   GDHPGGAGPRAARRQHRSERRARHAAAARTCGRAMIVRSSGSQPVRVEQDVVLARQTVR
FT                   KLTQDCAMRLIDQTKLVTAVSELARNTVVYGGGGDMDWQIVEEGTRVGVRLTFRDEGPG
FT                   IPDIKLAMTDGWTSGGGLGLGLTGAKRLVDDFELESTVGVGTRITITRWT"
FT   gene            complement(361879..362640)
FT                   /locus_tag="PST_0308"
FT   CDS_pept        complement(361879..362640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0308"
FT                   /product="positive regulator of sigma-B"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78014"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB3"
FT                   /protein_id="ABP78014.1"
FT                   /translation="MGGFHNVKPEELTQQTAEFIRLLISGTADGSADIAGPAWDAMRSY
FT                   LERLSRSRALLGFDSQQTAGFIFAAKRPLMSLLQSEYANEPAVFAEQLWAVSELLDHLG
FT                   LHTVRTFQQSREDVIKRQQKELLELSTPVVKLWDGVLALPMIGTLDSQRTQVVMESLLQ
FT                   RIVDTGSEIAIIDITGVPTVDTLVAQHLLKTVTAIRLMGADCIISGVRPQIAQTIVHLG
FT                   LDLQGIVTKASLADALALALRRSGLTVTRTA"
FT   gene            complement(362921..363841)
FT                   /locus_tag="PST_0309"
FT   CDS_pept        complement(362921..363841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0309"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78015"
FT                   /db_xref="GOA:A4VGB4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB4"
FT                   /protein_id="ABP78015.1"
FT                   /translation="MMFRIHQVNIYNFDLNLLRVLDALLRERNVSRAAERLSLSQPAVS
FT                   NALGRLRELLDDPLLVRVGRAMQPTPRALALEAPIRHALQQIEHSLIAGEAFDPARSHQ
FT                   RFRIAVTDYVELICMPALMRRLAERAPSIQLAIQHLTPNLPTDALDNGEVDLVLGRFLD
FT                   VPSRFHVRHWASETLQVAVRRDHPLLSGRLTLDAFLRLRHLWVHGGQTRGMVDQWLEGQ
FT                   GLEREVVYTTPNYLQAAHIVASSDLAAVLPTQLARHFARLLPLELFDLPFDLGPFGLDI
FT                   VSVAQRQNDAALQWLIEQIDGVAPA"
FT   gene            363922..365160
FT                   /locus_tag="PST_0310"
FT   CDS_pept        363922..365160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0310"
FT                   /product="probable 3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="Code: I; COG: COG1250"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78016"
FT                   /db_xref="GOA:A4VGB5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB5"
FT                   /protein_id="ABP78016.1"
FT                   /translation="MSQPRFDIQTAAVIGAGTMGRGIVMSLANAGVQVLWLDNNPEMLE
FT                   QALGAVADTYAHNVRQGRIDEAEAAARRARIAKAADYPALADVDLVIEAVYENLELKQK
FT                   IFRELDGIVKAAGILASNTSALDIDAIAAVTKRPEQVVGLHFFSPAHIMKLLEIVRGTK
FT                   TAPAVLEAATALGKRMGKVSVIAGNCPGFIGNRMLATYVREARMMLLEGAYPHQVDAAL
FT                   QGFGFAMGPFRMYDVVGIDLEWRARELAGKGQDEAEVQVDNRLCELGRFGQKSRMGYYR
FT                   YAEGSRQAEHDPEVDALVQRESERLGYERREIGPEEILERCLLALVNEGAKILEEGMAE
FT                   SSADIDTVYLYGYGFPAEVGGPMTWADRQGLPAIRERLNTLAERHGEHWQPAGLIDSLA
FT                   TLGGRFADYKKEA"
FT   gene            365163..366953
FT                   /locus_tag="PST_0311"
FT   CDS_pept        365163..366953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0311"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78017"
FT                   /db_xref="GOA:A4VGB6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB6"
FT                   /protein_id="ABP78017.1"
FT                   /translation="MEYKAPLRDMRFVLHELFDATGHCELLGNGLDRELIDGVLEEAAR
FT                   YTGGEIAPLNRNSDEEGVTLENGEVRTPQGFVEAYKQYVDNGWASMTGPTEYGGQGFPQ
FT                   LVACNFHEMLMGASLSFRIYSGLTEGAVLALYKHGSDELKNAYLEKLVSGRWSGTMCLT
FT                   EPQAGTDLALLRTRAEPQADGSYKVSGSKIFISGGEHDMSENIVHLVLARLPDAPAGVK
FT                   GISLLLVPKFIANADGTPGARNALSCGAIEHKMGIKGAATCVMNFDGATGWIVGEPNQG
FT                   LACMFTMMNDARFQVGLQGLGIAEQAYQGSLAYARERLQSRGLAGAQRPDKPADPIIVH
FT                   PDVRRMLLTQKTLVEGSRMLAAYCARQLDLEHGHPEPSYRKAASKRAALLIPIVKAFFT
FT                   DMGQEVASLGVQVYGGHGYIREWGMEQLMRDSRITQLYEGTNGIQALDYIRRKLLGDGG
FT                   AELSALQAEFSEICDRQSDRPALHALASKVQMRLGEWRELTAEIIAATGRDPQEIGAVS
FT                   VDFLQYSAYVLLAGLWLQAAARAQDALEQGAGEEAFYQAKLASADFYLRRVLPRASAHR
FT                   EAIQGGADCLMALPESDFAF"
FT   gene            366978..368141
FT                   /locus_tag="PST_0312"
FT   CDS_pept        366978..368141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0312"
FT                   /product="probable iron-containing alcohol dehydrogenase"
FT                   /note="Code: C; COG: COG1454"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78018"
FT                   /db_xref="GOA:A4VGB7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB7"
FT                   /protein_id="ABP78018.1"
FT                   /translation="MHPFSFATTAQLICEPGSSRRLASLCKERGARSVLVVTDPGITRF
FT                   GLLDEVLPGFETEGLQVAVYDQVVADPPEHIVLAAVAQAKASRVDLIIGFGGGSSMDVA
FT                   KLVALLAHPDCAQSLQDIYGVGNAKGQRLPLIQVPTTAGTGSEVTQIAIITTGETTKMG
FT                   VVSPLLLPDLALLDADLTLGLPPAVTAATGIDAMVHAIEAYTSALKKNPMSDLLAREAL
FT                   RLLAANLDEAVHNGSNREARQAMLLGACLAGQAFANAPVAAVHALAYPLGGNFHIPHGL
FT                   SNALVLPQVLRFNVSAAATHYGELAPIILGERLRTGDPSTYAEQLIEEFEQMSARVGLP
FT                   TRLRDAGVPEEMLPQLAKEAMLQQRLLVNNPREVSEADALAIYQAAY"
FT   gene            368180..368611
FT                   /locus_tag="PST_0313"
FT   CDS_pept        368180..368611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0313"
FT                   /product="putative thioesterase"
FT                   /note="Code: R; COG: COG0824"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78019"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB8"
FT                   /protein_id="ABP78019.1"
FT                   /translation="MPEQPKHLRRDYKHFQPITTRWHDNDIYGHVNNVVYYGFFDTAVN
FT                   NYLIQQGGLDIQDGDIVGFVVSSACDYFASIAYPDLIEVGLRVARLGNSSVQYELAIFR
FT                   EGEQEACAAGRFVHVFVDRASNRPTAIPGRLRAALEALS"
FT   gene            368683..369288
FT                   /locus_tag="PST_0314"
FT   CDS_pept        368683..369288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78020"
FT                   /db_xref="GOA:A4VGB9"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGB9"
FT                   /protein_id="ABP78020.1"
FT                   /translation="MVAARRQRRCLRHSMVLVFVLVMAFGFAWMAVVAAIIPVAAVAPI
FT                   TVVVIVAVGVADSAAGTAANGRANQAAGAAADLLADDVTACRAQATADGRFGAAALVGA
FT                   DHATCRTADAGADGRASRATQMFTHHGTERATEGTANGGFGVAAGKGGGAEQAGGQQEN
FT                   RGVLHGVIPYEELRRDPHVPLRFRQGLPDEMRDPVPVC"
FT   gene            complement(369349..370020)
FT                   /locus_tag="PST_0315"
FT   CDS_pept        complement(369349..370020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0315"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /note="Code: C; COG: COG1526"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78021"
FT                   /db_xref="GOA:A4VGC0"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC0"
FT                   /protein_id="ABP78021.1"
FT                   /translation="MISPANLEDFVVGFSLANGFVESLSDIYDIRLHGRGNARRAEVEI
FT                   SSRAFWRLKQQRRQLPGTSSCGLCGVEALEQALPQLAKLPSSALPPSHWLLDLRQRIGE
FT                   FQPLGRDCGAVHAALFMDATGELRLGREDIGRHNALDKLIGAMARVGCEPAGGLAIVTS
FT                   RCSLELVHKVQRAGIPTLVSLSSPTGLAAQWAQRHNLNLIHLPQHSPPRVYSPAAGDGC
FT                   A"
FT   gene            complement(370293..372692)
FT                   /locus_tag="PST_0316"
FT   CDS_pept        complement(370293..372692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0316"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78022"
FT                   /db_xref="GOA:A4VGC1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC1"
FT                   /protein_id="ABP78022.1"
FT                   /translation="MCILWGEQALQLYNDAHAALIGDRHPAELGQPACRRWGATWELLN
FT                   PACDAARRGEPRLLRNQRVAIERGGAAEDAWFDLALSPIRNAPHGIGGLLLCLSETSER
FT                   VRTETRLSQTALHYKLSAEVHRASEQRLQLALEASDLIGIWDWALGSEGIPPGAELSRI
FT                   LPVEQSGPKGLSSEAFFDHVHPQDAPRLRAALERCIAERGALDQRYRLQLPNGETRWAL
FT                   ARGRCHCDEQGRPLRFPGAVMDISRQQASEDALRQSEAELKMITDALPVLIGYLDHKER
FT                   FRFNNRYYTEWFGYPTQWLLGKTAREVLGEQGYAEREQSIRAALAGQQVVFEAYSPHRD
FT                   GQARRMLVHYLPRRDAQGAVLGFFVMALDVTERWRAEQALRELNETLESRIQERTQALA
FT                   EVYERLLKEMASREQAQEALRQSQKMEAVGQLTGGIAHDFNNMLTGIIGGLDLIQRYIQ
FT                   SGRHGETQRFIDAAVTSANRAAALTHRLLAFARRQPLNLKRVELNQLIESMHDLLSRTL
FT                   GRHIQIRNQLQAGLWPVSSDENQLESALLNLVINARDAMPDGGTLLLETRNTELRQGEV
FT                   GDLAAGRYVSLCLTDTGCGMSAKVLASVFEPFFTTKPIGQGTGLGLSMVYGFTRQAGGH
FT                   IQIASEPGVGTQVSLYLPVFDEQDAVAAPAAETEGPLRAQQGETVLVVEDDPAVRLLVI
FT                   DVLQMLGYQTLEAADGNAAIRILESATAVDMLVTDVGLPGMNGRQLADVARQQYPGLPV
FT                   LFMTGYARQAASPDFLEPGMDMISKPFNLDALAKRVSDMLMERDQR"
FT   gene            complement(373015..373695)
FT                   /locus_tag="PST_0317"
FT   CDS_pept        complement(373015..373695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0317"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="Code: R; COG: COG1011"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78023"
FT                   /db_xref="GOA:A4VGC2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC2"
FT                   /protein_id="ABP78023.1"
FT                   /translation="MIATLPWPDIDTVLLDMDGTLLDLHFDNHFWLELLPQRYAELHGI
FT                   SRAMAELELAPLFNEHVGKLTWYCLDYWTRELNLPIREMKREIAELIALRPSADEFLSA
FT                   LRQADKRVVLITNAHRDSLSLKLEKIELAPWFDRLISSHDYGYPKEAAQFWYALRQDLA
FT                   FDPSRTLFIDDSLPILRSARHFGVAHLLAVREPDSRRAPKDTEEFVAVDDYRELIASLH
FT                   GNQA"
FT   gene            373811..374377
FT                   /gene="nudE"
FT                   /locus_tag="PST_0318"
FT   CDS_pept        373811..374377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="PST_0318"
FT                   /product="ADP compound hydrolase"
FT                   /note="Code: LR; COG: COG0494"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78024"
FT                   /db_xref="GOA:A4VGC3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC3"
FT                   /protein_id="ABP78024.1"
FT                   /translation="MRQKPTVLAREIVASSRLFRVEELQLRFSNGVERTYERLVGKGSG
FT                   YGAVMIVALADAENALLVEEYCGGTDSYELSLPKGLIEPGEDVLEAANRELKEEAGFGA
FT                   RRLELLTELSLSPGYMSQKIQVVLARDLYPEQLPGDEPEPMRLEQVSLHELSSLVQHPQ
FT                   FSEGRALAALYLARDLLTQRGEFGQ"
FT   gene            374374..375192
FT                   /gene="cysQ"
FT                   /locus_tag="PST_0319"
FT   CDS_pept        374374..375192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="PST_0319"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="Code: P; COG: COG1218"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78025"
FT                   /db_xref="GOA:A4VGC4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC4"
FT                   /protein_id="ABP78025.1"
FT                   /translation="MSHPYLSAVIDLVRQAGEAILPHWRSELEVQAKADASPVTAADMA
FT                   AHHVLLDGLQALDGSIPVLSEEDCAVPLAERAGWTRWWLVDPLDGTKEFIAGSEEFTVN
FT                   VALIEQGEVRFGVVGIPASGRCYYGGKDFGAWRSEADGATQPLRVRPHPVGSFTVVASR
FT                   RHSSPAQERLLDSLRGRFGELALANVGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQG
FT                   VLEGAGGEVLEVAGAPLRYEARETYLNPSFLALPAGVDWREMLIELANRS"
FT   gene            complement(375246..375743)
FT                   /locus_tag="PST_0320"
FT   CDS_pept        complement(375246..375743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78026"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC5"
FT                   /protein_id="ABP78026.1"
FT                   /translation="MASVCIFVTFRNLPGMSRDSRYLEAILHHDIPLTRSLGLRVEQWE
FT                   NHELRLQVPLQPNINHKSSMFGGSLYCAAVLAGWGWLHLRLREAGIEDGHIVIHEGKIE
FT                   YPLPVVDDAMAICSAPSPEAWERFESIYRRRGRSRLELHSRILASDGRDAVRFTGQFVL
FT                   HK"
FT   gene            complement(375872..376273)
FT                   /locus_tag="PST_0322"
FT   CDS_pept        complement(375872..376273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0322"
FT                   /product="hypothetical Fe-S-cluster oxidoreductase"
FT                   /note="Code: R; COG: COG0727"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78027"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC6"
FT                   /protein_id="ABP78027.1"
FT                   /translation="MKTRLIASADPERLDTWVRYSAGLCRDCHATCCTLPVEVRIDDLI
FT                   RLELVDAFERDEPAKNIAKRLSKAGIVEHFNHKHEIFTLTRLTNGDCLYLDRKTRLCTV
FT                   YAKRPDTCRNHPRIGPRPGYCAYRSKSGG"
FT   gene            375929..376378
FT                   /locus_tag="PST_0321"
FT   CDS_pept        375929..376378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78028"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC7"
FT                   /protein_id="ABP78028.1"
FT                   /translation="MVAAGVRPLGIDRAEARLAVQIEAVAIGQARQREDFVLVIEVLDD
FT                   ARLAQALGDVLRRLVALEGIDQFQADQVVDAHFHRQGAAGRVAVTAQAGAVAYPGVQAF
FT                   RVGGGDQSCLHGMSSGAVGRADHSGSRADYQCLPAPVTGQAVAQM"
FT   gene            376418..378928
FT                   /gene="glgP"
FT                   /locus_tag="PST_0323"
FT   CDS_pept        376418..378928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="PST_0323"
FT                   /product="glycogen phosphorylase"
FT                   /note="Code: G; COG: COG0058"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78029"
FT                   /db_xref="GOA:A4VGC8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGC8"
FT                   /protein_id="ABP78029.1"
FT                   /translation="MNGRGCRESLLCVFANRGLSMTQESANATAQEVAAFRERVLRKLT
FT                   YSVGKDPENASDYDWFHAVALATRDSTIDRWMDCTREAYTGGQKRVYYLSLEFLIGRLL
FT                   VDSLSNLGLFEVAREALAGLDVDIDRIRLLEPDAALGNGGLGRLAACFMESMATLGVVS
FT                   HGYGIRYDHGLFRQAIVDGWQHEQTETWLDFGNPWEFERSEVKYLIGFGGSVTATTNEQ
FT                   GEVQHFWHWAEGVRAIAYDTPIVGWRGAGVNTLRLWRARPEADFHLARFNAGDHIGAAA
FT                   EEARAESISRVLYPADSTEAGQELRLRQEYFFVAASLQDLLRRHLKQRGSLDSLPEYTS
FT                   IQLNDTHPAIAVAELMRLLVDVHSYEWQHAWRLTTATLSYTNHTLLPEALETWPVGLME
FT                   RLLPRHMQIIYLINAYHLDNLRERGIHDAELLRSVSLIEEDHGRRVRMGNLAFLGSHST
FT                   NGVSGLHTQLMRKTVFTDLHRLYPQRINSKTNGITFRRWLYQANPQLTQLLVEHLGEEV
FT                   LDEPETRLRQLEPYAEQAAFRQRFAEQRLANKRHLANVIQERLGISVDPTALFDVHVKR
FT                   IHEYKRQLLNLLHTVALYQAIRSDPGGNWVPRVKIFAGKAAASYHQAKLIIKLTNDIAN
FT                   TINADPTVRGLLKVVFLPNYNVSLAEDIIPAADLSEQISTAGLEASGTSNMKFALNGAL
FT                   TIGTLDGANVEMSEQIGLEHMFIFGLTAQEVNARKQGNEYNAEAIIAGSHRLSEVLSAI
FT                   RGGGFSPGDPGRYVGLVDGISWHDTFMVCADFEAYWQAQLEVEERWRDPARWWRSSVLN
FT                   TARTGWFSSDRTIREYAREIWKVM"
FT   gene            379112..380122
FT                   /gene="fbp"
FT                   /locus_tag="PST_0324"
FT   CDS_pept        379112..380122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="PST_0324"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /note="Code: G; COG: COG0158"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78030"
FT                   /db_xref="GOA:A4VGC9"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGC9"
FT                   /protein_id="ABP78030.1"
FT                   /translation="MSRVTLSRYLIEQTRSNNTPADLRFLIEVVARACKAISHQVSKGA
FT                   LGGVLGSAGSENVQGEVQKKLDVLSNEILLEANEWGGHLAGMASEEMDNAYQIPGKYPK
FT                   GAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPDACFSQNDALGEEAFLQPGTKQVAAGY
FT                   AIYGPQTMLVLTLGHGVMGFTLDRELGSFVLTHENLCVPQSTAEFAINMSNQRHWEAPV
FT                   QRYVGELLAGKEGPLGKNYNMRWIASMVADVHRILTRGGIFMYPRDAREPDKAGKLRLM
FT                   YEANPMSMIIEQAGGAATTGTQRILEIQPQSLHQRVPVFLGSKEEVERVTGYHQG"
FT   gene            380126..380728
FT                   /locus_tag="PST_0325"
FT   CDS_pept        380126..380728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3803"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78031"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD0"
FT                   /protein_id="ABP78031.1"
FT                   /translation="MQAPWQDLLHWWFGQGTSATEIAAEKQRLWFGYRPQQDAEARERF
FT                   GTLVEQALNGDLQDWAELPEGWLALVLLLDQLPRMIHRDTPRAFAGDERAQQLVRDGLA
FT                   HGGDMLLSPIQRVFIYLVLEHAENLAVQDLAVAHFTALRDIAAEHEQALFRDFLDYAER
FT                   HREVISRFGRFPHRNAILGRDSSDAEQSFLQQPGSSF"
FT   gene            380810..381064
FT                   /locus_tag="PST_0326"
FT   CDS_pept        380810..381064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0326"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78032"
FT                   /db_xref="GOA:A4VGD1"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD1"
FT                   /protein_id="ABP78032.1"
FT                   /translation="MSLRTPLLIACTVLLAACSPITQENFAKLKPGMERVEVEKLLGKP
FT                   SECAGALGMSSCTWGEKNRFISVQFAGDKVMMFSGKGLK"
FT   gene            381090..381623
FT                   /gene="blc"
FT                   /locus_tag="PST_0327"
FT   CDS_pept        381090..381623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="PST_0327"
FT                   /product="outer membrane lipoprotein Blc"
FT                   /note="Code: M; COG: COG3040"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78033"
FT                   /db_xref="GOA:A4VGD2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD2"
FT                   /protein_id="ABP78033.1"
FT                   /translation="MRASVALLCLILLSGCVGGGRERPPETVGEVDLARYQGTWYELAR
FT                   LPMFFQRDCLRSEAHYQLQANGKVAVTNRCETEDGQWQEAKGEAVPQQAGRTDRLWVRF
FT                   DNWFGRLFPDLTKGHYWVLYLDEGYSTALVGSPDRKYLWLLARDAEVDQATRARLLSEA
FT                   ERRGYDTSELIWRQ"
FT   gene            complement(381646..382071)
FT                   /locus_tag="PST_0328"
FT   CDS_pept        complement(381646..382071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78034"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD3"
FT                   /protein_id="ABP78034.1"
FT                   /translation="MSAWKIAALAVLLALVGCGRDDPQAALQQAAEQLQASLESKQTGE
FT                   LMALLHADFQAQQQYDRDWARRTATLMFMRHRNVRVIALSQRSWIDATYPDRGHTEAQV
FT                   ALTGAEALLPQQAGHYQVRLEWRQENGSWQLARLQWQ"
FT   gene            382150..383124
FT                   /gene="pip"
FT                   /locus_tag="PST_0329"
FT   CDS_pept        382150..383124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="PST_0329"
FT                   /product="proline iminopeptidase"
FT                   /note="Code: R; COG: COG0596"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78035"
FT                   /db_xref="GOA:A4VGD4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD4"
FT                   /protein_id="ABP78035.1"
FT                   /translation="MQTLYPEIKPYARHELAVEEPHVLYVDESGSPDGLPVLFVHGGPG
FT                   GGCDAISRRFFDPSLYRIITFDQRGCGRSTPHASLENNTTAHLIADMQRIREHLGIDKW
FT                   VLFGGSWGSTLSLAYAQAFPEHVHALILRGIFLCRPEDLSWFYQEGASRLFPDYWQDFV
FT                   APIPPEERDDLMQAFYRRLTGSDQIAQMHAAKAWSCWEGRTATLRPNPNVVERFADPHR
FT                   ALSMARIECHYFVNQAFLEPDQLLRDMPKIAHLPGIIVHGRYDAICPLDNAWALHQAWP
FT                   NSELQIIRDAGHSAAEVGIADALVRATGEIAHRLLDLPPADAE"
FT   gene            383121..383558
FT                   /gene="dtD"
FT                   /locus_tag="PST_0330"
FT   CDS_pept        383121..383558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtD"
FT                   /locus_tag="PST_0330"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="Code: J; COG: COG1490"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78036"
FT                   /db_xref="GOA:A4VGD5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGD5"
FT                   /protein_id="ABP78036.1"
FT                   /translation="MKGLIQRVRHARVEVAGEIVGAIDQGLLVLVGVEREDDQARADKL
FT                   LHKLLNYRVFGDEQGKMNRSLKDIGGGLLLVSQFTLAADTRSGLRPSFSSAAPPAHGEA
FT                   LYDYLLARARDQHPEVACGRFGAEMQVHLVNDGPVTFLLES"
FT   gene            complement(383562..383981)
FT                   /locus_tag="PST_0331"
FT   CDS_pept        complement(383562..383981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78037"
FT                   /db_xref="InterPro:IPR005361"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD6"
FT                   /protein_id="ABP78037.1"
FT                   /translation="MRPLTIDMHRLEFALDGRDIAEYYLDLESGEIRAIFPGDPPPGAM
FT                   DKYDVKDDRYLHIEPLDLAQSIAMREAFLFTQHDPIAHAVLSNALKGRKPLRTFDFKLE
FT                   DFPEVREAWLRYQTVQLREYAITWLRENDLEPVRH"
FT   gene            complement(384168..384875)
FT                   /locus_tag="PST_0332"
FT   CDS_pept        complement(384168..384875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1385"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78038"
FT                   /db_xref="GOA:A4VGD7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD7"
FT                   /protein_id="ABP78038.1"
FT                   /translation="MNLLLLEEGDFVAADRVRLRDRRLTHMRDVHRVEVNESLRVGRLG
FT                   GQMGSGRLLRLDATEAELQVSFDQPPPAKLPVTLLLALPRPKMLRRVLQTVAAMGVPRL
FT                   VLLNSYRVEKSFWQTPFLEPAAIREQLILGLEQARDTVLPEVIIEKRFKPFVEDRLPQL
FT                   AAGTCGLVGHPGDFPACPRAVGGAVTLAIGPEGGWIPYEVEKFTAAGLQPVQLGERILR
FT                   VETAVSALLARLF"
FT   gene            complement(384872..385675)
FT                   /gene="tatC"
FT                   /locus_tag="PST_0333"
FT   CDS_pept        complement(384872..385675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="PST_0333"
FT                   /product="sec-independent protein translocase TatC"
FT                   /note="Code: U; COG: COG0805"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78039"
FT                   /db_xref="GOA:A4VGD8"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGD8"
FT                   /protein_id="ABP78039.1"
FT                   /translation="MSKPSIDDQEMPLVAHLTELRKRLLRCVVAIALLFAGLFYFSQQI
FT                   YALVAAPLRAYLPEGATMIATGVASPFLTPFKLTLMVALFLSMPIILHQIWGFIAPGLY
FT                   KHEKRIAVPLLVSSIFLFYAGMAFAYFVVFPIMFGFFASVTPEGVSMMTDIGQYLDFVL
FT                   TLFFAFGVAFEIPVATFLLIWVGIVDVATLRKSRPYVIVGCFAVGMVLTPPDVFSQSLL
FT                   AVPMWLLFEAGVICGSMIRKREEHFRGDAEDDVPPSGDQPPAPRP"
FT   gene            complement(385672..386091)
FT                   /gene="tatB"
FT                   /locus_tag="PST_0334"
FT   CDS_pept        complement(385672..386091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="PST_0334"
FT                   /product="translocation protein TatB"
FT                   /note="Code: U; COG: COG1826"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78040"
FT                   /db_xref="GOA:A4VGD9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGD9"
FT                   /protein_id="ABP78040.1"
FT                   /translation="MFDIGFTELLLVGLVALMVLGPERLPGAVRTTGLWVGRLKRSFSN
FT                   IKAEVEREIGADEIRRQLHNERILDLEREMKQSIMPPPASNPAATPPSPPSEGAGQPAN
FT                   AASSSPGDTVTPAANPPAPSTETAQPLRSDRPSEP"
FT   gene            complement(386159..386389)
FT                   /gene="tatA"
FT                   /locus_tag="PST_0335"
FT   CDS_pept        complement(386159..386389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="PST_0335"
FT                   /product="translocation protein TatA"
FT                   /note="Code: U; COG: COG1826"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78041"
FT                   /db_xref="GOA:A4VGE0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGE0"
FT                   /protein_id="ABP78041.1"
FT                   /translation="MGFGGISVWQLLIILLIVIMLFGTKRLKGLGSDLGDAIKGFRKSM
FT                   GTDEEKPGVEDKQNHTIDAQARKVEEPTKKD"
FT   gene            complement(386410..386742)
FT                   /gene="hisE"
FT                   /locus_tag="PST_0336"
FT   CDS_pept        complement(386410..386742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="PST_0336"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="Code: E; COG: COG0140"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78042"
FT                   /db_xref="GOA:A4VGE1"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGE1"
FT                   /protein_id="ABP78042.1"
FT                   /translation="MSDTLTRLAEVLEARKGAAPDSSYVASLYHKGLNKILEKVGEESV
FT                   ETILAAKDAAVSGDSSDLIYETADLWFHSLVMLAALGQHPQAVLDELDRRFGLSGHAEK
FT                   AARPQT"
FT   gene            complement(386735..387130)
FT                   /gene="hisI"
FT                   /locus_tag="PST_0337"
FT   CDS_pept        complement(386735..387130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="PST_0337"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /note="Code: E; COG: COG0139"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78043"
FT                   /db_xref="GOA:A4VGE2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGE2"
FT                   /protein_id="ABP78043.1"
FT                   /translation="MNWLDEINWNADGLVPAIAQDHKTGRVLMMAWMNREALQLTAQEN
FT                   RAIYWSRSRGKLWRKGEESGHVQQLHELRLDCDADVIILMVEQIGGIACHTGRESCFYR
FT                   VFENGAWKVVEPVLKDPHAIYAEHKHE"
FT   gene            complement(387180..388787)
FT                   /gene="ubiB"
FT                   /locus_tag="PST_0338"
FT   CDS_pept        complement(387180..388787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="PST_0338"
FT                   /product="ubiquinone biosynthesis protein UbiB"
FT                   /note="Code: R; COG: COG0661"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78044"
FT                   /db_xref="GOA:A4VGE3"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGE3"
FT                   /protein_id="ABP78044.1"
FT                   /translation="MKLFAAARRLFRILLVVIRYRLDDIILDLPMPWWLRGTSYLLPWR
FT                   WVPRRRSALSRGARLRLALEGLGPIFIKFGQILSTRRDLLPPDIAEELAMLQDRVPPFD
FT                   SAVATALIEQQLGAPVGELFARFDSKPLASASVAQVHAAKLRSGEEVVVKVVRPNLKPI
FT                   ISQDLAWLFMLANTAERISIDARRLHLVEVVDDYAKTIYDELDLLREAANASQLRRNFE
FT                   GSALLYVPQVYWDYCRSQVLVMERIYGVPVTDMAGLARQNTDMRQLAERGVEIFFTQVF
FT                   RDSFFHADMHPGNIFVSTHQPWSPQYIAVDFGIVGSLTPEDQDYLARNLMAFFKRDYRK
FT                   VAQLHIDSGWVPAETKVNEFEAAIRTVCEPIFEKPLKDISFGQLLVRLFQVARRFNMEV
FT                   QPQLVLLQKTLLNIEGLGRELYPDLDLWSTGQPYLERWMRERMGPRQLLKNAQAQIEQL
FT                   PHLAHMTRELLERMSHPHANNPPPPWRERRHWPLRLVGAILLGSGATLAAGAESFTALN
FT                   AWPAWIMLVAGTFIVVRR"
FT   gene            complement(388784..389407)
FT                   /locus_tag="PST_0339"
FT   CDS_pept        complement(388784..389407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3165"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78045"
FT                   /db_xref="GOA:A4VGE4"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGE4"
FT                   /protein_id="ABP78045.1"
FT                   /translation="MLRAALLAGAERGINRVLRLDPTALPRLARLSGRVIEIDCMAPAW
FT                   RLFILADDEGLRLAGTWGSDADCRLRAPASSLLRLAVSRNKTAVLHGPDVEIEGDSGLL
FT                   MNLAEVLQDLELDWEYEISRWLGPVGAQLLGSSLRNPLDWLRDSAGSLRQDLADYLSEE
FT                   SRTLVGQAEAQARFDELDDMKLALDRLEARIERLALNLNPDRSE"
FT   gene            complement(389407..390177)
FT                   /gene="ubiE"
FT                   /locus_tag="PST_0340"
FT   CDS_pept        complement(389407..390177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="PST_0340"
FT                   /product="ubiquinone biosynthesis methyltransferase UbiE"
FT                   /note="Code: H; COG: COG2226"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78046"
FT                   /db_xref="GOA:A4VGE5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGE5"
FT                   /protein_id="ABP78046.1"
FT                   /translation="MTDPRKAHDAEPTTHFGYKNVPESQKAQKVAEVFHSVAAKYDLMN
FT                   DLMSGGIHRLWKRFTIELSGARHGNRILDIAGGTGDLTRQFSRIVGPTGEVVLADINAS
FT                   MLKVGRDKLLDKGVAGNVRFVQADAEKLPFPDNYFDVVTIAFGLRNVTHKEDAIASMLR
FT                   VLKPGGRLLVLEFSKPTNQLFSKAYDAYSFSLLPMMGKLITNDSESYRYLAESIRMHPD
FT                   QETLKGMMEAAGFERVSYHNMTGGIVALHRGIKP"
FT   gene            complement(390324..390656)
FT                   /locus_tag="PST_0341"
FT   CDS_pept        complement(390324..390656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78047"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGE6"
FT                   /protein_id="ABP78047.1"
FT                   /translation="MALRRRSGQRLVQCPLDLALNAAAHGRKQQAEVEQHLHAVLAHLD
FT                   APVRATAPDRQHITLPLTAHAELAGQACGELVGLFAGRVAAEVVGTFDDDLRHDGSWLR
FT                   PKRRAL"
FT   gene            complement(390676..392607)
FT                   /locus_tag="PST_0342"
FT   CDS_pept        complement(390676..392607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0342"
FT                   /product="methyl-accepting chemotaxis transducer"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78048"
FT                   /db_xref="GOA:A4VGE7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGE7"
FT                   /protein_id="ABP78048.1"
FT                   /translation="MISRFFTDLAVTRKLGLGFGFMVLLTLLVAAIAVTSLNGLLERNQ
FT                   KQTRLSQVQEASYAVDTARTLFEQSGSDAHAQQVTGKIGEVRNHLQDIRTTLTAADDQR
FT                   DIASALQYAERIERSFQELKQARESREQSRGVMVSSAGEALKALGELEEQIYQTLEQSA
FT                   DDPLVVQQARALAELTRRVLESRYLVRGYIFQHTEESAQLAYAGLDRSREQADLLRGLL
FT                   PVDQHSHLDRMTSALQRYRAAIETFKVGMDATIQARTALASEIGGLLEINGNLYRNQQT
FT                   KMLGETQQARIQTMLTAFASALLGLLAAWFIARQIILPLRHTLAMARRIADGDLSGQDS
FT                   AQRRDELGQLESAMQDMRQSLRKLIGSIGDSSTQIAAAAEELSAVTEQTSAGVNDQRQE
FT                   TDQVATAVNEMAATVQEVARNAVDAAQATAEADQQAVQGEKLAGDAVAQIERMAMQVAN
FT                   TGEAMEHLRRDSDAIGSVLDVIKAVAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRA
FT                   LAQRTQQSTEEIEKLIGTLQNSAQSASQLMRDNQQLSDSTVELTRRAGDALSVIARTVS
FT                   TIQSMNQQIAAAAEQQSAVAEEINRSVVSVRDISLQTATASDETARASTELAQLGNALQ
FT                   QQIGRFRL"
FT   gene            complement(392909..393283)
FT                   /locus_tag="PST_0343"
FT   CDS_pept        complement(392909..393283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3536"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78049"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGE8"
FT                   /protein_id="ABP78049.1"
FT                   /translation="MRIPTAIKLHKASRTLELEYGADERYVLPAEFLRVHSPSAEVQGH
FT                   GNPVLQTGKLKVALEQIEPAGQYALKLTFSDGHDSGLYTWDYLERLALNQQALWDAYLA
FT                   ALAAAGKSRDPDESVVKLML"
FT   gene            complement(393332..394675)
FT                   /gene="hslU"
FT                   /locus_tag="PST_0344"
FT   CDS_pept        complement(393332..394675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="PST_0344"
FT                   /product="heat shock protein HslU"
FT                   /note="Code: O; COG: COG1220"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78050"
FT                   /db_xref="GOA:A4VGE9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGE9"
FT                   /protein_id="ABP78050.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRQ
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AALKMLREQEVHKMRHRAEDAAEERILDALLPPARPVGFSEEPVQSGDSNTRQLFRKRL
FT                   REGQLDDKEIDIEVAESPAGVEIMAPPGMEEMTNQLQNLFANMGKGKKKSRKLKIKEAF
FT                   KLIRDEEAARLVNEEDLKARALEAVEQNGIVFIDEIDKVAKRGNTSGADVSREGVQRDL
FT                   LPLIEGSTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDF
FT                   ERILTEPHAALTEQYRELLKTEGLHIEFLEDGIKRIAEIAWQVNEKTENIGARRLHTLL
FT                   ERLLEEVSFSAADLAGKQQGEPIRIDAAYVNEHLGELAQDEDLSRYIL"
FT   gene            complement(394703..395221)
FT                   /gene="hslV"
FT                   /locus_tag="PST_0345"
FT   CDS_pept        complement(394703..395221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="PST_0345"
FT                   /product="heat shock protein HslV"
FT                   /note="Code: O; COG: COG5405"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78051"
FT                   /db_xref="GOA:A4VGF0"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF0"
FT                   /protein_id="ABP78051.1"
FT                   /translation="MRRNGKVVMGGDGQVSLGNTVMKGNAKKVRRLYHGQVLAGFAGAT
FT                   ADAFTLFERFEGQLEKHQGHLVRAAVELAKDWRTDRSLSRLEAMLAVANKDASLIITGN
FT                   GDVVQPEDDLIAMGSGGGFAQAAAKALLLKAGADMSAQEIAETALNIAGSICVFTNQNL
FT                   TIEELDSAV"
FT   gene            complement(395360..397732)
FT                   /locus_tag="PST_0346"
FT   CDS_pept        complement(395360..397732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0346"
FT                   /product="molybdopterin oxidoreductase, alpha subunit"
FT                   /note="Code: C; COG: COG0243"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78052"
FT                   /db_xref="GOA:A4VGF1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF1"
FT                   /protein_id="ABP78052.1"
FT                   /translation="MSQTKFKPYRAPAGGWGSAYSVANILLRERVSPAGIGLLLKQNKP
FT                   IDGFACVSCAWAKPHPSRPLSFCENGAKATAWENTSLRCGPEFFARHSVSELLNWSDFD
FT                   LEQQGRLTHPLRYDATSDHYQPVSWDSAFAEIGAELKAMDDPDQVVFYMSGRAALETAY
FT                   MYGLLARLYGTNNLPDSSNMCHESTSVALPESIGVPVATVTLNDLEHTDGLFFFGQNTG
FT                   TSSPRMLHELQAARERGAEIVTFNPLRERGLERFVNPQSPREMLTPDSTVISTQYHQLA
FT                   IGGDMAAIAGMCKALFAMDGLAIAEGRQRVLDVAFIEQHTHGFEAFEARIRSYTWEQLE
FT                   RRSGLTRAAMEAAATAYARCERVIAPYGMGLTQHRHGVQTIQMLVNLLLLRGNMGKEGA
FT                   GILPVRGHSNVQGQRTVGITEKAAKVPVDNLRRQFGFEPPSEDGVNTVEACEGILDGSI
FT                   RGFIGLGGNFVRAIPDTLQMEPAWRKLRLSVQVSTKLNRNHLITGEVSYILPCLGRTEI
FT                   DRQATGEQRHTTEDSTGCIRAWRGAAEPAGELLLSEPAIIARLAKATLAPNPMLDWDAW
FT                   VADYSLIRDAIAESYPEIFHDFNVRMMEPGGFHRPLGASQRRWDTETGKANFINPPSLS
FT                   MDPDTEEGGHERHDVLQMMTLRSNDQFNTTVYGYDDRFRGIHGTRAVILMNRNDIVRLG
FT                   LAENDRIEAITVVDDGVHRAVGPLRVTPYSIPEGCCAGYYPECNALLPVWHHAERSKVP
FT                   AAKSIPVRLRKMIAAAVAGDVPRQPSRPQRSEQPGPA"
FT   gene            complement(397822..398304)
FT                   /locus_tag="PST_0347"
FT   CDS_pept        complement(397822..398304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0347"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="Code: J; COG: COG0219"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78053"
FT                   /db_xref="GOA:A4VGF2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF2"
FT                   /protein_id="ABP78053.1"
FT                   /translation="MFHVILFQPEIPPNTGNIIRLCANTGCHLHLIEPLGYELDDKRLR
FT                   RAGLDYHEYATLERHADLPSCLARIGIDAANPDGPRLFAFTTKGSQPFHEVRYRRGDAL
FT                   LFGPESRGLPPDIRDALPNEQRLRLPMRPDSRSLNLSNTVAIAVYEAWRQHGFAME"
FT   gene            398357..398749
FT                   /locus_tag="PST_0348"
FT   CDS_pept        398357..398749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78054"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF3"
FT                   /protein_id="ABP78054.1"
FT                   /translation="MRRIRRTFFGSLVLIGLLVGLMIGRLTAPGPVQLEAVQVLPQGLS
FT                   LRFDRKPETYDEHLEGAFALLFQAEGKAQSGQLQIDGMPVAWRVQQTEKGLLLHLVAAR
FT                   RLQGQWHGARGDGGWQVQVSVSPWRP"
FT   gene            complement(398833..400269)
FT                   /gene="ntrC"
FT                   /locus_tag="PST_0349"
FT   CDS_pept        complement(398833..400269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="PST_0349"
FT                   /product="nitrogen regulation protein NtrC"
FT                   /note="Code: T; COG: COG2204"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78055"
FT                   /db_xref="GOA:A4VGF4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF4"
FT                   /protein_id="ABP78055.1"
FT                   /translation="MSRSENVWIVDDDRSIRWVLEKALQQEGMATQSFDSADSVLARLA
FT                   RQQPDVIISDIRMPGLSGLDMLSQIREQYPRLPVIIMTAHSDLDSAVASYQGGAFEYLP
FT                   KPFDVDDAVSLVKRANQHAQEQQNQQQPANRHHTPEIIGEAPAMQEVFRAIGRLSHSNI
FT                   TVLINGESGTGKELVAHALHRHSPRSASPFIALNMAAIPKDLMESELFGHEKGAFTGAA
FT                   NQRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVRVDVRIIAAT
FT                   HQDLETLVQAGKFREDLFHRLNVIRIHIPRLADRREDIPALAEHFLASAAQELSVETKV
FT                   LKPETKEYLQHLPWPGNVRQLENTCRWITVMASGREVHVDDLPPELLNQQAEAQPAHNW
FT                   EQALRNWSDQALARGQSNLLDEAVPAFERIMIETALKHTAGRRRDAALLLGWGRNTLTR
FT                   KIKELGMRVDGSDDDDGDDS"
FT   gene            complement(400266..401510)
FT                   /gene="ntrB"
FT                   /locus_tag="PST_0350"
FT   CDS_pept        complement(400266..401510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="PST_0350"
FT                   /product="nitrogen regulation protein NtrB"
FT                   /note="Code: T; COG: COG3852"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78056"
FT                   /db_xref="GOA:A4VGF5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF5"
FT                   /protein_id="ABP78056.1"
FT                   /translation="MHLFGAPNERADRSSPNWVTGQPVGLQHHTDPRRNGALGLVLAFP
FT                   ARTFGCRPAMINEALQRLLIENLTTATLLLNSRLRLEYMNPAAEMLLAVSGQRSHGQFI
FT                   SELFTESPEALAALRQAVEEAHPFTKREATLTSATGQSLTVDYAVTPVLTRQETMLLLE
FT                   VLPRDRLLRITKEEAQLSKQETTKMLVRGLAHEIKNPLGGIRGAAQLLARELPEEHLKD
FT                   YTEVIIEEADRLRNLVDRMLGSNKLPSLAMTNIHEVLEHVASLIEAECQGSIILVRDYD
FT                   PSIPEVLMDREQMIQAVLNIMRNAMQALAGQNELGLGRLTLRTRTLRQFTIGHIRHRLV
FT                   ARIEIIDNGPGIPAELQNTLFYPMVSGRPDGTGLGLAITQNIISQHQGLIECESHPGHT
FT                   VFSIFLPLEQGATSA"
FT   gene            complement(401518..402147)
FT                   /locus_tag="PST_0351"
FT   CDS_pept        complement(401518..402147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78057"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF6"
FT                   /protein_id="ABP78057.1"
FT                   /translation="MSILRNVTTILLLGTALPALGGIYSYTDAEGNRVFTDRPSGQAVE
FT                   EVQLKPSNSMAIQPAPAPRAVQPPKQQAAAIRYQLQILSPAADEAIRNNAGTVSVTVEA
FT                   EPALQPGHFYQLLLDGEPFGAPGEQTSFQLSNVDRGTHQLAVAVVDAQERVLQQSESRS
FT                   FHLIRTSLAQRRMVNPCKKADYGVRPECPLKDKPVEKRDIPFVPFL"
FT   gene            complement(402144..402698)
FT                   /locus_tag="PST_0352"
FT   CDS_pept        complement(402144..402698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78058"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF7"
FT                   /protein_id="ABP78058.1"
FT                   /translation="MRSALFSLLFILSVPAFAEIYKYTDAQGNTVFTNQPPEGVQADTV
FT                   DLPPANTVNIRTPEPPPPLPDRQQNQQAPYQTLMLSGIPDAEALRANNGTFVVSALLEP
FT                   PLQPGHTLRFMLDGIPQAAPSPATSLQLNNVERGDHRLHVEVLSGERIIQRSEPVLFTV
FT                   QRVNTSSPALRPPPPKPRPAP"
FT   gene            complement(402863..404269)
FT                   /gene="glnA"
FT                   /locus_tag="PST_0353"
FT   CDS_pept        complement(402863..404269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="PST_0353"
FT                   /product="glutamine synthetase"
FT                   /note="Code: E; COG: COG0174"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78059"
FT                   /db_xref="GOA:A4VGF8"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF8"
FT                   /protein_id="ABP78059.1"
FT                   /translation="MSKSLQLIKDYDVKWIDLRFTDTKGKQHHVTVPARDAQDEDFFEH
FT                   GKMFDGSSIHGWKGIEASDMILMPVDETAVLDPFTEEPTLILVCDIVEPSTMQGYDRDP
FT                   RSIAKRAEEFLKTTGIGDTVFVGPEPEFFIFDQVKFKSDISGSMFKIYSEQGSWMTDQD
FT                   VEGGNKGHRPAVKGGYFPVPPCDHDHEIRTAMCNAMEEMGLVVEVHHHEVATAGQNEIG
FT                   VKFNTLVAKADEVQTLKYCVHNVADAYGKTATFMPKPLYGDNGSGMHVHMSISKDGKNT
FT                   FAGEGYAGLSETALYFIGGIIKHGKALNGFTNPSTNSYKRLVPGFEAPVMLAYSARNRS
FT                   ASIRIPYVSSPKARRIEARFPDPAANPYLCFAALLMAGLDGIQNKIHPGDAADKNLYDL
FT                   PPEEGKLIPQVCGSLKEALEELDKGRAFLTKGGVFSDEFIDAYIELKSEEEIKVRTFVH
FT                   PLEYDLYYSV"
FT   gene            404505..406064
FT                   /gene="thiI"
FT                   /locus_tag="PST_0354"
FT   CDS_pept        404505..406064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="PST_0354"
FT                   /product="thiamine biosynthesis protein ThiI"
FT                   /note="Code: H; COG: COG0301"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78060"
FT                   /db_xref="GOA:A4VGF9"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGF9"
FT                   /protein_id="ABP78060.1"
FT                   /translation="MVRGARPQRKRLNLEQFPLYSAPLFSSHTGTRAVSMKLIVKVFPE
FT                   ITIKSPPVRKGFIRQLAKNIRTVLRELDPEVRVEGVWDNIEVETALSEPKPLREMIERL
FT                   RCTPGIAHCLEVHEYPLGDLDDIVARCKAHYAERLPGRIFAVRCKRAGKHPFSSMDVER
FT                   HVGSQLRQQCGAAGISLKAPEIEVRMEIRDQRLFVVHEQHDGIGGYPLGALEQTLVLMS
FT                   GGFDSTVAAYQMMRRGLMTHFCFFNLGGRAHELGVMEVAHYLWKKYGSSHRVLFISVPF
FT                   EEVVGEILQKVDNSQMGVVLKRMMLRASTEIAERLHIDALVTGEAISQVSSQTLPNLSV
FT                   IDSATDMLVLRPLIARHKQDIIDTAFQIGTAEFAKNMPEYCGVISKNPTTRAKRYRVEH
FT                   EEKQFDMAILERALASARQVPIDRVIDELGEDIKVEEVSEAMAGQVILDIRHPDAAEDE
FT                   PLELSGIEVQTLPFYALNNRFKELDENRQYLLYCDKGVMSRLHAHHLLSEGHVNVRVYR
FT                   PA"
FT   gene            406232..408052
FT                   /gene="typA"
FT                   /locus_tag="PST_0355"
FT   CDS_pept        406232..408052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="PST_0355"
FT                   /product="GTP-binding protein TypA"
FT                   /note="Code: T; COG: COG1217"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78061"
FT                   /db_xref="GOA:A4VGG0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG0"
FT                   /protein_id="ABP78061.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLRLSGTLDRKEAENERVMDS
FT                   NDQEKERGITILAKNTALKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDG
FT                   PMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDLFDNLGASDEQLDFPIV
FT                   YASALNGIAGMDHENMDDNMDALFQAIIDHVPAPKVDVDGPFQMQISQLDYNSFLGVIG
FT                   IGRIARGTIKANSPVTAIGADGKKRNGRILKIMGHSGLQRVEVQEATAGDIVCVSGMDE
FT                   LYISDTLCDQNTVEALPPLTVDQPTVSMTFQVNDSPFAGKEGKFVTSRNIKDRLDKELL
FT                   HNVALRVEQGDSPEKFKVSGRGELHLSVLIETMRREGFELAVGRPEVVIIENEAGEKQE
FT                   PYENVTIDIEEQHQGPVMEQMGLRKGDLTNMIPDGKGRIRLEYTIPARGLIGFRNNFLT
FT                   LTSGTGILTSTFSHYGPIKAGEVTNRQNGVLVSMATGTALTYSLETLQARGKLFLEPGQ
FT                   DIYEGQLCGINSRDNDLVINPTKGKKLDNMRASGKDEVIALVPPIKFTLEQALEFIADD
FT                   ELVEVTPKSIRLRKKMLNENDRKRYERSKV"
FT   gene            408380..410017
FT                   /locus_tag="PST_0356"
FT   CDS_pept        408380..410017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0356"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78062"
FT                   /db_xref="GOA:A4VGG1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG1"
FT                   /protein_id="ABP78062.1"
FT                   /translation="MNKQMSVSMRLGLGFFVILALMVAVAVVSALKVDVIDRSMSQISS
FT                   QAGLKQRYAINFRGSVHDRAIAVRDAVSAADPAFARGQVAEIERLAQLYADSAAPMKTM
FT                   LAQPSADTVEKQLMQQIETIEAKTNALTQQVVELRFSEDSARAHEFLLDNVAGAYTEWL
FT                   RLINAFIDHQEASINQDVTVVRETASGFLALIVAVTGVAVLLGVAIAVVIIRKLRSTLG
FT                   AEPDEVARVIGNLANGDLGQVIVTPYPDSVMGATAKMASRLTAIIAEVRAAADGVGVAS
FT                   GELRTSSANSNQQIQHQSAEAEQVATAINQMATTVNEVASFAARAAAAAKSADEQVETG
FT                   TRIVGETAVSIHNLAKVLESATETVNQVSAQSGDIEKILQVITAIAEQTNLLALNAAIE
FT                   AARAGEHGRGFAVVADEVRSLANRTQLSSSEISEMIASLQAGAGRAVEVMQSSKQLAQQ
FT                   TVEQTLQAENALAKIRQEVGSINEMNAQIATASEEQGAVAEEVNQSVTRIHDSTVASSA
FT                   ASNQVASSSQDLTLLAEELNRKVNYFRG"
FT   gene            complement(410093..411406)
FT                   /locus_tag="PST_0357"
FT   CDS_pept        complement(410093..411406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0357"
FT                   /product="sodium-dependent citrate transporter (symport
FT                   system)"
FT                   /note="Code: C; COG: COG3493"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78063"
FT                   /db_xref="GOA:A4VGG2"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG2"
FT                   /protein_id="ABP78063.1"
FT                   /translation="MNRTPLSTAVPDCNPSLSVFSQRIFNLPLPLFAIALLVMAAAIAT
FT                   DTLPSGMIGALLVMMLLGELLGFAGDRLPIIKTYLGGGAILALFGAAAMVYFGWLPKAV
FT                   ADDVASFMKGGGFLDFYIAALITGSILGMDAKVLVKVGSRYALPLLCSVLFAALFAMAV
FT                   GALLGFSPQDAVVVIAMPIMGGGMGAGAVPMSQIYEQLLGQPASYYISILVPALALGNV
FT                   FAIIIAGLLNGLGNRYPSLTGNGQMMPGVDVSDKEGPITLPALGIGLVAALSFFIAGQI
FT                   LGKFVPLHPYALMIVLVALLKISNLVPESINDAASQWFRFVARNWTFALLFGIGVAFTD
FT                   LGQVIDAISLTYVLIVFAVVAGAAFGAGLVGKLVGFYPIESAITAGLCMANMGGTGDVA
FT                   VLSAARRMSLMPFAQISSRLGGALILLISSVVVPLFFT"
FT   gene            411674..413281
FT                   /locus_tag="PST_0358"
FT   CDS_pept        411674..413281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0358"
FT                   /product="two-component sensor kinase"
FT                   /note="Code: T; COG: COG3290"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78064"
FT                   /db_xref="GOA:A4VGG3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG3"
FT                   /protein_id="ABP78064.1"
FT                   /translation="MRLRLNTLISLLVAVMLVLALGLALWLFNVQLQDTLEEGQAARVT
FT                   NVAQSVAARDDVRQALVGMTMDFTADNPLQRDIDDLRQRLGVDFVVVMDRHALRLTHPE
FT                   PARIGQAFRGDDEGPALAGETYSSRAEGSLGTSIRGFAPVLDAQGDVLGAVSVGVTLAS
FT                   LGELLSEHRRDVVVGVLVLMLLTVLGAHLLARYIKRVLLGLEPYEITRLVEERQAMLAS
FT                   VREGVLAVDDQARITLVNPAAERLLVSTGLGKPPLGRPIAEYLPTSGLPEVLASASEQL
FT                   DREFSLNGLAILANRAPIRHQGRVIGAIATFRDKSEVNALAEQLTGVSRYAEALRAATH
FT                   EFKNKLHVLLGLAQMGDLDALRAYLRDLADHQLAPATALVEGIGEPVLAGFLLGKQSEA
FT                   RERGIVFQVEVEHPVPAAAPERIHGLVTILGNLLENAFEAVAEQAEQRVSLTLDYDEAL
FT                   LSLHVQDSGGGIQPEVREQIFERGVSTKGERRGIGLAAVREQVDAWGGTLAVYSEAGRG
FT                   SLFEVELPYRTAATEGTP"
FT   gene            413278..414003
FT                   /locus_tag="PST_0359"
FT   CDS_pept        413278..414003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0359"
FT                   /product="two-component response regulator"
FT                   /note="Code: KT; COG: COG4565"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78065"
FT                   /db_xref="GOA:A4VGG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG4"
FT                   /protein_id="ABP78065.1"
FT                   /translation="MKTALRVLIVEDDPMVMRLNVDYLARLDGIELVGQCASVPAALEL
FT                   LADETVDLLLLDVYLRNRSGLEVLRYLRAEDRNTDAVLITAASEIETVRAAQRLGVRDY
FT                   LVKPFSFERFRDAVESCRRARDALSRLPEQLGQGDIDRLFSQPAAADVRRPGDLPKGLT
FT                   PASLAQVAQAILALEEDSFTSENLLTATGMSRVSVRKYLKHLTDAQLLEESFHYGQIGR
FT                   PSFRYRCLDRVALQRLAQG"
FT   gene            complement(414077..414616)
FT                   /locus_tag="PST_0360"
FT   CDS_pept        complement(414077..414616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0360"
FT                   /product="putative exported protein"
FT                   /note="Code: S; COG: COG4731"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78066"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG5"
FT                   /protein_id="ABP78066.1"
FT                   /translation="MTRTNRSAGKPQPGCIAGDRVGATYSITGETMRPLFNALLLALPL
FT                   AFSSLASAADSPAGRWQTIDDETGKPKSIVEIQQAADGSLTGKVVEILQSDHGPNPLCT
FT                   ECEGERKDQPITGMTILWDLKPDGEQVWSNGTILDPAKGKTYRSKARLLDGGDKLEVRG
FT                   YIGIEALGRSQTWVRQ"
FT   gene            415001..415867
FT                   /locus_tag="PST_0361"
FT   CDS_pept        415001..415867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0361"
FT                   /product="probable epoxide hydrolase"
FT                   /note="Code: R; COG: COG0596"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78067"
FT                   /db_xref="GOA:A4VGG6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG6"
FT                   /protein_id="ABP78067.1"
FT                   /translation="MALDTWRANAREFSFGGKRIRYWTAGEGEPLLLIHGFPTASWDWH
FT                   KVWQPLAARYRLIACDMLGFGYSAKPRRHTYSLIEQADLQQALLAELGIGGAIHVLAHD
FT                   YGDSVAQELLARHCEGRITLASCVFLNGGLFPETHHPVRVQKLLLGPFGFLLGRLFSRR
FT                   TLGATFGRVFGAQTQPSDAELDDYWRLIAEGNGPAVMHRLIRYMPERVAQRERWVAAMQ
FT                   RGDVPMRVIDGAADPISGAHMVARYRELIPAPDTVLLEGIGHYPQVEAPERVLEHYFAF
FT                   RQGLHGR"
FT   gene            415836..416333
FT                   /locus_tag="PST_0362"
FT   CDS_pept        415836..416333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78068"
FT                   /db_xref="GOA:A4VGG7"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG7"
FT                   /protein_id="ABP78068.1"
FT                   /translation="MPSGRDCTGGDRRRTSAQRFSKHAAVEAWRIRLSLSKTQRAPPAS
FT                   AGRGSDRSGELLWQQRRDGLLHHRNHAVAQLRVGLHGFVDGVVFLDADVVFLDHTKHFL
FT                   VGLLLKVAGLVGVFGLLQLAGELLTDLHDLAERLGEAFQFLFAELLRLRASGGLGSRCR
FT                   VG"
FT   gene            416568..418046
FT                   /locus_tag="PST_0363"
FT   CDS_pept        416568..418046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78069"
FT                   /db_xref="GOA:A4VGG8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG8"
FT                   /protein_id="ABP78069.1"
FT                   /translation="MTHVSLWQRPASLRGALLLKVIVPLMAIMFGFSSVVLWTVERNSE
FT                   RRLQAEVELVARAVRLPLSASLEKNHERTLQQVLESVLGVGRVYGAYVYDRDGKLAAYA
FT                   GAVEPDQDASAIQQLTEGGELTGEYQRINGRPVYSYFVPLEESGGQINGLLQVTRRWGD
FT                   FERDIRRLRLIAAGLGGLLAGVALVVILLGHRSAVGKHLQQLARSMARVAAGDREHRAP
FT                   RSGPQEIMVLSGALNQMLDSIAAAERQVAEQQAREEQLQARLRQSQQLAAVGRLAAGVA
FT                   HELGSPLSVIDGKAQRVLRDEELAEAHRRALLQIRQQVARLSAIVRQLLDFGRAAGSPP
FT                   RRVPAEVLAHSAAAAVADELAALEVRLQLQAPPQTLHCRVDPPRFEQALTNLLRNAAQA
FT                   SPGGEVRLSWWGDGRELFMQVEDDGPGIAESHRGALFEPFFTTKAVGEGSGLGLAVAHG
FT                   VVSECGGRIELVHGRLPGAAFRIALPLSEEENHD"
FT   gene            418039..419427
FT                   /locus_tag="PST_0364"
FT   CDS_pept        418039..419427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0364"
FT                   /product="mutant NtrC-like activator"
FT                   /note="Code: T; COG: COG2204"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78070"
FT                   /db_xref="GOA:A4VGG9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGG9"
FT                   /protein_id="ABP78070.1"
FT                   /translation="MTDAVQERVLLVEDDDSLRQLLVEELEDRGLQVRALASAEEAVGS
FT                   LESWEPALVVSDLRLPGADGMALLRRVKSMQAAPAFLVITAFGSIQQAVAALKEGADEF
FT                   LTKPLDLEHFALAVGRALETRRLRDEVRRFQQLLSDDRFHGMLGRSRVMRGLFDQIRQL
FT                   ARAEGPVLVIGESGTGKELVARAVHAESERAGGPFLAINCAGLPAELLESEFFGHVAGA
FT                   FTGANRAHKGLFQQADGGTLFLDEIGEMPLPLQAKLLRVLQEGTIRPVGAERELSVDVR
FT                   IIAASNRPLETEAGREAFREDLFFRLETFILQVPPLRDREEDLELLAAGFVAHFAARGG
FT                   RPVRGIAPAALEQLRRYPFPGNVRELQNAIERAVTFCHGRSIELEHLPSRIASYRDDKA
FT                   RSAGAELLAELSDGPLLPTLEELELRYIEHVLKLVDGNKRRAAALLGIGRRTLYRRLGE
FT                   REEG"
FT   gene            419491..419949
FT                   /locus_tag="PST_0365"
FT   CDS_pept        419491..419949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4807"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78071"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH0"
FT                   /protein_id="ABP78071.1"
FT                   /translation="MLNNDVLRSLRYTLKVSDAQMAEIAALGGCTVAEAEVRAWLSRED
FT                   EDGYQECPDEAMARFLDGLIYFKRGKDESRPAPPLELPVSNNQILKKLRVAFELRDEDL
FT                   QAILHAADLQLSKSELGALFRKPGHSNYRPCGDQLLRNFLKGLSLRQG"
FT   gene            420102..421370
FT                   /locus_tag="PST_0366"
FT   CDS_pept        420102..421370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0366"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /note="Code: G; COG: COG2133"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78072"
FT                   /db_xref="GOA:A4VGH1"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH1"
FT                   /protein_id="ABP78072.1"
FT                   /translation="MKTFRLTLSALLALSCAAAIAAPTSDEALERMRSMKTTGQSLDMK
FT                   TIAQDGPTADAIRENLKRIKLPEGFRIDLYAVVPDARHMAVGPSSGVVFVGTRKTDLWA
FT                   VTDRTKNRTADEVKRFAPAISFTQPGPCFSPDGFLFVAEHNRVLVFPAAEFFYEGPDVA
FT                   ADIVVPTGELIPKDEESYNHGARVCAISPDNKLTISLGQPHNVPPKDKLELYERHGIGG
FT                   IVRMERDGSKREVYATGVRNSVGITYHPTTKELWFTDNQVDGMGDETPPGEINHAPKAG
FT                   MKFGMPWYGGGQVRTNEYADETPPEGLTPPVVETTAHAADMGLTFYTGKQFPEQYRGGL
FT                   FSAQRGSWNRTVPAGARVMFTPFAADGSGPSGETVPFAEGWLDEETGEYYGRIVDVAQL
FT                   KDGSLLVSDDTAGAIYRISYQGK"
FT   gene            421427..421768
FT                   /locus_tag="PST_0367"
FT   CDS_pept        421427..421768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78073"
FT                   /db_xref="GOA:A4VGH2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH2"
FT                   /protein_id="ABP78073.1"
FT                   /translation="MPIVSDSRRRLCCALPLLLCLAPSLQAADLAADKAKAKMCAACHG
FT                   IDGLAKVADAPNLAGNGELYLARQLQAFRSGERKHPQMSVIAAGLGDDDIAAVTRWYSS
FT                   IKVSVELPE"
FT   gene            421839..422513
FT                   /locus_tag="PST_0368"
FT   CDS_pept        421839..422513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3342"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78074"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH3"
FT                   /protein_id="ABP78074.1"
FT                   /translation="MTFSIVARCPRTGQIGVAAATAMPAVGKLLTHAAARVGAVATQAQ
FT                   INPYLGIDGLRFLREFSPAGEVLERLRRTDPCMELRQCAVIDSSGRTACWTGERCLPWA
FT                   GSIAGEQFCVQGNRLKGREVLEAACEAYVGSVQLPLVERLLAALAAGDAEGGDRHGESS
FT                   ATVYVVDQEQYPLWDIRVDHHRDPFAELRRLHEVFAREVVPEILAMPTRANPAGAAGEE
FT                   TI"
FT   gene            complement(422530..423009)
FT                   /locus_tag="PST_0369"
FT   CDS_pept        complement(422530..423009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0369"
FT                   /product="ATPase with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78075"
FT                   /db_xref="GOA:A4VGH4"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH4"
FT                   /protein_id="ABP78075.1"
FT                   /translation="MDKTRDKLLQPEHHDPYLKAWHQRSDTLCPRCGAAYQAGRWTWHG
FT                   LVDASNAQEALCPACQRIAEDVPAGTISLRGAFVKAHTDELSGLIRNTEEKEKGEHPLE
FT                   RLMAISDEPDGLRVTTTGLHLAQRIGHALEAAYDGELKILYDGEAYYVDVHWLRD"
FT   gene            complement(423136..425502)
FT                   /locus_tag="PST_0370"
FT   CDS_pept        complement(423136..425502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0370"
FT                   /product="c-di-GMP phosphodiesterase A-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78076"
FT                   /db_xref="GOA:A4VGH5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH5"
FT                   /protein_id="ABP78076.1"
FT                   /translation="MTLGKRALLVIFPVILIIQLVASTTAYLTQRASLLGLEQARLEQQ
FT                   LSALKSAYLDYEAFNRSVLYSIIDSEALLHFLRESDTAFRNDTLGLRLQQSIRSLSNTE
FT                   LSFVSFAIVQPDGQPAYYFESSLSPFGSMDATQQRIVQQARQSASSATIYLEQADGAPL
FT                   LVNTDFVLPASGSRPLPSQRGEAFAIQLAVRPERFIKLKRALESEYGAPVEIADQQLPV
FT                   DVGLSAEIPLSRSLHARLTPAPDYTAERLQKLGLAFLAGGSLIGLLSIGLLLWLIRRYI
FT                   TTPISQLDDQLTDLLLCKRAALDEPSDGGEIGRLTVNMKTLHDRSTAALQRIQEISWTD
FT                   SLTQISNRAHFGMLANVMYEQCLQEDKRLSLLFIDLDNFKQVNDRHGHDAGDALLRLFA
FT                   QRAQTLLERHRQQHPHTYSAFARLSGDEFAILLLSDAEPGLDALCDALLGLCRGGFRLE
FT                   ERTYPVSLSIGTACYPDDADSITQLLTRADTAMYQAKAEGKCMAVAFSNELEQRNERIR
FT                   LIEDQLRALDGDDQLRLVYMPALNRDGAVVSCEVLLRWHSPVLGTVSPAEFIPIAERAG
FT                   LFPKIDSWVIDHALAEYPQLVRLFGEQVILAINVSSAQLADDRICRYLAERAAHHGVAP
FT                   GRIEIELTETYAAELNKDTMAVVQAIRRAGFRVAIDDFGVGYTSIQQLLEYPADTIKLD
FT                   MAIITRLTRPDMQHSLSALVAFCHAQGKRVNAEGVDDMEKQSALLQAGCDLFQGYLISP
FT                   PRALPALEDWMAVRNRAQGALRLEQLAPRVVAQPL"
FT   gene            complement(425489..426574)
FT                   /locus_tag="PST_0371"
FT   CDS_pept        complement(425489..426574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0371"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein,
FT                   putative"
FT                   /note="Code: E; COG: COG0687"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78077"
FT                   /db_xref="GOA:A4VGH6"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH6"
FT                   /protein_id="ABP78077.1"
FT                   /translation="MLNNKKPRVAWCVRSAVLMTVSLLFPSTSLHAAQSLTLLTWEEYL
FT                   SEAVIERWQAETGVEIQQIFFDSGDKRDEILAKPDHQIDIALTELISSSRFGARKLLEP
FT                   IEQARLPALRHVARRWRDSCGRYAVPYLWGTLGIAYRSDRIEQAPRSWADLLKPARPDE
FT                   PHIVMMEDHEDILASPLILLGHSINTSDLDQLKAAFELLRSQSEAVLTYEYVITALRSQ
FT                   RHLDRADMALAYSGDQQVLNAVEGVHGEPWRYVVPEEGTLLWVDCLSVPSNSPNQALAY
FT                   RFLDFLNRPEIAALNAEDLGVATPNASARALLPEDVRADATIYPPEAVLARSQVYEERP
FT                   LEGTQTRRRIISALINAHDAR"
FT   gene            426795..427463
FT                   /locus_tag="PST_0372"
FT   CDS_pept        426795..427463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0372"
FT                   /product="phosphoribosyl transferase domain protein"
FT                   /note="Code: R; COG: COG1926"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78078"
FT                   /db_xref="GOA:A4VGH7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH7"
FT                   /protein_id="ABP78078.1"
FT                   /translation="MTLMIPFPDRIHAGEALAERLAQEGDWTDALVLALPRGGVPVAFE
FT                   VAQRLGLELDILVVRKLGTPGNRELAMGAIASGGVRVMNEDIVRYVHASRAEIDGTIAQ
FT                   ESHELQRREQAYRGDRPRPMVAGRAVILVDDGLATGATMRAAVKAVRQLEPSSITVAVP
FT                   VAAPDSVAQLEPLADRIICLHMPHDLYAIGRWYQNFDQTPDRLVVDLLQRAWSRGGQPA
FT                   "
FT   gene            427460..428113
FT                   /locus_tag="PST_0373"
FT   CDS_pept        427460..428113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0373"
FT                   /product="probable hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78079"
FT                   /db_xref="GOA:A4VGH8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH8"
FT                   /protein_id="ABP78079.1"
FT                   /translation="MSQSSATPMRFTLGKARLHGDLCVPAAARGLVVFVHGSGSSRHSP
FT                   RNQSVARCFNEMGLATLLFDLLTKHEQPIDEITRQLRFDIPLLSQRLTGVIDQLSSDAQ
FT                   LRELRIGLFGASTGAAAALTTAASRPADIAAVVSRGGRVDLAEPSLARVHAASLFIVGS
FT                   RDLEVLELNRAAAARLQCEHQLVVVPGASHLFEEHGTLEEVARLAGDWFVRHLC"
FT   gene            428227..428655
FT                   /locus_tag="PST_0374"
FT   CDS_pept        428227..428655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78080"
FT                   /db_xref="GOA:A4VGH9"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGH9"
FT                   /protein_id="ABP78080.1"
FT                   /translation="MDTHNPYAPPLAVLAGDETARIEALPVSASWKRRFLAIAQAGGPR
FT                   LPLFKRLPPAERRKALAFNILAFLFGPLYYLAKGMWRRAISYTLLALIAVTLIVLLLDA
FT                   SGYGEFARLLAYGVAGVFAMRANLDFYKRQVLGDNGWL"
FT   gene            complement(428650..429657)
FT                   /locus_tag="PST_0375"
FT   CDS_pept        complement(428650..429657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0375"
FT                   /product="arsenical pump-driving ATPase"
FT                   /note="Code: P; COG: COG0003"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78081"
FT                   /db_xref="GOA:A4VGI0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI0"
FT                   /protein_id="ABP78081.1"
FT                   /translation="MLLALAAERHVLFFGGKGGVGKTTVAATTALAQARAGRRVLLVST
FT                   DPAHNLGHLWQRPVGPQKVRLAAGLDGLELDPEVTVQQHLEEVGTALRKLMPAHLAGEV
FT                   DKHVALSRDAPGMHEAALLERIAETVDQGLAEYDLLVFDTAPSGHTARLMALPEMMAAW
FT                   TEGLLRRQERGSRFSQVLKNLGQDDRGFGQSILGQGDGEAAADRDSRIRQILDRRRERF
FT                   NRLREVLGDAQQCAFVIVLAAERLPVLETIELHAQLQRAGTPVGALVVNKRSPADAGAF
FT                   LAERHALEERHLTTLRQALGQLPLLELPLLPGDVVGEAALEAFAHRLGDATAGL"
FT   gene            complement(429648..429914)
FT                   /locus_tag="PST_0376"
FT   CDS_pept        complement(429648..429914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0376"
FT                   /product="superfamily II DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78082"
FT                   /db_xref="GOA:A4VGI1"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI1"
FT                   /protein_id="ABP78082.1"
FT                   /translation="MSEPLSILGKVSAGLREFYVAPYRRTFARARRDEDDLFMLLVFSE
FT                   TLGVPNPAAWYTLELMPALYERFHDWHRRMGMERSPLDHIACC"
FT   gene            complement(429911..431587)
FT                   /gene="cstA"
FT                   /locus_tag="PST_0377"
FT   CDS_pept        complement(429911..431587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="PST_0377"
FT                   /product="carbon starvation protein CstA"
FT                   /note="Code: T; COG: COG1966"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78083"
FT                   /db_xref="GOA:A4VGI2"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI2"
FT                   /protein_id="ABP78083.1"
FT                   /translation="MSAIALLLVGLGAMALGYVFYSKFIAERIYRLDPNYRTPAHTMRD
FT                   GVDYVPTNKFVLWGHHFTSVAGAAPIVGPAIAVIWGWGPAFAWVVFGTIFFAGVHDFGA
FT                   LWASARSRGQSVGMLSGRLIGSRGRSLFLVVIFLVLLMVNGAFAAVISNLLVSTPTSVI
FT                   PVWGAILVALVIGQMIYRYNMKLLWPSLGGVIVLYALILIGNQYPIVLPDEVMGLSAKS
FT                   LWILLLFVYAAIASLLPVWVLLQPRDYINGLQLFVGLGLLYLAVLFGAPELVAPAFNQE
FT                   LPADTPSIVPLLFVTIACGAISGFHGLVASGTTSKQLDKETDARFVGYFGAMGEGMLSL
FT                   AAIICCTAGFATLTDWQQVYTAFGSGGVTAFVQGGGTLLANGLGLPAELGGTILAVMAI
FT                   LFAGTTMDTGLRLQRFVIQEAGELAGMKVNTLVGTLIAVGVCMALAFGAGSDGTGGMVI
FT                   WPLFGTTNQLLAGLTLAVITVILIKLGRSPVYTLVPLVFLLAMSIYALLVQMGQFYRAE
FT                   NWLLLGMDVIILIAALWVTLEAIIAMRKGRDPAERAFEAQP"
FT   gene            431852..432343
FT                   /locus_tag="PST_0378"
FT   CDS_pept        431852..432343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: P; COG: COG1863"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78084"
FT                   /db_xref="GOA:A4VGI3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI3"
FT                   /protein_id="ABP78084.1"
FT                   /translation="MTQAAWRRGATDALFWSLLYTALWSLFAVGEGWLLGVPSIALAVA
FT                   LSLWLGLRPMAMRLIALPGFLGFFLKHMLLGGWDVARRALQPRCPLQPAWHPYPLRSRS
FT                   PRVRLLLSALVGLLPGTLASRVDADELRVHVLDERLPWQTTVAELERRLERLLGVEGRR
FT                   "
FT   gene            432343..432594
FT                   /locus_tag="PST_0379"
FT   CDS_pept        432343..432594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0379"
FT                   /product="potassium efflux system protein"
FT                   /note="Code: P; COG: COG2212"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78085"
FT                   /db_xref="GOA:A4VGI4"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI4"
FT                   /protein_id="ABP78085.1"
FT                   /translation="MAVFCALLLLTLIIGLWRVLLGPRRVDRLLAVQLFGTTGTALLLV
FT                   LAQWQGAPALRDAALVLALLAAMISAALVQLLRRSRHE"
FT   gene            432587..432880
FT                   /locus_tag="PST_0380"
FT   CDS_pept        432587..432880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: P; COG: COG1320"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78086"
FT                   /db_xref="GOA:A4VGI5"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI5"
FT                   /protein_id="ABP78086.1"
FT                   /translation="MSDLLNILSWPLLAGGLLFFAAGSIGLLRFPDTLSRLHALTKADT
FT                   LGLGLVVAGLSLRAGGVLEVAQMLLIWLLVLASGATACQLLARQSDEEGGDD"
FT   gene            432873..433781
FT                   /locus_tag="PST_0381"
FT   CDS_pept        432873..433781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78087"
FT                   /db_xref="GOA:A4VGI6"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI6"
FT                   /protein_id="ABP78087.1"
FT                   /translation="MTDWLLDAVLGLLLLGLAGGALHVRQLYAGVLLFIAFGLVLALVW
FT                   ARLGAADLALAEAAIGAGLTGVLLFAALARQPQAGSEPQLSRRRRLAAVAVLLPLLIVL
FT                   LPQLAPLAEQTSRVPMQIDAAMAQSGVDHPVTAVLLNFRAWDTLLELAVLLLALLGARQ
FT                   LGPLRMQLSEPWPLLQAWGRTLAPLLVLAGGYVLWRGAASPGGAFQAGALLASGIVLLR
FT                   LAGALPVLRWSQWPLRLLVLVGLLLFVAVAAACAWFGAGWLQYPSGWAKPLILVIEAAA
FT                   TLSIAASLSLLVIGDETETER"
FT   gene            433778..434059
FT                   /locus_tag="PST_0382"
FT   CDS_pept        433778..434059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: P; COG: COG1006"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78088"
FT                   /db_xref="GOA:A4VGI7"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI7"
FT                   /protein_id="ABP78088.1"
FT                   /translation="MNATLFWIAIGFALWLLGLHGLLTLRHALRRIIAINLMGSGVFLV
FT                   MIALAARHEPSDPLLVALVVTGLVVAVSATALALRLSSALAAAKEHER"
FT   gene            434056..435480
FT                   /locus_tag="PST_0383"
FT   CDS_pept        434056..435480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0383"
FT                   /product="probable NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78089"
FT                   /db_xref="GOA:A4VGI8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI8"
FT                   /protein_id="ABP78089.1"
FT                   /translation="MNAALASLLLPLGGGLLLILLRPARGGRWVIALSLGALLAAIMAL
FT                   QVVLDHGERSLFIGGWEAGLAIRFRLTPLAALLLVFTAGLHLLVALYAARIAHATGKAD
FT                   YWPLSCLLHAALAALWLSADLFNLYVTLELLSLVAVALVSLAGRKAWKPALNYLLLSLA
FT                   GSLAYLLGVALLYGRYGLLDLALLARLSEADGATHLALLLMSVGLMLKAALWPLHLWLP
FT                   PAHAAAPTAVSALLSALVVKGPLYILWLIWSEIAPAEFGRDAGLLFGTAGVLALVAGGW
FT                   SALRAPRLKTLVAYSTVAQLGYALLALGLLLHLPEPRLHAALWLFVLAHGLAKVSMFLA
FT                   AGELQTILGSKRVKGMKGASQNVPIALAAFAVAGGSLVGLPPSGGFLAKWLLLQPLFEQ
FT                   PQHWPWALGVLFGTLMSAAYVFRVVAHGFDRARPNPPSIHPDRLAQWLALLPALLVWGL
FT                   ALISEPLLLWLGGLGR"
FT   gene            435477..436973
FT                   /locus_tag="PST_0384"
FT   CDS_pept        435477..436973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0384"
FT                   /product="putative NADH dehydrogenase I chain M"
FT                   /note="Code: CP; COG: COG0651"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78090"
FT                   /db_xref="GOA:A4VGI9"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGI9"
FT                   /protein_id="ABP78090.1"
FT                   /translation="MNWHGLLPLGIVLSSLLPGLVIFALREDQQRLRVTLNLLGVTLKL
FT                   LLVGGMLYGVSQGSEYRFSVPLLPGAPLVLQADALSLLFVALSSLLWAATTIYAIGYLE
FT                   NSPLRSRFFGYFSLCVSATVGLALAGNLVSFLLFYELLTLATFPLVVHRGTPESLTAGR
FT                   VYLAYTVGGGTLVLMGVGLLHSLAGTPDFQAAGYLLEQVDEHEVPLQVAFVLLILGLGV
FT                   KAALIPLHGWLPQAMVAPAPVSALLHAVAVVKAGAFGIVRVVYDVFGAEALTRLDLTRP
FT                   LLWLAAATILYGSLRALQQQELKKRLAYSTISQVSYVTLGVALLGPIAAVGGLVHLVHQ
FT                   GLMKVTLFYCAGNFAETLGIHRIREMDGVGRRMPWTMAAFSIGALGMIGIPPIAGFISK
FT                   WTLGLGALEVGQDWVLLVLLGSALLNAAYFLPLLWRGWFAEPADWHEDRWAGERFETHW
FT                   MLLLPPLLTALLSLLVGLLAATALSPLGWSQLIVEREFAI"
FT   gene            436970..438619
FT                   /locus_tag="PST_0385"
FT   CDS_pept        436970..438619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78091"
FT                   /db_xref="GOA:A4VGJ0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ0"
FT                   /protein_id="ABP78091.1"
FT                   /translation="MSAWLWLLVPFAPLLGAALLPWLRERALPWLWLSGLPALLAALQP
FT                   PMALELPWLWEGVRWGADDVLTRAWLGFSAVLWTCAAVFASSSLGNGAGRLRFWMFWQL
FT                   AVAGNLLLIIATDALSFYLGFSAMSLSAYGLIVHRGGPGPRRAGRLYLQLAICGEMLLL
FT                   AGLLLRTHAADQAFDFASWQAQPIDHLTLALLLLGLGLKAGFWPLHVWLPLAHPEAPAP
FT                   ASAVLSGAMLKAGILGIWRCVPETDPTLTAWSMPLLLIGLFGALYAAALGLCAGKSKAV
FT                   LAWSSVSQMGWLLMVLALAWSLEAPSPALLTLLVLFGVHHGLAKGALFLAAGMVHEGRL
FT                   PRPGWLLLVLPALAIMGAPLTSGAAVKYLFKDALHDSLFAAWTPWLTLASFATALLLLR
FT                   ALWLMWRDQQHASAPPAAGQWLPWALLSLASVALPWLWSALREPLLAGLYPAGLWAALW
FT                   PLLLAVVLAGLAWQRHWRVPARLARLPNPALSASLALTRLLRQPPLPEPSVRLDGSRWR
FT                   QRERRWNRRWEGGALTLSAWLLVLLLWLGWWW"
FT   gene            complement(438650..440293)
FT                   /locus_tag="PST_0386"
FT   CDS_pept        complement(438650..440293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0386"
FT                   /product="methyl-accepting chemotaxis transducer"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78092"
FT                   /db_xref="GOA:A4VGJ1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ1"
FT                   /protein_id="ABP78092.1"
FT                   /translation="MNLSVKLKLGLSFAALTLVVLFVSFLALLELSKFNNTFTDYVEGV
FT                   NTREELAAELLVAAQRRAVAARNLVLMSSKAELRLEHTAVVEAHRDVQSHLAKLNAAVD
FT                   RLPSVEAHEEIQLVSEISRVESLYGPVALGIVELAIAGQRDEAIVRINRDCIPLLRQLL
FT                   NAGEAYMQHSRDAARAEVLTEEAEYETQRNLLLGVCVVAVLMALGLGVGIVRSLLRTLG
FT                   AEPFDLSAAARRVASGDMRSTSGIGHAPAGSVMASLGEMQRSLGELIGQVRLSAETISS
FT                   AAEDLSQSTEQASSGVVAQKLEVDQVATAIHEMAATVLEVARNSEEAASAALKADQQAQ
FT                   QSEATARQAVAQIKHLADEVAASSAAMTRLKRESERIGGVLDVIRSVADQTNLLALNAA
FT                   IEAARAGDAGRGFAVVADEVRTLARRTQDATVEIQSLIGGLQRIAEEAAGTMDMCSSLT
FT                   ERTVCGVGDTGAAVVDITQQIAAIQQMMHQIATAAEEQSAVAEEISRSVTRVRDIADQS
FT                   ATSTEQTAASSVELARLGSALSQQVRRFEL"
FT   gene            complement(440506..440949)
FT                   /locus_tag="PST_0387"
FT   CDS_pept        complement(440506..440949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78093"
FT                   /db_xref="GOA:A4VGJ2"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ2"
FT                   /protein_id="ABP78093.1"
FT                   /translation="MSLDDRKKLVRQHIDLTWNRGHLALAEHLHSKDFLYKSSFIGRPL
FT                   VSAEFLDMVRQIRHAMPELEVVVEECIAEGNRVVTWSTLIGTIEHAAFGYPPSDKVLSI
FT                   SAMAFWTITPTQQVQEICTMFDMESFRAQLGLDTRPYAEKILP"
FT   gene            complement(441026..442486)
FT                   /gene="phoQ"
FT                   /locus_tag="PST_0388"
FT   CDS_pept        complement(441026..442486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoQ"
FT                   /locus_tag="PST_0388"
FT                   /product="two-component sensor PhoQ"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78094"
FT                   /db_xref="GOA:A4VGJ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ3"
FT                   /protein_id="ABP78094.1"
FT                   /translation="MRDETHRNRTRPRLSVHRALPMSRRWRRLQARVRTRLTGAMSLRL
FT                   RLMLGAASLAALFMLALLPALQGAFSLTFEKVIEQRLAADASTLITAAQVEGGRLQMPE
FT                   RLPDEEFDLPDAQLLGFIYDRRGELIWHSRSAADERIDYRPRYEGGATEFLRVRDADGV
FT                   EYFVYDVELHLAGSRDNAFSFVTMQPTSEYLSLFEEFRRQLYLWLGSGLLVLLALLWLG
FT                   LTWGFRTLKRVSAELDQVEAGQRERLSDDHPRELLRLTRSLNRLLDSERRQREQYRNSL
FT                   GDLAHSLKTPLSVLQGVGETLSAQSQSREQAQVMQAQIERMSQQIGYQLQRASLGKSGL
FT                   VRHRVELRPLLDSLCSTLDKVYRDKRVQIDVQLVEPCVVPMEQGALMELLGNLLENAYR
FT                   LCLGQIRISARTHDGDLLLGIEDDGPGVPVDQRARIIRRGERLDAQHPGQGIGLAVVKD
FT                   ILDSYGGELSLGESPLGGAAFQVRLRAD"
FT   gene            complement(442420..443097)
FT                   /gene="phoP"
FT                   /locus_tag="PST_0389"
FT   CDS_pept        complement(442420..443097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoP"
FT                   /locus_tag="PST_0389"
FT                   /product="two-component response regulator PhoP"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78095"
FT                   /db_xref="GOA:A4VGJ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ4"
FT                   /protein_id="ABP78095.1"
FT                   /translation="MKVLVVEDEALLRHHLQTRLGESGHIVDAVPNAEEALYQTHEFNH
FT                   DLAVIDLGLPGISGLDLIRQLRSRGKTFPILILTARGNWQDKVEGLAAGADDYVVKPFQ
FT                   FEELEARLNALLRRSSGFTQATIEAGPLLLDLNRKQATANGEPLALTAYEYRILEYLMR
FT                   HQQQVVAKERLMEQLYSGDEERDPNVIEVLVGRLRRKLEAQCAMKPIETVRGLGYLFTE
FT                   RCR"
FT   gene            complement(443173..443637)
FT                   /gene="oprH"
FT                   /locus_tag="PST_0390"
FT   CDS_pept        complement(443173..443637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprH"
FT                   /locus_tag="PST_0390"
FT                   /product="outer membrane protein H1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78096"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ5"
FT                   /protein_id="ABP78096.1"
FT                   /translation="MDGKNRFDDVIKNSGTWGVRAGQMTDEGRYYMTYENVSDDYGSSL
FT                   KLRQQNLIGSYDMFVPLGDTTRLFGGASAGLTKLENESKGYSRDTDIGYLVGLQAGILQ
FT                   KLGDNTSVEAGYRYLRSNAGTEVSERGVGKLGSIDVHSSKQAYLGLNYHF"
FT   gene            complement(443912..444322)
FT                   /locus_tag="PST_0391"
FT   CDS_pept        complement(443912..444322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78097"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ6"
FT                   /protein_id="ABP78097.1"
FT                   /translation="MLVMTLAPWLLAAAAAATTDAPVQVRLDLQPAAAEQRLTLSLCFK
FT                   GSGQQVRYRLKVRSSGTAGTGQTTQSGSLTAGESEQCPLRNRLGIAADTAVEAELQWWI
FT                   DDQEQPPLLERYPPRGSDSDEEPDPDQPQQLA"
FT   gene            complement(444367..445248)
FT                   /locus_tag="PST_0392"
FT   CDS_pept        complement(444367..445248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78098"
FT                   /db_xref="GOA:A4VGJ7"
FT                   /db_xref="InterPro:IPR009742"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ7"
FT                   /protein_id="ABP78098.1"
FT                   /translation="MLKPAAIATLLAFGATQVMAQNSTELEQTGTGNVAVLQQIGLVQS
FT                   SDIAVSQVGDFNDASVTQVGESHFNVANLQQTGNLNVASLEQTWRANTLTASSTGDGNQ
FT                   LSGSQTGFAVAEITQRGDNNSLSFSQQTYYEGSRLSVSQDGVSNQAEIAQGDGNRLALV
FT                   QDGNYNDADIRQGDYHNELSFTQSGDDNRLTVDQNGYGGVISGSSTGNRNSVDIDQRFA
FT                   SNRASVTQNGDDNLASIEQGNWGHQATIMQLGSANEAMIRQGFPANDNTRLPGVATIHQ
FT                   SGTGNSATIIQQ"
FT   gene            complement(445266..445880)
FT                   /locus_tag="PST_0393"
FT   CDS_pept        complement(445266..445880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0393"
FT                   /product="curli fiber surface-exposed nucleator CsgB,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78099"
FT                   /db_xref="GOA:A4VGJ8"
FT                   /db_xref="InterPro:IPR009742"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ8"
FT                   /protein_id="ABP78099.1"
FT                   /translation="MAPLGLIHETRYPGGLLHHPMDIQGRARRSRIASTVIRYLPMTLC
FT                   SPPRAALLLALILSLIGSPLLAADLMDNGDLAPGGIPLGAAPSRLTQAAGAQQAYLQQL
FT                   GQGNLAELRQNGQALSAQVLQQGSDQEAFILQHGEDLLAVIEQVGHGNYAEIRQTGSDN
FT                   QASISQYGAYNDARIEQVGDGLRSTVTQYGYGQQINIVQGR"
FT   gene            complement(445952..446608)
FT                   /gene="corR"
FT                   /locus_tag="PST_0394"
FT   CDS_pept        complement(445952..446608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corR"
FT                   /locus_tag="PST_0394"
FT                   /product="DNA-binding response regulator CorR"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78100"
FT                   /db_xref="GOA:A4VGJ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGJ9"
FT                   /protein_id="ABP78100.1"
FT                   /translation="MDADLTRGNTSPTVTLLTGNELLGLFFRHFLGEQAQVEVSLVGLE
FT                   PPEQHDADLFLVDAGHSEAEQISSLIDQLDDHTPVALVNIVPEQAEQLVEKHPVIRGVF
FT                   YSHATREHLLEGIRVLLKGGDWLPRVLTERLLGQWRRMRQLAESKTSLTLREREILSLA
FT                   GKGLSNAEIAEQLCLSPHTIKSHIHNLLRKIGASNRAEAAYLLRSHLDWDKSCSV"
FT   gene            446799..448511
FT                   /locus_tag="PST_0395"
FT   CDS_pept        446799..448511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0395"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78101"
FT                   /db_xref="GOA:A4VGK0"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK0"
FT                   /protein_id="ABP78101.1"
FT                   /translation="MSQTSAAVSPRELSARALATGLLLGALLAPSNVYSGLKIGWSFNM
FT                   SIIALLVGFAFWQGVARAFGRPRWSLLESNINQTTASSCASIISGGLVAPIPAYTLLTG
FT                   QQLDSLALMAWVFSVSFLGIWVAWYLRPGLIAGSGLRFPEGMATLATLQQIYSQGAEAG
FT                   RRLWVLGSAALLAAGTKLIDSFFWSLPRWAPSAQLERLTFTFEPSLLLVGFGGIVGLRV
FT                   GLSLLLGALLAWGLLAPWLLTEDLVRLPAAATGPQFATLIEWLLWPGVSLMVCATLTSL
FT                   GLRLLRSRTATRRGSRRWRPQGWPAAGLALAITLVVALQISLFGIAPALALLSIPLALL
FT                   LAMVAARVVGATGIPPIGAIGQLSQLGFGVFAPGQVPVNLMSANTAGGAAGQCTDLLND
FT                   FKVGHAIGATPARQAVAQCVGILLGSVVGVLAYQLLIPDPQAMLITPEWPAPAVATWKA
FT                   VAEALTGGLGALAVDVRWAMLVGALCGVLLGALEGLLPEAQLRWLPSSAALGLAFIIPA
FT                   SISLLMTFGAVLAWAFTSRWRSLGERFVIVAAAGLVAGESMAGVGASLWQLLR"
FT   gene            448581..449651
FT                   /locus_tag="PST_0396"
FT   CDS_pept        448581..449651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0628"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78102"
FT                   /db_xref="GOA:A4VGK1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK1"
FT                   /protein_id="ABP78102.1"
FT                   /translation="MTKPTSPDDNKQVANRAMVQAAVLAAVVLLCIVAWLAFDFLLLLF
FT                   ASILFGVLIHGVSCWLSRHSPLPYKASMAAFFVALLLGLGGGGWLVAPSIAEQADALSD
FT                   SLPEAVERLRERAEQLPWANELLQQSDRLADSLPEGSSAFSVVTKVMGSVAGALSSFVI
FT                   AFAIGICLAIDPRVYRSGLLKLVPQGYRPRAAEVLDESGATLRAWLLAKLLEMLLIGVL
FT                   TTLGLWLLGIELALVLGLIAGLLSFIPNIGPVLAVIPALLLASLEGGRTVLYVAGLYLF
FT                   VQALESYVFTPFMQQRIVSIPPALTIGVQLLFGLLAGTLGLLLATPLAALGMVLVRMLY
FT                   VEDLLGDREQVTDGSS"
FT   gene            complement(449684..450274)
FT                   /locus_tag="PST_0397"
FT   CDS_pept        complement(449684..450274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78103"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK2"
FT                   /protein_id="ABP78103.1"
FT                   /translation="MRFRHIRAAKVSPAPRSSAERSPAGRETARKPEACRAVVLFAESV
FT                   SAALAALAAGTSGTRRTGGAIRAGIGTGALVTAGSGGRTICRTRHIGRACACARTGSAV
FT                   HAAGASASASASASASASAAHGALLMGPVIHGIVRAGAGVVRRERRAGKQTRQGECRDL
FT                   VHVHDASPAIFSGGTQVPAAGLARGFLASLYKT"
FT   gene            complement(450675..452081)
FT                   /gene="serA"
FT                   /locus_tag="PST_0398"
FT   CDS_pept        complement(450675..452081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="PST_0398"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="Code: HE; COG: COG0111"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78104"
FT                   /db_xref="GOA:A4VGK3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK3"
FT                   /protein_id="ABP78104.1"
FT                   /translation="MVTLSTLQHRGGGVSRGSYASIRTPLKRASADSRHRHCRVGQPSL
FT                   DTSVLSFGLKVLMQMSQTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEDLKTALSGD
FT                   ELKEKIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVFNA
FT                   PYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIIGYGSIG
FT                   TQLSVLAEALGMQVFFYDVVTKLPLGNATQIGSLYELLGMCDIVSLHVPELPSTQWMIG
FT                   EKEIRAMKKGAILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEEFESPL
FT                   RGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPSHPGKHR
FT                   LLHIHQNIPGVMSEINKVFADNGINICGQFLQTNEKVGYVVIDVDKEYSDLALEKLQHV
FT                   NGTIRSRVLF"
FT   gene            452104..453498
FT                   /locus_tag="PST_0399"
FT   CDS_pept        452104..453498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0399"
FT                   /product="oxidoreductase, FAD-binding, putative"
FT                   /note="Code: C; COG: COG0277"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78105"
FT                   /db_xref="GOA:A4VGK4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK4"
FT                   /protein_id="ABP78105.1"
FT                   /translation="MTDPALIDELKTLVEPGKVLTDADSLNAYGKDWTKHFAPAPSAIV
FT                   FPKSIEQVQAIVRWANAHKVALVPSGGRTGLSAAAVAANGEVVVSFDYMNQILEFNEMD
FT                   RTAVCQPGVVTAQLQQFAEDKGLYYPVDFASAGSSQIGGNIGTNAGGIKVIRYGMTRNW
FT                   VAGMKVVTGKGDLLELNKDLIKNATGYDLRQLFIGAEGTLGFVVEATMRLERQPTNLTA
FT                   LVLGTPDFDSIMPVLHAFQDKLDLTAFEFFSDKALAKVLGRGDVPAPFETDCPFYALLE
FT                   FEATTEERAEQALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISHWTPYKN
FT                   DISVTVGKVPAFLKEIDAIVGEHYPDFEIVWFGHIGDGNLHLNILKPDAMDKDEFFGKC
FT                   ATVNKWVFETVQKYNGSISAEHGVGMTKRDYLEYSRSPAEIEYMKAVKAVFDPNGIMNP
FT                   GKIFAA"
FT   gene            453526..454191
FT                   /locus_tag="PST_0400"
FT   CDS_pept        453526..454191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0400"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="Code: Q; COG: COG0179"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78106"
FT                   /db_xref="GOA:A4VGK5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK5"
FT                   /protein_id="ABP78106.1"
FT                   /translation="MSYQHHYTDGTPIHYPLGKVVCIGRNYAEHAKELNNPVPTEPLLF
FT                   IKAGSCTVPLEGGFSIPSDRGAVHYEAEIAVLIGKPLSRKPNEEEVRDAISGFAPALDL
FT                   TLRDVQARLKEKGHPWEIAKSFDGACVLAPFVPGDAVEDLGDIGIRLSINGEVRQDGNS
FT                   SQMLNAILPLLQHIAGHFSLQPGDVVLTGTPAGVGPLNQGDELVLELVGLSRFESRVL"
FT   gene            454224..455189
FT                   /locus_tag="PST_0401"
FT   CDS_pept        454224..455189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3204"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78107"
FT                   /db_xref="GOA:A4VGK6"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK6"
FT                   /protein_id="ABP78107.1"
FT                   /translation="MPLLCEPFSCCNPAPSAGTLFMPVRYSRWRLLVAVVLLLLFVALL
FT                   IAGRLLHWDDQLRLYWSERSVTAEQRAAGIWLPDYELALETTLAGLEDDETSGLTWSPL
FT                   TGTLFTVTGKHPQLIEFTPAGVVLRRIALTGFSDPEAVEALDDGRLAIVDERRRLVAVF
FT                   RLKPGVESLELDDLASYDLGFAEAGNKGFEGLAWNPHTQRLLLAKERDPQGLFELPFPG
FT                   EDGAVGALKALPSQPLLVRDLSSVTIDPRSGHTLLLSDESRLLVELDLQGKPRSFIALF
FT                   GGLNGLVQGIEQAEGVAMDGEGNIYVVGEPNRFYVFSRKR"
FT   gene            455276..456163
FT                   /locus_tag="PST_0402"
FT   CDS_pept        455276..456163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3204"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78108"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK7"
FT                   /protein_id="ABP78108.1"
FT                   /translation="MKILLAALLGVALLLAVAAGVHYRLFERGWFHFTQWQQGEQSGSA
FT                   SLWLPDYRVAIQGKVVAGIDDDLSALTFDPDRNSLIAVTNGDPHWLELSLEGDLLRAIP
FT                   LVGFGDPEAIEYISEGVYVISDERLQRLLRVEVNEQTSVIDAEQAQQLSLGIDLNGNKG
FT                   FEGLAYDTVGQRLYVAKERNPVRIYEISGFPFAEPTPSVHISEHQARLFVRDLSSLQFD
FT                   EQTGHLLALSDESRLVVELDADGQPLSSLSLSAGRHGLERDVPQAEGMAMGPDGTLYLV
FT                   SEPNLFYVFRKPAR"
FT   gene            complement(456197..456466)
FT                   /locus_tag="PST_0403"
FT   CDS_pept        complement(456197..456466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78109"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGK8"
FT                   /protein_id="ABP78109.1"
FT                   /translation="MLSSEQYKAHASALNGIDSVRKNAVREEAFEVRESSNGKHYFVLK
FT                   ATNGQVIGQSQMYASLHSAEQGCDSVRRHAPNAALQDESASPVA"
FT   gene            complement(456633..457304)
FT                   /gene="rpiA"
FT                   /locus_tag="PST_0404"
FT   CDS_pept        complement(456633..457304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="PST_0404"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="Code: G; COG: COG0120"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78110"
FT                   /db_xref="GOA:A4VGK9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGK9"
FT                   /protein_id="ABP78110.1"
FT                   /translation="MTQDQLKQAVAQAAVDHILPKLNDRSIVGVGTGSTANFFIDLLAK
FT                   HKGFFDGAVASSEATAERLKQHGIPVYDLNSVSELEFYVDGADEANKHLELIKGGGAAL
FT                   TREKIVAAVAKTFICIADGSKLVEQLGAFPLPVEVIPMARSHVARELVKLGGDPVYRDG
FT                   VVTDNGNVILDVHNLMIGFAPELEGKINDIVGVVSNGLFAMRPADLLLLGTQDGVQTLT
FT                   R"
FT   gene            457471..458985
FT                   /gene="ilvA-2"
FT                   /locus_tag="PST_0405"
FT   CDS_pept        457471..458985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA-2"
FT                   /locus_tag="PST_0405"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="Code: E; COG: COG1171"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78111"
FT                   /db_xref="GOA:A4VGL0"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGL0"
FT                   /protein_id="ABP78111.1"
FT                   /translation="MLEHYVKKILTSRVYDVAVETPLQPARQLSERIGNQILLKREDLQ
FT                   PVFSFKVRGAYNKLAQLSPEELARGVVTASAGNHAQGVALAAKQLGIKATIVMPRTTPE
FT                   LKVQGVRARGGKVVLHGDAFPEALAYSLKLVEEKGYVYIHPYDDPDVIAGQGTVAMEIL
FT                   RQHQGPIDAIFVPVGGGGLVAGIAAYVKYLYPQTRVIGVEPDDSNCLQAAMAAGERVVL
FT                   EQVGLFADGVAVAQIGQHTFDVCKHYVDEVITVSTDEICAAIKDIYDDTRSITEPAGAL
FT                   AVAGIKKYVERDGVCGQVLVGIDSGANVNFDRLRHVAERAELGEKREAIIAVTIPEQPG
FT                   SFKAFCEAIGKRQITEFNYRYHTDREAHIFVGVQTHPENDPRAALVQGLRDKGFPVLDL
FT                   TDNELAKLHTRHMVGGHAAGVSDEMVLRFEFPERPGALFNFLNKLGGRWNISMFHYRNH
FT                   GAADGRVVAGLQVPAEERHLVPAALDKIGYRYWDESDNPAYKLFLG"
FT   gene            459006..459434
FT                   /locus_tag="PST_0406"
FT   CDS_pept        459006..459434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5528"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78112"
FT                   /db_xref="GOA:A4VGL1"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGL1"
FT                   /protein_id="ABP78112.1"
FT                   /translation="MEHYLTLRIVHGATAVLLLLGVIVHLLMLWKAARGGDQAVLQRKL
FT                   QRTRRLSLPLLAVIGLSLPVTGWWLTHLAGWPLGQLWLLASSVLFVVLVALVPLLAGRL
FT                   AAWQAPGNATAARNAGIYGVLVLLVLIAITALMGAKPV"
FT   gene            complement(459435..460661)
FT                   /locus_tag="PST_0407"
FT   CDS_pept        complement(459435..460661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0407"
FT                   /product="probable MFS transporter"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78113"
FT                   /db_xref="GOA:A4VGL2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGL2"
FT                   /protein_id="ABP78113.1"
FT                   /translation="MPASLEQRSSRPIVVVALATALCLTGDSMLYIALPIYWHEVGLEA
FT                   LWQVGVLLSVNRLIRLPFNPLIGWLYQRISLRAGLLLATTLGTLTTLGYGIAKGFIAWL
FT                   LLRALWGIGWSFFRIGGLSAVVYCAAGQSRGQAMGLYNGLYRLGSLVGMLLGGLLVPVY
FT                   GLPALALSFAAMALLGLPLLLRHFQPPAALDERQLPAAPAADTPPRLARLNGKYRVIVS
FT                   GFCTAMLIQGVLAATLSALIERFYGNRLDLFGLLLSATALSGILQALRWSWEPWLGRRF
FT                   GAWSDGPRGRSRLYGGTLLVAALSFGLMASGLPLLPWLAVTLLVMLLATALTTLTDALA
FT                   SDVASAGNVVAFMTRYSIAQDLGAALGPLLAYLLIGLADGFAWLYWGGSAIYLLLALAW
FT                   LRRRGRAGD"
FT   gene            complement(460776..461432)
FT                   /locus_tag="PST_0408"
FT   CDS_pept        complement(460776..461432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0408"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="Code: E; COG: COG0560"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78114"
FT                   /db_xref="GOA:A4VGL3"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGL3"
FT                   /protein_id="ABP78114.1"
FT                   /translation="MRLALFDLDNTLLAGDSDHAWGEYLCQRGIVDASHYRARNDAFYQ
FT                   DYLAGNLDVHAYQNFCQEILGRSEMTQLQAWHEEFMREHIEPIVLSKGEALLRQHLEAG
FT                   DKVAIVTATNRFITGPIAARLGVDTLLATECEMRDGRYTGRLTDIPCFQEGKVQRIERW
FT                   LAETEQSLEGSYFYSDSRNDLPLLERVDHPVAVDPDPVLRAIAEERGWQVISLRP"
FT   gene            461626..462105
FT                   /locus_tag="PST_0409"
FT   CDS_pept        461626..462105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0409"
FT                   /product="(di)nucleoside polyphosphate hydrolase, putative"
FT                   /note="Code: LR; COG: COG0494"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78115"
FT                   /db_xref="GOA:A4VGL4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGL4"
FT                   /protein_id="ABP78115.1"
FT                   /translation="MIDSDGFRPNVGIILTNDVGQVLWARRINQDAWQFPQGGINARET
FT                   PEEALFRELNEEVGLEEQDVKILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRL
FT                   TGAEDRVRMDLTGKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLPVRD"
FT   gene            462131..464404
FT                   /gene="ptsP"
FT                   /locus_tag="PST_0410"
FT   CDS_pept        462131..464404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="PST_0410"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase
FT                   PtsP"
FT                   /note="Code: T; COG: COG3605"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78116"
FT                   /db_xref="GOA:A4VGL5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGL5"
FT                   /protein_id="ABP78116.1"
FT                   /translation="MLGTLRKIVQEVNAAKDLKAALGIIVLRVREAMGSQVCSVYLLDP
FT                   ETERFVLMATEGLNKRAIGKVSMAPNEGLVGLVGTREEPLNLEHASEHPRYRYFAETGE
FT                   ERYASFLGAPIIHHRRVMGVLVIQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGRQGKGIQETRFIGIPGAPGAAVGTALVVLPPADLDVVPDKHIDNIEAELTLFEAA
FT                   LEAVRADMRNLSEKLATQMRKEERALFDVYLMMLDDSALGGEVTKVIRTGQWAQGALRQ
FT                   VVTEHVRRFEMMDDAYLRERASDVKDIGRRLLSYLQEARQQALVYPDKTILVSEELSPA
FT                   MLGEVPEGKLVGMVSVLGSSNSHVAILARAMGIPTVMGAVDLPYSKVDGIELIVDGYRG
FT                   EIITNPGKVLREQYEVLAEQERQLSEGLDVLRELPCETTDGHRIPLWVNTGLLADVVRA
FT                   QERGAEGVGLYRTEVPFMIKERFPSEKEQMAIYREQLEAFHPLPVTMRSLDIGGDKCLP
FT                   YFPIKEENPFLGWRGIRVTLDHPEIFLLQTRAMLKASAGLNNLRILLPMISGIRELEEA
FT                   LHLIHRAWCEVRDEGLDVIMPPVGVMIEVPAAVYLTRELARMVDFISVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLEALQRVVKEAHGEGKPVSICGEMAGDPAAAMLLLAMGFD
FT                   SLSMNATNLPKVKWLLRQISMDTAQQLLARVMLLDSPQVIHSTVQLTLRNLGLNKLINP
FT                   SAAV"
FT   gene            complement(464426..465181)
FT                   /locus_tag="PST_0411"
FT   CDS_pept        complement(464426..465181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3332"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78117"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGL6"
FT                   /protein_id="ABP78117.1"
FT                   /translation="MCLIVFAWSPDHSQPLVVAANRDEFHARPSLPLGCWEDAPWIIGG
FT                   RDLQAGGTWMGVTARGRFAALTNIRAPGQPIGARSRGELPERYLRGELPPADYLAALAE
FT                   RRGDYAGYNLLVGDRQTLWHLNSHDGEPKELQPGVYGLSNAGLDTPWPKLRRARAALTS
FT                   ILQQPEPERLLALLADAEPAAEHELPQTGVPLEWERRLSSIFIASPEYGTRASTALIRH
FT                   ADGSLDIIERSFGPAGPSGEVRYRHPPAS"
FT   gene            465197..466108
FT                   /locus_tag="PST_0412"
FT   CDS_pept        465197..466108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0412"
FT                   /product="putative membrane protein"
FT                   /note="Code: R; COG: COG0730"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78118"
FT                   /db_xref="GOA:A4VGL7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGL7"
FT                   /protein_id="ABP78118.1"
FT                   /translation="MQTCKGTGAAAERAWPAGGSASACKRQSGIFATMPVCFAGTGRME
FT                   FLLYLLLGGFAGVLAGLFGVGGGLIIVPVLVFSFSAQGFSQDILTHLAVGTSLATIVFT
FT                   SVNSILTHHRLGAVRWPMVLWMTFGILLGAALGSLTAAAIQGPMLQKIIGVFALAMAVQ
FT                   MGFDLRPKATGRVPGRPELSLVGVVIGWASAIFGIGGGSLSVPYLTWRSVPMQQAVATS
FT                   AACGLPIAVAGALSFMAVGWHEAHLPQWSLGFVYLPALLGIAATSMFFARLGARLAHRL
FT                   SAKVLKRLFALLLLSVGINFLV"
FT   gene            466119..466919
FT                   /gene="lgt"
FT                   /locus_tag="PST_0413"
FT   CDS_pept        466119..466919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="PST_0413"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="Code: M; COG: COG0682"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78119"
FT                   /db_xref="GOA:A4VGL8"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGL8"
FT                   /protein_id="ABP78119.1"
FT                   /translation="MLPYPQIDPVAIAIGPLQIHWYGLMYLIGIGGAWWLASLRVQRFA
FT                   PEWPKDKLSDLVFWVAMGVIVGGRLGYVLFYDLAAYINQPSLILQVWKGGMSFHGGLIG
FT                   VLLCSWIFARRNGKSFFELMDFIAPFVPIGLGAGRIGNFINAELWGKATDVPWAMVFPT
FT                   DPQQLARHPSQLYQFALEGVALFVILWLYSRKPRPTMAVSGLFAVCYGIFRFIVEFVRV
FT                   PDAQLGYLAFGWLTMGQVLCIPMVLLGAGMIAWGYRREAGRAPA"
FT   gene            467001..467819
FT                   /gene="thyA"
FT                   /locus_tag="PST_0414"
FT   CDS_pept        467001..467819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="PST_0414"
FT                   /product="thymidylate synthase"
FT                   /note="Code: F; COG: COG0207"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78120"
FT                   /db_xref="GOA:A4VGL9"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGL9"
FT                   /protein_id="ABP78120.1"
FT                   /translation="MAPASSQSMKQYLDLMRHVREHGTFKSDRTGTGTYSVFGYQMRFD
FT                   LAEGFPLVTTKKCHLKSIIHELLWFLQGDTNIKYLKENGVRIWDEWADENGELGPVYGY
FT                   QWRSWPAPNGESIDQIANLLAMIKKNPDSRRLIVSAWNPALVEQMALPPCHALFQFYVA
FT                   DGKLSCQLYQRSADIFLGVPFNIASYALLTLMVAQVCDLEPGEFIWSGGDCHLYANHLE
FT                   QADLQLTREPLPLPTMKLNPEVKDLFAFRFEDFELVGYEAHPHIKAPVAV"
FT   gene            468050..468823
FT                   /locus_tag="PST_0415"
FT   CDS_pept        468050..468823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0415"
FT                   /product="ParA family protein"
FT                   /note="Code: D; COG: COG1192"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78121"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM0"
FT                   /protein_id="ABP78121.1"
FT                   /translation="MRRVVFNQKGGVGKSSIACNLAAVSASQGYRTLLVDLDAQANSTH
FT                   YLTGLTGDDIPTGIADFFKQILAGGNAGKKARPPILETAFDNLHLISATAELADLQPKL
FT                   EAKHKINKLRKLLEGLAEDYDRIYLDTPPALNFYTVSALIAADRCLIPFDCDSFSRQAL
FT                   YGLLNEIEEMKDDHNEALEVEGIVVNQFQPRAALPQQMIDELLGEGLPVLPINLMSSVK
FT                   MRESHQACTPLVYLDPRHKLSQQFVELHDLLESAG"
FT   gene            complement(468829..469815)
FT                   /locus_tag="PST_0416"
FT   CDS_pept        complement(468829..469815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0416"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /note="Code: E; COG: COG4177"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78122"
FT                   /db_xref="GOA:A4VGM1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM1"
FT                   /protein_id="ABP78122.1"
FT                   /translation="MNSQLSVTPTTKRPLLRLETVLILIGVVALTLAPFYFYPIFLMKV
FT                   LCFALFACAFNLLLGYTGILSFGHAAFFGGSAYFTAHAVKEWGLTPELGILVGVAGAAF
FT                   LGLIIGFLAIRRQGIYSTMITLALSQMFFFFCLQASFTHGEDGIQNIPRGHLFGLIDLE
FT                   EPLYMYFFVLSVFLAGMLLIWRVIHSPYGMILRSIRENENRAISLGYTVSRYKLGAFVM
FT                   SAALAGLAGGLKALVFQFATLTDVSWQMSGEVVLMTLLGGIGTLVGPVFGAALVTTLGN
FT                   YFATSELPVTLVTGIIFMVCVLVFRRGMIGELYASRLGKKLERRAED"
FT   gene            complement(469815..470702)
FT                   /locus_tag="PST_0417"
FT   CDS_pept        complement(469815..470702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0417"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="Code: E; COG: COG0559"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78123"
FT                   /db_xref="GOA:A4VGM2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM2"
FT                   /protein_id="ABP78123.1"
FT                   /translation="MTTIFDVPIQAFLGQLLIGLINGSFYAMLSLGLAIIFGMLKIINF
FT                   AHGAQYMIGAFAGYLLLATLGIGYWPALILAPIVVGLCSAVIERLALSRLYNLDHLYSL
FT                   LFTFGLALALEGAFRYFYGSSGQPYAVPKELAGGYNLGFMFLPKYRAWVVLASLVICIA
FT                   SWLLIEKTKLGAYLRAATENPTLVRTFGINVPLLLTFTYGMGAALAGLAGMLAAPIYQV
FT                   SPLMGSNLIIVVFAVVVVGGMGSILGAIITGYLLGILEGLTKVFYPEASNIVIFVIMAI
FT                   VLLVRPAGLMGRDA"
FT   gene            complement(470702..471406)
FT                   /locus_tag="PST_0418"
FT   CDS_pept        complement(470702..471406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0418"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein LivF, putative"
FT                   /note="Code: E; COG: COG0410"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78124"
FT                   /db_xref="GOA:A4VGM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM3"
FT                   /protein_id="ABP78124.1"
FT                   /translation="MTEPLLSVRELNAWYGESHALHGIDLDVHAGETVTLLGRNGVGKT
FT                   TALRAIVGIIRKRSGTIRFDGKDMLRVPLHRTARHGIGYVPEERGIFSTLTVEENLTLP
FT                   PVIAKGGMSLAEIYQLFPNLEERRKSPGTKLSGGEQQMLAMARILRTGARLLLLDEPTE
FT                   GLAPVIIQRIGEVLQTLKQRGMTILLVEQNFRFASKVADRFYVVDHGQVIDTFDVADLP
FT                   GRMSMLNEALGV"
FT   gene            complement(471399..472199)
FT                   /locus_tag="PST_0419"
FT   CDS_pept        complement(471399..472199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0419"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="Code: E; COG: COG0411"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78125"
FT                   /db_xref="GOA:A4VGM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM4"
FT                   /protein_id="ABP78125.1"
FT                   /translation="MSMAAVQPSAAGDVGRDTPVMLSARGLRKEFGGFVAVNNVDLDVH
FT                   HARVHALIGPNGAGKTTVFNLLTKFLQPTAGSIRLLDHDITRTDPAKVARMGLVRSFQI
FT                   SAVFPHLSVLDNVRVALQRPGGLATQFWLPMRSLNRLNERAMQLIESVGLADKRHEPAA
FT                   DLSYGRKRVLEIATTLALEPKVLLLDEPMAGMGHEDVHVVAEIIREVATQRAVLMVEHN
FT                   LKVVADLCHQVTVLQRGEILTSGDYRTVSQDERVRVAYMGTDDD"
FT   gene            complement(472196..473401)
FT                   /locus_tag="PST_0420"
FT   CDS_pept        complement(472196..473401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0420"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein, putative"
FT                   /note="Code: E; COG: COG0683"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78126"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM5"
FT                   /protein_id="ABP78126.1"
FT                   /translation="MKLSAIAAATLTAAVAVPASAEISDGKVKIGILNDQSGVYADFGG
FT                   KWSFEAAKMAAEDFGGKVLDAPIEIVTADHQNKPDIASNIARQWYDREQVDSIMELTTS
FT                   SVALAVQGISKSKKKINLVTGAATTELTGKQCSPYGFHWAYDTHALAVGTGGALVSQGG
FT                   DSWYFLTADYAFGYSLEEQTSKFVKSKGGEVKGAVRHPLASTDYSSFLLQAQSSGAKVI
FT                   GLANAGLDTANSIKQAAEFGIVAGGQRLAALLFTLAEVHGLGLDAAQGLTLTESFYWDR
FT                   DDKSREFGERFFKRTGRMPNMVHAGTYSGVMQYLKAIEKAGTDATEPVAKAMHELPVDD
FT                   VFARNAKVGANGRLISDVYLMEVKKPEESSRPWDYYKVLATVPGDEAYIKPADSGCELV
FT                   GQ"
FT   gene            complement(473805..474602)
FT                   /locus_tag="PST_0421"
FT   CDS_pept        complement(473805..474602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: T; COG: COG0589"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78127"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM6"
FT                   /protein_id="ABP78127.1"
FT                   /translation="MFQHILVAHDLSPDADLALQRAVQLARQTGARLSLLHVLDERDPS
FT                   ADEHAARAWLQERLREQQLDQLEPWIRRGPAVEEILTQAEGLEADLLVLGRHHRGSSQG
FT                   FAGTTLERIMLESTAPLLLVVAPAEAPYRRAMAALDFSRCATRAMQCAWQLLDGDAELH
FT                   ALHVHEMAEVHGPDPEGLVLQQELFDQLVEDIQQQLPQTGALLSYSLHQGERSNCLDAA
FT                   LRDWQPQLLALGSHSRGEMSSALLGSLARQFLDQPPCDILIAR"
FT   gene            474801..475715
FT                   /locus_tag="PST_0422"
FT   CDS_pept        474801..475715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0422"
FT                   /product="probable two-component response regulator"
FT                   /note="Code: T; COG: COG0784"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78128"
FT                   /db_xref="GOA:A4VGM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM7"
FT                   /protein_id="ABP78128.1"
FT                   /translation="MSKVSVLVVDDAPFIRDLVKKALRSQFPGIRTEDAVNGRKAQQML
FT                   ARERFDLILCDWEMPEMSGLELLTWCRTQDALKAVPFIMVTSRGDKENVVQAIQAGVSD
FT                   FIGKPFSNEQLTSKVRKALGRAGKLDALAASAPTRVLSTGVANDSLAALTGGKAEVVRP
FT                   AAAPAPEAKAAPLIQPSSAAPAAAPGAASSGRGQGQLRLAHGSVACVIKALSLKEALLV
FT                   VKRGEPLPQVLESAVLDLEQGEGGEIARLNGYLHAVAAFEPKPDSDWLQLSFRFVDRDP
FT                   QKLDYLSRLIARGTAQRHFTPGA"
FT   gene            475880..476755
FT                   /locus_tag="PST_0423"
FT   CDS_pept        475880..476755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0423"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="Code: M; COG: COG0739"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78129"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM8"
FT                   /protein_id="ABP78129.1"
FT                   /translation="MLGLPLLASPALALTIYKYTDANGVVTYSDQAAPGAQVFVFRDRM
FT                   VEKLDTQVKLETRKHDAGETLLVRNDLFAPVDIELKLENVENAVGAPTKPIRWVLPPRS
FT                   QIRLATLAPRDASKPLKYTPKLRHALGDPRLIPKPYKYPLPWRGGPFRLTQGANGQYSH
FT                   FTPKGRYAVDIAMPEGTPIVAARGGMVVKIENEQSGRGNNPAGNFVRILHDDGTMGVYL
FT                   HLMKGSVAVREGQRIETGTRIARSGNTGNSTGPHLHFVVQRNVGLAIESIPFDFSQPVN
FT                   SLPNFAVGGE"
FT   gene            complement(476808..477569)
FT                   /locus_tag="PST_0424"
FT   CDS_pept        complement(476808..477569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78130"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGM9"
FT                   /protein_id="ABP78130.1"
FT                   /translation="MRINALTTATALALGLTATSQAFAQSATGPISNFGVIGSHNQYKL
FT                   TVNDESDKERLNQGGLYYNFGNKMTGQEGFIYQAGIEGQYREKDDVEYMSARADIDLGL
FT                   RAALSTNNYVDVIVGGGYDWGRIEQDDVDFGLFEEDVKLTTRSPFAKAGVGYNYLTPDY
FT                   TVRLEVGARYSIEADSKLKVGGESDTVDLKDKVNPYGELSVLWNKGINNMPISTSLYYT
FT                   QTRYELDSNSEFAENSKLKQEQVGLKVGLAF"
FT   gene            complement(477763..479106)
FT                   /locus_tag="PST_0425"
FT   CDS_pept        complement(477763..479106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0425"
FT                   /product="metal ion transporter, putative"
FT                   /note="Code: R; COG: COG1253"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78131"
FT                   /db_xref="GOA:A4VGN0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN0"
FT                   /protein_id="ABP78131.1"
FT                   /translation="MDPSPSYAASSYFADFGLILFALFLVLLNGFFVAAEFAMVKLRAT
FT                   KVEAIASRHGWRGHILRTVHNQLDAYLSACQLGITLASLGLGWVGEPAFAHLLEPLLAG
FT                   IGIQSPALVHGIAFFTAFFIISYLHIVIGELAPKSWAIRKPELLSLWTAVPLYLFYWLM
FT                   YPAIYLLNASANAILRIAGQGEPGMHHDHHYSREELKLILHSNRARDPSNPQIQVLASA
FT                   VEMSELEVVDWANSREDLLQLDHDAPLAEILEIIRRHKYSRYPVYDSARGEYVGLLHIK
FT                   DLLLALAANGALAEDFCLSELLRPLERVSKHMPLASLLEQFRQGGAHFVLVEEGDHKVI
FT                   GFLTMEDVLEVLVGDIQDEHRKTERGVLAYQPGKLLVRGDTPLFKLERLLGIDLDHVEA
FT                   ETLAGLVYETLKRVPDENEVLQVDGLQIVIKKMRGPKIVLAKVLRLKD"
FT   gene            complement(479208..480509)
FT                   /gene="phoR"
FT                   /locus_tag="PST_0426"
FT   CDS_pept        complement(479208..480509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="PST_0426"
FT                   /product="two-component sensor PhoR"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78132"
FT                   /db_xref="GOA:A4VGN1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN1"
FT                   /protein_id="ABP78132.1"
FT                   /translation="MNQDWQGALVRRLLLLLGGCLLLGLITGEYAWVLVIGLSGYLVWT
FT                   LRQLLRLQRWLHRADPDEPPPDSAGIWGDVFDNLYQMQRRDLRLRGELQGIIDRAQGST
FT                   AALKDAVIMLDSDGNLEWWNPAANRLLGLKKPQDAGHPIGNLVRHPAFKEYFDKGNYDQ
FT                   PLELASPVDDRLRLQFNITRYGNREHLLLVRDVTRLHQLEQMRKDFVANVSHELRTPLT
FT                   VIAGYLETLLENAEAVNPRWLRALQQMNQQAGRMQHLLNDLLLLARLETSSRPTDNQPV
FT                   AVGLLLQSIISDARALSGNRGHLISLDADPGLQLKGSEAELRSAFSNLVFNAVKYTPDG
FT                   GSVHVRWWGDEVGAHLSVEDSGIGIEQKHLPRLTERFYRVDSSRASSTGGTGLGLAIVK
FT                   HVLLRHQGRLDISSTPGQGSRFSCHFQNSQVPGR"
FT   gene            complement(480578..481267)
FT                   /gene="phoB"
FT                   /locus_tag="PST_0427"
FT   CDS_pept        complement(480578..481267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="PST_0427"
FT                   /product="DNA-binding response regulator PhoB"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78133"
FT                   /db_xref="GOA:A4VGN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN2"
FT                   /protein_id="ABP78133.1"
FT                   /translation="MNGKSILIVDDEAPIREMIVVALEMAGYDCLEAENTQQAHALIID
FT                   RKPDLILLDWMLPGTSGIELARRLKRDELTADTPIIMLTAKGEEDNKIQGLEVGADDYI
FT                   TKPFSPRELVARLKAVLRRATPVDSEAPIEIGGLLLDPVSHRVTIDGKPAEMGPTEYRL
FT                   LQFFMTHQERAYTRSQLLDQVWGGNVYVEERTVDVHIRRLRKALGEAYENLVQTVRGTG
FT                   YRFSSKS"
FT   gene            complement(481386..482279)
FT                   /gene="ubiA"
FT                   /locus_tag="PST_0428"
FT   CDS_pept        complement(481386..482279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="PST_0428"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="Code: H; COG: COG0382"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78134"
FT                   /db_xref="GOA:A4VGN3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGN3"
FT                   /protein_id="ABP78134.1"
FT                   /translation="MYLKLLQSCNRLHPRAWDFIQLMRLDKPIGTYLLLWPTLWALWIA
FT                   AEGVPSAKNLFIFITGVILMRAAGCVVNDFADRNFDGHVQRTQARPMAAGRVSSREAWT
FT                   LFAVLVGLSFGLVLLTNATTVYLSFGALALAACYPFMKRYTFYPQVVLGAAFSWGMPMA
FT                   FTAETGSLPPEAWLLFIANLLWTVAYDTYYAMADRDDDLKIGIKSTAILFGEADRVIIV
FT                   TLQGLALFCLLLAGVRFELGQWFHLGLVIAAGCFAWEFWKTQSRKPQVCFKAFLHNHWA
FT                   GLAILAGIVLDYATKA"
FT   gene            complement(482323..482877)
FT                   /locus_tag="PST_0429"
FT   CDS_pept        complement(482323..482877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0429"
FT                   /product="chorismate-pyruvate lyase, putative"
FT                   /note="Code: H; COG: COG3161"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78135"
FT                   /db_xref="GOA:A4VGN4"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN4"
FT                   /protein_id="ABP78135.1"
FT                   /translation="MPERAVSEFLDWLSADRLPSPLEPALHDWLYVDKGSLTRRLTELA
FT                   DGAFSVTPLHEAWQSLRTDECAALGVPADSEGWVREVYLCGHGQPWVFARSVAARAQLE
FT                   DSGLDLQRLGNRSLGELLFSDPAFARGTLEACQYPSHWLPNACRVDGLWARRSCFRQNR
FT                   LGVLVAEVFLPELWQAAAVTP"
FT   gene            complement(482986..483759)
FT                   /gene="glcC"
FT                   /locus_tag="PST_0430"
FT   CDS_pept        complement(482986..483759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcC"
FT                   /locus_tag="PST_0430"
FT                   /product="transcriptional regulator GlcC"
FT                   /note="Code: K; COG: COG2186"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78136"
FT                   /db_xref="GOA:A4VGN5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN5"
FT                   /protein_id="ABP78136.1"
FT                   /translation="MSNEPNNDRRQVADVVAERIERLIVDGVLKVGQALPSERRLCEKL
FT                   GISRSALREGLRVLRGRGIIETSQGRGSFVAELSGNHDASPLMHLFNSQPRTLYDLLEV
FT                   RALLESESARLAALRGTDADFVLLRRRYEEMLAAHASEQGADPREHARLDHAFHLAICE
FT                   ASHNPVLVHTLQSLTDLMLSTVFASVNNLYHRPAQKRQIDRQHSRLYHAVIERLPEQAQ
FT                   RAARDHIHGIRDNLKEIEQEEQRLVRATMRLEGWT"
FT   gene            483992..485491
FT                   /gene="glcD"
FT                   /locus_tag="PST_0431"
FT   CDS_pept        483992..485491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="PST_0431"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /note="Code: C; COG: COG0277"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78137"
FT                   /db_xref="GOA:A4VGN6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR004490"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN6"
FT                   /protein_id="ABP78137.1"
FT                   /translation="MNILYDERVDGALPKVDKAALLAELQAQLPDLDILHRGEDLKPYE
FT                   CDGLSAYRTTPLLVVLPERIEQVETLLKLCHQRGVPVVARGAGTGLSGGALPLEQGILL
FT                   VMARFNKILEVDPAGRFARVQPGVRNLAISQAAAPFDLYYAPDPSSQIACSIGGNVAEN
FT                   AGGVHCLKYGLTVHNLLKVDILTVEGERMTLGSDALDSPGFDLLALFTGSEGMLGIVTE
FT                   VTVKLLPKPQVAKVLLAAFDSVEKAGRAVGDIIAAGIIPGGLEMMDNLSIRAAEDFIHA
FT                   GYPVDAEAILLCELDGVEADVHDDCARVSEVLKLAGATEVRLAKDEAERVRFWAGRKNA
FT                   FPAVGRISPDYYCMDGTIPRRELPGVLKGISDLSEQFGLRVANVFHAGDGNMHPLILFD
FT                   ANQPGELERAEDLGGKILELCVKVGGSITGEHGVGREKINQMCSQFNADELTLFHAVKA
FT                   AFDPSGLLNPGKNIPTLHRCAEFGRMHIHNGQLPFPELERF"
FT   gene            485491..486552
FT                   /gene="glcE"
FT                   /locus_tag="PST_0432"
FT   CDS_pept        485491..486552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="PST_0432"
FT                   /product="glycolate oxidase, subunit GlcE"
FT                   /note="Code: C; COG: COG0277"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78138"
FT                   /db_xref="GOA:A4VGN7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN7"
FT                   /protein_id="ABP78138.1"
FT                   /translation="MSVIANDASALLLDQVNQALAAKTPLRIQGSGSKAFLGRAAEGQL
FT                   LDVREHRGIVSYDPTELVVTARAGTPLAELEATLDEAGQMLPCEPPHFGEGATVGGMIA
FT                   AGLSGPRRPWSGSVRDFVLGSRVITGQGKHLRFGGEVMKNVAGYDLSRLMAGSFGCLGV
FT                   LTEVSLKVLPKPRLCTSLRLEIDLERALLKLAEWGQQPVPISAASHDGKALYLRLEGGE
FT                   GSVNAARERIGGEDLAPGYWNELREQRLAFFADPRPLWRLSLPNNTPAVALPGDQLVDW
FT                   AGAQRWLKSDADAVTIRGIAIEVGGHATCFTAGATSNPFQPLSAPLLRYHRQLKAALDP
FT                   QGIFNPGRMYSEV"
FT   gene            486559..487776
FT                   /gene="glcF"
FT                   /locus_tag="PST_0433"
FT   CDS_pept        486559..487776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcF"
FT                   /locus_tag="PST_0433"
FT                   /product="glycolate oxidase, iron-sulfur subunit"
FT                   /note="Code: C; COG: COG0247"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78139"
FT                   /db_xref="GOA:A4VGN8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN8"
FT                   /protein_id="ABP78139.1"
FT                   /translation="MQTNLSEAAKQLPRAEEAESILRSCVHCGFCNATCPTYQLLGDEL
FT                   DGPRGRIYLMKQMFEGGEVTESTQLHLDRCLTCRNCETTCPSGVKYHNLLDIGRDFIER
FT                   QVQRPLGERLVRGGLRTVIPRPGLFKALLGTGNALKPLMPASLKDHLPREIRPAKPRPQ
FT                   VMHQRRVLMLEGCVQPSLSPNTNAAAARVLDRLGISVSPAREAGCCGAVDYHLNAQDAG
FT                   LDRARRNIDAWWPAIEAGAEAIVQTASGCGAFVKEYGHLLKDDPAYAAKAARVSELAKD
FT                   LVEVLRSAELEKLDVRADKRMAFHCPCTLQHAQKLGGAVEDVLTRLGYQLTAVPDAHLC
FT                   CGSAGSYSITQPEISHQLRDNKLNALESGKPEVIVTANIGCQTHLDGAGRTPVKHWIEV
FT                   VEESMQ"
FT   gene            487850..488254
FT                   /gene="glcG"
FT                   /locus_tag="PST_0434"
FT   CDS_pept        487850..488254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcG"
FT                   /locus_tag="PST_0434"
FT                   /product="glcG protein"
FT                   /note="Code: R; COG: COG3193"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78140"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGN9"
FT                   /protein_id="ABP78140.1"
FT                   /translation="MKSKAVLSQTEVATILAAARAEAQANGWAVTIVVADDGGHPLALE
FT                   RLDGCAPIASYIATEKARSSALGRRETKGYEDMVNNGRTAFLSAPVVCSLEGGVPVVVD
FT                   GHVIGSVGVSGVTAAQDAQIAKAGVAALAN"
FT   gene            488275..490455
FT                   /locus_tag="PST_0435"
FT   CDS_pept        488275..490455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0435"
FT                   /product="malate synthase G"
FT                   /note="Code: C; COG: COG2225"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78141"
FT                   /db_xref="GOA:A4VGP0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP0"
FT                   /protein_id="ABP78141.1"
FT                   /translation="MTERVTLGRLQVAANLQRFIEDEVLPGTGIEAAAFWQGLDTLVHD
FT                   LAPKNRELLAERDRMQVELDSWHKANPGPIKDMAAYRAFLESIGYLLPVPGEVKIETAN
FT                   VDSEIATQAGPQLVVPIMNARYALNAANARWGSLYDALYGTDAISQEGGAQKGPGYNEV
FT                   RGAKVIAYARTFLDQAAPLAEGSHADATAYRVQDGQLKVTLENGSVTGLKQPEKFVGFQ
FT                   GEAVEPKAVLLKNNGLHIEIQIDPNSPIGQTDAAGVKDLLIESAVSTILDCEDSVAAVD
FT                   ADDKVLAYRNWLGIVQGTLSEEVAKGSSSFVRRLNPDREYSAPNGGELKLHGRSLLFIR
FT                   NVGHLMTNPAILLEDGREIPEGIMDGVFTSLIAKHDLARKGNSRTGSVYIVKPKMHGPK
FT                   EVAFADELFGRVEDLIGVPRYTLKMGIMDEERRTSANLKACIAAAKHRVAFINTGFLDR
FT                   TGDEMHTCMEAGPVLRKGDMKSTPWIQSYERNNVLVGLACGLRGKAQIGKGMWAMPDLM
FT                   AAMLEQKIGHPKSGANTAWVPSPTGATLHALHYHQVNVQAVQSELEKVDLAAEREQLLN
FT                   DLLTIPVVAEDKWSAEEKQQELDNNCQGILGYVVRWVEQGVGCSKVPDIHNVGLMEDRA
FT                   TLRISSQHIANWLHHGVVSREQVQETLERMAKVVDQQNAGDPLYRAMSSDYTQSIAFQA
FT                   ASDLVFKGREQPSGYTEPLLHQWRQRFKAAQG"
FT   gene            490672..492375
FT                   /locus_tag="PST_0436"
FT   CDS_pept        490672..492375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0436"
FT                   /product="L-lactate permease, putative"
FT                   /note="Code: C; COG: COG1620"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78142"
FT                   /db_xref="GOA:A4VGP1"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP1"
FT                   /protein_id="ABP78142.1"
FT                   /translation="MSQTLLSILAFVPLVLAGVLLIGFRWPAKYAMPLVFVLTALIGLL
FT                   AWDMTLNRVIASTFQGLILTAAILWIIFGAILLLNTLKHSGGISSIRRGFSNISPDRRV
FT                   QVLIVAWLFGCFIEGASGFGTPAAVAAPLMVALGFPALAAVVMGMMVQSTPVSFGAVGT
FT                   PILVGVGAGLDKTGISEQLAAVGSNWEVFFHLIFSRVAIIHALCGILMPLIMVSIMTRY
FT                   FGRNKSWTEGLAIAPFAVFTGLAFVIPYAAAGVFLGPEFPSMIGALVGLAIVVPAAKAG
FT                   FLLPKDSWDFAPASEWPSEWMGKIEMKIEDVAGKTPISVPMAWAPYLILAGLLVASRVF
FT                   PDFKALLMSLSFGWKDILGETGVSGTLEPLYLPGGILCIVVLITFFLHRMSARELGAAI
FT                   SESSKTLLGAGFVLIFTIPMVRILINSGVNGSDLMSMPVAMAQLVANSVGDVYPFFAPA
FT                   VGALGAFIAGSNTVSNLMLSQFQFNTAGLLGLSGALMVALQSVGAAAGNMIAIHNVVAA
FT                   SATVGLLGREGITLRKTMLPTLYYLILAGTIGLIGFYVMGISDPLVGAAG"
FT   gene            492490..492657
FT                   /gene="rubA"
FT                   /locus_tag="PST_0437"
FT   CDS_pept        492490..492657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rubA"
FT                   /locus_tag="PST_0437"
FT                   /product="rubredoxin"
FT                   /note="Code: C; COG: COG1773"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78143"
FT                   /db_xref="GOA:A4VGP2"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP2"
FT                   /protein_id="ABP78143.1"
FT                   /translation="MKKWQCVVCGYIYDEALGAPEEGIAPGTAWEDVPEDWVCPDCGVG
FT                   KLDFEMIAIG"
FT   gene            492693..493877
FT                   /gene="rubB"
FT                   /locus_tag="PST_0438"
FT   CDS_pept        492693..493877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rubB"
FT                   /locus_tag="PST_0438"
FT                   /product="rubredoxin reductase"
FT                   /note="Code: R; COG: COG0446"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78144"
FT                   /db_xref="GOA:A4VGP3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041364"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP3"
FT                   /protein_id="ABP78144.1"
FT                   /translation="MSAPVVIIGTGLAGYNLAREFRKLDPQTPLLLITADDGRSYSKPL
FT                   LSTGFAANKDADSLGMATAGAMAEQLNAEIRTHTRVTRLDPTHRRVWIGNEPVPYRDLV
FT                   LAWGAQTIRVPVEGDAADAVYPINDLHDYGRFRAAAAGKRRVLILGAGLIGCEFANDLL
FT                   QGGHEVDLVAPSEQVMPGLLPRQAAEAVKRGLEGIGARFHLGATLERLQRSTDGLQATL
FT                   SDGSQRACDLVVSAVGLRPRTELAAEAGLEVKRGIVVDRLLKTSAEHVYALGDCAEVEG
FT                   LSLLYVMPLMAGARALAKTLFGNPTFVSYGPMPVTVKTPACPVVVSMPAVGSAGSWSVE
FT                   ARGNDVKALYLGTCGELLGYALTGAAVQERLALNKQLPPVLAELPQILSLKSPN"
FT   gene            493982..494299
FT                   /gene="hupA"
FT                   /locus_tag="PST_0439"
FT   CDS_pept        493982..494299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="PST_0439"
FT                   /product="DNA-binding protein, HU family"
FT                   /note="Code: L; COG: COG0776"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78145"
FT                   /db_xref="GOA:A4VGP4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP4"
FT                   /protein_id="ABP78145.1"
FT                   /translation="MNSTDTTTKTSQRLPMRKPELAAAIAEKADLSKDQANRVLNAVLD
FT                   EITNALNRKDSVTLVGFGTFVQRHRGARTGKNPQTGQPVTIKASNTVAFKPGKMLKDAV
FT                   N"
FT   gene            494442..494816
FT                   /locus_tag="PST_0440"
FT   CDS_pept        494442..494816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78146"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP5"
FT                   /protein_id="ABP78146.1"
FT                   /translation="MKFRFLLWMLGRLMAKASRTNPEFQQQLGDKDLSFQLHTLDGKVA
FT                   RHFVVKDQRVTSKRGPASEPAFSLGFKDAAYGFATMTAKNKQLAFMQGIQNKDIQIQGN
FT                   PALVMWFQGLTKYLKPKKKK"
FT   gene            complement(494964..495866)
FT                   /locus_tag="PST_0441"
FT   CDS_pept        complement(494964..495866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0441"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78147"
FT                   /db_xref="GOA:A4VGP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP6"
FT                   /protein_id="ABP78147.1"
FT                   /translation="MRRKIPSTAALIAFEAAARHESFTRAADELALTQSAICRQIGGLE
FT                   EFLGLALFRRSRRGVKLTAAGQSYARRIAAQLDAVERDTLSVMGQQGAMSLELAVVPTF
FT                   GTQWLVPRLRHFQALHPEITVNLTNRTRPFLFADTEFDAAIYFGDADWSGTEAHYLMPE
FT                   DLQPVCSPALLRDGQPFTTQALAQLPLLQQTTRPYAWRQWFDSLGLKVARDMTGPRLEL
FT                   FSMLAQAAEHGMGVALIPPFLIQRELAEGRLALAHPHAYRSETRAYYLMIPERKVESAG
FT                   LVAFRDWLKDEAKVWRERA"
FT   gene            496041..497222
FT                   /gene="gcdH"
FT                   /locus_tag="PST_0442"
FT   CDS_pept        496041..497222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="PST_0442"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78148"
FT                   /db_xref="GOA:A4VGP7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP7"
FT                   /protein_id="ABP78148.1"
FT                   /translation="MAGKASFNWIDPLLLDQQLTEEERMVQASAAQFAADKLAPRVLEA
FT                   FRHERTDPAIFREMGETGLLGATIPEAYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQ
FT                   SSLVMVPIFEFGNEATRQKYLPKLASGEYIGCFGLTEPNHGSDPGSMVTRAKKVDGGYR
FT                   LSGSKMWITNSPIADVFVVWAKDDAGEIRGFVLEKGWEGLSAPTIHGKVGLRASITGEI
FT                   VMDNVFCPEENAFPDVRGLKGPFTCLNSARYGISWGALGAAEFCWHTARQYVLDRQQFG
FT                   RPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSLMKRNSCGKALDVA
FT                   RMARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFF"
FT   gene            497288..498511
FT                   /locus_tag="PST_0443"
FT   CDS_pept        497288..498511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0443"
FT                   /product="putative lipid metabolism-related protein"
FT                   /note="Code: C; COG: COG1804"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78149"
FT                   /db_xref="GOA:A4VGP8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP8"
FT                   /protein_id="ABP78149.1"
FT                   /translation="MPGALSHIRVLDLSRVLAGPWCGQILGDLGAEVIKVERPGTGDDT
FT                   RHWGPPYLKDQHGENTSEAAYYLTANRNKQSLTVDFTRPEGQRVIRELVAQCDVLLENF
FT                   KVGGLAAYGLDYESLKAINPRLIYCSITGFGQDGPYATRAGYDFMIQGLGGLMSLTGRS
FT                   DAEEGAGPVKVGVALTDILTGLYATVGVLAALAHRERSGEGQHIDTALLDVQVACLGNQ
FT                   ALNYLTTGVAPRRMGNAHPNIVPYQDFPTADGDIILTVGNDGQFRKFCEVAGRPEWAAD
FT                   ARFATNRARVAHRAELIPLIRQVTVFRTTAEWVSALEQAGVPCGPINDLAQVFADPQVQ
FT                   HRGLNVDMPHPLAGRVPQVASPLRLSASPVAYRNPPPLLGEHSEALLQRLLGMNDEQIA
FT                   GLRAAGVI"
FT   gene            complement(498529..499542)
FT                   /locus_tag="PST_0444"
FT   CDS_pept        complement(498529..499542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0444"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="Code: CR; COG: COG0604"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78150"
FT                   /db_xref="GOA:A4VGP9"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGP9"
FT                   /protein_id="ABP78150.1"
FT                   /translation="MKAVAYFESLAIDDPRALQDVELPEPVPGPRDLLVEVRAISVNPV
FT                   DTKVRRNTQPEGGQPKVLGWDVAGVVVGVGSEVSLFKVGDEVFYAGSIARAGGNSERHL
FT                   VDERIVGRKPRSLSFAEAAALPLTAITAWELLFERLQLVEGQGAGQQLLIVGAAGGVGS
FT                   IMLQLARQLTKVSVIATASRPETQAWAREHGAHHVIDHSQPLHAELQRAGFASVSHVAS
FT                   LTQTDQHFDQLVEALTPQGRLALIDDPAQPLDVMKLKRKSLSLHWELMFTRSLFETPDM
FT                   IEQHHLLQRVSQLVDLGVLRTTLGEHFGTINAANLRRAHALLESGKAKGKIVLEGF"
FT   gene            499920..500591
FT                   /locus_tag="PST_0445"
FT   CDS_pept        499920..500591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0445"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78151"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ0"
FT                   /protein_id="ABP78151.1"
FT                   /translation="MLQLSAPSDFGRNVLLPWLDEFQARHPQLQLRLLLGDGLTDLFRQ
FT                   PVDLVLRYGEPQDSSLVALPVAAGNRRVLCASPAYLQRHGAPQRLDELAGHNCLRFMLA
FT                   GRVHDRWCFQEGRRARTVQVSGDRVSDDADVVRRWALAGLGLAYKSWLDIADDVAAGRL
FT                   RVLLPECLGEAAPLGLLCAHRAQLSKPVRLLHEHLQARCEALLTRAPWAQRAAEGVSTS
FT                   A"
FT   gene            500560..501261
FT                   /locus_tag="PST_0446"
FT   CDS_pept        500560..501261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0446"
FT                   /product="cytoplasmic membrane protein"
FT                   /note="Code: S; COG: COG1704"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78152"
FT                   /db_xref="GOA:A4VGQ1"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ1"
FT                   /protein_id="ABP78152.1"
FT                   /translation="MRRREFQRRPELLWPLAILICVLVNRMDKRIMQTQRFRNTWQLAV
FT                   VVLMSWLLAGCGINNIPRYDEQVKSAWSQVENQYQRRADLIPNLVETVKGFARQEQETL
FT                   TAVVEARARATSIQVDANTLDDPQKLQQFQQAQNQLTGALSRLMAVSERYPELKSNQNF
FT                   LALQSQLEGTENRIAVARRDFIAAVERYNTEIRTFPGRIWHKLMYSDMPIRENFEATAE
FT                   NAEQAPQVQFQ"
FT   gene            501258..502010
FT                   /locus_tag="PST_0447"
FT   CDS_pept        501258..502010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG1512"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78153"
FT                   /db_xref="GOA:A4VGQ2"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ2"
FT                   /protein_id="ABP78153.1"
FT                   /translation="MTRRFPLLLALLLWAGSLFAQQAELPALTGRVVDRAELLDTQAEA
FT                   RLTSMLAAHEQATGEQVVVVTVPDLGGRSIEEFGLELGRTWGIGQEGEDNGALLIVARD
FT                   DRKIRIEVGYGLEDRLTDAQSSVIINRVIAPALQRGDFTAGITEGTQAIITVLGGDPLP
FT                   AELRPVMPMGQQEPGGFGVLAFFLMLVAIFVLGGGRGGRGGGRRALLLGALLGGMGRGG
FT                   GFGGGGFGGGGFGGGGGGFGGGGASGGW"
FT   gene            502029..502646
FT                   /locus_tag="PST_0448"
FT   CDS_pept        502029..502646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0448"
FT                   /product="predicted membrane protein"
FT                   /note="Code: S; COG: COG3762"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78154"
FT                   /db_xref="GOA:A4VGQ3"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ3"
FT                   /protein_id="ABP78154.1"
FT                   /translation="MTLLSESELRQVAEAIERVERSTDAELVTVLAAQADDYHYIPLLW
FT                   ASLIALLLPGALLFFSGWLSAWQLLLVQWATFIVLALLFRLPGVTSRLIPRSVRCWRAC
FT                   NLARRQFIELNLHHTEADTGVLIFVSEAERYVEILVDRGISSRIDNAAWESIVGCFTER
FT                   VKQGQVLEGFLGCIEASGALLAQHVPKTHERNELPNRLVLLP"
FT   gene            complement(502698..503975)
FT                   /locus_tag="PST_0449"
FT   CDS_pept        complement(502698..503975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78155"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR033891"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ4"
FT                   /protein_id="ABP78155.1"
FT                   /translation="MKDAHGYQLTGCNGEAQALLDQALAQFRCLHAASLATTEAALQAS
FT                   PELVMGHVLHAWLYLLGTEAAALPVARASRDRALALPHNEREARHLHALGLLMDGRWYA
FT                   AGRALEDLSVDYPHDLLALQAGHQIDFFTGDARMLRDRIARVLPDWSLEVPGYHALLGL
FT                   YAFGLEESGDYRLAERLGREAVALQPDDAWAQHAVAHVLEMQGRREEGIAWMRGNPAWQ
FT                   QDSMLAVHNWWHLALHHLEMDDFESVLALFDGPLNGHGSTLALELIDASALLWRLQLRG
FT                   VEVGQRWSGVAERWAAMAADGCYAFNDFHAAMAFACAGRDDLLDLLHDAQRRACGRADD
FT                   NARFTALVGAPGVGAVEAFVEGDHARCIDRLRSIRNQAQLFGGSHAQRDLIDQTLIVAA
FT                   QRAGQQGLARALQRERQMLAEQRRMQ"
FT   gene            504487..505176
FT                   /locus_tag="PST_0450"
FT   CDS_pept        504487..505176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0450"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Code: K; COG: COG4977"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78156"
FT                   /db_xref="GOA:A4VGQ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ5"
FT                   /protein_id="ABP78156.1"
FT                   /translation="MLLAQTGLLAGCEGTSHWGYCDCLRREYPDVHWHPDKTLVSTGIG
FT                   QRLVMSGSGSSWHALGLFLIARFVGAREAMEVARLNLFDWDATSPLAYAAMMRTGQLAD
FT                   PIIARCQEWAAQHYEEEAPVSAMVRISGLPERTFQRRFALATGLTPLDYIHTLRLEEAK
FT                   QLLESGELSVEAIAWEVGYQDAGFFGRLFRRKVGLTPAQYRRRFGVLSRRLAGIATLQE
FT                   ERAPALH"
FT   gene            complement(505203..507572)
FT                   /locus_tag="PST_0452"
FT   CDS_pept        complement(505203..507572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78157"
FT                   /db_xref="GOA:A4VGQ6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ6"
FT                   /protein_id="ABP78157.1"
FT                   /translation="MRRRTVTGPCAAISAAGHLCGTCRCGASTQWRCTSSPARACAATI
FT                   SFPARTVIRRKPAVRSSHSRPHGGTCRILAGYRSLPIRDTVGHINRIQHIRTVARHTFG
FT                   AAGFPHNNCGPPAGGGLSKHRAFPIGCEMKTPRLLQGRRGPVLSVFLLLLIAACVAYWQ
FT                   LRPDAPSTPATGAAASMLEALQESTAPWQANRRDLSVLLADLRGASIASAALGKDAVYV
FT                   SLYDGLRYWVPDQSGRVAGLLLEQYAQSNGELFPLAMFQTDAEKPFYTYLLPYSPIALL
FT                   LLGAAIFFAMKTRSFEVQRKGSGITFADVIGAAEAKQALSDVTAYLRDPGAYARLGARP
FT                   PKGVLLTGEPGTGKTQLAKALASESNASFIQVTGSDFSSMYFGVGIQKVKALFRTARKQ
FT                   APCIIFIDEIDGIGKRAEQTRSSDAESNRIINQFLAEMDGFDGASGVLVLGATNFPNSL
FT                   DPALVREGRFDRSIAVGLPGLDDREALFRLYAGKLNAADDLDFPQLARNTVGLTPAAIA
FT                   YIANHAALLAARTGAHQVDMAHFVDAVETCRIGEQPSGVTPMSPTDRKRIAVHEAGHAL
FT                   VAAALNVGRVEKVTILPRGQALGVTLVTPVEDKRLHMYSELRNRIQMLLAGRGAEQLYF
FT                   HEVSSGAGQDLQEASKIALSMVGALGMGPNGSLLSLQAVRDAHIEFDSGESIRAADQLL
FT                   QQLYSDCIALLQRLKPALDEIADKLLAEETVPGEDVLAAIERLPAQHHEASVSSIIGHA
FT                   LSSIDRVAASAMEGADRFELAPVVSPDEDDEGPTRL"
FT   gene            507519..508439
FT                   /locus_tag="PST_0451"
FT   CDS_pept        507519..508439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0451"
FT                   /product="hypothetical protein"
FT                   /note="Code: ET; COG: COG0834"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78158"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ7"
FT                   /protein_id="ABP78158.1"
FT                   /translation="MTGCRDCRARACYRSTPHGRPSRSVADMRHTADSRPCHDAGRAHK
FT                   NNVRSTRDFNMPTRNKTLRSAVLGALFALLPFASANAQDTVNLLTQNFPPFSMANDGKN
FT                   FAKEEAISGIDAEVVAALFKRAGIPYTLTLRFPWSRLQQLAEKTPGFAVFSLSRTPERE
FT                   PKYKWVGPLSEIQIVLLKRPDSPIQISSLEEARQYRIGSKDGSVGSQYLISRGIEVQSS
FT                   LIDTPAKLKAGQFDLWATTNPSGEYEAKQAGVGPLAVALTLSRVDLYLAMNKETPDEVV
FT                   EKLQRTLDQMKQEGLLQQAARRYVN"
FT   gene            complement(508475..509704)
FT                   /locus_tag="PST_0453"
FT   CDS_pept        complement(508475..509704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0453"
FT                   /product="cytochrome c family protein"
FT                   /note="Code: C; COG: COG2010"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78159"
FT                   /db_xref="GOA:A4VGQ8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ8"
FT                   /protein_id="ABP78159.1"
FT                   /translation="MNNRFTTGSLLGAALALFGTAALAQQADDALLERGEYLTRAADCL
FT                   ACHVTEGGKPYAGGLPVEMPFGTLYSTNITPDKETGIGNWTDDEFVEAMQKGVGPDGRH
FT                   YYPAFPYTSYTLMPREDILAIKAYLFSLEPVNQPNRENDIGFPFNQRWGIALWNLLFLD
FT                   DERFEPDPQQSAQWNRGAYLVEGPGHCGECHTPRNFMQAKQSSKALGGATIQGWAAWNI
FT                   TGDEQSGIGGWPDEALAAYLATGVAPGYGVAGGPMAEVVNHSLRHLTPEDIQAMVVYLK
FT                   SVPAQPADVKRPEARSLANQPPAESQHPLGQKLFADACASCHQWDGSGRQSDYAALRGL
FT                   RTLNDPQGLNLVRVILDGDALHGPSGHHLMPAFNRHFNDREVAELANFMLEHFGAQPGA
FT                   LSAGTISERR"
FT   gene            complement(509716..511914)
FT                   /locus_tag="PST_0454"
FT   CDS_pept        complement(509716..511914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0454"
FT                   /product="isoquinoline 1-oxidoreductase, beta subunit,
FT                   putative"
FT                   /note="Code: C; COG: COG1529"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78160"
FT                   /db_xref="GOA:A4VGQ9"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGQ9"
FT                   /protein_id="ABP78160.1"
FT                   /translation="MSQPDTTLQSPSRRTLLKVGSLALGGLVIGFTLPFAGRSFAEQVL
FT                   NEGPEDQPMSNATALDAFISIDRDGQVTFTVPKIEMGQGAQSGLAVMVAEELEIGLEQI
FT                   TLKEAPPNEQIYNDKLLNFQATGGSTSIRSNWEPLRQAGAAARLLLIQAAAQRWQLGAD
FT                   QLRAENGRVLGPDGQSLGYGELIEDAAKLPIPKDIPLKPADQFRLIGKPTRRLDTPAKV
FT                   DGTARFTIDLVVPGMKYASIRACPVLGGTLREVYERAARQIPGVIEVVRLDNAVAVIGE
FT                   HTWAAFAGVRALEIDWALGDNAGIDSAQMEREIRAALDKPGAIANEQGDIDAALKDAAR
FT                   TFEAEYEMPFLAHAALEPMTCVAEVRADAVELWVGTQVPVRAQTAAAEVAGRPAEQVIV
FT                   NNQLIGGAFGRRLEVDFISQAVAIAAQVDYPIKLTWTREEDTTHDMYRPHYIDRFAAAL
FT                   DAEGRLQGWRHTIAGASVLARFAPEAVPENGLDGDAVEVAMHPIYAMPNLRVNYVPVPP
FT                   RALHQSWWRGVGPLRSTYMLESFIDEVARSVEQDPVDYRMALLGSHPRAQGVLRLAAEK
FT                   AGWGEPLEAGHGRGVAVQEVFGSFLATVVELQVSEDKGIRLKRLVVAIDCGQVMNPVSV
FT                   KSQIEGGTLFGLSAALFNEITVREGRVEQTNFHDYRQLRISDAPPVETYIVESREAPGG
FT                   VGEAGTAMIAPALVNALAAANGTRIRRLPLARAGYYVI"
FT   gene            complement(511926..512378)
FT                   /locus_tag="PST_0455"
FT   CDS_pept        complement(511926..512378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0455"
FT                   /product="isoquinoline 1-oxidoreductase, alpha subunit,
FT                   putative"
FT                   /note="Code: C; COG: COG2080"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78161"
FT                   /db_xref="GOA:A4VGR0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR0"
FT                   /protein_id="ABP78161.1"
FT                   /translation="MLTLSINGTDLQVDVPEDMPLLWVLRDVLGLTGSKYGCGIAQCGA
FT                   CTVHLDGQAARACVLPVGEVKGRKVVTIERIGNTELGRKVQQAWLEDEVVQCGYCQCGQ
FT                   IMSAVALLEQNPQPDDRAIDQGMAGNLCRCCTYTRIRSAIKRVAQA"
FT   gene            512427..513101
FT                   /locus_tag="PST_0456"
FT   CDS_pept        512427..513101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78162"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR1"
FT                   /protein_id="ABP78162.1"
FT                   /translation="MDARVRSRQRERQKSRNFSAPRSRRHGICEALPAVERRKRNAAGF
FT                   FADLDCLSSLESSGTLPLCNSVDSRASMTCLDHYMRAFCTLAAVWLVPAFGSTLPEPVG
FT                   HVARVEGAAFVSSRGHTNAAKVGQAIIPGVALSTGAEGGLGVIMGDGSVLSFGPDSELT
FT                   LDDYRFAPASDELRLRATLNRGTLNLIAGDMARLDPQAIAVETPEGRVGVRGGQVLLKV
FT                   KP"
FT   gene            513137..513676
FT                   /locus_tag="PST_0457"
FT   CDS_pept        513137..513676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0457"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78163"
FT                   /db_xref="GOA:A4VGR2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR2"
FT                   /protein_id="ABP78163.1"
FT                   /translation="MAALGGCAQHSYVMLADDSGGRGAAVLGDEQRVLDMPGQGMAIAP
FT                   GGQAFTVSDMQRKADFAKALSAQPALPERFTFHLAPSGELDAGAEQLLDSVLLAARRRD
FT                   YPVVTVIGHTDTLGHRAANEQVGMRRAQRMAELLRARGLEAMELRVESHGERNLLVATP
FT                   DATAEPRNRRVEVLVR"
FT   gene            complement(513717..514097)
FT                   /locus_tag="PST_0458"
FT   CDS_pept        complement(513717..514097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0458"
FT                   /product="endoribonuclease"
FT                   /note="Code: J; COG: COG0251"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78164"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR3"
FT                   /protein_id="ABP78164.1"
FT                   /translation="MSKTVINTDKAPAAIGTYSQAIKAGNTVYLSGQIPLDPKTMELVE
FT                   GFEAQAVQVFENLKAVAEAAGGSLKDIAKLNIFLTDLGNFATVNEVMSRYCQQPYPARA
FT                   AIGVAALPKGAQVEMDAILVID"
FT   gene            complement(514202..516310)
FT                   /gene="spoT"
FT                   /locus_tag="PST_0459"
FT   CDS_pept        complement(514202..516310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="PST_0459"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase"
FT                   /note="Code: TK; COG: COG0317"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78165"
FT                   /db_xref="GOA:A4VGR4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR4"
FT                   /protein_id="ABP78165.1"
FT                   /translation="MPAIDALADRLSTYLVPDQVNLVRRAYFYAEQAHDGQRRRSGEAY
FT                   VTHPLAVANILADMHMDHQSLMAAMLHDVIEDTGIPKEALVAQFGETVAELVDGVSKLT
FT                   QMNFETKAEAQAENFQKMAMAMARDIRVILVKLADRLHNMRTLEVLAGEKRRRIAKETL
FT                   EIYAPIANRLGMHTMRVEFEDLGFKAMHPMRSERIRAAVRRARGNRNEIVEKIEQSLIH
FT                   CLERDGLEGEVLGREKHLYSIYKKMRGKRKAFHEIMDVYAFRIVVDKVDTCYRVLGAVH
FT                   SLYKPLPGRFKDYIAIPKANGYQSLHTTLFGMHGVPIEIQIRTREMEEMANNGIAAHWL
FT                   YKSNEDEVPKGTHARARQWVKGVLELQQRAGNSLEFIESVKIDLFPDEVYVFTPKGRIM
FT                   ELPKGSTAVDFAYAVHTDVGNTCIACRVNRRLAPLSQPLESGSTVEIVTAPGARPNPAW
FT                   LNFVVTGKARTHIRHALKLQRRSESINLGERLLSKALSGFETSLDKISPERIQQVLAEY
FT                   HMEYVEDLLEDIGLGNRMAYVIARRLIARDDEQAPALEGPLAIRGTEGLVLNYAKCCTP
FT                   IPGDPIVGHLSAGKGMVVHLETCRNIADVRHNPDKCIQLSWSKDVTGEFNVELRVELEH
FT                   QRGLIALLAGSVNAADGNIEKIGMDERDGRISVVQLVVSVHDRVHLARVIKKLRTIKGV
FT                   TRITRVKA"
FT   gene            complement(516371..516634)
FT                   /gene="rpoZ"
FT                   /locus_tag="PST_0460"
FT   CDS_pept        complement(516371..516634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="PST_0460"
FT                   /product="RNA polymerase omega subunit"
FT                   /note="Code: K; COG: COG1758"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78166"
FT                   /db_xref="GOA:A4VGR5"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGR5"
FT                   /protein_id="ABP78166.1"
FT                   /translation="MARVTVEDCLDNVDNRFELVMLATKRARQLATGGKEPKVAWENDK
FT                   PTVVALREIASGLVDYDVIAQDEIVDDEPLFTQYEEEPNEAI"
FT   gene            complement(516754..517374)
FT                   /gene="gmk"
FT                   /locus_tag="PST_0461"
FT   CDS_pept        complement(516754..517374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="PST_0461"
FT                   /product="guanylate kinase"
FT                   /note="Code: F; COG: COG0194"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78167"
FT                   /db_xref="GOA:A4VGR6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR6"
FT                   /protein_id="ABP78167.1"
FT                   /translation="MSATTGTLYIVSAPSGAGKTSLVKALVDAQPQVRVSVSHTTRAMR
FT                   PGEVDGVNYHFVSREEFLARLERNEFLEHAEVFGNLYGTSQRWLEQTLAEGYDLILEID
FT                   WQGAQQVRRLMPQAKSIFILPPTQEALRQRLNNRGQDSDEIIEKRMREAVSEMSHYVEY
FT                   DYLVINDDFAHALIDLQSIFRANQLKQQAQQQRHARLLSELLA"
FT   gene            complement(517436..518299)
FT                   /locus_tag="PST_0462"
FT   CDS_pept        complement(517436..518299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1561"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78168"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR7"
FT                   /protein_id="ABP78168.1"
FT                   /translation="MVHSMTAFARSEQAGAHGTLSWEIRSVNHRYLEPHLRLPEAFRDL
FT                   EGQVRDALRKGLSRGKVECTLRFAEEGQRGNLQVDQERASQLIAAAESVAALIRQPAAI
FT                   DPLQVLGWPGVLVGDALDPQALNQSALELFHKALEQLKEGRRREGEELAKLLGERLDSI
FT                   LEEVATLREQVPQMLTTQRQKILDRFSEVRAELDPQRLEQEMVLLAQKSDVAEELDRLS
FT                   THVSEVRRVLKAGGAAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMRE
FT                   QVQNLE"
FT   gene            518449..519171
FT                   /gene="rph"
FT                   /locus_tag="PST_0463"
FT   CDS_pept        518449..519171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="PST_0463"
FT                   /product="ribonuclease PH"
FT                   /note="Code: J; COG: COG0689"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78169"
FT                   /db_xref="GOA:A4VGR8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGR8"
FT                   /protein_id="ABP78169.1"
FT                   /translation="MKRPSGRAADQLRSIRITRNYTKHAEGSVLVEFGDTKVICTASIE
FT                   TGVPRFLKGQGQGWLTAEYGMLPRATGERNQREAARGKQGGRTLEIQRLIGRSLRAALD
FT                   MSKLGENTLYIDCDVIQADGGTRTASITGAMVAVIDALKVLKKRGGLKGGDPVKQMIAA
FT                   VSVGIYQGEPVLDLDYLEDSAAETDLNVVMTDAGGFIEVQGTAEGAPFHADELNAMLAL
FT                   AHDGVRQLFELQRAALAD"
FT   gene            519188..519556
FT                   /locus_tag="PST_0464"
FT   CDS_pept        519188..519556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3296"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78170"
FT                   /db_xref="GOA:A4VGR9"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGR9"
FT                   /protein_id="ABP78170.1"
FT                   /translation="MSDQDLVPLPSREARQWAMFCHYSAFFWFLAPMIGNVLGPLIVWQ
FT                   LKKDMDPFVDQQGKEALNFQLTFSLAMMICGVLAWILIGFPLMVLVSVVALVLVVIAGI
FT                   RANEGKPYRYPFCWRIVR"
FT   gene            complement(519630..520409)
FT                   /gene="crc"
FT                   /locus_tag="PST_0465"
FT   CDS_pept        complement(519630..520409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crc"
FT                   /locus_tag="PST_0465"
FT                   /product="catabolite repression control protein"
FT                   /note="Code: L; COG: COG0708"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78171"
FT                   /db_xref="GOA:A4VGS0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGS0"
FT                   /protein_id="ABP78171.1"
FT                   /translation="MRIISVNVNGIQAAAQRGLLSWLQAQNADVICLQDTRASALELDD
FT                   PAYQLDGYFLYACDAEIPEQGGVALYSRLQPKAVITGLGFETADRYGRYLQADFDKVSI
FT                   ASLLVPSGQGGDANLNHKLKFMDDFAHYLDKQRRKRREYIYCGSLYVAHQKLDVKNWRD
FT                   CQQDPGFLAPERAWLDEIFGNMGYIDALREVNREGDLFSWWPDTEQAEMLNLGWRFDYQ
FT                   ILTSGLRRFVRSARLPRQPRFSQHAPLIVDYDWTLSL"
FT   gene            520495..521142
FT                   /gene="pyrE"
FT                   /locus_tag="PST_0466"
FT   CDS_pept        520495..521142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="PST_0466"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="Code: F; COG: COG0461"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78172"
FT                   /db_xref="GOA:A4VGS1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGS1"
FT                   /protein_id="ABP78172.1"
FT                   /translation="MQAYQREFIRFAIERGVLRFGEFTLKSGRTSPYFFNAGLFNSGSA
FT                   LAQLGRFYASAVIESGLDFDVIFGPAYKGIPLGAATAIALAEQHQRDLPWCFNRKEAKD
FT                   HGEGGTLVGAPLTGRVLIVDDVITAGTAIREVMQIIQAQNAEAAGVLIALNRQERGQGE
FT                   GELSAIQEVERDYRMPVISIVSLEQVLEYLADDVQLKQHLPAVQAYREQYGI"
FT   gene            521162..521755
FT                   /locus_tag="PST_0467"
FT   CDS_pept        521162..521755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78173"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGS2"
FT                   /protein_id="ABP78173.1"
FT                   /translation="MRRSVATRTMLLLGVICPVLASAAELYRYVDERGVVVLDRHGVPP
FT                   QHISRGYQVLNEQGRVVREVPPAPTAEEFARLQAKKARDASDAQLLRLYASVEDVERAE
FT                   TRKLAELDSVIGLSQGNLQSIRSQHSSLRKQAANHERAGRNVPENLLAQIENLEKEEQS
FT                   LLRDLARFEKTRAEAEVSFAQDRQRVAELLGQNP"
FT   gene            521962..523437
FT                   /locus_tag="PST_0468"
FT   CDS_pept        521962..523437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0468"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78174"
FT                   /db_xref="GOA:A4VGS3"
FT                   /db_xref="InterPro:IPR021794"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGS3"
FT                   /protein_id="ABP78174.1"
FT                   /translation="MNDRNLRSYQELHKPKGNFATRAEYLEHELEIMAPKRWGVNLPFR
FT                   DYRFEYEDWVPAMAATIGKIVMVAAVVAAFAGPMGLSNEFVIENARYEMLIAALLFVVL
FT                   FSGFLNPTANLAGTHGPLIPLIPLIVASGGHPMALGIMVGVLGFTLGVFKGGSLLARLT
FT                   SDGVCGGLLLYLGFIGITSQIKKLFGWADSFDMGYIAFVVVFATIVMYAYLEHIRMRWL
FT                   AIPLGSALAALIAFVMGAPFEFTTEPGVPNLNPMYWWGEDTGWQIGLPDLHHFIAVAPF
FT                   AVLAVAMWSPDFLGHRVFQQLNYPPKAKKVLMNIDDTMCVAAARQIVGTSLGGGNLASS
FT                   WGTFMVPAAIAKRPIPAGALLTGLLCVVAALWGYPMDLAIWPPVLSVALMVGVFLPLLE
FT                   AGMQMTREGKTSQSAAIVIFSSALVNPVFGWSLTVLLDNLGLIGDKERGQSLSHLHRWV
FT                   IPTIVFIVLCAVMLGIGMFPGIPAMLESFRIDL"
FT   gene            complement(523494..524396)
FT                   /gene="argB"
FT                   /locus_tag="PST_0469"
FT   CDS_pept        complement(523494..524396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="PST_0469"
FT                   /product="acetylglutamate kinase"
FT                   /note="Code: E; COG: COG0548"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78175"
FT                   /db_xref="GOA:A4VGS4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGS4"
FT                   /protein_id="ABP78175.1"
FT                   /translation="MTLSREAATQFAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELK
FT                   TGFARDIVLMKAVGINPVVVHGGGPQIGDLLKRLNIESHFIDGMRVTDSQTMDVVEMVL
FT                   GGQVNKSIVSLINQHGGSAIGLTGKDAGLIRARKLKATRQTPEMTKPEIIDIGHVGEVT
FT                   GVNAELLEMLVQGNFIPVIAPIGVGENGESYNINADLVAGKVAEALKAEKLMLLTNIAG
FT                   LMDKQGNVLTGLSTAQVDALIADGTIYGGMLPKIRCALEAVQGGVNSAHIIDGRVPNAV
FT                   LLEIFTDVGVGTLITNSQR"
FT   gene            complement(524413..526983)
FT                   /locus_tag="PST_0470"
FT   CDS_pept        complement(524413..526983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0470"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78176"
FT                   /db_xref="GOA:A4VGS5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGS5"
FT                   /protein_id="ABP78176.1"
FT                   /translation="MALFKRTAKDSGVLNPAETRSKRSGINIKPLLGGLASSLIGLGAA
FT                   AALLWLGLQNAEQEQRTQLASAWGQSQASALQQALRQLQGDTQAVTERLMLVEALRGDG
FT                   ERRRDAEQRLLDLPGVVDAHLNVRGRAVPDTSRPGPLNFAALDLLQRAEAGHAPAPEAY
FT                   KVDNRWLLYSAVALRGEGQQAIRGTLLLVTDLERLFAGLPTLPAGAGQLRLSQQFAGAP
FT                   EQVLLQRGTPGNATALTLPSGNSNWTLSYVPGSEAAPAMLTPLHLIAAALLALAGVLIG
FT                   LQLVLGSQQRKLREDVLRISRLLQELSTGKTIQIPALSLPVLDALARNMVRLPVRPAGS
FT                   APTQAPAAAPAVRPAKPTEYVAPPLPETDILDIDILDEDQDIFGLDTKERETAMSSAKA
FT                   PNLPASIFRAYDIRGVVGDSLTTETAYWVGRAIGSESLAKGEPNVSVGRDGRLSGPELV
FT                   QHLIQGLLDSGCDVSDIGMVPTPVLYYAANILAGKSGVMLTGSHNPPDYNGFKIVIAGD
FT                   TLANEQIQVLRKRIETNDLSSGVGKVEQVDVLERYFEQIRSDIAMAKPMKVVVDCGNGV
FT                   AGVIAPKLIEALGCTVIPLYCEVDGNFPNHHPDPGKPENLVDLIAKVKSEKADLGLAFD
FT                   GDGDRVGVVTNAGTMIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRP
FT                   VMWKTGHSLIKKKMKESGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSQDKRDA
FT                   EQVFAAFPCDISTPEINITVTEESKFTIMDALQRDAKWGEANLITLDGVRVDYPKGWGL
FT                   IRASNTTPVLVLRFEADSEEELSRIQDVFRGQLLSVAPDLKLPF"
FT   gene            complement(527028..527483)
FT                   /gene="dut"
FT                   /locus_tag="PST_0471"
FT   CDS_pept        complement(527028..527483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="PST_0471"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /note="Code: F; COG: COG0756"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78177"
FT                   /db_xref="GOA:A4VGS6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGS6"
FT                   /protein_id="ABP78177.1"
FT                   /translation="MHALQAKILDPRLGRDFPLPEYATPGSAGLDLRAMLQQDTVLEPG
FT                   QTLLIPTGLAIHIADPTLAALVLPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG
FT                   QSAFTIAVGERIAQLMLVPVVQARFELVDSFDSSDRGAGGFGHSGSH"
FT   gene            complement(527485..528693)
FT                   /gene="coaBC"
FT                   /locus_tag="PST_0472"
FT   CDS_pept        complement(527485..528693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="PST_0472"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /note="Code: H; COG: COG0452"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78178"
FT                   /db_xref="GOA:A4VGS7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGS7"
FT                   /protein_id="ABP78178.1"
FT                   /translation="MQRLYRKRIVLGVGGGIAAYKSAELVRRLRDHGAEVRVVMTQGGR
FT                   EFITPLTLQALSGHPVHLDLLDPAAEAAMGHIELARWADLVLIAPATADLMARLAQGVA
FT                   NDLLTTVVLATNAPVALAPAMNQAMWADPATQANREQLLARGIRLFGPGSGSQACGDIG
FT                   MGRMLEAEELARAAADCFETGMLTGKHLLITAGPTQENIDPVRYITNHSSGKMGFALAE
FT                   AAAEAGARVTLVTGPVFLPTPDRVQRIDVVSARDMLAACEAAMPCDILIAAAAVADYRP
FT                   EVVAPHKLKKDPSTGDGLLLQMVRNPDILATLAGRADRPFCVGFAAETENLLEYAARKL
FT                   RDKNLDLIVANDVANPSIGFNSEDNAVSVIDRQQHETRFGQASKGHIARALVAFIAERY
FT                   KES"
FT   gene            528831..529505
FT                   /gene="radC"
FT                   /locus_tag="PST_0473"
FT   CDS_pept        528831..529505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="PST_0473"
FT                   /product="DNA repair protein RadC"
FT                   /note="Code: L; COG: COG2003"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78179"
FT                   /db_xref="GOA:A4VGS8"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGS8"
FT                   /protein_id="ABP78179.1"
FT                   /translation="MSIRDWPASERPREKLLDQGAAALSDAELLAIFLRTGVAGKSAVD
FT                   LARYLLAEFGSLRALLEADLDQFSAHLGLGPAKFAQLQAVLEMGRRHLAERLRRDSALE
FT                   SPQAVRDYLKARLRHEPHELFGCLFLDAKHRVLAFEVLFHGTIDGASVYPRQVVKRALA
FT                   QNAAAVILTHNHPSGVAEPSQADRQLTQRLKDALALIDVRVLDHFIVGDGEPLSMAEYG
FT                   WM"
FT   gene            complement(529512..530840)
FT                   /locus_tag="PST_0474"
FT   CDS_pept        complement(529512..530840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78180"
FT                   /db_xref="GOA:A4VGS9"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGS9"
FT                   /protein_id="ABP78180.1"
FT                   /translation="MLALLPLALACELFALVSRLQWPSVISGALLVLFFLWHWRSLMPY
FT                   PRRLGLVTLGLLAYWLLLGTPSWEQAQRMLAAAAYYGAFIGALGLAHCAVKRLPQLGEL
FT                   HRLLLRQPRRRLYPSYLLSTFAISSVLSFGMLNLVCGSLERHLDGRGYSPAQRREGARG
FT                   VMVTALRGFALVPLLAPTSVAVAILTRELPGLSWSALLPFGLLCAAILLVVGWTMDNHR
FT                   LHQLQMGSERPPTPAGELRRLLYGSLLGIALIALLASLTWLSATQAAMLLVPLAVIGLL
FT                   LHQGGSPTAVYGEVRDTLAGMRNETFIFACSALLGGLTAILIPVERLAGHFSSTPLALF
FT                   GLGAIGMLAIIALALLGVAPIISLSLCAALLAQLAGHGVAVMQPAVALLVGFSLAMLLS
FT                   PYGPSALMLARHAGISPWRIAFGWNGRFVLLVLGPLLLVPLLA"
FT   gene            complement(530844..531272)
FT                   /locus_tag="PST_0475"
FT   CDS_pept        complement(530844..531272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0475"
FT                   /product="thioesterase family protein"
FT                   /note="Code: Q; COG: COG2050"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78181"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT0"
FT                   /protein_id="ABP78181.1"
FT                   /translation="MSEHSRLQVEASITGFFQDLGCRLTEYGPERVVIELLLQPRHLNN
FT                   ASNLHGGVSATLLDVAMGLCGIWTEQADQRRVATTLSMNVNFSAPAPAGSRIRAVARCR
FT                   SSGHKVFMASCDLLDEQDRLLAFGEGVYQRGKLRSELP"
FT   gene            531388..532911
FT                   /gene="paaC"
FT                   /locus_tag="PST_0476"
FT   CDS_pept        531388..532911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaC"
FT                   /locus_tag="PST_0476"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase PaaC"
FT                   /note="Code: I; COG: COG1250"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78182"
FT                   /db_xref="GOA:A4VGT1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT1"
FT                   /protein_id="ABP78182.1"
FT                   /translation="MFERIGIIGAGAMGRGIAQLFASAGKQVWLYDARGESVAEALRFN
FT                   RELLERSLAKGRLSTEALDATLARMRPASTLQELAGCDLLIEAIVENLEAKQALFVELE
FT                   ALVAEDAVLATNTSSLSVTRIAAACRHPQRVAGFHFFNPVPLMKLVEVVRGERSDPQVI
FT                   ERLVKLAEEAGHFPAITPDTPGFLVNHAGRAYSTEAQRILAEGIADAEQIDRILRDGPG
FT                   FRMGPFELFDLTGLDVSHAVMESVYQQFYQDPRYTPSYQAAQRVAAGLLGRKSGQGYYR
FT                   YDNGQQMRTPAPALEPVPVDRPFWLDSQDAELRGWLAALLGQTGAQLESGETPSERAIC
FT                   LITPLGEDASSMIARLGLPAARCVAYDLFSDRERRHVLMRTPALDPALEAQARQALGGD
FT                   GVPVEVINDSPGFVSQRVVASIVNLGCEIAQKGIADPHTLDRAITLALGYPKGPLGFAE
FT                   HYGAARVLAILEAMQACYGGEARYRPSPWLRRRVQLALPLSAPERGSAP"
FT   gene            533083..534645
FT                   /locus_tag="PST_0477"
FT   CDS_pept        533083..534645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0477"
FT                   /product="probable chemotaxis transducer"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78183"
FT                   /db_xref="GOA:A4VGT2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT2"
FT                   /protein_id="ABP78183.1"
FT                   /translation="MSPANRHPKAIVFHVALIVGLLLMHYWLAPPLLLTALLLLAAALW
FT                   PWFTVWRAADDGSTAADTPPAFSELTKNLSRNTCHNALSAAQVAFSAEQLASRLQSQLK
FT                   AVSEIANGAEAIAATEQDSAERARHTLDAAQSVRQRSDAGQAELQRAIERMQQLSAQTH
FT                   ASRELIDGLSARTEEIRRITDVIQSIASQTNLLALNAAIEAARAGEAGRGFAVVADEVR
FT                   SLAARTSSATEEVGRMVADIRQQSEAVVSYIQRQANELDAAAEQIATTGEQLSGIAGLA
FT                   GSVESQVEQITTGTADNHQRLTGQFVALDQLRADALDSEKQTRQLEQAAERLVAQAESA
FT                   SEQLAEVQLDDYHQAMFDLARQGAAAIAERFEADIQAGRVSLDDLFDRNYRALPNTDPV
FT                   KYQTRFDKYADEVLPAIQEPLLQRHPALVYAIATTPEGYVPTHNRAFSQPPVGNPEIDR
FT                   VKSRSKRLFNDRTGGRCGSHQRRLLLQTYSRDTGELMHDLSVPIMVRGRHWGGLRLGYR
FT                   PEQ"
FT   gene            534747..535271
FT                   /locus_tag="PST_0478"
FT   CDS_pept        534747..535271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0478"
FT                   /product="membrane protein, putative"
FT                   /note="Code: S; COG: COG4539"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78184"
FT                   /db_xref="GOA:A4VGT3"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT3"
FT                   /protein_id="ABP78184.1"
FT                   /translation="MKTLTDHLAQYAAYHRDPRNLLTHFVGIPLIVVAVAVLLSRPGIA
FT                   WAGLWLSPAALVSLVAALFYLRLDLRYGMLMSAVLALCLWLGALAAGAGTALWLGIGVG
FT                   LFVVGWIIQFIGHYFEGRKPAFIDDLSGLIIGPLFVAAELGFMLGLREPLRLAIEARVG
FT                   PVRLRHTAAHG"
FT   gene            complement(535278..536015)
FT                   /locus_tag="PST_0479"
FT   CDS_pept        complement(535278..536015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78185"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT4"
FT                   /protein_id="ABP78185.1"
FT                   /translation="MDRFTRFWLLLILGMLPGLTEAAEPTTPLQNMQIHANRATSSLLL
FT                   YRGEGFQKAHLLRLEDDLRALNAALMQVPNPTSALRESHQELLARLREGASFGTAEDDM
FT                   PWGFPLQMSKALRDFLTAVRAQQGADSQAELPAKVEYLAVQYLSRAYIGSFEIAREQPD
FT                   TYLGQDERHLVPAIDAQLAELDGKRDPLLAKLKTRWDFLRVALQDMNSASNNLTTASGR
FT                   PFAPIMVDRHTRSLSDQWMAAKP"
FT   gene            complement(536218..537735)
FT                   /locus_tag="PST_0480"
FT   CDS_pept        complement(536218..537735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0480"
FT                   /product="phospholipase D family protein"
FT                   /note="Code: I; COG: COG1502"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78186"
FT                   /db_xref="GOA:A4VGT5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT5"
FT                   /protein_id="ABP78186.1"
FT                   /translation="MLLAGCASHPAPTESYSVAPDASPLGRRIQQLAASQPDGYSGFRL
FT                   LAESTEAFTARSEMIRAAQLSLDVQYYIVHDGLTTRALIDELLQAADRGVRVRLLLDDT
FT                   TSDGQDYRIGALAAHPNVQIRVFNPLHLGRSNAITRTMGRLLHLSLQHRRMHNKLMLVD
FT                   GSLAIVGGRNLGDEYFEADQAMNFTDIDLLGAGPVAEQLARSFDEYWNNQLSVPIQRFL
FT                   WWQPKASGLDKARRQLRDYLQQARQDNSEQYQRLMQYKQEPQLQQWLDELIWAPGEAMW
FT                   DAPEKLLAEGIPATSLLLTTQLAPTMQAVSRELTLISAYFVPTASGVEYLAERAGAGVT
FT                   VRILTNSLEATDVPAVHGGYAPYRRELLEHGVRLFELRRQPQQEPSYSFLGESESSLHS
FT                   KAAVFDQEKVFIGSLNFDPRSVLWNSEVGVLVESHELAREVHRLTLEGMSPALSYEVRL
FT                   EERDGRQQLVWIAEDGGRLRVLEKEPGGLWRRFNAWFADVIGLEKML"
FT   gene            complement(537826..539196)
FT                   /locus_tag="PST_0481"
FT   CDS_pept        complement(537826..539196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0481"
FT                   /product="probable oxidoreductase"
FT                   /note="Code: E; COG: COG0665"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78187"
FT                   /db_xref="GOA:A4VGT6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT6"
FT                   /protein_id="ABP78187.1"
FT                   /translation="MPRSTAPVYPRKMQTFHDTSVNHRASASNTSDHAPSYYAASVNRE
FT                   LSFEPLQGEQRADVCIVGGGFSGLNTAIELAERGLSVILLEAHCIGWGASGRNGGQLIR
FT                   GVGHDVEQFTNILGEEGVDELKRMGFEAVEIVRQRIERYAIDCDLTWGYCDLATKPRHL
FT                   KGFDEDYSDLLRLGYPHPLQRVSRPNLATVIGSQRYLGGLLDMGSGHLHPLNLALGEAA
FT                   AAQSLGVRLFEHSKVERIEYGQQVKVHTANGVVQAETLVLACNAYLNGLQPKLAGKVLP
FT                   AGSYIIATERLPEPLCRELLPQNTAVCDQRVALDYFRLSADGRLLFGGACHYSGRDPKD
FT                   IAAYMQPKMLEVFPQLIGIGIDYQWGGMIGIGANRLPQIGRLPEQPNVFYAQAYSGHGL
FT                   NATHLAGRLLAEAITAQQSHGFDLFAKVPHPTFPGGRLLRSPLLAMGMLWYRLKDRF"
FT   gene            complement(539264..539752)
FT                   /gene="lrp"
FT                   /locus_tag="PST_0482"
FT   CDS_pept        complement(539264..539752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="PST_0482"
FT                   /product="leucine-responsive regulatory protein"
FT                   /note="Code: K; COG: COG1522"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78188"
FT                   /db_xref="GOA:A4VGT7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT7"
FT                   /protein_id="ABP78188.1"
FT                   /translation="MRTRHQTRRELDKIDRHILRILQAEGRLPFTELGERVGLSTTPCT
FT                   ERVRRLEREGIIMGYSARLNPQHLKAGLLVFVEISLAYKSGDIFEEFRRAVLKLPHVLE
FT                   CHLVSGDFDYLVKARISEMASYRKLLGDILLKLPHVRESKSYIVMEEIKESLDLPVPD"
FT   gene            539900..541198
FT                   /gene="dadA"
FT                   /locus_tag="PST_0483"
FT   CDS_pept        539900..541198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="PST_0483"
FT                   /product="D-amino acid dehydrogenase, small subunit"
FT                   /note="Code: E; COG: COG0665"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78189"
FT                   /db_xref="GOA:A4VGT8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGT8"
FT                   /protein_id="ABP78189.1"
FT                   /translation="MRVLVLGSGVVGTASAYYLARAGFEVVVVDRQPAVAMETSFANAG
FT                   QVSPGYASPWAAPGVPLKAMKWLLQRHAPLAIKLTGDIDQYLWMAQMLRNCTAARYAVN
FT                   KERMVRLSEYSRDCLDELRAETGIAYEGRQLGTTQLFRTQAQLDAAAKDIAVLERSGVP
FT                   YELLDRASIARVEPALAKVSHKLSGALRLPNDQTGDCQLFTTRLAEMARALGVEFRFEQ
FT                   NIQRLEHAGDRIAGVWIDGKLETADRYVLALGSYSPQMLKPLGIRAPVYPLKGYSLTVP
FT                   ISDPAMAPQSTVLDETYKVAITRFDQRIRVGGMAEIAGHDLSLDPRRRETLEMVVGDLY
FT                   PQGGDPSDAVFWTGLRPATPDGTPIIGATPYRNLFLNTGHGTLGWTMACGSGRVLADLL
FT                   ASKRPQISTEGLDIFRYGKHKENHKHAHPAAAH"
FT   gene            541660..542208
FT                   /locus_tag="PST_0484"
FT   CDS_pept        541660..542208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0484"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG1396"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78190"
FT                   /db_xref="GOA:A4VGT9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGT9"
FT                   /protein_id="ABP78190.1"
FT                   /translation="MDVGVRLQTIRKLKGLSQRELAKRAGVTNSTISMIEKNSVSPSIS
FT                   SLKKVLSGIPMSLVEFFSPDFDQDSDTQVVYKGSELIDISDGAVSMKLVGKAHPGRAIA
FT                   FLDETYPPGSDTGMDMLSHQGEEAGMLVEGRLELTVSGQVYVLESGDSYYFESSKPHRF
FT                   RNPFDVPARLISATTPANF"
FT   gene            542368..542793
FT                   /gene="cycB"
FT                   /locus_tag="PST_0485"
FT   CDS_pept        542368..542793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycB"
FT                   /locus_tag="PST_0485"
FT                   /product="cytochrome c5"
FT                   /note="Code: C; COG: COG3245"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78191"
FT                   /db_xref="GOA:A4VGU0"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU0"
FT                   /protein_id="ABP78191.1"
FT                   /translation="MNLIKKILVAQTAVLALWAMSAQAATDEAIAERLKPVGEVCIQGE
FT                   ECAAAGAGAAAAAGGAARSGSDVYGKFCTACHGSGLLNAPKTGDSAAWSARADAAGGLD
FT                   GLLKHAISGINAMPPKGTCGDCSDDELKAAIQHMSGL"
FT   gene            542927..543463
FT                   /locus_tag="PST_0486"
FT   CDS_pept        542927..543463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0486"
FT                   /product="uncharacterized protein containing
FT                   double-stranded beta helix domain"
FT                   /note="Code: S; COG: COG4297"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78192"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014500"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU1"
FT                   /protein_id="ABP78192.1"
FT                   /translation="MPSTAPHPELLQLCSDGRTPNSPHPVLIYRQLPLAGPSPAEAFER
FT                   LFDSHLWPSAWRGTVYDYHHYHSTAHEVLGVASGWARLMLGGEKGEEVELRAGDALVLP
FT                   AGTGHCALEASEDFQVVAGYPLDQQYDMQRPDAASHDASRARIARVGVPVSDPLAGTQG
FT                   ALVTLWRGEAAPVSR"
FT   gene            complement(543481..544122)
FT                   /gene="xpt"
FT                   /locus_tag="PST_0487"
FT   CDS_pept        complement(543481..544122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="PST_0487"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /note="Code: F; COG: COG0503"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78193"
FT                   /db_xref="GOA:A4VGU2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGU2"
FT                   /protein_id="ABP78193.1"
FT                   /translation="MTAEAPPRRASGKPRPPTLEVAFVEQLKDKIRSHGIVLSDRVLKV
FT                   DAFLNHQIDPVLMQAIGREFARRFRDDGITKIVTIEASGIAPAVMAGLELGVPVIFARK
FT                   HQSLTLHDNLLTATVYSFTKQVESTIAVSTQHLSANDRVLIIDDFLANGKAAKGLISII
FT                   NQAGASIAGLGIVIEKSFQTGRKELEEAGYRVESLARVASLADGAVQFID"
FT   gene            complement(544190..544774)
FT                   /locus_tag="PST_0488"
FT   CDS_pept        complement(544190..544774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78194"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU3"
FT                   /protein_id="ABP78194.1"
FT                   /translation="MILDATQWRAWHGDDFPEGSWYRDEEQLCAIVGAPRIDLISRERY
FT                   ANFILRFEYALPVGGNSGVFYRVDEAAELAWHSGPEMQLLDDAVHPDGAEPTTRNGALY
FT                   GLRATQQETPIEPGSFMEGALVVRDADVEHWLDNRMVLSYRLDDPDLRMQIRTSKFADK
FT                   PLYAQATAGHIVLQHHGEAVRFRRLSIEPLS"
FT   gene            complement(544784..546406)
FT                   /locus_tag="PST_0489"
FT   CDS_pept        complement(544784..546406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0489"
FT                   /product="putative trehalose synthase protein"
FT                   /note="Code: G; COG: COG0366"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78195"
FT                   /db_xref="GOA:A4VGU4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU4"
FT                   /protein_id="ABP78195.1"
FT                   /translation="MRPLWYRNAVIYQIDPSLFRDSNGDGCGDLRGITERLDYIRGLGC
FT                   TAIWLMPFYQSPFEDAGYDISDHLQVAERFGDLADIVALLEKAEELGLHVIIELVVQHT
FT                   SSEHRWFQEARRDRDSPYRDYYIWADEPDDAIEPIFPTVEDSVWTWDEQAGQYYRHLFY
FT                   KHEPDLDLTNPRVIHEIERIMSFWLRLGVSGFRIDAAVHMVRQAGGGDLRQGYWLLEHM
FT                   RDFVTMRRPETVLLGEIDTDPEKYIEYFGDEADRVTLLLDFWVNNHLFLALARQQAEPL
FT                   CRALNSQPLPPSHSQYALWIRNHDELSLDRLEEDERNEVLDTFAPDQNMRAYNRGIRRR
FT                   LAPMLDGDERRIAATHALLFSLPGTPIIRYGEEIGMGDDLERPERLAVRTPMQWSNEPN
FT                   AGFSCIDAQRLIAPVIDEGPFAFDRVNVFAQTLRSDSLMARTGNMIRTRIGLREIGIGK
FT                   RRTVEVDDPSVFAIRHDNDSTVLMLVNLADRETTVTITDDDLQDMVDVLADCDYGQPEG
FT                   TPLQLRLGPYGYRWLRRKQQLFG"
FT   gene            complement(546409..547944)
FT                   /locus_tag="PST_0490"
FT   CDS_pept        complement(546409..547944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0490"
FT                   /product="oligo-1,6-glucosidase"
FT                   /note="Code: G; COG: COG0366"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78196"
FT                   /db_xref="GOA:A4VGU5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU5"
FT                   /protein_id="ABP78196.1"
FT                   /translation="MSETRRTPWWMGATVYQIYPRSFADSNGDGIGDLQGVLRHLDYLK
FT                   RLGVDALWLSPIFRSPMADAGYDISDYCDIDPLFGSLADIDRLIAEAHARDIRVLLDFV
FT                   PNHTSDEHPWFVESRSSRDNPKRDWYIWRDQPNNWRAALGAGSAWTWDEHTQQYYLHLF
FT                   LAKQPDLNWRNPEVVAAMHDVLRFWLDRGIDGFRIDVIHCTGKDPSFADDPRCQAGQPL
FT                   SDFNDQPYSHEVLRGLRKLVDSYPGDRMLVGEVNIRSTERVLQYYGAGDELHLAFNFNP
FT                   LDAPWDPVLFRTCIREVEHWLQPAGAWPTWVLSNHDNVRQRSRYQGSERAARAAAVLLL
FT                   TLRGTPFIYQGEELGLEDAHIADEARIDPGGRDGCRAPIPWLAEPPHDWNGTSPWLPFP
FT                   PDADELAAERQVGAANSMFALYQRLLAARKASPALLHGDFVELPSHPEVLAYRRQLGDD
FT                   LRLVCINFAEAAHACPQSGDWTVEIASDGLGEGEPYAGTLNPGQALVLRPTEA"
FT   gene            548131..549141
FT                   /locus_tag="PST_0491"
FT   CDS_pept        548131..549141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0491"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /note="Code: G; COG: COG0057"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78197"
FT                   /db_xref="GOA:A4VGU6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU6"
FT                   /protein_id="ABP78197.1"
FT                   /translation="MLRIAINGYGRIGRAVVRALFERGLQNQVQVVAINDLSEHNTLVH
FT                   LTRFDSTFGRFPEPVTLEGDSMVVRGQSIRLLAERDATQLPWKELGVDVVLECTGKFKQ
FT                   RAAIEQHLQAGAGRVFASHPLDGGDLTVVYGVNHQLLADQRVISNASCTTNCLAPLAKV
FT                   LHEAVGIRQGLLNTVHSYTNDQNLLDKAHKDLYRARAAGLSMIPSTTGAAKAIGLVLPE
FT                   LAGRLDGLSVRVPTPNVSLVDLTFIAENAPASVEAINQILRDGAQKLPAGVMECNDEAL
FT                   VSCDFNGYPASCVADLSQTRVQGELVKVMAWYDNEWGFSNRMLDVLLHWQGANAG"
FT   gene            549138..549821
FT                   /locus_tag="PST_0492"
FT   CDS_pept        549138..549821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: E; COG: COG3404"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78198"
FT                   /db_xref="GOA:A4VGU7"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU7"
FT                   /protein_id="ABP78198.1"
FT                   /translation="MTDADRPGVGQGLWQLPLAQFRNAVAERALPGCGAVAAVTADLAV
FT                   ALIVKALRVTAGQRDDDRCSALLDEARALLGRPGAFADDDVAVFREVLKDQHDDRLASS
FT                   AARQACAVPLATAHACIEALGIAERALLLVDPALRCDVEAAVLLLVACVDAVLLNVDAD
FT                   LQRAGRRAGARASAGAGRAAGHGSGAASATFGLISAHTAQQIKRDRRSRFLLTSTHSLS
FT                   TLQAR"
FT   gene            549886..551052
FT                   /locus_tag="PST_0493"
FT   CDS_pept        549886..551052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0493"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="Code: C; COG: COG1454"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78199"
FT                   /db_xref="GOA:A4VGU8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU8"
FT                   /protein_id="ABP78199.1"
FT                   /translation="MSHRIVLPRLMEVGAGASGQLARVLQELGCSRPLIVTDRMMVELG
FT                   YVARIAGQLEEAGIASQCFADTLPEPTAASIRAGVEMVRQGDFDSIVALGGGSPIDSAK
FT                   AIGILGKFGGEMRDYRFPRDVSEAGLPLIAIPTTAGTGSEATRFTIITDETSDEKMLCA
FT                   GLGFMPIAALIDYELTLSLPPRVTADTGIDALTHAIEAYVSRKASLYSDSQALEAMRLL
FT                   APNLRAAFHEPGNRAAREAMMLGATLAGIAFSNASVALVHGMSRPIGAFFHVPHGLSNA
FT                   MLLPAITAFSIPAAPERYADCARAMAVATQTDSVEVANDKLLAELRAINQELKVPSPEQ
FT                   FGIARERFFELRATMARQALASGSPGNNPRVPTEAEIIDLYETVWNQE"
FT   gene            551057..552559
FT                   /gene="mmsA-1"
FT                   /locus_tag="PST_0494"
FT   CDS_pept        551057..552559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA-1"
FT                   /locus_tag="PST_0494"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="Code: C; COG: COG1012"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78200"
FT                   /db_xref="GOA:A4VGU9"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGU9"
FT                   /protein_id="ABP78200.1"
FT                   /translation="MLTLGNLINNEAVAGRSERHATVYNPATGEPRLYVSLSSADETRE
FT                   AIAAAQAAFEAWSKTPPLVRARVMFRFKELLEKRRDDVARLITSEHGKVFSDAQGEVTR
FT                   GLEVVEFACGIPHLLKGEFSSNVGRDIDSNSLMQPLGVCAGITPFNFPAMVPLWMLPVA
FT                   IACGNTFVLKPSEKDPSATMLIGELLAEAGLPAGVLNIVNGDKEAVDVLLTDERVQSVS
FT                   FVGSTPIAEYIYATASAHGKRCQALGGAKNHMVVMPDADPQQVVSSLMGAAYGSAGERC
FT                   MAISVAVCVGDEVADKLVEMLKGEISQMRTGPGLGVEPEPHMGPLVTREHQQKVSGYID
FT                   LGVEDGATLVCDGRGIKVEGYENGFYVGPTLFDRVTPSMRIYREEIFGPVLAVVRVASF
FT                   DEALQLINDHEFGNGTSIFTRDGDTARQFEENVKVGMVGVNVPIPVPMAFHCFGGWKRS
FT                   VFGPLNMHGPDGVRFFTRMKTVTRRWPTGIRAGTEFAMPTMK"
FT   gene            552651..553445
FT                   /locus_tag="PST_0495"
FT   CDS_pept        552651..553445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0495"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78201"
FT                   /db_xref="GOA:A4VGV0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV0"
FT                   /protein_id="ABP78201.1"
FT                   /translation="MRSTPREKGSSITRVLEIIEAVAAAKEPLSPTALAERLDIPKASA
FT                   HRLVQTLEKEGFLQFGLRGGLLPGERLHVAALNILRSSRHKALRQAILRQLSEAIGETC
FT                   GLAIPDGLDMLYFDRVQTNWPLQINLPIGSHTPLWCTASGKLYLASLPPEQLERVLPSL
FT                   PLQRMARNTLTDLSALRDDLARVREEQLGTDCEEFIDGMVACAVPVRASDGELLACLFS
FT                   HAPVIRCSMAQLLAFVPRMRAAARELEAVLGSAAALEADQST"
FT   gene            complement(553433..554050)
FT                   /locus_tag="PST_0496"
FT   CDS_pept        complement(553433..554050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0496"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="Code: R; COG: COG1272"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78202"
FT                   /db_xref="GOA:A4VGV1"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV1"
FT                   /protein_id="ABP78202.1"
FT                   /translation="MYHGERFNAWTHLVGAALACLGAIWLLVLAALDGSPVKIVSVAIY
FT                   GLSLILLYSISTLYHSLRGRAKVVMRKLDHLSIYLLIAGSYTPFCLVTLAGTWGWTLFG
FT                   IVWGLAVIGMLQEIKPRSEARVLSLVIYAVMGWIVLVAVKPLFAALGGAGFSWLLAGGI
FT                   CYTVGIVFFVFDDRFRHWHGIWHIFVMVGSLLHFIAILFYVL"
FT   gene            complement(554147..556123)
FT                   /gene="rep"
FT                   /locus_tag="PST_0497"
FT   CDS_pept        complement(554147..556123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="PST_0497"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="Code: L; COG: COG0210"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78203"
FT                   /db_xref="GOA:A4VGV2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV2"
FT                   /protein_id="ABP78203.1"
FT                   /translation="MNYVGGPLLVLAGAGSGKTSVITRKIAHLVQNCGIQARHIVAMTF
FT                   TNKAAREMKERVGTLLKGSEARGLTVSTFHNLGMNIIRKEYARLGYKPGFSIFDDGDIK
FT                   ALLTDIMQKEYAGDDGADEIKNLIDSWKNDLILPDEALAKARGPKEQTAAIVYLHYQRT
FT                   LKAYNAVDFNDLILLPVKLFQEHPDILEKWQNRIRYLLVDEYQDTNASQYLLVKMLVGM
FT                   RNQFTVVGDDDQSIYAWRGARPENLMLLKEDYPSLKVVMLEQNYRSTSRILKCANILIA
FT                   NNPHVFEKQLWSEMGHGDEIRVIRTRNEEAECERVALEILTEHLRTQRPYSDFAILYRG
FT                   NYQAKLMELKLQHHQIPYRLSGGTSFFARQEVKDLMSYFRLLVNPDDDNAFLRVINVPR
FT                   REIGSTTLEKLGNYASERGISMYAAADEIGLGAHLDSRYAERLARFKHWMDNVRQQCAQ
FT                   NDPIAAIRSMVMDIDYENWLRQNASSDKVADARMGNVWFLVDALKNTLEKDEDGDMTIE
FT                   DAIGKLVLRDMLERQQEEEEGAEGVQMMTMHASKGLEFPSVYIIGFEEEILPHRSSIEA
FT                   DTIEEERRLAYVGITRAKRNLALTFAAKRKQYGEVIDCTPSRFLDELPPEDLVWEGMEE
FT                   APVEVKAARGNDALAAMRAMLKR"
FT   gene            556401..558038
FT                   /locus_tag="PST_0498"
FT   CDS_pept        556401..558038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0498"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78204"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV3"
FT                   /protein_id="ABP78204.1"
FT                   /translation="MPLLLLAHRPDWAVRLRACLQDSAHAEQLVVATDWQTVSQQLESP
FT                   CLVLATPQCRPAPGRFPWPLILLLDEEPEETPEGAVDWLVADQLSAEVLRRCLRYVRER
FT                   CNLQGTLQKLAVRDPHTGIANRQGFQAQLLDALSEHDGHGLELGYLDLDNFRHVNDALG
FT                   HDAGDRLILQVVARLKAQLEVGDLLARLGGDEFALLLDTRDDAGRADAIADRIVEALAE
FT                   PYWVDGESLMLGCSLGLARASAGTSADALLWHAQLAMRQAKASQGCTWCLYDEHVSRSA
FT                   RSLADQEGELRRALRRGELELHYQPRLCLDTGRVVGIEALVRWLHPERGLLGPDAFIPM
FT                   AEESGLIVPLGYWVIARALRDLQSLHEQGADSLHMAVNLSFRQFQDSQLLPTLTRLIDE
FT                   RAIDPHWLEFELTETAVMRRSEQVQTAMQALGQLGVRFSLDDFGTGFSSFVHLSNLPIT
FT                   LLKIDKSFVASMGARPEKRQLVEAMVGLAHNLRLEVVAEGVETAEQLELLRQFGAQQVQ
FT                   GYLVSQPLPLAELLSFMSAERQTAGLAH"
FT   gene            complement(558078..560051)
FT                   /locus_tag="PST_0499"
FT   CDS_pept        complement(558078..560051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0499"
FT                   /product="probable choline transporter"
FT                   /note="Code: M; COG: COG1292"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78205"
FT                   /db_xref="GOA:A4VGV4"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV4"
FT                   /protein_id="ABP78205.1"
FT                   /translation="MEAKQPSSSHLNAPVFYGSAVIILALVIYSVAFQEHAQALFGDAQ
FT                   AWIIANVSWLYILAVALILLMVVLLAFSRYGDIKLGPDHSEPDYSALTWFAMLFSAGMG
FT                   IGLMFFGVAEPVMHFLSPPVGEGGTTLAAREAMKITFFHWGLHAWSIYAIVAMILAYFA
FT                   YRHGLPLTLRSALYPLIGERIYGPIGHAVDIFAIIGTVLGVATSLGLGVTQINTGLNHL
FT                   YGLPVTIPVQIGLIVATTLLATISVVTGLDKGVRRLSELNLSLAGLLMLMVLIAGPTVF
FT                   ILQTFVQNIGSYLSDIVNKTFNLYAYEPNDWIGGWTLFYWGWWLAWSPFVGLFIARISR
FT                   GRTIREFVAGVLLVPTAFTLLWMTVFGDTAIHMILWEHVSSLGEAIEQDSSLALFAFFE
FT                   HFPFSALISLVAIIMVVVFFVTSADSGALVVDMLASGGKQGTPIWQRIFWAVSMGGVAI
FT                   ALLLADGLTALQTATIASALPFTIALLCSMWGLLKALRLDATKQGLRYQALSISPSAAP
FT                   TAGGWQRRLRTLMLFPRRAHVVRFIAEVVRPAYEAIAEEMRKQGYEVEISEGEDRRLRF
FT                   EITHEGEPDFIYEVRPRAYAMPSFVVTSEDDEREERKYFRAEVHLKEGGQDYDVMGWSR
FT                   EDVIGDILGQYEKHMHFLHMVR"
FT   gene            complement(560181..561677)
FT                   /locus_tag="PST_0500"
FT   CDS_pept        complement(560181..561677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0500"
FT                   /product="magnesium chelatase, subunit D/I family"
FT                   /note="Code: O; COG: COG0606"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78206"
FT                   /db_xref="GOA:A4VGV5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV5"
FT                   /protein_id="ABP78206.1"
FT                   /translation="MSLAIVHSRAQIGVEAPAVTVEAHLANGLPALTLVGLPETAVKES
FT                   KDRVRSAILTSGFDFPARRITLNLAPADLPKDGGRFDLAIALGILAASGQLPGERLEQL
FT                   ECLGELALSGALRPIQGVLPAALAARAAGRALLVPRANAEEASLASGLTVFAAEHLLEV
FT                   AAHFNGVTPLEPYVAQGLLRQVQPYPDLADVQGQQAAKRGLLIAAAGAHNLLFSGPPGT
FT                   GKTLLASRLPGLLPPLDEQEALEVAAIHSVASHSPLQHWPQRPFRQPHHSASGPALVGG
FT                   GSRPQPGEITLAHQGVLFLDELPEFDRKVLEVLREPLESGHIVIARARDKVRFPARFQL
FT                   VAAMNPCPCGYLGDPNGRCRCTPEQIQRYRNKLSGPLLDRIDLHLTVAREATALNAAPQ
FT                   TGQSSAVLAAQVAEARRLQLARQGCANAFLDLVGLREHCQLTAEDQAWLERACERLALS
FT                   LRAAHRLLKVARTLADLEQAERIGRQHLAEALQYRPGSQA"
FT   gene            complement(561714..562199)
FT                   /locus_tag="PST_0501"
FT   CDS_pept        complement(561714..562199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78207"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV6"
FT                   /protein_id="ABP78207.1"
FT                   /translation="MRQRGQSRIDASFARAACCGGSAANEAARRTVEHSERTKMVRSCT
FT                   MACSFFVHRSRERRKKRRATLRPVQRQVFSMLPPKAFLDAIGSQASRLFNGETPLPRGE
FT                   FEAQLKGVVQGALNKLDVVSRDEFDSQMVVLARTRARLEALEAKVAELEEKLTPPAS"
FT   gene            562371..562709
FT                   /gene="glnK"
FT                   /locus_tag="PST_0502"
FT   CDS_pept        562371..562709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="PST_0502"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="Code: E; COG: COG0347"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78208"
FT                   /db_xref="GOA:A4VGV7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV7"
FT                   /protein_id="ABP78208.1"
FT                   /translation="MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIDVAIADDQLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRT
FT                   GETDTDAI"
FT   gene            562748..564064
FT                   /gene="amtB1"
FT                   /locus_tag="PST_0503"
FT   CDS_pept        562748..564064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB1"
FT                   /locus_tag="PST_0503"
FT                   /product="ammonium transporter"
FT                   /note="Code: P; COG: COG0004"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78209"
FT                   /db_xref="GOA:A4VGV8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV8"
FT                   /protein_id="ABP78209.1"
FT                   /translation="MTLRRFAGLGALLSLLSPGLAMAQEATLDSGDTAWMLTATALVLF
FT                   MTIPGLALFYGGMVRSKNILSVMMQCFAITGLMSILWMVYGYSLAFDTTGMEAGVTNFN
FT                   SFVGGLDRAFLSGLTPDSLVGAFPESVFITFQMTFAIITPALIVGAFAERMKFSAMLVF
FT                   MGVWFTLVYAPIAHMVWGGDGGLMWDWGVLDFAGGTVVHINAGIAGLVACLVLGKRKGF
FT                   PTTPMAPHNLGLTLVGAAMLWIGWFGFNAGSAVAANGTAGMAMLVTQIATAAAALGWMF
FT                   AEWIGHGKPSALGIASGVVAGLVAITPAAGTVGPMGALIIGLVSGVVCFFCATSLKRKL
FT                   GYDDSLDAFGVHGVGGIVGALLTGIFAAPMLGGFGEVENIGLQLWIQFKGVLFTVVYTG
FT                   IVTYLILKAIDLVMGLRVNEEQETIGLDLSLHNERGYNL"
FT   gene            564256..565431
FT                   /gene="amtB2"
FT                   /locus_tag="PST_0504"
FT   CDS_pept        564256..565431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB2"
FT                   /locus_tag="PST_0504"
FT                   /product="ammonium transporter"
FT                   /note="Code: P; COG: COG0004"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78210"
FT                   /db_xref="GOA:A4VGV9"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGV9"
FT                   /protein_id="ABP78210.1"
FT                   /translation="MWMAAGFAMLEAGLVRAKNTAEILTKNIVLYALASIMYLLVGYYI
FT                   MYSSPEGGIFPSLGFLIGDEHAVDLVAAGGEDAPYYSARADFFFQIVFAATCMSVVSGA
FT                   VAERMKLWAFIAFAVVMTGFIYPIQGFWKWGGGFLDAAGFLDFAGSGVVHMAGAAAALA
FT                   GVLLLGARKGKYGPNGQINAIPGANMPLATLGAFILWMGWFGFNGGSQLKMSTIEDANA
FT                   VAQVFVNTNMGAAGGLIAALITARLLFGKSDLTMVLNGALAGLVAITAEPLTPSALQAT
FT                   LIGGVGGVLVVFSILGLDKLKLDDPVGAISVHGVAGMWGLLAVPLTNADASFGAQLLGL
FT                   VSIFLWVFFASLIVWGIIKAVMGLRVSEEEEYEGVDVVECGLEAYPEFTRQ"
FT   gene            565533..565958
FT                   /locus_tag="PST_0505"
FT   CDS_pept        565533..565958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG0432"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78211"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGW0"
FT                   /protein_id="ABP78211.1"
FT                   /translation="MWQQTLITLRARPRGFHLITDELLAALPELRQCQVGLLHLWLRHT
FT                   SASLTINENADSAVRRDFERFFNRLVPQGEDGYEHDYEGPDDLPAHFKASLLGCQLSLP
FT                   VSAGRLALGTWQGVYLGEHRDQGGARQIVATLHGTAS"
FT   gene            566036..566365
FT                   /locus_tag="PST_0506"
FT   CDS_pept        566036..566365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78212"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGW1"
FT                   /protein_id="ABP78212.1"
FT                   /translation="MSDEELEQDDLEVGDEEEGEELNAADDGDDSLDEEGTDSERATPT
FT                   KKAKAKSAEPDELPSLEAKQKEREALARAMEEFLARGGRVQEVEPNVVADPPKKPDSKY
FT                   GSRPI"
FT   gene            complement(566435..567136)
FT                   /locus_tag="PST_0507"
FT   CDS_pept        complement(566435..567136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0507"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="Code: R; COG: COG1011"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78213"
FT                   /db_xref="GOA:A4VGW2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGW2"
FT                   /protein_id="ABP78213.1"
FT                   /translation="MSIRLITFDLDDTFWETTPAIQSAETALRDWLAAHAPRLGDFPIE
FT                   ALGAIRRMLVEQEPALRHRISELRRRILQHALQDAGYPADEANGLAEQAFQVFLDARHE
FT                   VQIFPDVQPTLEFLANHYTLGVITNGNADVRRLGLADYFQFTLCAEDLGVGKPDPHPFQ
FT                   QALRLGDARPEQAVHIGDHALDDIAGAQQAGLRAVWFNPKRIAWAHDYQPDAEIQRLAD
FT                   LPKLLLAWRDN"
FT   gene            complement(567133..568032)
FT                   /gene="xerC"
FT                   /locus_tag="PST_0508"
FT   CDS_pept        complement(567133..568032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="PST_0508"
FT                   /product="integrase/recombinase XerC"
FT                   /note="Code: L; COG: COG4973"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78214"
FT                   /db_xref="GOA:A4VGW3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGW3"
FT                   /protein_id="ABP78214.1"
FT                   /translation="MQNELDAYFEYLRSARQLSGHSLDAYRRDLDKVLTYCERERIAGW
FT                   RDLQGRHLRHLIAEQHRQGQSSRSLARLLSSVRGLYRYLNQEGLCEHDPATGLSAPKGE
FT                   RRLPRLLDTDRAMQLLDGGVEDDFIARRDQAMLELFYSSGLRLSELVGLNLDQLDLAAG
FT                   LVRVLGKGNKVRELPVGSKAREALQAWLPLRTLAGPADGAVFIGQQGRRLGARAVQLRV
FT                   RQAGVRELGQHLHPHMLRHSFASHLLESSQDLRSVQELLGHADIGTTQIYTHLDFQHLA
FT                   KVYDHAHPRAKRKQDTDT"
FT   gene            complement(568089..568781)
FT                   /locus_tag="PST_0509"
FT   CDS_pept        complement(568089..568781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3159"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78215"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGW4"
FT                   /protein_id="ABP78215.1"
FT                   /translation="MTDQTQGSTPLPDAEAVAAYLRAHPEFFVDHDELIPELRIPHQPG
FT                   TAVSLVERQVKLLRERNIEMRHRLSQLMDVARDNDRLFDKTRRLVLDLLDAGSLEEVVS
FT                   AVEDSLRHEFQVPYVSLILFSEATLPVGRCVSTAEAKQNIGGLLEGGKTICGVLRPHEL
FT                   SFLFGEDGPSVGSAAVVSLDDQLGVLAIGSRDPQHYKSSLGTLFLGYIAEVLARVLPRF
FT                   GTPLRSVR"
FT   gene            complement(568778..569608)
FT                   /gene="dapF"
FT                   /locus_tag="PST_0510"
FT   CDS_pept        complement(568778..569608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="PST_0510"
FT                   /product="diaminopimelate epimerase"
FT                   /note="Code: E; COG: COG0253"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78216"
FT                   /db_xref="GOA:A4VGW5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGW5"
FT                   /protein_id="ABP78216.1"
FT                   /translation="MLLRFTKMHGLGNDFMVIDLVSQHAHIQPKHAKQWGDRHTGVGFD
FT                   QLLIVEPPQNPDVDFRYRIFNSDGSEVEQCGNGARCFARFVVDKRLTVKRKIKVETKGG
FT                   IIELDIRPDGQIRVDMGPPRLVPAEIPFQAEREALSYSLEVDGQQVELAAASMGNPHAV
FT                   LRVDSVERAPVHELGPKIEHHPRFPQRVNVGFLQVVDRRHARLRVWERGAGETQACGTG
FT                   ACAAAVAAIRQGWMDSPVQIELPGGRLSIEWAGPGQPVMMTGPAVRVFEGQVRL"
FT   gene            complement(569619..570866)
FT                   /gene="lysA"
FT                   /locus_tag="PST_0511"
FT   CDS_pept        complement(569619..570866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="PST_0511"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="Code: E; COG: COG0019"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78217"
FT                   /db_xref="GOA:A4VGW6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGW6"
FT                   /protein_id="ABP78217.1"
FT                   /translation="MEAFSYRDGQLFAEGVALPALAQRFGTPTYVYSRAHIEAQYRAYA
FT                   DALEGMPHLVCFAVKANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGEPGRIVFSGV
FT                   GKTRDDMRRALEVGVHCFNVESTDELERLQQVAAELGMKAPVSLRVNPDVDAGTHPYIS
FT                   TGLKENKFGIDIDNAEAVYARAAELPNLEVVGVDCHIGSQLTSLPPFLDALDRLLALID
FT                   RLATRGIQIRHLDLGGGLGVRYRDEQPPLAGDYIQAVRQRIEGRGLALVFEPGRSIVAN
FT                   AGLLLTRVEYLKHTAHKDFAIVDAAMNDLIRPALYQAWMNVIAVQPHEGDTRRYDIVGP
FT                   ICETGDFLAKDRELALAEGDLLAVCSAGAYGFVMSSNYNTRGRAAEVLVDGDQAFEVRR
FT                   RESVQELYAGESLLPT"
FT   gene            complement(570879..571067)
FT                   /gene="lppL"
FT                   /locus_tag="PST_0512"
FT   CDS_pept        complement(570879..571067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lppL"
FT                   /locus_tag="PST_0512"
FT                   /product="lipopeptide LppL precursor"
FT                   /note="Code: N; COG: COG5567"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78218"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGW7"
FT                   /protein_id="ABP78218.1"
FT                   /translation="MLGILRRLDFSRIPVPMKRLLLPFIALAVFAAALSGCGQKGPLYL
FT                   PDDEQTVKERSKDRFEL"
FT   gene            571207..571539
FT                   /gene="cyaY"
FT                   /locus_tag="PST_0513"
FT   CDS_pept        571207..571539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="PST_0513"
FT                   /product="CyaY protein"
FT                   /note="Code: P; COG: COG1965"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78219"
FT                   /db_xref="GOA:A4VGW8"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGW8"
FT                   /protein_id="ABP78219.1"
FT                   /translation="MSLSEARYHDLVDAVQESVEDVFDDTSLDVDLENSGGVLTVRFDN
FT                   GSQLILSRQPALRQLWVAARSGGFHFDYDEGSQLWLCDASGERLGELLTRVTQEQGGEA
FT                   LEFEDL"
FT   gene            571700..572104
FT                   /gene="rnk"
FT                   /locus_tag="PST_0514"
FT   CDS_pept        571700..572104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="PST_0514"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /note="Code: K; COG: COG0782"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78220"
FT                   /db_xref="GOA:A4VGW9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGW9"
FT                   /protein_id="ABP78220.1"
FT                   /translation="MTSAPPIILTKLDLQRLERLLDSLDDYGPAAEALEQELSRAQVVE
FT                   RSEMPAGVVTMNSRVHCRDEGSGKDYHLTLVYPHDAGKEGTVSVLAPVGTALLGMSVGQ
FT                   HIDWPAPGGKMIKLTLLAIEYQPEAAGDPF"
FT   gene            complement(572188..572430)
FT                   /locus_tag="PST_0515"
FT   CDS_pept        complement(572188..572430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78221"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX0"
FT                   /protein_id="ABP78221.1"
FT                   /translation="MNCAMEWLIWLQASPDDQELHAACEAWQRASPVNASAWQRAEQIW
FT                   RLTGQLPSEAQRPPRTDENAGAWIVRTFCRRARRA"
FT   gene            complement(572445..575261)
FT                   /gene="cyaA"
FT                   /locus_tag="PST_0516"
FT   CDS_pept        complement(572445..575261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="PST_0516"
FT                   /product="adenylate cyclase"
FT                   /note="Code: F; COG: COG3072"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78222"
FT                   /db_xref="GOA:A4VGX1"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX1"
FT                   /protein_id="ABP78222.1"
FT                   /translation="MTRTQHIHLVLEEGIDRKVLATLRTRFLAVNAARLERALAAMSTR
FT                   QQQVLKLLPLLFHVNHPILPGYISATTPAGLANFEPDAEQLAEAQRLSRSFAYKPVRGK
FT                   APQPILGLFLMGSLGTAAQDEHSDLDVWVCHDPELDERQLEELRRKCESLRAWAASQGS
FT                   EAHFFLVDPERFTQGQRDAKLTSDDCGTTQHYLLLDEFYRTALWLGGRTPLWWLVPDYE
FT                   EHRYDDYVATLLAKRFVRADEVLDLGHLGQVPPGEFVGAGLWQLYKAIDSPYKSLFKLL
FT                   LVEVYASRYPQLRCLALDFKQAIYHGRTDLDELDPYIAAYHAIERYLCERGAQERLELA
FT                   RRCLYLKINRPLSRPPVNRNKSWQRSLLERLTRDWRWDERQFVLLDNRSQWKVRQVSQE
FT                   RRALVNELTYGYRFLSDFTRRVQATSPLTSRDLGVLGRRLYAAIERKAGKVEVVNLGIS
FT                   PDMSEDSLTLVHGYDGAGDVHWSLYQGQLTAPELPNYAPLKRARELLALLAWGHRNGVV
FT                   DTGTHLSLFPGDSGLSEAELFALLSDLRRALPMPLPAVDEEALLAPSRASRVLLLVNIG
FT                   MDPALHAAGLASSESILAGAVENLVQSVDQVTLNSWNEMLVTRYEGPKALALCLRDNLV
FT                   DLGASDQPPQLQVFCFARNRGQAIARRLEQIFDDARRSLAGATHGRYLLQIRQHFHVLQ
FT                   RDGSDLRLTSLVDRAALLEYLGEAHHLYSPLQLDRAALAGDDLALILTQGRPGCMQVFY
FT                   RAEDGIAELSVLDECNALWRQQLPYRDERTLLRPLLRFLESLMFRRAAQQPGEGVAPLD
FT                   PTILVYRIQPGQGPQPSTLERRPAPLGEVTDPFYEVQAIVEAGDNGRSQVTLYCNQQEF
FT                   SGLEYGNDLFAAVTRTIVARRRDGERYPCYITDIDLSGLHGNGRSQTVQYLRYKSRLEA
FT                   ALNAAMDA"
FT   gene            complement(575412..575657)
FT                   /locus_tag="PST_0517"
FT   CDS_pept        complement(575412..575657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78223"
FT                   /db_xref="InterPro:IPR013468"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX2"
FT                   /protein_id="ABP78223.1"
FT                   /translation="MSYTPELVAELEVLCQFNLENLQEGLKVHHNASPSTIAAFSRLHA
FT                   KGLITQADGGYLTSLGRDAAEQAQTLLTILSETVPA"
FT   gene            complement(575736..576176)
FT                   /locus_tag="PST_0518"
FT   CDS_pept        complement(575736..576176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78224"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX3"
FT                   /protein_id="ABP78224.1"
FT                   /translation="MTAPDRPRYRVDADRQAAQRRVRYVETNRPDDGSCTLCQLDEENP
FT                   APLDRNPMTNDTHTSDEDEAFAEEALLQAIENQLESGEPAATQATLNKLTLVGYERDEC
FT                   LQMMALVLAHEIRAMLRDDRPFDGAAYETMLRKLPELPEASE"
FT   gene            complement(576247..576774)
FT                   /locus_tag="PST_0519"
FT   CDS_pept        complement(576247..576774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78225"
FT                   /db_xref="GOA:A4VGX4"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX4"
FT                   /protein_id="ABP78225.1"
FT                   /translation="MPDLRTLLLNQDTQGGELFESPKERLLFYRSEIHFESSLLAERTS
FT                   AYLASQSFLMIAFASSMANSNPEWGDLFRLVVPAILSLLGLLTSIHAMPGIKANFDVIE
FT                   RWHQKQAELLQIEGRVGMLPNNESALFGEGNSPVGGHRYKRTLLFSLRTPIIFSLVWGA
FT                   FGLLCLALSFMD"
FT   gene            complement(576852..578000)
FT                   /locus_tag="PST_0520"
FT   CDS_pept        complement(576852..578000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: P; COG: COG3213"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78226"
FT                   /db_xref="GOA:A4VGX5"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX5"
FT                   /protein_id="ABP78226.1"
FT                   /translation="MHPRQPRLPFANAWFFPVAALYAAFILPISVFALLGLIPAPPGLS
FT                   TPSGHAHEMLFGFALAVVAGYLLGPQPLRLILSLLGCWALARLSFLLCPGSWLALASAA
FT                   TFAGAVAWKVLPRFFGAAKKWRNQSVAPLLAGLAMLSAMAGSGLGVAVERLLLVEALLL
FT                   FATLMAFMGGRIIAPAMAGYAQSEGRRLDARVQPGLEGAVLILLGLAFVLNPLPWPLLR
FT                   QLAAALVISAGVLSAIRLLRWQPWRCARADLLILLLGYAWLAFGLLLLGLGLLLPALSL
FT                   SATLHALSVGALGSLTFAVMARTRLLYRFRDPAARPWIQAMALLISLAALARVVPALLA
FT                   LPQPGWLLIAAGCWSLAFLSLALLLWQCRAAHVDSPRAQPDR"
FT   gene            complement(578056..579450)
FT                   /gene="argH"
FT                   /locus_tag="PST_0521"
FT   CDS_pept        complement(578056..579450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="PST_0521"
FT                   /product="argininosuccinate lyase"
FT                   /note="Code: E; COG: COG0165"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78227"
FT                   /db_xref="GOA:A4VGX6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGX6"
FT                   /protein_id="ABP78227.1"
FT                   /translation="MSTDKTNQSWGGRFSEPVDAFVARFTASVEFDKRLYRHDIMGSIA
FT                   HATMLAKAGVLTDAERDQIIANLKDIQSEIEAGTFDWRVDLEDVHMNIEARLTDRIGIV
FT                   GKKLHTGRSRNDQVATDIRLWLRDEIDVILGEITRLQQGLLGLAEAEADTIMPGFTHLQ
FT                   TAQPVTFGHHLLAWFEMLSRDYERLVDCRKRTNRMPLGSAALAGTTYPIQREITCELLG
FT                   FEAISGNSLDGVSDRDFAIEFCAAASVAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKTGRVFGALTGLLALMKGQPLAYNKDNQEDKEPLFDAADTL
FT                   RDSLRAFADMVPAIKPKREIMREAALRGFSTATDLADYLVRKGLPFRDCHEIVGHAVKY
FT                   GVQTGKDLAEMTLDELRQFSGEIGDDVFAVLTLEGSVNARDHIGGTAPAQVRAAVKRGQ
FT                   ALLAGR"
FT   gene            579762..580715
FT                   /locus_tag="PST_0522"
FT   CDS_pept        579762..580715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0522"
FT                   /product="alginate biosynthesis protein AlgZ/FimS"
FT                   /note="Code: T; COG: COG2972"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78228"
FT                   /db_xref="GOA:A4VGX7"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX7"
FT                   /protein_id="ABP78228.1"
FT                   /translation="MLAEPMQPGFNWMRLALTSLFVQWIVLLSAGTMCLLRPLLARLRA
FT                   AFAGLACCALVVGLTLACTAVADIYQLGGPLSRDGEVNLYLRHALISLIMSGLLLRYFY
FT                   LQSQWRRQEQAELRARIESLQARIRPHFLFNSLNSIAALVASDPAKAEQAVLDLSDLFR
FT                   ASLARPGTLVAWRDELELSRRYLSIEQYRLGDRLQMDWRVDGVPDDLPIPQLTLQPLLE
FT                   NALVYGIQPRIEGGVVSVTADYVDGMFQLVVSNPFDEAAQAQASRGTRQGLQNIDARLA
FT                   ALFGPLASLSVERREGRHYTCLRYPCARQPQEARSI"
FT   gene            580664..581458
FT                   /gene="algR"
FT                   /locus_tag="PST_0523"
FT   CDS_pept        580664..581458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algR"
FT                   /locus_tag="PST_0523"
FT                   /product="alginate biosynthesis regulatory protein AlgR"
FT                   /note="Code: KT; COG: COG3279"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78229"
FT                   /db_xref="GOA:A4VGX8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX8"
FT                   /protein_id="ABP78229.1"
FT                   /translation="MSTLSVCETTAGSQIYMNVLIVDDEPLARERLSRLVGDLDGYRVL
FT                   EPAASNGEEALTLIEELRPDIVLLDIRMPGLDGLQVAARLCETDAPPAVIFCTAHDEFA
FT                   LEAFQVSAVGYLVKPVRPEHLSEALKKAERPNRMQLAALTRPAAVSGAGPRSHISARTR
FT                   KGIELIPLDQVIYFIADHKYVTLRHVGGEVLLDEPLKSLEDEFGERFVRIHRNALVFRD
FT                   RIERLQRTPLGHFQLFLKGLDGEALTVSRRHVAGVRKLMQNL"
FT   gene            581608..582552
FT                   /gene="hemC"
FT                   /locus_tag="PST_0524"
FT   CDS_pept        581608..582552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="PST_0524"
FT                   /product="porphobilinogen deaminase"
FT                   /note="Code: H; COG: COG0181"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78230"
FT                   /db_xref="GOA:A4VGX9"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGX9"
FT                   /protein_id="ABP78230.1"
FT                   /translation="MPMSREIRIATRKSALALWQAEYVKARLEASHPGLKVSLVPMVSR
FT                   GDKLLDAPLAKIGGKGLFVKELETALLENEADIAVHSMKDVPMEFPEGLGLYCICERED
FT                   PRDAFVSNRFDSLDALPPGSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAG
FT                   EYDAIILAAAGLIRLGFGERIRSSIGVDESLPAGGQGAVGIECRTGDSEVHALLACLNH
FT                   APTATRVVAERALNKRLNGGCQVPIACYAVLEGEQLWLRGLVGQPDGTLLLRAEGRAPA
FT                   AEAEALGVQVAEELLDQGAEQILKAVYGEAGHA"
FT   gene            582549..583319
FT                   /gene="hemD"
FT                   /locus_tag="PST_0525"
FT   CDS_pept        582549..583319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="PST_0525"
FT                   /product="uroporphyrinogen-III synthetase"
FT                   /note="Code: H; COG: COG1587"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78231"
FT                   /db_xref="GOA:A4VGY0"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY0"
FT                   /protein_id="ABP78231.1"
FT                   /translation="MTGWRLLLTRPAEECEALAATLAEAGVHSSSLPLLAIEPLPESAE
FT                   QRATILELDRYCAVVVVSKPAARLGLELLDRYWPQPPFGQAWFSVGGATGAILEAYGLD
FT                   VSWPERGDDSEALLALPRLAQALARPDPKVLIMRGEGGREFLAETLRGRGVQVDFLELY
FT                   RRSLPDYPPGTLVQVVRSERLNGLVVSSGQGLLSLHELAADTWPELCELPLFVPSPRVA
FT                   EMARQLGAKRIVDCRGAGAAALLAALRETAVAAS"
FT   gene            583258..584520
FT                   /locus_tag="PST_0526"
FT   CDS_pept        583258..584520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0526"
FT                   /product="uroporphyrin-III C-methyltransferase, putative"
FT                   /note="Code: H; COG: COG2959"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78232"
FT                   /db_xref="GOA:A4VGY1"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY1"
FT                   /protein_id="ABP78232.1"
FT                   /translation="MAQELRPCWRPCGKPRWPLPDAKDGNVSEADSKKEPLQPPASEPA
FT                   PATEPAKPAKPAKPVPSKPAANGGAKSLAALALLVGLGGVALGGYGIWQLQQLGAQQDQ
FT                   RLEAMQGAAEQTRQLAERERQLAARLGRLEQLPSASELEERRRLLAALQSDQQRLSGRV
FT                   EQVLGASREEWRLAEAEHLLRMAMLRLSAMQDVKSAEMLVHEADLILQKQDDPGAYGTR
FT                   QKLLEGLEALRSLPELDRTGLFLQLGALRGQTGQLSALAPEFVNGEALPENAQDSRWQR
FT                   WLNELTRYVRVDFDASADVKPLLAGQTLGQVRLALSLAIEQAQWAVLNGNTRVYRQSLE
FT                   QASTLLKDHFSDDNGQARGLRERLEALTQREVEVSLPDLAPALQALQAYVQKRERRDES
FT                   DAGETSAQPEAQDAEQEAQRT"
FT   gene            584517..585737
FT                   /gene="hemY"
FT                   /locus_tag="PST_0527"
FT   CDS_pept        584517..585737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="PST_0527"
FT                   /product="HemY protein"
FT                   /note="Code: H; COG: COG3071"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78233"
FT                   /db_xref="GOA:A4VGY2"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY2"
FT                   /protein_id="ABP78233.1"
FT                   /translation="MRRLVLVFILLLAIAGLLGWAISQSAGYVLITYDRFRYESSFWVF
FT                   LALIGCLWLLALAVHWVLGLLHVSGALINPWSRRHRERRVEKASRRGLRELAEGQWGPA
FT                   LGHLQLAAARDRQPLVHYLGAARAANELGEYAQSDELLQKAREREPEAALAIGLTQAQL
FT                   QIARGQYVEARASLSALQSDHPRHPYVLTLLQQLYVQLEDWAALCRLLPELRKHRVLPP
FT                   ARLSELEVLAWTAAVEQAGQPSELTAEASLEALNQRWQTVPSAQRGEPLVVRAYADGLA
FT                   RLGAQAKAEEVLYAAIKRQYDDRLVERYGRVQGSDPARQLANAEGWLKDHPQNAVLLLA
FT                   LGRLSLRNALWGKARDYLEASLRFDHRPETCAELARLLAQLGDTENSNRLFQQGVGLLD
FT                   RNLPATL"
FT   gene            585856..586347
FT                   /gene="dsbH"
FT                   /locus_tag="PST_0528"
FT   CDS_pept        585856..586347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbH"
FT                   /locus_tag="PST_0528"
FT                   /product="disulfide bond formation protein"
FT                   /note="Code: O; COG: COG1495"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78234"
FT                   /db_xref="GOA:A4VGY3"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGY3"
FT                   /protein_id="ABP78234.1"
FT                   /translation="MRLASPRSLFVIAFLGSALLIAIALYMEHVMGLAPCPLCIVQRIC
FT                   VIGFGLVCLVAAIHGPAKVGRRVYAAIAALFVAAGAATAIRQIWLQSVPADQLPSCLPS
FT                   LEYMMEALPFQEIARLVLHGTAECAEVSWTMLGMSIPEWSLLGFIGMAIVCLWQLLRRD
FT                   "
FT   gene            586611..587072
FT                   /gene="algQ"
FT                   /locus_tag="PST_0529"
FT   CDS_pept        586611..587072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algQ"
FT                   /locus_tag="PST_0529"
FT                   /product="alginate regulatory protein AlgQ"
FT                   /note="Code: K; COG: COG3160"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78235"
FT                   /db_xref="GOA:A4VGY4"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY4"
FT                   /protein_id="ABP78235.1"
FT                   /translation="MLESCRNAQERWGGVHLLIDRWLHERHALINAYDRLHIERDDARQ
FT                   ALQRFCEYLVDYVSAGHFEIYEQLLAEAEAFGDARAIELAKQIYPRIETITQVALSFND
FT                   RCEKGDCLGSPGLADELKKLGQLLHERFELEDCLIEVLHTAHKQAAAPA"
FT   gene            587177..588034
FT                   /gene="algP"
FT                   /locus_tag="PST_0530"
FT   CDS_pept        587177..588034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algP"
FT                   /locus_tag="PST_0530"
FT                   /product="alginate regulatory protein AlgP"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78236"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY5"
FT                   /protein_id="ABP78236.1"
FT                   /translation="MPAKKKSVTTPLHLLQQLSHSLIEHLDKACSQAIKDAEGALAKLQ
FT                   KQRGKAQDKLTKARAKLDEAGSTGKPKAQTKARARLGELEESLTLLQTRQSETLNYLAE
FT                   LKRDAEHSLKLAQGIRQVADAADQALQGRQQPAKPAAARPAAGKSAPAAAKPRTSTTRA
FT                   SAAKADSAPAKAGTTTTASKPAAKPAAKSPAKAAVKPAAKAPASAAAKPATTGASASKA
FT                   PARSRAAAGSKAPASAEKKAAASAEAPDRAAAAKPATKATAKKPVARKPAAKRAAAQPA
FT                   ASSS"
FT   gene            complement(588010..588486)
FT                   /locus_tag="PST_0531"
FT   CDS_pept        complement(588010..588486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5589"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78237"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY6"
FT                   /protein_id="ABP78237.1"
FT                   /translation="MRTPDLWTFALACYARPGVETACLELQNQGADVCLLLCGAWLQAR
FT                   GVACSQARLQALTALAAPWRGDVIEPLRGLRQAWRSQAEQDLALHSLREALKTLELQAE
FT                   RELLERLQKISQDWPSNGAADAWLETLVPVAHNRAALEVLRSAALQTQLELAAG"
FT   gene            588556..590466
FT                   /locus_tag="PST_0532"
FT   CDS_pept        588556..590466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0532"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Code: R; COG: COG0488"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78238"
FT                   /db_xref="GOA:A4VGY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY7"
FT                   /protein_id="ABP78238.1"
FT                   /translation="MIRLQNLTLQRGPQRLLEGAELTLHPGQKAGLVGANGAGKSTLFA
FT                   LLRGELVPDGGDCQLPPDWRIAHMRQEIETLERLAVDYVLDGDVELRRIQTELAAAEQA
FT                   HDGNALARLHTELDNADGYSADARARKLLAGLGFSNEQMVLPVGSFSGGWRMRLNLAQA
FT                   LMCPSDLLLLDEPTNHLDLDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVIHLEQR
FT                   KLTLYRGGYSAFERTRAERLAQQQQAYEKQQAQRAHMESFIRRFKAKATKARQAQSRIK
FT                   ALERLEELAPAHVDSPFDFRFREADKVSSPLLDLAEGRLGYGDKLVLDKVKLQLVPGAR
FT                   IGLLGPNGAGKSTLIKTLSGELSPLGGRLQRGENLVVGYFAQHQLDSLDPKASSLLHLQ
FT                   RIAANEREQTLRDFLGGFDFRGDRCDEPVLNFSGGEKARLALALIAWGKPNLLLLDEPT
FT                   NHLDLEMRLALTLALQDFEGAVLVVSHDRHLLKSTTDEFLLVADGRVQDFDGDLEDYAR
FT                   WLVDYRARQQPAVAAEAVADKTDKRAQRQAAAALRQQLAPHKRQADKLEKDLAGVHEKL
FT                   AALETRLGDSALYEAARKDELRQLLAQQAELKVREGELEEAWLEALETLEALQAQLEAS
FT                   A"
FT   gene            590463..591044
FT                   /locus_tag="PST_0533"
FT   CDS_pept        590463..591044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0533"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="Code: M; COG: COG0668"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78239"
FT                   /db_xref="GOA:A4VGY8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY8"
FT                   /protein_id="ABP78239.1"
FT                   /translation="MSEPWLTLVEEWRLQWMLGLQVLLILLVAYVLQRLVVRGLTRVSS
FT                   RYPLPPELLIPVRGGIRWFIIGGALIMVLERFGVSATVLWTAISGFVAVAAIAFFAIWS
FT                   VLSNLLCAVLILTVGPFRLGDVVEIVEAFDKPIVKGRVIDINLLYTTLEEVAEAGTGAI
FT                   VQVPNSLFFQKAVRRWRGTDVQLFNRNLNE"
FT   gene            591054..591812
FT                   /locus_tag="PST_0534"
FT   CDS_pept        591054..591812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0534"
FT                   /product="membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /note="Code: P; COG: COG0861"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78240"
FT                   /db_xref="GOA:A4VGY9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGY9"
FT                   /protein_id="ABP78240.1"
FT                   /translation="MEWLSNPEIWVAFLTLTALEIVLGIDNIIFISILVSRLPKEQQPK
FT                   ARFFGLALAMGTRILLLLSIAWVMRLTNDLFTVLGEGVSGRDLILFFGGLFLLFKSTLE
FT                   IWHSVEGEEEEQTAGGAAKAGFVGIILQIAVIDIVFSLDSVITAVGLVQHVPVMVAAIV
FT                   IAVLVMMVSAGTIADFIDKHPTLKILALSFLIVVGTLLIAEAFDVHVPKGYVYFAMAFS
FT                   LGVEALNIRMRKAMKRKLKEPVKLGKGSPD"
FT   gene            591843..592475
FT                   /locus_tag="PST_0535"
FT   CDS_pept        591843..592475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0535"
FT                   /product="transporter, LysE family"
FT                   /note="Code: E; COG: COG1280"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78241"
FT                   /db_xref="GOA:A4VGZ0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ0"
FT                   /protein_id="ABP78241.1"
FT                   /translation="MTLETWLAFFVACWVISLSPGAGAIASMSCGLQYGFWRGYWNAIG
FT                   LQLALVLQIAVVAAGVGAVLATSELAFGLIKWFGVCYLLWLAWKQWQAQPEALDDSAAP
FT                   RPIGRPLSLVLRGFLVNASNPKAIVFILAVLPQFLDPQRPLLLQYSEMAATMVVVDLVV
FT                   MAGYTGLAAKVLRLLRTPRQQRLVNRSFATMFAGAAALLATVRRAAA"
FT   gene            592490..592945
FT                   /locus_tag="PST_0536"
FT   CDS_pept        592490..592945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1671"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78242"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGZ1"
FT                   /protein_id="ABP78242.1"
FT                   /translation="MRVWIDADACPRAAKDQVIKFALKRKFEVLLVAGQSQVKPAFACV
FT                   RLIVVPSGPDAADDYLVEHAEPGDLVICSDVPLADRLVKKGVAALDPRGRGFDERNMGE
FT                   RLAVRNLFTDLRDQGQVGGGQAAYGERDRQTFANALDRLLTRLSRSQ"
FT   gene            complement(592920..595052)
FT                   /locus_tag="PST_0537"
FT   CDS_pept        complement(592920..595052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0537"
FT                   /product="GGDEF domain/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78243"
FT                   /db_xref="GOA:A4VGZ2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ2"
FT                   /protein_id="ABP78243.1"
FT                   /translation="MSRLLFSDLPADQVALLGHSHDPMLVVLSYLIASAAAFTALALAK
FT                   RVSRSSSPRGRELWRWVGAFALGGGIWSMHFIGMLAFRAPLDIRYEHGITTLSLLIAVA
FT                   VSYVVMRVLGRDHLSVAQYALAGTAAGIGIAAMHYTGMAAIRSLATLYYAPLAFAASVL
FT                   IAIGASIAALVLGFHFRTSQSRHQRWQRLLCSLVMGAAIVSMHYTGMHALTLAVPAGLV
FT                   EHAAPFGSHTGQGALASAIGLVALLVIVTGIAASWAEQRFSEQREALDLAEHQLNAMTH
FT                   YDPLTNLFNGRAFTEMVTQVLAAREERQALAVLVVDLDNFKRINDSLGHRSGDLALQQA
FT                   AQRIRAVLGQHDMLARFSGDEFCVLTLGAWEHAQATAERILDQLRPPFVLGDTQLRLTA
FT                   SIGISQYPEDGLNFDALFRHAGLAVGQCKVSGRNRSLRFNPALELRAQEDLSLEQDLRR
FT                   ALNENLLSVHYQPIVDGRSGRPVSLEALVRWQHPQQGFISPERFVGLAEQHGFVAELDT
FT                   WVARRACADLVGLLEGGHDLRMAVNCSALNLSNPQMPAVVARILERTGLEPARLTVEVT
FT                   ENALMNSLGAAIRTLDAVRELGVKVSIDDFGSGYSSLTYLRQLPVDTLKVDRAFVREIA
FT                   EQANDRAITAAIIAMAHKLGLKVVAEGVEEAVQLDYLRENGCDFIQGYYYSRPLPLPAL
FT                   RDWLAERPLTATVTTA"
FT   gene            complement(595164..595706)
FT                   /locus_tag="PST_0538"
FT   CDS_pept        complement(595164..595706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: Q; COG: COG2050"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78244"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ3"
FT                   /protein_id="ABP78244.1"
FT                   /translation="MLLPSTCSARTTSGSLVRPFSGMPTMNHDDALLAEQAQAVRQMFE
FT                   RIPFNQALGIELDEISTSRVVMHLPMKPELVGNFVHGILHGGVIASLLDVAGGAMAMLG
FT                   AFDKHRHLTMQERAARLSRLGTIDLRIDYLRPGRATRFTASATLLRSGNKVAVVRSELH
FT                   NESDTLIAVGTGTYLCG"
FT   gene            complement(595775..596440)
FT                   /gene="elbB"
FT                   /locus_tag="PST_0539"
FT   CDS_pept        complement(595775..596440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="PST_0539"
FT                   /product="enhancing lycopene biosynthesis protein 2"
FT                   /note="Code: Q; COG: COG3155"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78245"
FT                   /db_xref="GOA:A4VGZ4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ4"
FT                   /protein_id="ABP78245.1"
FT                   /translation="MNKKVAVILSGCGVYDGSEIYESVITLLRLDQRGVKVQCFAPNIA
FT                   QMHVINHLTGEEMPESRNVLTESARLARGEIKDLREARAEDFDALIMPGGFGAAKNLST
FT                   FATEGANSKALPDVVALVKAFAEARKPVGMMCIAPTMAAEIFGAGVICTLGSDDADAAK
FT                   AVGQMGASHQACEVSDIVVDKQHRLVTTPAYMLAQSISEAASGIYKLVDRVLEMTTED"
FT   gene            596743..597756
FT                   /gene="hemB"
FT                   /locus_tag="PST_0540"
FT   CDS_pept        596743..597756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="PST_0540"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /note="Code: H; COG: COG0113"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78246"
FT                   /db_xref="GOA:A4VGZ5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ5"
FT                   /protein_id="ABP78246.1"
FT                   /translation="MSFVPASRLFPATRLRRNRRDEFSRRLVRENVLTVDDLILPVFVL
FT                   DGENRREAVPSMPGVERLSIDLLLEEAEELVALGIPALALFPVTPLEKKSLDAAEAWNP
FT                   DGIAQRATRALRARFPELGIITDVALDPFTTHGQDGILDDNGYVQNDVTVDALVKQALS
FT                   HAEAGAQVVAPSDMMDGRIQAIREALEVAEHHNVRIMAYSAKYASAYYGPFRDAVGSAA
FT                   NLGKSNKNTYQMDPANGDEALHEVGADLAEGADMVMVKPGLPYLDIVWRVKEAFKAPTF
FT                   VYQVSGEYAMHMAAIQNGWLSEAVILESLVGFKRAGADGILTYFAKQAAQQLKRGQ"
FT   gene            597777..599993
FT                   /gene="ppk"
FT                   /locus_tag="PST_0541"
FT   CDS_pept        597777..599993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="PST_0541"
FT                   /product="polyphosphate kinase"
FT                   /note="Code: P; COG: COG0855"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78247"
FT                   /db_xref="GOA:A4VGZ6"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ6"
FT                   /protein_id="ABP78247.1"
FT                   /translation="MINQGLSEKDLQDAVVSEVLEVVEPEAVAVPSAPPEVVEEAPVAP
FT                   VTNLDDSALYIHRELSQLQFNIRVLEQALDESYPLLERLKFLLIFSSNLDEFFEIRVAG
FT                   LKKRVTFAREQAGADGLQPHQALARISELVHEQVDRQYAILNDVLLPALAEHQIRFIRR
FT                   RHWTAKLKTWVRRYFRDEIAPIVTPIGLDPTHPFPLLVNKSLNFIVELEGVDAFGRDSG
FT                   LAIIPAPRLLPRVIRVPESVGGPGDNFVFLSSMIHAHADDLFHGMRVKGCYQFRLTRNA
FT                   DLSVDTEDVEDLARALRGELISRRYGDAVRLEVADTCPQHLADFLLKQFSLGESEMYRV
FT                   NGPVNLTRLFSITGLDSHPELQYSPFTPSIPKLLQNSDKIFSVINKQDILLLHPFESFT
FT                   PVVDLLREAAKDPCVLAIKQTLYRSGANSEIVDALVDAARSGKEVTAVIELRARFDEES
FT                   NLQLASRLQQAGAVVIYGVVGYKTHAKMMLILRRENGELCRYAHLGTGNYHAANARLYT
FT                   DYSLLTSDDALCEDVSKLFSQLIGMGKTMRMKKLLHAPFTLKKTLLDLITQETQHAAEG
FT                   RPAHIILKINALTDPKMIKALYKASQTGVRVDLIVRGMCCLRPGIAGVSHNIHVRSIIG
FT                   RFLEHSRVFYFQNDGDEKLYLSSADWMERNLDRRVETCFPVESKKLVTRVKKELEGFLS
FT                   DNTQSWILQPDGSYVRNSPTGNQNARNVQSTLLERLTGPQVGTR"
FT   gene            complement(600049..601551)
FT                   /gene="ppx"
FT                   /locus_tag="PST_0542"
FT   CDS_pept        complement(600049..601551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="PST_0542"
FT                   /product="exopolyphosphatase"
FT                   /note="Code: FP; COG: COG0248"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78248"
FT                   /db_xref="GOA:A4VGZ7"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ7"
FT                   /protein_id="ABP78248.1"
FT                   /translation="MRQNTAESFPMIAALDLGSNSFHMVLARTSNGEMRILERLGEKVQ
FT                   LAAGIDENRLLDEAAMQRGLDCLRRFAQMVNHLPQGAVRIVGTNALREARNRATFIRRA
FT                   EEIINHQVEVISGREEARLIYLGVSHTVPASQGRRLVADIGGGSTEFIIGEGFESQLRE
FT                   SLQMGCVSYTQRFFRDGKITPARYAQAYTAARVELMGIEHGLRRLGWQESIGASGTIRA
FT                   VGLAIKSGGFGTGEVNAEGIGWLKRKLFKLGDVEKIDIDGVKPDRRGVFPAGLAILEAI
FT                   FDALEINSMTHSEGALREGVLYDLLGRHHDEDIRDRSLSFLMERYHVDMEQAARVEAKA
FT                   LEAFDQVAEAWNLDQDWHRELLAWAARVHEVGLDIAHYHYHKHGAYLIEHSDLPGFSRQ
FT                   DQLMLALLVRGHRRNIPQDKFGETGADADALVRLCILLRFAILFHHIRGANAVSDVQLK
FT                   ADERSLELIFPTDWLNANPLTRADFEAEAAWLARVGYDLRMK"
FT   gene            602295..603554
FT                   /gene="rho"
FT                   /locus_tag="PST_0543"
FT   CDS_pept        602295..603554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="PST_0543"
FT                   /product="transcription termination factor Rho"
FT                   /note="Code: K; COG: COG1158"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78249"
FT                   /db_xref="GOA:A4VGZ8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A4VGZ8"
FT                   /protein_id="ABP78249.1"
FT                   /translation="MNLTELKQKPITELLEMAEQMGIDNMARSRKQDVIFSLLKKHAKS
FT                   GEEISGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPP
FT                   KEGERYFALLKVDSINYDRPENAKNKILFENLTPLFPNERLKMEAGNGSTEDLTGRVID
FT                   LCAPIGKGQRGLIVAPPKAGKTIMLQNIASNITRNNPECHLIVLLIDERPEEVTEMQRT
FT                   VRGEVVASTFDEPPTRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDAHALEKPKRFFGAARNIEEGGSLTILATALVETGSKMDEVIYEEFKGTGN
FT                   LELQLDRRIAEKRVFPAININRSGTRREELLTAEDELQRIWILRKLLHPMDEIAAIEFL
FT                   LDKLKDTKTNDEFFMSMKRK"
FT   gene            603678..605144
FT                   /locus_tag="PST_0544"
FT   CDS_pept        603678..605144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0544"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="Code: H; COG: COG0043"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78250"
FT                   /db_xref="GOA:A4VGZ9"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VGZ9"
FT                   /protein_id="ABP78250.1"
FT                   /translation="MQYRDLRDFISGLEKRGELKRVTAAVSPVLEMTEICDRTLRKQGP
FT                   ALLFENPTGFDMPVLGNLFGTPGRVALGMGAEDVSELREIGKLLAFLKEPEPPKGLKDA
FT                   WSKLPIYKKVISMAPKVLKDAPCQEVIVEGDDVDLTKIPVQHCWPGDAAPLITWGLTIT
FT                   KGPNKERQNLGIYRQQVIGRNKVIMRWLSHRGGALDFREWCEKYPDRPYPVAVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSRTELVKAIGSELQVPAYAEIVLEGHIHPGEMAD
FT                   EGPYGDHTGYYNEVDRFPVFTVERITHRKNPIYHSTYTGRPPDEPAILGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTD
FT                   DDINARDWNDVIWAITTRMDPKRDTVMIDNTPIDYLDFASPISGLGSKMGLDATHKWPG
FT                   ETNREWGRAIVQDPAVKRRVDELWLQLGID"
FT   gene            605113..606189
FT                   /locus_tag="PST_0545"
FT   CDS_pept        605113..606189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0545"
FT                   /product="oxidoreductase, iron-sulfur-binding"
FT                   /note="Code: HC; COG: COG0543"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78251"
FT                   /db_xref="GOA:A4VH00"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH00"
FT                   /protein_id="ABP78251.1"
FT                   /translation="MNSGCSWVSTDITEEAGPSPSEALAGYPVHRKDVQMKVTLQPSGA
FT                   VLDVRPGERLLDAAKRLGYECPQSCRNGNCHICASLLVEGSVRQAGEVRDHGELLACLA
FT                   EPLEDCVLLWDGVLAPGELPVRELSCQISGYEDVGGDVVRLRLRLPAGRQPRYHAGQYL
FT                   LLQREDGEWSAFSLASAPGSGRELELHVLAREESAVELLAFLRRQGFARIQMPFGDTHL
FT                   AELPEGPLVLIAAGTGMAQMHSLIEYCRAAGFPHPVHLYWGVRRPEDFYRLPHWEEWQG
FT                   MSNLHLHRVVSDVCGWEGRCGMLHEAIREDFSDLKPLHIYASGSPSMVYGTLDALVAAG
FT                   MDPHQMRADVFAYAPRES"
FT   gene            complement(606245..606910)
FT                   /locus_tag="PST_0546"
FT   CDS_pept        complement(606245..606910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: D; COG: COG3087"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78252"
FT                   /db_xref="GOA:A4VH01"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH01"
FT                   /protein_id="ABP78252.1"
FT                   /translation="MAARKKAAPKRGASRYQAPAKQPVPGWIWLVCGLVIGGFIMFLMS
FT                   LEPGGEEVKRAKEAPKTAVKEQPKRTPATEQPPKPKYDFYTLLPESEVILPPEAKQPEP
FT                   PSAPVTPEEAAKIDEARAQAALNGQVPPPPPTVAKAPVTQFFLQAGSFRQQAEADRVRA
FT                   QIILLGQDVRVESVKVRDEPWYRVLVGPFGSREQLNAAQKTLAASGYKNLLLQQRQAR"
FT   gene            complement(606911..608650)
FT                   /gene="argS"
FT                   /locus_tag="PST_0547"
FT   CDS_pept        complement(606911..608650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="PST_0547"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="Code: J; COG: COG0018"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78253"
FT                   /db_xref="GOA:A4VH02"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VH02"
FT                   /protein_id="ABP78253.1"
FT                   /translation="MKDSIRHLIQQALVRLTSEGVLPEGLTPAIQVENTKDKSHGDFAS
FT                   NIAMMLAKPAGMKPRELAEKLIAALPQDAQISKVEIAGPGFLNFFQNSDALAQRLETAL
FT                   ADAQLAVHKASAKQRVVIDLSSPNLAKEMHVGHLRSTIIGDAVGRVLEFLGDEVIRQNH
FT                   VGDWGTQFGMLLAYLEEKPAAAESELADLEQFYRAAKQRFDESPEFADRARELVVKLQA
FT                   GDAQCLSLWTRFNDISLSHCQKIYDRLNVKLTPADVKGESAYNADLADIVEALREKGLL
FT                   TEDNGAQCVFLDEFKNAEGNPLPVIVQKAGGGYLYATTDLAAMRYRSQQLHADRVLYFV
FT                   DQRQALHFQMAFEVARRAGFVHEGMQLEHMGFGTMNGADGRPFKTRDGGTVKLIDLLDE
FT                   AEQRAYTLVKGKNPELDEAELRQIARAVGISAVKYADLSKHRTSDYRFNFELMLSFEGN
FT                   TAPYLLYAYTRVASVFRKLGKGIDEISGQIQLDAEQELALAAKLAQFGEVLNSVGEKGE
FT                   PHLLCAYLYDLAGLFSSFYEHCPILGAEQEAQKQSRLRLAALTGRTLKQGLELLGLEPL
FT                   ERM"
FT   gene            complement(608765..611161)
FT                   /gene="priA"
FT                   /locus_tag="PST_0549"
FT   CDS_pept        complement(608765..611161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="PST_0549"
FT                   /product="primosome assembly protein PriA"
FT                   /note="Code: L; COG: COG1198"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78254"
FT                   /db_xref="GOA:A4VH03"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH03"
FT                   /protein_id="ABP78254.1"
FT                   /translation="MPPPDPMSSTARSRARIIPEQKGDASAGDRRPATRIALWDGGERR
FT                   DRLPSSLNIKDHRVPSCILRLALPSPLRRLFDYLPPHGATAGSLQPGMRLRVPFGRREV
FT                   IGVLVELSDQSEVPLEKLRPAIELLDSTPPLPPSLFKLCLWTAQYYQHSLGDTLSWALP
FT                   VLLRQGEPAEARLERYWRLAEGANPDDPRLARAPRQRETLKIIAQHAHGLPHALLGKLQ
FT                   LNKDSLDLLLEKGLVRVESRRSSPPRQHSGSWLLQAELTLNAQQRAAFEAISAGLGGFQ
FT                   AFLLAGVTGSGKTEVYLQLIHRVLAAGKQALVLIPEINLGPQTLARFEQRFNARIALLH
FT                   SNINDRERLDAWLAARDGEADIIIGTRSALFTPMKNPGLIIIDEEHDASYKQQEGLRYH
FT                   ARDLALVRARQENLPIVLGSATPSLESLHNAHSGRYALLKLSQRAGNAQQPRFLRLDVK
FT                   SRPLDAGISGPLQQAIGQTLAAGQQVLVYLNRRGFAPTLLCHDCGWLSQCQRCDARMTL
FT                   HQRHNELRCHHCGHVERPPRNCPDCGKVDLRPVGAGTERAEERLGVLFPDYPVLRIDRD
FT                   STARKGAMEKMFTTINRGDPCLLVGTQMLAKGHHFPRVTLVAILDADGGLFSADFRASE
FT                   RMAQLIVQVAGRAGRAEEPGKVIIQTHLADHPLLVQLTDQGYFAFAEQALSERRAAGLP
FT                   PFSHLALLRAEAQKPGQAEAFLDEACTLAEQTFGQLQLSGIELLGPVPAPMERRAGRYR
FT                   AQLLLQGNARAALHRLMDAWVPLLEQLPGGRAVRWSLDVDPIDLF"
FT   gene            611109..612209
FT                   /locus_tag="PST_0548"
FT   CDS_pept        611109..612209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0548"
FT                   /product="staphylococcal nuclease"
FT                   /note="Code: L; COG: COG1525"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78255"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH04"
FT                   /protein_id="ABP78255.1"
FT                   /translation="MIRALLRAVLDIGSGGGTQSQRIHHESRYPSELRRNRSHLQLWQR
FT                   HQDPLHPGQEPEHRRLLRVPPVLHRQAEGAGYRRSYRSLQAAFRCVRRQVSRHGGNPMR
FT                   FSEYMKKASLVGAFFVSIFCNLQALAFCPSPGTLPLVGVAKVVDGDTLRLVDGRSVRLI
FT                   GINTPELGRDGRKAEPFAVAAQRRLRALVEASNGRVGLVPGRESKDRYGRTLAHAYDEQ
FT                   GRNLESALLAEGLGLMVAIAPNTALVACHRRAEQQARQSRLGVWRKLTPRSTRAVRQGG
FT                   FALLQGMVERVEHNRGGYWLEMEGPLVVHIPPQAFSAFDLAQLPRLAGKTLEPRGWLVD
FT                   RRGRAGTGQARWMLRVTHPAMLGLPR"
FT   gene            612351..613619
FT                   /gene="maeB"
FT                   /locus_tag="PST_0550"
FT   CDS_pept        612351..613619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="PST_0550"
FT                   /product="malic enzyme"
FT                   /note="Code: C; COG: COG0281"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78256"
FT                   /db_xref="GOA:A4VH05"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH05"
FT                   /protein_id="ABP78256.1"
FT                   /translation="MTDLKTAALEYHAQPRPGKLSVELTKPTATARDLSLAYSPGVAEP
FT                   VREIARDAELAYRYTGKGNLVAVISDGTAILGLGNLGPLASKPVMEGKGVLFKRFAGVD
FT                   VFDIEVDAESPQAFIDTVKRISITFGGINLEDIKAPECFEIERALIEQCDIPVFHDDQH
FT                   GTAIVTAAGMLNALEIAGKTLEQAKIVCLGAGAAATSCMKLLVSMGAKIENIFMIDRKG
FT                   VIHAGRDDLNQYKAVFAHETDKRTLDDALDGADVFVGLSGANLLSPEGLKRMAANPVVF
FT                   ACSNPDPEISPELAHATRSDVIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKRINEEM
FT                   KIAAALALRDLAKLPVPAEVAAAYGVDSLEFGREYIIPKPMDPRLITLVSDAVAKAAIE
FT                   SGVATLPYPSHYPLQSVGDVFNG"
FT   gene            complement(613686..615920)
FT                   /gene="ponA"
FT                   /locus_tag="PST_0551"
FT   CDS_pept        complement(613686..615920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA"
FT                   /locus_tag="PST_0551"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="Code: M; COG: COG5009"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78257"
FT                   /db_xref="GOA:A4VH06"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH06"
FT                   /protein_id="ABP78257.1"
FT                   /translation="MRRSPIRFDDIPQAFIHALLAAEDDNFANHYGVDITGLMRAATQL
FT                   LKSGQIQTGGSTITMQVAKNYFLTSERSFSRKINEILLALQIERELSKNEILELYVNKI
FT                   YLGNRAYGIEAAAQVYYGKPISELSVAQLAMIAGLPKAPSAFNPLVNPARSKERRDWIL
FT                   GRMYRLGSLDESSYRQALAEPETARYHGATPELDASYIAEMARAEMVGRFGSAAYTDGF
FT                   RVYTTVSSERQIAANNALNSGLIEYDQRHGYRGPEANLANAPRDTWLQELAKYRSLSGL
FT                   QPAAVTQVETSGILVITRNGQEHTVSWDSMKWARPYLGINSMGPRPQRPADVVKVGDVV
FT                   RIRWQDEAAVFSQVPQAQAALVSLDPEDGSIEALAGGFSFGQSNYNRAIQAKRQPGSSF
FT                   KPFIYSAALDAGYTAASLVNDSPIVFVEQGMDRIWRPKNDNNTFLGPIRMREALYKSRN
FT                   LVSIRLLQTMGVDYTINYITRFGFNAQDLPRNLSLALGTATLTPMEIATGWTTFANGGY
FT                   KIEPYLIQRIEDREGNLLFEANPARVPPRETQTADVEVHPVQSNPVIADGEQMPAAPRF
FT                   AEQVLDERTAYIMTSMLQDVIKRGTGRRALALGRDDIAGKTGTTNDSIDSWFSGYNADL
FT                   VTTVWAGFDQPQSLGRNEYGGTVALPIWMNYMGAVLKDMPEHPPAEPDGLLKLRIDPVS
FT                   GRAATPSTPDAYFEVFKSEDSPPPMGEFDPGYQAPGSPLPADEAAPLDLF"
FT   mobile_element  complement(616403..617512)
FT                   /mobile_element_type="insertion sequence:RP3"
FT   gene            complement(616431..617468)
FT                   /locus_tag="PST_0552"
FT   CDS_pept        complement(616431..617468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0552"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78258"
FT                   /db_xref="GOA:A4VH07"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH07"
FT                   /protein_id="ABP78258.1"
FT                   /translation="MKIDARKLSPQEQREKRSTALRMREQGYTYKAIGEAVGVHPRTIA
FT                   HWAQVAEHKGEKAAIAGGQRGVRQGDRRSLSSSQEVLIRTLMTDKMPDQLKLGFALWTR
FT                   DAVRELIRQRCGFLMPVRTVGEYLKRWGYTPQRPLHRAYQQKPEVVQHWLDNEYPRIAQ
FT                   RARAENGEIQWGDETGMRSDSHAGRSYAPIGETPVRLVSGSRFSTNMISTVTNRGKLRF
FT                   MLYRETLTAPVLIRFLSRLIRDAQGRKVFLILDNLRVHHSKKVSAWVGDRKEQIELFFL
FT                   PAYAPELNPDEYLNCDLKHQVRTGLPARNQDELERRVRSVMRRLQLRPQRIRSYFRHPR
FT                   IAYAA"
FT   gene            617668..618462
FT                   /gene="pilM"
FT                   /locus_tag="PST_0553"
FT   CDS_pept        617668..618462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="PST_0553"
FT                   /product="type 4 fimbrial biogenesis protein PilM"
FT                   /note="Code: NU; COG: COG4972"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78259"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH08"
FT                   /protein_id="ABP78259.1"
FT                   /translation="MIEMDAGLSDEELENQLKIEADQYIPYPLEEVAIDFEVQGPAPRA
FT                   PGRVEVLLAACRKENVEIREAALALAGLTAKVVDVEAYALERSYGLLASQLGTGHGELT
FT                   VAVVDIGATMTTLSVLHNGRTIYTREQLFGGRQLTEEIQRRYGLSQEEAGLAKKQGGLP
FT                   DDYDSEVLLPFKEAVVQQVSRSLQFFFAAGQFHDVDCILLAGGTASIPGLDHMIQQKIG
FT                   TQTLVANPFADMALSGKVNAGALASDAPALMIACGLALRSFD"
FT   gene            618462..619034
FT                   /gene="pilN"
FT                   /locus_tag="PST_0554"
FT   CDS_pept        618462..619034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="PST_0554"
FT                   /product="type 4 fimbrial biogenesis protein PilN"
FT                   /note="Code: NU; COG: COG3166"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78260"
FT                   /db_xref="GOA:A4VH09"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH09"
FT                   /protein_id="ABP78260.1"
FT                   /translation="MAQINLLPWREQLREERKQRFLASLMGVLVVAAGLVFLGDRYFQG
FT                   AIEQQNARNEFIKKEIAVLDARIAEIKELRERRQQLLERMKIIQDLQGNRPIIGRVFDQ
FT                   LVRTLPDGVYFTSLKMTGKNIAIVGAAESNNRVSNLMRNLDGSDWLEAPNLNEVKAVTA
FT                   GAVDQENVFQLTVQQTQPGASTEGAKP"
FT   gene            619031..619654
FT                   /gene="pilO"
FT                   /locus_tag="PST_0555"
FT   CDS_pept        619031..619654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="PST_0555"
FT                   /product="type 4 fimbrial biogenesis protein PilO"
FT                   /note="Code: NU; COG: COG3167"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78261"
FT                   /db_xref="GOA:A4VH10"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH10"
FT                   /protein_id="ABP78261.1"
FT                   /translation="MSLAESLESLRKVDLADLDLNNLGSWPAPVKFITGVIVLAAVLGL
FT                   GYYFHLQDLQLQLEQHRAQEVTLKQQFSTKAFQAANLEAYKEQMAEMETSFGALLRQLP
FT                   SDTEVPGLLEDITRTGLGSGLEFEEIKLQPEVAQQFYIELPINIKVVGGYHDLATFVSG
FT                   VSSLPRIVTLHDFEIKPEKGDAANKLRMSIVAKTYRYNDKGLQK"
FT   gene            619651..620178
FT                   /gene="pilP"
FT                   /locus_tag="PST_0556"
FT   CDS_pept        619651..620178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="PST_0556"
FT                   /product="type 4 fimbrial biogenesis protein PilP"
FT                   /note="Code: NU; COG: COG3168"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78262"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH11"
FT                   /protein_id="ABP78262.1"
FT                   /translation="MKRARLTALGLSLAVISGCGGSSDFNDLQMYMDEVRTRPKGTIEP
FT                   LPAFIPYEAFTYSAAALRHPFQPPVKLDLAQRQRGSKDIQPDESRVKQFLEGFNIENFT
FT                   MVGTLANGGGRYALIKGGDGVHRVKIGDYLGRNHGRIVEISEAAVDVVEIVPDGEGGWL
FT                   ERPRSLTLKERT"
FT   gene            620193..622331
FT                   /gene="pilQ"
FT                   /locus_tag="PST_0557"
FT   CDS_pept        620193..622331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="PST_0557"
FT                   /product="type 4 fimbrial biogenesis protein PilQ"
FT                   /note="Code: U; COG: COG4796"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78263"
FT                   /db_xref="GOA:A4VH12"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH12"
FT                   /protein_id="ABP78263.1"
FT                   /translation="MENLYRSAQRKQLMNTTLSRLGVSLLAVFISPALLAANLNALDVA
FT                   ALPGDRVELKLAFDEPVASPRGYTLDQPARIALDLPGVSNNLGAKNRELGVGNARSVTV
FT                   VEAQGRTRLIVNLTALVPYSTRVDGNNLFVVLGEGSGTTSPAAASAAVTAPIAKPAPVK
FT                   PMAAGKAIDNIDFRRGEDGAGNVVITLSDPSVGSTIEEQGGKIRVVFAKAELPEALRVR
FT                   LDVQDFATPVKFVDSTAQAGGASIAIEPTGRYDYLAYQTDNKLTISVKPLTEEEADKRK
FT                   TDRFAYSGEKLSLNFQDIDVRSVLQLIADFTDLNLVASDTVSGNITLRLQNVPWDQALD
FT                   LVLKTKGLDKRQVGNVLLVAPADEIAARERQELESQRQIAELAPLRREVVQVNYAKAAD
FT                   IARLFQSVTNNGGVAEERGSIAVDDRTNNIIAYQTQERLDELRRIVAQLDIPVRQVMIE
FT                   ARIVEANVDYDKSLGVRWGGNLGAGNKWSAWGKNGNLDIEDGEDGGQQITWPMNTPFVD
FT                   MGAVGSTSGIGLGFVTDNAILDLQLSAMEKTGNGEVVSQPKVVTADKETAKILKGSEVP
FT                   YQEASSSGATSTSFKEAALSLEVTPQITPDNRIIMEVKVTKDEPDFSQAATTGVPAIRK
FT                   NEVNAKVLVTDGETIVIGGVFSNTQSKSVDKVPFLGDLPYLGRLFRRDLVQDRKSELLV
FT                   FITPRIMNNQSIQASRSY"
FT   gene            622416..622883
FT                   /gene="aroK"
FT                   /locus_tag="PST_0558"
FT   CDS_pept        622416..622883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="PST_0558"
FT                   /product="shikimate kinase"
FT                   /note="Code: E; COG: COG0703"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78264"
FT                   /db_xref="GOA:A4VH13"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH13"
FT                   /protein_id="ABP78264.1"
FT                   /translation="MPFKDSDKEIEQRTGASIPLIFDVEGEAGFRERERAVIADLCQQD
FT                   GVVLATGGGAVLREDNRKALRSGGRVVYLCTSVDQQLERTSRDRNRPLLQASDPRSVLA
FT                   ALMAIRDPLYRSIADIIIETDERPPRLVVMEILDRLASLPPRESQDESALS"
FT   gene            622907..624010
FT                   /gene="aroB"
FT                   /locus_tag="PST_0559"
FT   CDS_pept        622907..624010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="PST_0559"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="Code: E; COG: COG0337"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78265"
FT                   /db_xref="GOA:A4VH14"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4VH14"
FT                   /protein_id="ABP78265.1"
FT                   /translation="MQTLQVDLGERSYPIHIGERLIDRSDLFASKIRGRQVAIVTNETV
FT                   APLYLDRLTSTLSGYSVTPIILPDGESHKNWETLQLIFDALLGARHDRNTTVVALGGGV
FT                   IGDMAGFAAASYQRGVDFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPRAVVI
FT                   DTATLATLPSRELSAGLAEVIKYGLICDEPFLTWLEANIDRIRSLDSLALTEAIHRSCA
FT                   AKAKVVNADERESGVRATLNLGHTFGHAIETHMGYGVWLHGEAVSAGTVMALEMSSQLG
FT                   WIGQADRDRAIRLLQRAGLPVVPPAEMQPQDFLEHMAVDKKVLDGRLRLVLLRQMGEAV
FT                   VTGDFPRGVLETTLSADYGAMTEHLGA"
FT   gene            624021..625592
FT                   /locus_tag="PST_0560"
FT   CDS_pept        624021..625592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0560"
FT                   /product="type II secretory pathway, component ExeA
FT                   (predicted ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78266"
FT                   /db_xref="GOA:A4VH15"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH15"
FT                   /protein_id="ABP78266.1"
FT                   /translation="MNSLSADDAFLTHYGFSHDPFAARVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLLVTGPEGSGKTLLRQALVASSNKQAVQSVVVTPQSTMDASALLAQIAQALN
FT                   SQDADFDGIMAQVVQLALTGQEVYLLVDDAERLTGAAVETLLRLAAGTPEARPHVFLFG
FT                   EPALAGRLEALSEGEERHHAIALQPYEEDETREYLALRLEGAGSGIECLNEEQIARIHD
FT                   QSGGWPGAINQVARDELLAAMQSSRGRRKSTGMALPLPKKHLLAALAVIVVVAIGFLVL
FT                   RGGEGERSVAPQATQLPLDAPAGSSAASSEQGGQTAIEFDAEERPLSLPLGGDAQPVIR
FT                   EPLAAAAGGEDDAEVALPGARESTIPAPAPAPAPAPAPAPVERAQPAPPVATVPTPAPT
FT                   QAPAPASPQVRQNVAERTPAPTAAPSASGNRSWYASQPGSNYLVQILGTRVEKNAQAIV
FT                   QQHGASYRYFTKTHEGKPLYVVTYGNFANRAAAVAAVKSLPASLQAGKPWVRSFASVQQ
FT                   ELAPAR"
FT   gene            625766..630214
FT                   /gene="gltB"
FT                   /locus_tag="PST_0561"
FT   CDS_pept        625766..630214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="PST_0561"
FT                   /product="glutamate synthase large chain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78267"
FT                   /db_xref="GOA:A4VH16"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH16"
FT                   /protein_id="ABP78267.1"
FT                   /translation="MRAGLFRPEEFKDNCGFGLIAHMQGEASHHLLKTAIQSLTCMTHR
FT                   GGINADGKTGDGCGLLMQKPDAFLRAKALEHFNAELPAQYAVGMVFLDQDASKADRART
FT                   QLSEEIQAQGLTLVGWREVPVDTSVLGQLALERLPRIEQVFVSGEGLDERQFGIKLFFA
FT                   RRRAEVTLADDSAFYVCSLSDKDIIYKGLMMPADLAQFYPDLGDERLATAICVFHQRFS
FT                   TNTMPQWRLAQPFRFLAHNGEINTITGNRNWAQARRLKFANELLPDLESLSPLINRTGS
FT                   DSSSMDNMLELLVTGGMDLFRGLRMIIPPAWQNVETMDPDLRAFYEFNSMHMEPWDGPA
FT                   GVVLTDGRHAVCLLDRNGLRPARWVTTKNGYITLASEVGVWDYKPEDVLAKGRVGPGQI
FT                   LAVDTYTGKVLHTDDIDNHLKAQQPYKKWLRQNALRIQSTLDDNDHGSAFYDADQLKQY
FT                   MKMYQVTFEERDQVLRPLAEQGQEAVGSMGDDTPMAVLSRRVRSPYDYFRQQFAQVTNP
FT                   PIDPLREAIVMSLETCLGAERNVFEETAEHANRAILTTPVISPAKWRTIMNLERPGFER
FT                   LVIDLNYEEGTGLEAAIRNIADQAEEAVRGGKVLLVLSDRRIAPGKLPVHASLAVGAVH
FT                   HRLVETGLRCSCNILVETATARDPHHFAVLIGFGATAVYPFLAYEVLGDLIRTGEVLGD
FT                   LYEVFKHYRKGISKGLMKIISKMGISTIASYRGAQLFEAVGLSDEVVELSFRGVASRIK
FT                   GARFEDLEAEQKALAVEAWSSRKPIQQGGLLKFVYGGEYHAYNPDVVSALQLAVQSGDY
FT                   SRFKEYTALVDQRPVAMLRDLLKVKLADQPLALEEVEPLDAILKRFDSAGISLGALSPE
FT                   AHEAIAAAMNRIGARSNSGEGGEDPARYGTERSSKIKQVATGRFGVTPEYLVNAEVLQI
FT                   KVAQGAKPGEGGQLPGGKVNGLIARLRYAVPGVTLISPPPHHDIYSIEDLAQLIFDLKQ
FT                   VNPQALVSVKLVAEPGVGTIAAGVAKAYADLITISGYDGGTGASPLTSIRYAGSPWELG
FT                   LAETHQTLRGNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGTAPMIALGCKYLRI
FT                   CHLNNCATGVATQNEQLRKDHFIGTVDMVVNFFQFVAEETREWLAKLGVRSLGELIGRT
FT                   DLLEVLPGDTAKQNNLDLTPLLGGSNIPADKPQFCEVEKNPPFDQGLLAEEMVKLAKSA
FT                   IDAKSGGEFELEICNCDRSIGARVSGEIARQHGNQGMKDAPITFRFKGTAGQSFGVWNA
FT                   GGLNLYLEGDANDYVGKGMTGGKLVVTPPQGAAYRSQDSAIIGNTCLYGATGGKLFAAG
FT                   TAGERFAVRNSGAHAVVEGTGDHCCEYMTGGFVCVLGKTGHNFGSGMTGGFAYVLDMDN
FT                   SFVDRVNNELVNLQRITGEAMEAHRSHLQDVLREYVAETASEWGAELLDNLDDYLRRFW
FT                   LVKPKAANLASLLSSTRANPQ"
FT   gene            630271..631740
FT                   /gene="gltD"
FT                   /locus_tag="PST_0562"
FT   CDS_pept        630271..631740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="PST_0562"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="Code: ER; COG: COG0493"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78268"
FT                   /db_xref="GOA:A4VH17"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH17"
FT                   /protein_id="ABP78268.1"
FT                   /translation="MSCSRMYRLRPLLRGYEMTERLNNDFQFIEVGRKDPKKKLLRQRK
FT                   KEFVEIYEPFKPQQACEQAHRCLGCGNPYCEWKCPVHNYIPNWLKLVSEGNILAAAELA
FT                   HQTNTLPEVCGRVCPQDRLCEGACTLNDGFGAVTIGSVEKYIADTAFAMGWRPDMSKVK
FT                   PTGKKVAIIGAGPAGLGCADILVRNGVTPVVFDKNPEIGGLLTFGIPEFKLEKTVLSRR
FT                   REIFSGMGIEFRLNTEVGKDISIDQLLADYDAVFMGMGTYTYMKGGFPGEDLPGVYDAL
FT                   DFLIANVNRNLGFEKSAEDFIDMKGKKVVVLGGGDTAMDCNRTSIRQGAKSVTCAYRRD
FT                   AANMPGSRREVKNAKEEGVKFLFNRQPIAIVGEGKVEGVKVVETRLGAPDARGRRSPEP
FT                   IPGSEQVLPADAVVIAFGFRPSPAPWFEGQGIQLDNQGRVVAPERGQFKHQTSNPKIFA
FT                   GGDMVRGSDLVVTAIYEGRQAAEGIMDYLGV"
FT   gene            631841..632944
FT                   /gene="hemE"
FT                   /locus_tag="PST_0563"
FT   CDS_pept        631841..632944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="PST_0563"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /note="Code: H; COG: COG0407"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78269"
FT                   /db_xref="GOA:A4VH18"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH18"
FT                   /protein_id="ABP78269.1"
FT                   /translation="MRQCTALFRWNPAMTALKNDRFLRALLKQPVDVTPVWMMRQAGRY
FT                   LPEYRASRAKAGDFMSLCMNPELACEVTLQPLDRYPLDAAILFSDILTVPDAMGLGLYF
FT                   ETGEGPRFKKVVSSAADIEALPIPDPEKDLGYVMDAVRTIRRELNGRVPLIGFSGSPWT
FT                   LATYMVEGGSSKDFRKSKAMLYENPQAMHALLDKLAQSVTSYLNGQILAGAQAVQIFDS
FT                   WGGSLSAAAYQEFSLAYMRKIVDGLIREHDGRRVPVILFTKGGGLWLESMADAGAEALG
FT                   LDWTCDIGEARRRVGDKVALQGNMDPSVLYAKPDAIRAEVARILASFGHGNGHVFNLGH
FT                   GITPEVDPAHAGAFIESVHELSAQYHA"
FT   gene            complement(633003..634460)
FT                   /locus_tag="PST_0565"
FT   CDS_pept        complement(633003..634460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0565"
FT                   /product="major facilitator family transporter"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78270"
FT                   /db_xref="GOA:A4VH19"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH19"
FT                   /protein_id="ABP78270.1"
FT                   /translation="MRIPYESQNISFRSNNILDSLNKASYHFVHKPKQQQSRPSIEKAI
FT                   TGVTGRFWPEKANRTEVFIVSSTHDASDASAEIPAPGAPISHTEKGTPRFTRTALALFA
FT                   GGFATFALLYCVQPMMPMLSQAFGINAAQSSLILSLSTLTLAVGLLITGPISDAIGRKQ
FT                   VLVASLLAAAVFTVGSALAPSWHGVLLMRALVGLALSGVAAVAMTYLSEEIHPHHLGLA
FT                   MGLYIGGNAIGGMSGRLLSGVLVDYLSWHSVLGLMGGLALLAALLLWRFLPESRHFRPR
FT                   PLRPQGLLQGYRLHFRDAGLPWLFLQGFLLMGSFVTLYNYIGYRLIAEPFHLSQTMIGL
FT                   LAVLYLSGIYSSAQVGALADRFGRRRVFWLVIALMLAGVGLTLFDRLPLVLLGMLLFTF
FT                   GFFGAHSVASSWIGRRARQARGQASSLYLFSYYLGSSIAGTLGGVFWHAAGWDGVGLFI
FT                   ASLLLIAFAVALHLARLRPLPEPQTAH"
FT   gene            634459..635358
FT                   /locus_tag="PST_0564"
FT   CDS_pept        634459..635358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0564"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78271"
FT                   /db_xref="GOA:A4VH20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH20"
FT                   /protein_id="ABP78271.1"
FT                   /translation="MELRHLRYFVAVAEELHFGRAAEQLRISQPPLSQQIQALEQELGV
FT                   RLFDRTNRRVALTDAGRLFLEETRRTLAQVDKSVDVARRAEQGEIGELKVGFTSSAPFT
FT                   SILPRAILAFRRTFPAVHLDLQEMTSKQVVDAVQDETLQVGMIRPFALPAGLQTVELFS
FT                   EPLVALMHAGHRLADAGDEGLTLADLAEEPFVFFPRSYGTGLYDQLLSLARRAGFNPRI
FT                   AQEANEALTIIGLVAAGLGVSVLPASFQRIRIDGVRFLTLQDKDATTAVWLVKRRQEQS
FT                   PLAQAFMELVTREASAQR"
FT   gene            complement(635367..635657)
FT                   /locus_tag="PST_0566"
FT   CDS_pept        complement(635367..635657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78272"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH21"
FT                   /protein_id="ABP78272.1"
FT                   /translation="MFGKSSHTFEINYIYQNDPRAETYDADVDSLSQGEAARHLIQLHN
FT                   ADAENSLVMPKADADEAQLLEQAEVLGITDIRVTRVHKHEKGDTPGHYKQP"
FT   gene            complement(635735..636172)
FT                   /gene="trxC"
FT                   /locus_tag="PST_0567"
FT   CDS_pept        complement(635735..636172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxC"
FT                   /locus_tag="PST_0567"
FT                   /product="thioredoxin 2"
FT                   /note="Code: OC; COG: COG0526"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78273"
FT                   /db_xref="GOA:A4VH22"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH22"
FT                   /protein_id="ABP78273.1"
FT                   /translation="MTDSLIVPCAQCASLNRIPAARVHDAPRCGRCKSEALPDQPFELQ
FT                   QSQFANQIKGDLPLLVDVWASWCGPCRSFAPTFAQAARQLQGRCRLAKLDSEANAQLST
FT                   QLGIRSIPSLILFRDGREVARQSGAMPLPQLLAWLAQQGVR"
FT   gene            complement(636241..637518)
FT                   /gene="metY"
FT                   /locus_tag="PST_0568"
FT   CDS_pept        complement(636241..637518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="PST_0568"
FT                   /product="homocysteine synthase"
FT                   /note="Code: E; COG: COG2873"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78274"
FT                   /db_xref="GOA:A4VH23"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH23"
FT                   /protein_id="ABP78274.1"
FT                   /translation="MKLETLAIHAGYSPDPTTRAVAVPIYQTTSYAFDDTQHGADLFDL
FT                   KVPGNIYTRIMNPTTDVLEQRVAALEGGVAALAVASGMAAITYAIQTIAEVGDNIVSVA
FT                   KLYGGTYNLFAHTLPRQGIEVRFAAHDDIAALEALIDDRTKAVFCESIGNPAGNVIDLA
FT                   ALAEAAHRHGVPLIVDNTVATPMLCRPFEHGADIVVHSLTKYMGGHGTSIGGIVVDSGK
FT                   FPWAQHKERFALLNTPDVSYHGVTYTEAFGPAAFIGRCRVVPLRNMGAAISPFNSFLIL
FT                   QGLETLALRMERHCENALKVAEFLQAHPQVAWVKYAGLPDHPEHELARRYMGGTPASIL
FT                   CFGIEGGMEAGARFIDALKLVVRLVNIGDAKSLACHPASTTHRQLNAEELARAGVSQDL
FT                   IRLSIGIEHIDDILADLAQALSASRG"
FT   gene            complement(637611..639407)
FT                   /locus_tag="PST_0569"
FT   CDS_pept        complement(637611..639407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0569"
FT                   /product="transporter sodium/sulfate symporter family"
FT                   /note="Code: P; COG: COG0471"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78275"
FT                   /db_xref="GOA:A4VH24"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH24"
FT                   /protein_id="ABP78275.1"
FT                   /translation="MSMFPESLPLLFVCALLIWVLVAFIRESWSPDIVVAIAVAVLLAT
FT                   QLLTPGEVLGVLSNSAPVTIACMFIISAALERTGCIDALGTWLGDLVGTSPTRVLFGLT
FT                   ITALVISACLNNTPVVAILTPVAISLAKRAGTTPSKLLIPLSYATILGGTLTMIGTSTN
FT                   ILVDGVARKAGLAPFGMFEITAAGLIMAAAGMIYLLTVGRHLLPERDTLSKLLGPRLDR
FT                   NFMTELRVPLNSPVIGKTIAEANLNGGSGLQVLQVNRDSQLFSRPEHDFVLSAGDLLMI
FT                   HGQVKDVVELRESGHLTFNRGDAFETISSEDVILAEAIVGRGSRYSHRPMRDLDLSARY
FT                   GISVLAVHRQDENIQGNFDDFQLQFGDVMLVEGTPAQIKRFADNGELISLNAVQERAFR
FT                   RDKAPIAIIATLAVMGLAAFGVMPIEGLAIIGAATVLATRCLDVEDAYKAVDWKILSLI
FT                   FGMLAISIAMDKVGLVQLIVQNVTTVTPWAGPLFMLSFIYLLTSLLTEMLSNNAVAVLI
FT                   TPIAIGLAQHLGVDPRAFVVAVMFAASASFATPIGYQTNTFVYNAGGYRFADFLKIGIP
FT                   LNLLLWLVGTLVIPLFWPLTPI"
FT   gene            639817..641280
FT                   /locus_tag="PST_0570"
FT   CDS_pept        639817..641280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78276"
FT                   /db_xref="GOA:A4VH25"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH25"
FT                   /protein_id="ABP78276.1"
FT                   /translation="MAEASGKTSSRKFVTDVELKALRPGQTATDSLPGRGSGSILFECR
FT                   TSGAVEAYYRRRGEGGQKVKIGVFKKTPKSPGLSLTEIREQAVRLAKIAADHGDIKAYQ
FT                   AKCAAEEEARQAELQRQLHEQQRLAEIEAAKGTFSELFRDYIEDRRRSGVSAQQIDEFE
FT                   RVLRNDLEGEKVVSVADDGQEQRLNVMAMKAKDVRPEHVNLLLKPIWDRGAGRQTGKVR
FT                   SFLVAAFSFGLKAEHHIDRSSNKSYGLQMNPADPVTVPNTSKPGERALTDKELKQFWHT
FT                   ITKVDSVGAIMARVFHFAFATAGQRPLQFIREPWTSYNFQKKYLKIIDSKGRGSKKRAH
FT                   FVPLSSRALQILEQVRALQPPGAVYPWSVGGQKPIHASSLSHAVTEWFATEHAKLDGQP
FT                   VPKFTPRDIRRTCTQFMQRHGIKDFDSDALQSHGQTGVVEVHYRNNPEAKLPQMRPTME
FT                   AFDAALSRLLDSPDEDEYQAEQLDLFEKG"
FT   gene            641930..642586
FT                   /locus_tag="PST_0571"
FT   CDS_pept        641930..642586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78277"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH26"
FT                   /protein_id="ABP78277.1"
FT                   /translation="MFRRPIHDEVMGLASRLADKCHPQVAQKHADELARYARLTSACTA
FT                   LESFSGCRPRMDDDAFDVLARRRSQVADLIAHANLHAYEQEAPEGLYLAIPFFSRCSDK
FT                   QPVWLLNRTAQSVTYLRRQLYAYASTDDGIDEYQTAGNAFADGIAASSVIEPWGGLQID
FT                   DYSMSFDGDFVSNRRVILLIDGVRSEWFTSISKLGGYLWDEALHGLHALKKVKEL"
FT   gene            642591..643268
FT                   /locus_tag="PST_0572"
FT   CDS_pept        642591..643268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78278"
FT                   /db_xref="GOA:A4VH27"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH27"
FT                   /protein_id="ABP78278.1"
FT                   /translation="MFGAVDYRIFSSSDAQTAGVPVPLVQVSLGEAGAQYGPGASGEVF
FT                   VRGPNVFQGYLTAEGVVGNPEGGWFASGDLGEVTANGELRIVGRAKDVIIRSGHNIDPQ
FT                   MIEEAALGGLFAWFIWANFYAPWWRLVDDRVIKAPSALLSILEDSAELEMHRDSEGQQW
FT                   TRFVRFSADCPICSGRVLLMPGKPDQALPIVGRCIESPYTHVYSFDRVRLSGTYLGCEV
FT                   PMV"
FT   mobile_element  643400..645086
FT                   /mobile_element_type="insertion sequence:RP2"
FT   gene            643474..644904
FT                   /locus_tag="PST_0573"
FT   CDS_pept        643474..644904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: L; COG: COG3666"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78279"
FT                   /db_xref="GOA:A4VH28"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH28"
FT                   /protein_id="ABP78279.1"
FT                   /translation="MKRFIQGEHRGQSTLLPESLNDYVTDTNPVRVVDVFVDELDLGQL
FT                   GFDGVIPAETGRPAYHPADLLKIYIYGYLNRIQSSRRLEREAQRNVELMWLTGRLMPDF
FT                   KTIANFRKDNGKAIRGVCRQFVVLCQQLGLFAEALVAIDGSKFKAVNNRDRNFTSAKLQ
FT                   RRMEEIESSISRYLTALDTADRQEPVVAQAKAERLHSKIAALKTKMQELRDIGAQLESA
FT                   PDKQISLTDPDARSMMTRGTGLVGYNVQAAVDTKHHLIVTHEVTNNGVDRDQLSAMAKQ
FT                   ARDAMGVESLSVVADRGYFKSEEILACHEVGITTFVPKAKTSAAAAAGRFGRDDFIYDA
FT                   AHDEYRCPAGERLVWRFSTVEKGLKLHRYWSSHCQGCALKDQCTPSAQRRVSRWEHESV
FT                   LDAMQSRLDQAPEMMRIRRQTVEHPFGTLKAWMGATHFLTKTLDRVSTEMSLHVLAYNF
FT                   KRVLNLLGNSALMAAMRA"
FT   gene            complement(645151..646140)
FT                   /locus_tag="PST_0574"
FT   CDS_pept        complement(645151..646140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0574"
FT                   /product="sodium:bile acid symporter family protein"
FT                   /note="Code: P; COG: COG0798"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78280"
FT                   /db_xref="GOA:A4VH29"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH29"
FT                   /protein_id="ABP78280.1"
FT                   /translation="MTRDALEQNQVPIYFVAVIVAAIGGLLAPNTAQGLSVLVTPTIAV
FT                   LMYAMFLQIPFLNLKDGMRNKPFMAALLVANFVLIPLLVWGLTRFLDGHPAILIGVLLV
FT                   LLTPCIDYVVVFTHIGRGDSRLILSATPILLLLQLALLPLYLGLMLSDTSGVVVSIGPF
FT                   VEAFLALTMAPLILALLTEALVKRSAAVKTWADAWAWLPVPAMAAVLIAVVGSQIAPVV
FT                   NEIGRLAPVLPIYIAFAFLAPVIGALVSKVCKLPVRSARAVIFSSSTRNSLVVLPLALA
FT                   LPEQLRGLAAAAVITQTLVELVAELVYVRAVPAFLCRDRAETSEPLNG"
FT   gene            646564..646878
FT                   /locus_tag="PST_0575"
FT   CDS_pept        646564..646878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78281"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH30"
FT                   /protein_id="ABP78281.1"
FT                   /translation="MALLLVMGWHMSSLLVGAEPQAGFKSESTHSSLLTEAAPSCVFCA
FT                   GHRHSPMTADHVHETPYLGPLLILPAQAESNILATLPDQAAPTRPVYLIERPPRSSRVI
FT                   "
FT   gene            647120..647563
FT                   /locus_tag="PST_0576"
FT   CDS_pept        647120..647563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0576"
FT                   /product="disulfide bond formation protein"
FT                   /note="Code: O; COG: COG1495"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78282"
FT                   /db_xref="GOA:A4VH31"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH31"
FT                   /protein_id="ABP78282.1"
FT                   /translation="MMETETNTRFPSPWSLLLMAWGIALVSTLAALFIGEVMGKTPCVL
FT                   CWFQRAFMFPLVVILAVGCYTSDFGVWRYALPVTVVGGLIALYHSLLYFGAIPESIKPC
FT                   GAGPSCSSADMTIFGSVPLPLLSLVAFTLIAVLLVLIRRRSSL"
FT   gene            647732..648169
FT                   /locus_tag="PST_0577"
FT   CDS_pept        647732..648169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78283"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH32"
FT                   /protein_id="ABP78283.1"
FT                   /translation="MAESHVVSGLVAKRSEVSGLISHYQHEIARLQGDMQHLDATIKLF
FT                   DPEYDLRTIRPKQVRQSSRLFANGECHRLMLEALREMGGQGSTGEIAQRIHACKGFEED
FT                   ALKAVHHGLDAVLRRAASSGLLVKVGRNESGNLWKLADLAQ"
FT   gene            complement(648163..649170)
FT                   /locus_tag="PST_0578"
FT   CDS_pept        complement(648163..649170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0578"
FT                   /product="conserved possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78284"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH33"
FT                   /protein_id="ABP78284.1"
FT                   /translation="MSQHFLLSAQARTLSLRKIYSLSDDQAFEMFKQSCWGHHDAICPC
FT                   CGSMAKHYFIKTRRQWRCRDCNHTFSVTSGTIFASHKLPLKVYLAAIAIYCNAVKGLSA
FT                   LQLARDLDVQYKTAFVLAHKIRESLMAQRDETELDGEVELDGAYVNGHVRPKNKKADRV
FT                   DRRLAENQKADKRCVFVMRSRAESGQGGKRTLTFVMKSEHQAGVLKLAGRFIRKGTTVF
FT                   ADEAPAYDPLHAYFPTNRVNHQVEYRSDDGVTTNMAESYFSRFRRMQYGQVHKFGIMYL
FT                   NHYANEAAYREDNRRMSNGEMFFDILMKCAETRTSRDFGGYWQGNKRLMEHLVH"
FT   gene            649194..649517
FT                   /locus_tag="PST_0579"
FT   CDS_pept        649194..649517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0579"
FT                   /product="GMP synthase, PP-ATPase domain/subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78285"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH34"
FT                   /protein_id="ABP78285.1"
FT                   /translation="MWIICHICALSNLYLGKYPFCGRVFFINSEVAMNEQTWNQRATNL
FT                   LKSQMVLAGVNYEELIQRLAAIGVDESYKGIANKINRGTFSFVFFMQCMKALGVKETLK
FT                   KTF"
FT   gene            649875..651389
FT                   /locus_tag="PST_0580"
FT   CDS_pept        649875..651389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0580"
FT                   /product="ISPsy14, transposase"
FT                   /note="Code: L; COG: COG4584"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78286"
FT                   /db_xref="GOA:A4VH35"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH35"
FT                   /protein_id="ABP78286.1"
FT                   /translation="MRKIREVLRLKFDCGLSVRKIARSLGTGHSSAGDYLCRFAASGLS
FT                   WPCSLSDAELEQQLFPPAPAVASEKRPLPDWAWVHAELRRPGVTLALLWQEYRLSQPQG
FT                   FQYSWFCEHYRAWQGKLDVVMRQEHRVGEKLFVDYAGQTVPVIDRHSGEIRQAQVFVAV
FT                   LGASSYTFAEATWSQQLPDWLGSHTRCFAFLGGVPEIVVPDNLRSAVSKAHRYEPDINP
FT                   SYRDLAEHYGVAVVPARARKPRDKAKAEVGVQVVERWILAALRNRQFFSLDELNSAIAG
FT                   LLERLNRRPFRRLPGSRHSAFEALDRPALRPLPEQPYVYAEWKKARVHIDYHVEVDGHY
FT                   YSVPYQLVKKQLEVRLTARTVECFHANQRGASHLRSMHKGRHSTQAEHMPKSHREHAEW
FT                   TPQRLIRWAEQTGPSTAGVIRHILERRIHPQQGYRACLGILRLGKTHGEVRLELACRRA
FT                   ISLGACSYKSLESILRQGLENLPLAQQHLPLLPDDHANLRGPGYYH"
FT   mobile_element  650246..650726
FT                   /mobile_element_type="insertion sequence:RP6"
FT                   /note="fragment"
FT   gene            651407..652162
FT                   /locus_tag="PST_0581"
FT   CDS_pept        651407..652162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0581"
FT                   /product="ISPsy14, transposition helper protein"
FT                   /note="Code: L; COG: COG1484"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78287"
FT                   /db_xref="GOA:A4VH36"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH36"
FT                   /protein_id="ABP78287.1"
FT                   /translation="MLPHPTLDKLQTLRLHGMLKALNEQLKTPEIDSLSFEERLGLLVD
FT                   RELTERDDKRLSSRLRQARLKHNACLEDIDYRSPRGLDKALILQLSSGQWLRDGLNLII
FT                   GGPTGVGKTWLACALAHQACREGYSVRYLRLPRLLEELGLAHGDGRFAKLMSSYAKTDL
FT                   LILDDWGLAPFTAEQRRDMLELLDDRYGQRSTIVTSQMPVDNWHELIGDPTLADAILDR
FT                   LVHNAYRINLKGESMRKRTQKLTTPGTSD"
FT   mobile_element  651501..652119
FT                   /mobile_element_type="insertion sequence:RP6"
FT                   /note="fragment"
FT   gene            652729..655167
FT                   /locus_tag="PST_0582"
FT   CDS_pept        652729..655167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0582"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="Code: L; COG: COG1643"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78288"
FT                   /db_xref="GOA:A4VH37"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH37"
FT                   /protein_id="ABP78288.1"
FT                   /translation="MADHESVVLQAPPGAGKTTRVPLALLNEAWLGGQSILMLQPRRVA
FT                   ARAAAERMASELGEKVGETVGYRIRLESRVGPNTRIEVVTEGILSRRLQDDPSLEGVGL
FT                   VIFDEFHLRSLDSDLALALCLNGRELFRDDQPLKLLVMSATLEGARLSNLLGDAPVVTS
FT                   EGRMFPVDTVWGQPYQTGEYIEPKVVRACLDAVHDQQGSILIFLPGQAEIRRVHQDLSD
FT                   KLAERDDLLLCALHGELDLNAQRAAIEPAPPGQRKIVLATNIAETSLTIEGVRVVIDSG
FT                   LERVPRFDPVSGMTRLATQRISQASAAQRAGRAGRLEPGICYRLWSQTQHEQMAAYGAP
FT                   EIHQADLAALALQLARWGVTPDQLRWLDMPPAAPFTQARDLLGRLGALEADGRLSSHGQ
FT                   AMAEVPAHPRIAHLLLRGHALGLGPLACDVAALLGERDVLPGGGADLHSRLAMLEGSQR
FT                   MSRHAQGAAQRIKQLARQYRSYQRGSVTEAVADPEHPRWLGCLLALAYPDRVAQQRRAG
FT                   GGEYRLANGRAAIFTEPDALMKHSWLVVAELGSRQGQREERIYLATDLDPSLFENVLAE
FT                   QVTVVDELDWDDRAGALVAERQRKVGELVLSREPLKELDADARSRALLGLVRKKGLELL
FT                   PWTSELRQWQARVALLRELDMAQQGQSKWPCFRDDTLLATLEEWLLPYLNNVSRLSHFS
FT                   LLDLGSILRGALPWPLPQELDELAPTHIKVPSGSSIKLDYSESPPVLAVRLQEMFGLAD
FT                   TPRIAGGKLPIKLHLLSPARRPVQVTQDLANFWRSTYLEVKKDLKGRYPKLSRNMRAAA
FT                   "
FT   gene            655454..657949
FT                   /locus_tag="PST_0583"
FT   CDS_pept        655454..657949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0583"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="Code: L; COG: COG1643"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78289"
FT                   /db_xref="GOA:A4VH38"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH38"
FT                   /protein_id="ABP78289.1"
FT                   /translation="MPGLLQAFQERDEVVLQAPPGAGKTTRVPLALLDEPWLQGQTIIM
FT                   LEPRRLAARAAAERMAAELGERVGDTVGYRIRLESKVSSSTRIEVVTEGILARRLQEDP
FT                   SLDGVGLVIFDEYHLRNLDADLALALTLHGRELFRDALPLKVLLMSATLEGERLSRLLN
FT                   DAPIVTSEGRMYPVTTIWGKPQQPGDFTEPRVIATCLDALEEQSGSVLIFLPGQAEIRR
FT                   VHQGLQDNLQRRQDILLCPLHGELDLSAQRAAIDPAPPGKRKVVLATNIAETSVTIDGV
FT                   RVVIDAGLERVPRFDPRSGMTRLDTQRISKASATQRAGRAGRLEPGCCYRLWSEAQHEQ
FT                   LAGFSTPEIQQADLAGLALQLARWGVLPSDLRWLDTPPTAAYAQACVLLRRLGALDHAQ
FT                   RLTTHGRDMAELPAHPRIAHLLLRGHALGLTNQASDIAALLGERDIQRGGGADLHSRLA
FT                   MLAQEHRASRDDQGKVQRARQLARQYRSYLRGPVTEAVGDPDQPKWIGALLALAYPDRI
FT                   AQQRRAGGAEYRLANGRAALFAEPDALMKHSWLVIADLGSRQGQREERIYLAADLAPAL
FT                   FETVLKDQVSQLDELDWDEREGVLRAERQLKIGELILSSVPLVTLDDSARIKALENYVQ
FT                   RKGLELLPWTAELRQWQLRVALLRSLDVDRDGVSEWPDLSDSKLLASLDVWLAPYIGKV
FT                   TRLSHFGQLDLSSILRNLLPWPLPQQLESQAPQTITVPSGSNIRIDYSEQPPILAVRLQ
FT                   ELFGLSDTPRIASGRQVLKLHLLSPARRPVQVTQDLANFWRSTYNEVKKDLKGRYPKHH
FT                   WPDNPLEAEATARAKPKGT"
FT   gene            complement(658167..659201)
FT                   /locus_tag="PST_0584"
FT   CDS_pept        complement(658167..659201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78290"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH39"
FT                   /protein_id="ABP78290.1"
FT                   /translation="MSDLKRIINLHMSFASDMRDYLERNISCWHETLRSLQTRFWYEAL
FT                   SQRTGLNTAYELERHFEPSSFTFNDDGTIEYYKNKWTGYRQGQHRPMPPQRELVEKKAP
FT                   GSTRELLHPLWSALDLNDKRVMREDAFLRQLLPPIQEVMFKPGSSGVLGYTTRASITQR
FT                   LLDKLERRASMDVLACLTWLLREAAEKQCASAQLIGHALHNVLTMMALELHALKIALPL
FT                   LQIFIDQILPLGLPQHYRAGMTPGDYVNASGYLNRIVYTTTKGRKRKLDWDQRGKIMQQ
FT                   LIQGKSGWSVKYAMMPQYELDDGGEELPADVIEAHSLASKRREWGWDCLLTGKEGRMPP
FT                   VEVL"
FT   gene            659398..660759
FT                   /locus_tag="PST_0585"
FT   CDS_pept        659398..660759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0585"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78291"
FT                   /db_xref="GOA:A4VH40"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH40"
FT                   /protein_id="ABP78291.1"
FT                   /translation="MTLEGAAREVYQVDEIGSGNDLDIFHFPFLFCAKGDPWQEANSYL
FT                   LWLMRDKAPRNRRTDDVRRRASKLLDYLLFCEDNNLDWLDFSGARPPLRPTYRYFYHLI
FT                   NEGTRSNQVINQYTSAIYFFYKYVSEHWHDLDMKRVDTIKQVRLIVQGSKGVKVVDAEK
FT                   RSQTRRTPPVSSVPLGFVREYGEDLRPLSNRELGAFLAAIRNETEWSAVERLIQMIALM
FT                   TGARKQTVLTMRLKHLKGFTEDKLEREGAYKLHAGPRTGIDTKYDKPQVLYVPKQLAEE
FT                   LVTLAKSPMMRTRREKFRAQLEASHPGLSVAEDDMYLFLSDQGNSYYMAKSDPRYTVVK
FT                   SPQTGQVTETIKRKLIQKASSPFPKDFSYHWLRATFAYQLYQRLQPLVQEGAMKHGEDI
FT                   DFIQKRMHHESRETTENYLKLFKMTHEKVIAQEIWEGKLFNGSYAVLKVEAHDE"
FT   gene            660752..662686
FT                   /locus_tag="PST_0586"
FT   CDS_pept        660752..662686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78292"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH41"
FT                   /protein_id="ABP78292.1"
FT                   /translation="MNSRQQFEHRANTQIITLSEVTQEFAEPERLRLQLSSKLRKKPFD
FT                   IGSFAYVIRVKNESVWDDRGTPVVIESFVESRRELIVRLLESFVGQRDSTVLTRLNGIE
FT                   YFIDWLNTQGYREVFASAAQAQQAYRDYTSHLNHQVAHQVWKPISAKGIQGFVSQTIEL
FT                   LYPEDSRHILGGAVTIIAEKGSEAASAAHVEVYRDVCLAIARQCSAFVLNAQPYPVVVT
FT                   VRDYEVVGFPSSLGWVGPFKESPLSYNAGERRIATVEEYWAAADKLGRKRRPKSWLEHE
FT                   LALAQANVDAANEDDHHRHRLQVAGLAVKAYASLFLMITGATPTEFDQFSYADALAVEK
FT                   SPIKKELSAVKFRAGGKATLYNIGQYTGLPLLKEYLKLREWILNGVEHERLFFTMPMIN
FT                   KQVSTNNEFSEFNTSALLSNFFTSISGTFLNPKVPKLSPRKMRKHKSLGMHTAGVSPST
FT                   VAASLNHSEEVNLSTYSEATPEQQEAEFGQFWQAMHHAAKVVRDRSQRPAEGEIATAAG
FT                   HCDGFNKPIHVRDLGAVAIEPNCRSQYGCLYCEHYICHSDEEDLHKLASLQYVINAVRK
FT                   AAPDAAHAEALYKELSIRIEFILEALGERSDAVKQLVEAIKARVFEYGELTLFWESRLS
FT                   RYEKMGVVF"
FT   gene            662683..664731
FT                   /locus_tag="PST_0587"
FT   CDS_pept        662683..664731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0587"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78293"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH42"
FT                   /protein_id="ABP78293.1"
FT                   /translation="MNAVVHSIGSLFSSGQFPHTSEPDNAPQLYGKPAPDFVLCRDEHG
FT                   NATAVYGCAVWDFNAYRLSATKLSRILFDAVLDESGQEQQALIEEAKYLLYCLIYFAGG
FT                   GRIGRLSAGTLNQYWIVLRAAMQFCYEQKKKPMVGVLSLQQLFTVPVYLAAFIHSNSFD
FT                   KTSLAGILRGLARVGEERLGYASLNPANFDLTRPEYKQHPVIPTRIYLNLINLTGDLLD
FT                   QLYEGVGRFESFVACFDDEYYGFAHSAQKSRGLGGKAHWRPDMAQAIKDHDLASVFVGE
FT                   FECPHKINLQRVLLQMQYVAKTVIHLYTGMRDQEVMRMPYHCLSDQVVRQAVVDDKGIE
FT                   RDKPQSVNVLSTTTKFSGYKKEGAWFSPGEVVKAVEVAQAICRGLAKLYKIELDARCPL
FT                   FLNPAIVGSTRNNAEVGVPRFMGRSTQGTALHSLSIQAEDLQELAQSDPSRDFYSEPAF
FT                   AVGQPWPLTSHQFRRSLAFYGSSSGFLSLPTVRVQFKHMTIQMARYYANGFDNLRTIFG
FT                   YYDEKKKDFVLPSSHFAFEFQMAMPMSVANQLIADLVFNEEPLFGGTGSYMERQKERVK
FT                   AGEIQIEDVRADTEKRAKNGEISYHPTLLGGCTKVGRCNSFMLGDYTECTGCDGAIIER
FT                   KKLVAAIEDARDELSNYSEDSGEYQIVKAELDRLVAFKARLIDSVEV"
FT   gene            664734..665201
FT                   /locus_tag="PST_0588"
FT   CDS_pept        664734..665201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78294"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH43"
FT                   /protein_id="ABP78294.1"
FT                   /translation="MKSGGGASKGLSACEEALQRLLVWKPVVPEHVGLDLSKLTASIVS
FT                   LEAGFDRGYLKRSRKAHLPLLAQIEAARAEASKGAGSSSGKQIRQMESQLAAVEKKLSI
FT                   AQMQRGNVLAQNIKLWQRVRELERSMADSRSAKVEPLLRNCNDMTIKLHST"
FT   gene            complement(665372..666295)
FT                   /locus_tag="PST_0589"
FT   CDS_pept        complement(665372..666295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78295"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH44"
FT                   /protein_id="ABP78295.1"
FT                   /translation="MSRKRPPEERILVLARDQRRKYGARLTFQVQRPEYIGGLENVTLL
FT                   IDDGALATIEPGRVLSWEGGQRYHIEVVGFPTASDAEEAGMRTAQSLLLTAVSLNFGLR
FT                   LNYHSHEPPTVFDRTVSTGVSAWGEGFAFWPQEVVLKELTQTLAVPLRDRRLLLSMELF
FT                   VAAGLESNDRAKFVMAVSALEPLAAQQELGPDVAAVIDDLARRLAGESAISDDLRNSLR
FT                   GRLLQLKRESIRQALKRLSAVWLPGDQDAWRDLDRAYALRSELLHEGRPNDLDILLSEE
FT                   TRKVSNLLRRIYQQAFEYKLHSPIAT"
FT   gene            complement(666411..666701)
FT                   /locus_tag="PST_0590"
FT   CDS_pept        complement(666411..666701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78296"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH45"
FT                   /protein_id="ABP78296.1"
FT                   /translation="MNMAVYIVTWNLNKERGNYDAARREFLQCLEHYDNTKDSGLESVR
FT                   WVSTTRSVNDVEADLRTKLDANDRIFVSQVTNGNHQGWLDKQVWDWINARH"
FT   gene            complement(667142..668665)
FT                   /locus_tag="PST_0591"
FT   CDS_pept        complement(667142..668665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78297"
FT                   /db_xref="GOA:A4VH46"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR041327"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH46"
FT                   /protein_id="ABP78297.1"
FT                   /translation="MANLENEFILIAGSISKKTEKASIDLAHDFTRAVTKSVLAAKGGL
FT                   VVYLTGLPTNEAGDALTFDWTVAYEAEKLLAEYAPARQLKIVTSQLAMRDKMTLEQRTL
FT                   IRRLSAENFAEIVYIEDDLVTGGNIGDEQVEVATAMIALGGGKGVSDRARKMRKQKLPV
FT                   LPFDLQLGGFSEDGEGARGLQDAFFREPFMMFPFTGEQVKGRLDSMSLQEPLYSLDKLA
FT                   ELSVGLFKAEIEAREAARSPDLLVITAIAIELAAAKKVFGIGEDVPARYSKHGIHFWPV
FT                   TIQRADGPLSCVVASLGNAGNVNASAITTLLLSELNPNKVLMMGIAGGRRKKLSLGEVI
FT                   LSERVVYYEGAAAHAGGKIALRPEMQRPGLSTQQDLNAYFATASLPDRLQERAEKLGFA
FT                   IPVESTAGDVAARLMVSPATIASGELLIRDPEIFESFQGIHDKALVAEMEAYGVFDACE
FT                   KQNVPVLVVRGISDFGDTTKDNTFHRVASEAAAIVTLDYATHGWSRRAM"
FT   gene            complement(668716..669672)
FT                   /locus_tag="PST_0592"
FT   CDS_pept        complement(668716..669672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0592"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG2378"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78298"
FT                   /db_xref="InterPro:IPR016634"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH47"
FT                   /protein_id="ABP78298.1"
FT                   /translation="MITIRIVSRCSLIFIRYRGSIMTNESKPTDDQPTSKGGARWGQER
FT                   RLEFIDYRLRWDGQINRSSLTDFFGISVPQASLDITEYAKLSESNLEYDTRARVYRATE
FT                   SFKAVFKSSAVERYLEDLLRVAVQPEVPYGSFLGWQSPVAGIPKLGRRLNAGIVGEILR
FT                   AIREKGSVEVFYQSMTDPEGGERKLSPHALVHDGNRWHARAYCHRREAFRDFSLTRIKR
FT                   CCYAGPDRERASEDTPWNTMVDVVLTAHPDLSPAKRGLIESDYLMENGEMHIECRQALL
FT                   MYLLFQLNLTEDQAGQKPEVIQVALKHPEEIRALLKY"
FT   gene            669867..670811
FT                   /locus_tag="PST_0593"
FT   CDS_pept        669867..670811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0593"
FT                   /product="probable nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78299"
FT                   /db_xref="GOA:A4VH48"
FT                   /db_xref="InterPro:IPR026774"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH48"
FT                   /protein_id="ABP78299.1"
FT                   /translation="MPLTNTQIKYYDSNVLRLSKDKRETYNAQVDRLIAALKDSLKKQD
FT                   KITIKKVVKAGSFAKHTILRPSAQNPADVDVVFYISGQKVDEETFATLSQKIYDALIKL
FT                   YPNKSVEDFEIQRKAAKVTFVGTGLEVDIVPVIENPNKENYGWQFDRIDGSKTETCAPC
FT                   QVNFVKVRKDEDPDFRTLVRLAKRWRTWKEVPLKSFHIELIMAHVLELKGKTGSLEKRF
FT                   RDFLLYIADSGLKDVIKFPENKQVPDFSDTVVIIDPVCDTNNVASRISEEERQEIVQLA
FT                   EESWETAHFASVEDDFEIWKELFGKGFKVEDAA"
FT   gene            670808..671299
FT                   /locus_tag="PST_0594"
FT   CDS_pept        670808..671299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78300"
FT                   /db_xref="InterPro:IPR041162"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH49"
FT                   /protein_id="ABP78300.1"
FT                   /translation="MSYSATQTTTYTTTDIEAVVRRITADLLMIASSSEAVTEVKAKEW
FT                   ANDIELLAKNGYLKFADLTLLSHGVEQKATRFYVNESGSLANQRPGDARWPKVQGAHLR
FT                   IVLSYNDSYTQQAQEKMSGKLKINWTTSYDDISHSQLTQSGGREYSSNGYGMERKDYIR
FT                   "
FT   gene            671296..672192
FT                   /locus_tag="PST_0595"
FT   CDS_pept        671296..672192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0595"
FT                   /product="probable ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78301"
FT                   /db_xref="GOA:A4VH50"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH50"
FT                   /protein_id="ABP78301.1"
FT                   /translation="MSNNSVFDSVIELPEAQLTEREKVLLGFVGRYERVQNQLQLLLNQ
FT                   GQLSEWSMAHHKSVLPICNLVADQYPLVIFHGDVGTGKTATAECIANRIVRDSRTEDSV
FT                   LFKLSNRVRGSGKVGEMGTLLTQAFAEVVEAAGKKRRAILIIDEGDSIAAARSQSQSHH
FT                   EDKVAVNTLIQGVDELRKYGGRIVVILCTNRLSVLDAALRRRAAIVEEFTRPNATERKE
FT                   LLSMDLLGMGLTDKQLTDLASVTGERNGQPAWTYSDIRTRLYPTAMAKAFPNRPLSFKD
FT                   LTDSILEMKPSPVMEDK"
FT   gene            672344..672901
FT                   /locus_tag="PST_0596"
FT   CDS_pept        672344..672901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78302"
FT                   /db_xref="GOA:A4VH51"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH51"
FT                   /protein_id="ABP78302.1"
FT                   /translation="MKADKEIFVSVDIEASGPIPGKYSMLSIGACVASNPAEQFSCFLK
FT                   PISQEFVPAALEVTGLSLERLREEGLEPGEAMAQFRAWVESLADADQRVVFVGFNASFD
FT                   WSFVNYYFHLFLGENPFGIAALDIKSMYFGASECAWKSTRSSEIEKVVNPESSGNHDAL
FT                   DDAVYQAELFNLIREKLVFGRP"
FT   gene            673073..673315
FT                   /locus_tag="PST_0597"
FT   CDS_pept        673073..673315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78303"
FT                   /db_xref="GOA:A4VH52"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH52"
FT                   /protein_id="ABP78303.1"
FT                   /translation="MNINVTAIERNIRLYALPGLLTLIGIGTMLLIDPSAASVRPFDQM
FT                   IAPLKRGVFWVAVMLTVGGILWSLYRAWLLALMEN"
FT   mobile_element  673293..675897
FT                   /mobile_element_type="insertion sequence:RP7"
FT   gene            complement(673487..674290)
FT                   /locus_tag="PST_0598"
FT   CDS_pept        complement(673487..674290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0598"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78304"
FT                   /db_xref="GOA:A4VH53"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH53"
FT                   /protein_id="ABP78304.1"
FT                   /translation="MRDLMAELKELRLHGMATAWAELTAQGESNTASSKWLLEHLLEQE
FT                   HTDRAMRSVSHQMNMAKLPMHRDLASFDFNASSADARLISELASLAFTDTAQNVVLIGG
FT                   PGTGKTHLATALAVSGITRHGKRVRFYSTVDLVNLLEREKHDGKAGRIAQALLRMDLVI
FT                   LDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSSVFGDAKMTTALLDRLT
FT                   HHCHIVETGNESYRLQHSSLAAQAKIKSRERKRKGGQEPEDDEPF"
FT   gene            complement(674283..675755)
FT                   /locus_tag="PST_0599"
FT   CDS_pept        complement(674283..675755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0599"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78305"
FT                   /db_xref="GOA:A4VH54"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH54"
FT                   /protein_id="ABP78305.1"
FT                   /translation="MYFRDKLSLHEIAKRTGLARNTIRKWVRAPEAKPPVYQRRAIFNK
FT                   LSPFHATLEQALKADSLRPKQQRRSAKALLAQIKAEGYDGGYSQLTAFIRAWRGGQGKA
FT                   SQAFVPLTFALGEAFQFDWSEEGLLVGGIYRRMQVAHLKLCASRAFWLVAYPSQGHEML
FT                   FDAHTRSFGSLGGVPRRGIYDNMKTAVDKVNKGKGRTVNARFAVMCAHYLFDPDFCNVA
FT                   AGWEKGIVEKNVQDSRRRIWLDAQDCQFHSFEELNAWLGQRCRALWNELTHPQYSGLSV
FT                   AEVLELERAELMPVPAPFDGYVERPARVSSTCLVSVGRNRYSVPCEYAGKWVSSRLYPT
FT                   RIEVVADDALIASHVRLLDRDQVSYDWQHYLPLIERKPGALRNGAPFADLPAPLRQLKH
FT                   GLGRHAGGDRIMAQVLAAVPVAGLDAVLVAVELVLESGSLSAEHILNVVARLAATEPPP
FT                   SVETHLSLKEAPVANTARYDRLRGQAEEVGHA"
FT   gene            complement(675875..676264)
FT                   /locus_tag="PST_0600"
FT   CDS_pept        complement(675875..676264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78306"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH55"
FT                   /protein_id="ABP78306.1"
FT                   /translation="MRHNLSISTGECDTQRLSHAIAAIPPPCRNSGCDTHGVSQDTGAT
FT                   YQGCRKLTPRYTCCAVSGIKTACLGTQNGQYRHENCHFWQEERPNWHCFYRLYFDIKTI
FT                   QINNLSEFSVTDWLPLVQLLPLTEN"
FT   gene            complement(676412..677683)
FT                   /locus_tag="PST_0601"
FT   CDS_pept        complement(676412..677683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78307"
FT                   /db_xref="GOA:A4VH56"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH56"
FT                   /protein_id="ABP78307.1"
FT                   /translation="MNALNQSNISVPITHGLSLSFAAGHDPKILELALPHLTKISESIY
FT                   RHHNSPLLAEFIDIVLNRFLRENHRNAKSVYQLRARMAKIKAVLTQDDPLRRLASLNNR
FT                   DIQALKDELPKLLRKNNTSSSQGDNLQAYYRLFNRMLDQATNDHWIDEDLKIKGCQTTK
FT                   SKITKSFLDSNLVSLFNSWPYQTYAPDAPKATVRHDAHSYCFWLMPLGLFTGARLNEIC
FT                   QLRVHDVFHDTHGVPLISINDSGFNKSLKNEQSKRDIPICSKLIEMGFLDFVAERRQAQ
FT                   GPDALLFSELRFDEKHLYSRAASRFFCGPVTGAGFIGQHCPVALAGGFNFKSFRRTFSV
FT                   QLQKSGVPATTIAHLLGHDGGKLEVTNEHYLEKSPSVILLDTLEHNLSYNLPLDAISWQ
FT                   HFKHLMTSQAGRSKRGRKANKTLH"
FT   gene            complement(677837..680290)
FT                   /locus_tag="PST_0602"
FT   CDS_pept        complement(677837..680290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78308"
FT                   /db_xref="GOA:A4VH57"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH57"
FT                   /protein_id="ABP78308.1"
FT                   /translation="MSKRQSKTGVQHLVYQAKTGFQFYFTFPSNIGSHPKLPAQIRWSL
FT                   GHDEALARDLAKHLNARIQDLLQPFKNPLKELIPELFLSKLDLLQAEIRRFVDSQQKIW
FT                   ALRPTPTALANADLSAGHERLLIECQEHTVLYCNEPGSEIHFALFPSEALRHALKFGFT
FT                   RFDWPLGTNDPVVANAAAAYIYSAITVLENIPMAKNAHNAGHPLITMLSLYEYLCFARP
FT                   DQGRNLLHIPPGLPQSAHSTMFHLSRISEQADHFVFCHHFQTLQEESGLYTILIPLGDP
FT                   SLKRDPNYPEKMRIELLTSSPILASILLHFSLGQIDKILVKSFIEAPSADAFERALQEI
FT                   QELIRRMLGPIPPAEPMYTLPDMSASNDAITAPQDAGTLALLGALSSVLSPAQNAKLQA
FT                   LFEAPTANDGLIQPPTTGAPTLHFGTLAKEFEERQVREGAWQNPRTRITMHSRLEGLTE
FT                   LIGGHRPLTTLTRADFNALRDQLRGYPKNRHRLRATRYQPLSQIIQGGKYEPINARTAK
FT                   KFFELARAIISYAHDQGYLKENLAAGLAFSTKGAPSPRKRTYNPGQIELLLNGPAYTLK
FT                   APPRWRLDDYRFWLPLLGLYTGARLSELCQLQLGDIREELGVWVISISSSGARQLKTVD
FT                   SERLVPLHRVILEAGFLAFHKQRLEANSGDLSASLFENLRVYGDLSPGHIASRWYRGSD
FT                   KDDKGYLGQCGLGDDELTYHGLRHTFIQQFRRQKLDMLIGKALVGHADRSTTGGYGDCY
FT                   PSYVLKKELDKIEFEASTAHIHYSHYKELQTQQGVFRIGRPVGAGTTKTASRPAKRHWQ
FT                   SRITR"
FT   gene            complement(680311..680553)
FT                   /locus_tag="PST_0603"
FT   CDS_pept        complement(680311..680553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78309"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH58"
FT                   /protein_id="ABP78309.1"
FT                   /translation="MAKTIIKDASSTPKTTVSRQHARGAYKGAQAKIKNLNILYNNDLS
FT                   DFLKAPRLHQISPETRLNRGFQARFDGFGFHTVLL"
FT   gene            complement(680648..682057)
FT                   /gene="fadD"
FT                   /locus_tag="PST_0604"
FT   CDS_pept        complement(680648..682057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="PST_0604"
FT                   /product="long-chain-fatty-acid-CoA ligase"
FT                   /note="Code: IQ; COG: COG0318"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78310"
FT                   /db_xref="GOA:A4VH59"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH59"
FT                   /protein_id="ABP78310.1"
FT                   /translation="MLVLDNDNLSLMMFPSTFKQEGTVVMTNRRDPLEEHARQIELVKP
FT                   KVVFLETLLLDSYYDTLRSHGCSIVLMDPPSAEQAARPGVHSFWSLVEAASELDHELEL
FT                   DTDEHICMLRFTGGTTGKGKCAMYSIDNWMACRDAAFINTDMAIDSNTRLLHVSPLTHG
FT                   SLMLFFPTFYAGGTNLTMNQLDMENWRLEVERERVTHSFLVPTVLYRLLELQRANPRDF
FT                   SSLTTLIYGAAPMSPDKLGELITCFGQIFVQGYAATETPMTVALLGKTAHQPDATGSLQ
FT                   HLSSAGRPTAGVEVFIAAPDGKPLPLGETGEIRIRCKAVIKGYYGNPEATAAEFDDGAW
FT                   KSGDLGYIDAAGYLYIVDRLKDMIISGGFNVYAVEVEAALAAHPQVLMAAVVGIPHAEW
FT                   GEAVHAEVILRPNAQVTEDELIAQVKAKIGAYKAPKTLAFVAELPTSVVGKVLRRQVKE
FT                   KYWQGQARKIS"
FT   gene            complement(682281..683057)
FT                   /locus_tag="PST_0605"
FT   CDS_pept        complement(682281..683057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0605"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase FadB2x"
FT                   /note="Code: IQR; COG: COG1028"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78311"
FT                   /db_xref="GOA:A4VH60"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH60"
FT                   /protein_id="ABP78311.1"
FT                   /translation="MRIQDKVVVITGGASGLGLATAHYLAAEKGARIAIFDLNVEAGEQ
FT                   AVAALGTERAMFVATDVSSEESVQNAVDAVMANFGAIHVCINGAAVPTGFKILGKEGKA
FT                   APLARFAQATAINLNGVFNVMSKCAEHMAKNEAEAGEERGVVINVSSGAAYEGQLGQCA
FT                   YSATKAGVIGLNMPAARELGAIGVRVNAIAPGLFLTTMVAALDEKVLGSLKEQMEAPKR
FT                   LGDTREFAHCCAFIIENAYINAETIRLDAASRMRAK"
FT   gene            complement(683130..684287)
FT                   /locus_tag="PST_0606"
FT   CDS_pept        complement(683130..684287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0606"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="Code: I; COG: COG1960"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78312"
FT                   /db_xref="GOA:A4VH61"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH61"
FT                   /protein_id="ABP78312.1"
FT                   /translation="MGHVMRTPEQLEAVESFRRFLADRIDPVFNKEYRDKFMPKEKMAE
FT                   MLRQLSEFGMVSGAVSEANGGLGLDWPTMTMLFEEVAACSVDLSTPVVINSFGAQMLEK
FT                   LAPAHLRERYLPGLISGDSFVSVGISEPDVGSNVLEIKTRARRDGDDFIITGEKTWISN
FT                   GSYSDFLICTCRTGDDPRKGLTHFLLDRKEHPYEVQNIHKMAWNSQSTAQIFLNDVRVP
FT                   ASNIIGNEGEALKNTLSFFERSRVFVAAQGLGIGRRALEEAVRYAKERKQHGKLIAGHQ
FT                   LISAMLAEMATNVDAARLLTYRAAEMIGAGIPAEMEAAMAKYFACEAAVTIARQAVQIH
FT                   GGAGVTTDFLVEKLAREAIIVPIPEGTTQIQQLIIGRALTGVNAF"
FT   gene            complement(684312..685523)
FT                   /locus_tag="PST_0607"
FT   CDS_pept        complement(684312..685523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0607"
FT                   /product="putative lipid-transfer protein"
FT                   /note="Code: I; COG: COG0183"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78313"
FT                   /db_xref="GOA:A4VH62"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH62"
FT                   /protein_id="ABP78313.1"
FT                   /translation="MTPFGRLLERSLYDLVEEAVDLALKDAGAATCDVGAAYYGTLTNG
FT                   MLQGQTAIPGPIAMRRLGIEGVPVFSVENACATGSSAFNLATLALRAGQCDIALAVGAE
FT                   KMNVADKAKMFAVFDGGWDVSTVEQNKETLLAMGEGIVPPPGSMSERPYSVFMDVYAAI
FT                   CRNHMTRYGTTQRQIAAVAAKNHQHSVHNPLAQFQQAFSIEEVLASPPIAYPLTTLMCS
FT                   PISDGAAAVLLCNAAGLKRLQGADKRAIRVLASVVQTGTTRSLDEPEKIIACLAAKKAY
FT                   EQAGVAPGDVDVAEVHDASAIGEILNAESLLLVPFGEGGPAAERGDFTVGGKIPINPSG
FT                   GLESKGHPIGATGLGQIHELVTQLRGEAGKRQVEGARIAIQENGGGLFGIEEAVVAVNI
FT                   LAKQ"
FT   gene            complement(685602..686387)
FT                   /locus_tag="PST_0608"
FT   CDS_pept        complement(685602..686387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0608"
FT                   /product="putative enoyl-CoA hydratase/isomerase"
FT                   /note="Code: I; COG: COG1024"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78314"
FT                   /db_xref="GOA:A4VH63"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH63"
FT                   /protein_id="ABP78314.1"
FT                   /translation="MSEAVLLFETLGPVARLTLNRPKAMNSLNLAMLAELEQRLAEIAA
FT                   NDELRTVILTGAGPAFCAGADLKEVLAGASLAAGEADFLDRANQVFGQLRNLPKPVIAA
FT                   LNGVTMAGGLELAMCADIVVAADSATIADAHANFGVYPGAGGAAILPRLIPLNMAMYLL
FT                   LTGKSLSASEMKACGLVCEVHADAELAEAALSLAKQIAKKSPIALRRMKEVARASADKT
FT                   RDDALLHEQVMLRQHLRSADLQEGLHAFNEKRAPQFKGR"
FT   gene            686721..688163
FT                   /locus_tag="PST_0609"
FT   CDS_pept        686721..688163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0609"
FT                   /product="coniferyl aldehyde dehydrogenase"
FT                   /note="Code: C; COG: COG1012"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78315"
FT                   /db_xref="GOA:A4VH64"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH64"
FT                   /protein_id="ABP78315.1"
FT                   /translation="MSSSQQPDAESTIARMRDVLKRQQAAFIAEGPPSVELRIARIDKV
FT                   IALLQDNQQLLCEALASDFSWRSHDQSLMTDVLLPIAGLKYARKHLRQWMKPERRRAEL
FT                   GAGLLGAKAEIHYQPLGSIGVMTPWNFPVAIAFGPLAEAFAAGNRAMIVLSEFNPATAA
FT                   LLIELLAEKFADTEVAAFIGGAEVGAAFSSLPLDHIIFTGSPRVGRLVMRAAAENLTPL
FT                   TLELGGKSPTIIARGADLDNAARRIWGGKGISSGQACIAPDYVLVHEDDRERLLVSMQA
FT                   ELPRMFPTIRNNPDYTAMATPGQYQRLQSYLGDAEALGVRCIEINPAGEDLSSVRKIAP
FT                   TLLIDPPQDALVLQEEIFGPLLPICSYRSIDEAIAYINARPRPLALYYFGDDQAEARHV
FT                   LAHTYSGGACINEVMQHIFQNSLPFGGCGNSGYGRYRGGDGFKAFSLQRSVFSPARFDV
FT                   MAMLRPPYGKLFRRVMGLLLRA"
FT   gene            688230..688784
FT                   /locus_tag="PST_0610"
FT   CDS_pept        688230..688784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0610"
FT                   /product="dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78316"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH65"
FT                   /protein_id="ABP78316.1"
FT                   /translation="MSDEVDEQGRRLIHQRQVECLGYLRADGLWDIEGRLADSKTHAVP
FT                   LASEARTVEAGQVYHGMLIRLTLDDDFIICEVQVEMPNVPTSECRGAVPAYQKLLGERI
FT                   GAGFSRRIKELFGGVGGCVHLSELLLPIATTAFQTIPMARAMVAPRTTHDSEAYNRATA
FT                   GLINTCHALRASGPIAQLIKK"
FT   gene            complement(688837..689970)
FT                   /locus_tag="PST_0611"
FT   CDS_pept        complement(688837..689970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0611"
FT                   /product="alpha-methylacyl-CoA racemase"
FT                   /note="Code: C; COG: COG1804"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78317"
FT                   /db_xref="GOA:A4VH66"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH66"
FT                   /protein_id="ABP78317.1"
FT                   /translation="MGALDGVRIVEIAGIGPGPFCGMLLADMGAEVILIERAGKGGDLL
FT                   DLGQHAIVNRGKRSLALDLKDPAAIEAVLRLIEGADGLIEGMRPGVMERLGLGPEVCLT
FT                   RNPRLVYGRMTGWGQKGPLAQTAGHDLNYIALSGALWFSGEAGAPPLAPPTLVGDLGGG
FT                   ALYLAMGMLAGIINASNNGVGQVVDAAIVDGSANLMNLLLSAHSAGQQPLARGQGLLDG
FT                   AHWAQTYACADGHFISVQALEPQFNALLFAKLGLGDDQDFKNPYDPRLWGSLRERLAAL
FT                   FISQPRQHWVDLLEGSDACFAPVLTPLEAMSHPHMAARGVYSKPNGVLQAAPAPRFSAT
FT                   PAGEPGAVPKRGEHGADILRAAGLSEAAIQGLLQAQG"
FT   gene            complement(690047..691660)
FT                   /locus_tag="PST_0612"
FT   CDS_pept        complement(690047..691660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0612"
FT                   /product="putative alcohol dehydrogenase"
FT                   /note="Code: E; COG: COG2303"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78318"
FT                   /db_xref="GOA:A4VH67"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH67"
FT                   /protein_id="ABP78318.1"
FT                   /translation="MKENAVFDYIVVGGGAAGCVVASRLSEDPAVSVCLLEAGGRDTNP
FT                   LVHMPAGVAVMVPTAINNWQYQTVAQKGLNGRIGYQPRGKTLGGSSSINAMAYHRGHPN
FT                   NFDDWEALGNPGWSYQEVLPYFKRAEHNEDFRNELHGQNGPLNVRFQSSPNPFIEKFIE
FT                   AGAHAGYPHCVDPNGATMEGFSRVQVMQKDGQRCSAARAYLTPNLARPNLHIETHAHAT
FT                   RLLLEGTRAVGVEFIQHGVTRQLRANTEVILSSGAFNSPQLLLLSGIGPKDELQKLGIE
FT                   VVHDLPGVGKNLVDHIDYVHPFRVESRALFGLSLRGAWDVLKATWQYFRQRKGMLTSNF
FT                   AEGCAFVKTSPELREADIELAYIIAMFADHGRTLYRGHGMSIHACLLYPKSVGQVTLAS
FT                   TDPLTPPLIDPAFLTHPDDIATLIKGYKIIRQVIEAPALQALKPREVLKVPMQTDAEIE
FT                   QMIRNRADTLYHPIGTCKMGCDPLAVVDARLRVHGLDGLRVVDASIMPTIVGCSTTAAT
FT                   VMIGEKAADFIRADRAASAA"
FT   gene            692010..693050
FT                   /locus_tag="PST_0613"
FT   CDS_pept        692010..693050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0613"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Code: K; COG: COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78319"
FT                   /db_xref="GOA:A4VH68"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH68"
FT                   /protein_id="ABP78319.1"
FT                   /translation="MSGLHTPASTADVTLSPHITTIGSYSLVVARALEVSGIDSARIFK
FT                   SVGIPLDVVNDPLTRIPVAQMNALYRACVDVTNNPYFGLLVAKYIHLPHLHALGYALAA
FT                   SGTLLDFCRRLERYFQLVSQVAKIHLDEADGQIRLSFEYLAEPSGETEDAFVGFLVRTM
FT                   RLLHKPGFNPLQVALHRPMPREGAEPYETLFRAPVSFGVPHGFLVFDKAELLQSLAGSC
FT                   PELAQVSDTIVIGYLARLDKNDVITSVKQKIIEFLPDGDCTRDKVANALCMSPTTLQLK
FT                   LSQRSTHFQQLLDETRKDLACSYLRQVTRPVTEITFLLGFSDTSNFTRAFKRWTGLSPT
FT                   NFRQQL"
FT   gene            complement(693148..695133)
FT                   /locus_tag="PST_0614"
FT   CDS_pept        complement(693148..695133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0614"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="Code: Q; COG: COG2015"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78320"
FT                   /db_xref="GOA:A4VH69"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH69"
FT                   /protein_id="ABP78320.1"
FT                   /translation="MKKTLPLFLPALLSLAVSHAALAEVATKPAEPTTIAVNAAAAKVL
FT                   PAGDRSDDLNRGFIASIADAQTLGADGKLVYSLKGYEFLQAEDGPDTVNPGLWIQARKS
FT                   MTHGLYKVTEGFYQVRGMDIANMTILEGKTGLIIIDPLMTSETSRAALDLYYQHRPQKP
FT                   VLAVIYNHSHIDHYGGVKGIVDEADVKAGKVQIIAPEGFMKHAIAENVLAGNIMSRRSD
FT                   YQFGTTLPRGERGQLDLGGAKVLPNGTITLIPPTRELTQPIETLLIDGVEIVNMLTPGT
FT                   EAPAEMIHYFPQHKVLDTGEMAVQAQHQLLTLRGAEIRNSLAWSKALNEALQRFGADTD
FT                   ILVSQHTWPVFGQQRVANYLSKQRDLYKWLHDQSLHLMNKGYKPVEIAESLRRNVPASL
FT                   ASEWFSRGFYGSVQRNSKAVYQQYMGWYDGNPVNLDALNDVDYGRKFVAYAGGGYALLK
FT                   RAKADFAAGEYRWVAQATNHLVFAEPDNQAARELNADALEQLGYQAESAVERNSYLAAA
FT                   MELRLGDKKVTAPMKTASADTLRALSIENIFDLLGVRLDATKAEGQHIVLNWNFSDSGK
FT                   RYILNLENSALTYSPERNAKNADATLTLERSTLDAILAQQLAPKKAIESGLIKIEGNPA
FT                   AFGGLLALIDNNLPSFELVAPNPPTK"
FT   gene            695582..697333
FT                   /locus_tag="PST_0615"
FT   CDS_pept        695582..697333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78321"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH70"
FT                   /protein_id="ABP78321.1"
FT                   /translation="MAGLGFVPVQAFEFDTGSEDWTVRFDNTLKMNYAQRVESANSKLA
FT                   NSWNNNDGNRNFSSGSAVAQRIDVMSELDVVYQQKMGFRVSSNTWYDHAYDNVGSDNAA
FT                   TNQIHNGKPDSRHLSGYAERYYNGPSAEILDAFVFGSTAVGDEAQLSAKLGKHTQYWGE
FT                   SILAFAHGNSYGQSGLDISKALAIPGTEAKELFIPRNQLSTSLTLNSELTLAAQYFLDW
FT                   DASRLPESGTYLGFNDGIQSGGHNLSLIGGLNPAFGAPGPIGANQYLRLSNGKTYTPRN
FT                   SGDFGLMAKWSPEWLDGTLGFYYRNTSDILPNLALSPVAVIGAPQLVSGNIGHYNQFYV
FT                   DDIDIYGISLSKSIAGVSVGFDLNYRENMPLASVPATVSAAGAAAGLPGFIGSFDGDNG
FT                   VARGNTVHAVLNGLSTFGQTPVWDAASLLVELGYSRWLDVTENQQLFKGESWYRGVDKV
FT                   SKDNYILGLNFNPTWFQVFPGIDMYMPVSYSIGLKGQSAVQLGGNEGSGSYSVGVGMDV
FT                   RSQYSFDLKYVDNFGDFDTCSKAGEGAAPGGNGKYDCVVGQTTAFAGTPAQLKDRGMVT
FT                   FTFKTSF"
FT   gene            697366..698730
FT                   /locus_tag="PST_0616"
FT   CDS_pept        697366..698730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78322"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH71"
FT                   /protein_id="ABP78322.1"
FT                   /translation="MTFVKSLLATTLAVAVSGAALAAATPEQAAQLGKNLTAVGAEKAG
FT                   NADGTIPAYDGGLTTIPVGFKAGDAFRPDPFAGEKPRLVINAQNAAEQASKLTATSQEL
FT                   LKRYPSYRMDVYPTHRTVALPQRVLDNTAVNALNAKATNDGLALENALPGVPFPIPATG
FT                   NEAMWNHLLRYQGVTMTNKYDSWFADGSGAVTLSSIGIFTIDYPAYDPARPVGPLAPED
FT                   AFYRIKVMYTGPARRAGEAILLVDAVNPLKQPRRAWQYLPGQRRVKLAPDLAYDTPNAG
FT                   TGGTATYDDAFVYNGAMDRYDFKLVGKKEMYVPYNTYQLNYHKNASELVTPKHINPDLV
FT                   RWELHRVWVVEATLKPGKRHIYSKRTFYLDEDTWTALASDQYDSRGQLYRGGFAHMTYS
FT                   YDVQAPDTINHMLYDFVAGSYSLNGYYGPYGGVKYIEPQSKAQWSPESLAGSGIR"
FT   gene            698801..699877
FT                   /locus_tag="PST_0617"
FT   CDS_pept        698801..699877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0617"
FT                   /product="glycosyl hydrolase"
FT                   /note="Code: R; COG: COG4447"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78323"
FT                   /db_xref="GOA:A4VH72"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH72"
FT                   /protein_id="ABP78323.1"
FT                   /translation="MIFFKWIAFSALTAALALPFNRAVIAAEFVDVLDAPAQMSELAVQ
FT                   GMLTGLTHAGERLIVVGQRGHILYSDNAGQHWQQASVPVSSDLIAVHFPTPQQGWAVGH
FT                   DGVVLHSRDAGETWSRQLDGRQLGPLMLAHYQKLATEKPDDAALAALVNESQRVAVEGA
FT                   DKPFLDVWFENEQVGYIVGAFNLIFRTADGGQHWTPWLERTANPSFLHLYALRPVGQEL
FT                   FIVGEQGLVLKLDANAGRFNATPTPYTGTFFGIVGKPGVALVFGLRGNVYRSVDGGANW
FT                   HKVELNLPLSITAGTVAADGRIILLSQAGHVLVSADEGASFQLQPRNGSAPVSAALLAA
FT                   PDALLLAGVNGLRQLPLK"
FT   gene            699934..702414
FT                   /locus_tag="PST_0618"
FT   CDS_pept        699934..702414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0618"
FT                   /product="transporter, putative"
FT                   /note="Code: R; COG: COG1033"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78324"
FT                   /db_xref="GOA:A4VH73"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH73"
FT                   /protein_id="ABP78324.1"
FT                   /translation="MGNHKLDSMPVIRELQDFDARSGNLLERLIFNNRLLVVLACLLVT
FT                   VMLGYFAATKLTLSASFEKMIPHNQPFIKNYLENRQSLRGLGNSVRVVVESTDGDIYLP
FT                   QYLESLKRISDELFVTPGVDRAWMKSLWTPSVRWTEVTESGFQGGPVMPDAYDGSPASV
FT                   EQLRLNIARSGIVGSLVGNNFKSSMIFVPLLEKDPVTGVAIDYHQFSRALEEQLRNQYE
FT                   FAGQPHSGAEEGKGPLKVRVIGFAKLVGDLIDGLVLVMMYFAAAALVATAIIFAFTRCV
FT                   RSTALVIACSVVAVIWELGLVALGGYALDPFSLLVPFLVFAIGVSHGAQKMNGIMQDVG
FT                   RGTHQLVAARYTFRRLFLAGLTALLADAVGFAVLMLIDIPVIQELAITASIGVAVLIFT
FT                   NLVLLPVLLSYCGVSPKAAARSLREETKGLTGGWRVLSRFTERRWASVAILVSGLLAVG
FT                   GFMVSTQLQIGDLDPGAPELRADSRYNRDNAYITANYSLSSDQFAVMLKTPAEGCLKYE
FT                   TLIEADRLGWLLQQQSGVQTTVSLVNAVRQITAGTYEGNPKWLTIARNQDVLNYGAQQA
FT                   SVSNPELFNADCSMMPVVAYLADHKAATLDQVVDVAQGFAEEHSNDSRQFLLAAGSAGI
FT                   EAATNSVVREANRTMLLYVYAAVILLCFITFRSWRAVVVAVVPLMLTSILCEALMVWLG
FT                   MGVKVATLPVIALGVGIGVDYALYLLSIQLDHQRAGLSLAEAYKKALSFTGKVVGLVGI
FT                   TLAAGVITWAWSPIKFQADMGILLTFMFIWNMIGALVLIPALSHYLLPTPRSAAAFWAR
FT                   DKGEALGAPNGATA"
FT   gene            complement(702609..702989)
FT                   /locus_tag="PST_0619"
FT   CDS_pept        complement(702609..702989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78325"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH74"
FT                   /protein_id="ABP78325.1"
FT                   /translation="MEFRYLGNGQYFPPIAPNGRVYAVPFEREDQVEIFYLTSEGIVGV
FT                   DVQARWSEIVGFYYDDDSWEIIPRNYFGRGMRFRRRVPCLMVIDGRETCTTHILGYPIP
FT                   SCVMNRVAFEQRMPKPDANLGG"
FT   gene            complement(703882..704544)
FT                   /locus_tag="PST_0620"
FT   CDS_pept        complement(703882..704544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78326"
FT                   /db_xref="GOA:A4VH75"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH75"
FT                   /protein_id="ABP78326.1"
FT                   /translation="MSKPSNDDFGARSKLNRAPANLTQRGAERRDALLAAALRIIVKDG
FT                   PGSVTFRTVVAEAKASHGSVAYYFGTREELIREAMVLVANRNIEALAKMLREFESTPIE
FT                   LASLATTIAHHSTQQMIEDRSMGITIIELHLAAARYPELRPVLHDWGRAYARIIHTVLA
FT                   NLGSSDPNADAALLINTINGHVIGQLALQRSNFESAILRPAIFRLLTAISSSTELAE"
FT   gene            complement(704612..705094)
FT                   /locus_tag="PST_0621"
FT   CDS_pept        complement(704612..705094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0621"
FT                   /product="fatty acid synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78327"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH76"
FT                   /protein_id="ABP78327.1"
FT                   /translation="MPHSTQALDSPMPYLDDLKTGDQLEPLVYEITQDLIHRYGLASLD
FT                   LNPVHMNPAWCERAQVFGTPKTVQHGMMNMSFMASAVLRTFGPLADVFLVDSKFTKPGP
FT                   VGNTITCRGKVRDVHVLNNGNDFAIINVEATDQDGDLVGISEVHVRLPRKPGANAV"
FT   gene            complement(705114..705677)
FT                   /locus_tag="PST_0622"
FT   CDS_pept        complement(705114..705677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78328"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH77"
FT                   /protein_id="ABP78328.1"
FT                   /translation="MSKNTEVFEHFVQTERQRGFSRDFLATWEQCEFWDSVEVGQMRKN
FT                   PRTFVVQEEDVLAYNKSLGETHPLFVDPEYARRHAPHGTIVVHPVFITTIAFWFAQPGD
FT                   TGSWIRTPGARNPFQHIEIIEPIRVGDRLTQTQETSDRFWRRDKAYITTHSILTDQNGR
FT                   KKVEFSGTLILPPTANDVRRFATA"
FT   gene            complement(705773..707563)
FT                   /locus_tag="PST_0623"
FT   CDS_pept        complement(705773..707563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0623"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="Code: I; COG: COG1022"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78329"
FT                   /db_xref="GOA:A4VH78"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH78"
FT                   /protein_id="ABP78329.1"
FT                   /translation="MNATSMSTCDVERRNFLHELDHFVARAPDAVFLRTLDPVTTLSRS
FT                   EFADQVGRLAAVLRELGVAKGESVGLLMGNILEFYVADAAVLAAGGVPVSLYPTSSPEQ
FT                   LGYMAKDAGIKLLITEAALLSRLTEAEVCFEMLSAVAVIDDLPGEVAAARWPIIALQQL
FT                   MRASSQRITLAEAAQSVRVEDLLTLVYTSGTTGAPKGVRLSHVNLLSAAQSMGTLMQLS
FT                   EGGRIISWLPHAHVAGRVGQYYCAVIFGVEVTICPDQKRLPMYLPIVKPTYFFAVPRLW
FT                   EKLKASIEAEFARLPETAQVELRRVLSARTEALQTSSVSSSLGQADADYFAPLRTKLGL
FT                   DQARVLSTGTAPTPRHVLEFFAALDLPIGDIFGATETCACGAMGQPGHFKLGSVGQAVP
FT                   GMQIAIAEDGEVLLRGLPIMQGYHNQPEKTAEALSEEGWYRTGDVGRLDDDGFLWITDR
FT                   KKELIINSSGKNMSPANIEAMIKSGDPLIGSVCVVGDARLYNTALIVLDPDYANAWAAA
FT                   RQITGSITTLASHPDVVAAVAAGVERGNQRLSRVEQVKRFTLLAAEWPAAGDELTATLK
FT                   LKRKAIEHKYAQNIEQMYVN"
FT   gene            707878..708147
FT                   /locus_tag="PST_0624"
FT   CDS_pept        707878..708147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0624"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78330"
FT                   /db_xref="GOA:A4VH79"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH79"
FT                   /protein_id="ABP78330.1"
FT                   /translation="MSRIQNMDYSLITTRLGEQLRQRRLNRGLTQATLADLAGITRQKV
FT                   IAIEKGDLSVGMAAYARVLGALDCEFSVVPSAMPTLDEIQGVFD"
FT   gene            708147..709343
FT                   /locus_tag="PST_0625"
FT   CDS_pept        708147..709343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG3550"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78331"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH80"
FT                   /protein_id="ABP78331.1"
FT                   /translation="MTAVLQVATPEGDSGKILSSAGDYLFRYHEDAKAQAAISLLMPVR
FT                   LDEYRHRELHPIFQMNLPEGYVLEQLRNRLAKVANVDPMLLLALSGSSSPIGRVAVSSP
FT                   EVDALLRRQQFPGEKLEEILAWDGAEDIFAGLVDRYILRAGISGVQPKVLVPEHQDSAP
FT                   QRFTSKTSDLIIKSGRDEFPGLAINEFLCMSVAREAGIAVPEFYLSDNAKLFVMRRFDR
FT                   DEQLNPIGFEDMAALMGLAAEQKYSKSYSAIAKAIRLFCPPEQVQNSLAQLFAIVTLSC
FT                   IVGNGDAHLKNFGLLYSDPTQRDARLAPAYDIVNTTAYIPEDVLALDLAGNKSLFASRQ
FT                   GLLDFAQVCDVARPEEVIREQLHALERVLARSTDLSERAPNVVAAIRHCAGPFVQTFG"
FT   gene            complement(709726..712191)
FT                   /locus_tag="PST_0626"
FT   CDS_pept        complement(709726..712191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78332"
FT                   /db_xref="GOA:A4VH81"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH81"
FT                   /protein_id="ABP78332.1"
FT                   /translation="MAISLTGLRECELFAEVMKKTSLNILLDSKELEFILSCAIVFLNE
FT                   YSGDKRKSPYFEIAYYITLKCAINNNYYEPLLDTSSNFGLYPIAQYIVKNKLTEGTSST
FT                   GFSLEYQLDKFKNEHITETYEQKKYKAQMIGSDSKENCYIAPTSFGKSALIVDIIKART
FT                   PKRTAIIVPTKSLLIQTYKLIKNNFPQHHIIFHDEMHDGADEFISIFTQERALRLLKNK
FT                   AISFELLIVDEAHNLFEMDGRSILLTRLIRRNRLRNPNSTNYYLSPLISETENLKTSEA
FT                   QNFFERRIASNIKEPDIYEFRTSGETLSYNRFLNEFYRQGNELNFIQYIINNKKEKNFL
FT                   YLRAPKRVEELSNLVSKELSPAESSILNELSQTISNNVHSDFYCVEHIKKGLIYLHGKL
FT                   PDLIKEYLEYKFSQIKELQFMVANSVILEGVNLPIDNLFILNTHKLDERSLTNLIGRVN
FT                   RLNEVFDDKRRSLDKLLPPIHFVNSDEFNRKGGKMENQIKLLRNGIFKDKIKNPLLLNF
FT                   DPTEFINKLEKLRENEDYTGIEHLERKISQFTDIQDRENFLINSDSDESRKVKQTLMES
FT                   GISSVYSSPEGVFDVLEKRIDTIPTSTEWIASSVIDKVYLYFIKALEHEISDAAFLRLQ
FT                   HPKARDFYKLFTRNLHRLNLKDHISDTVGYFNSIKYTDSGREFYIGVSYGEIPKNNVTG
FT                   VYASNAYIDLSKKTDKQLVNLALVKIKIESDFVSYRLNEYVNVLHDLNLITDDEYNLHI
FT                   YGTNKKSNTEFVKIGISGALINKLERDKQIDNISITDLGVINYNSEFSKYIKSQDDLIQ
FT                   FEISKYINI"
FT   gene            complement(712193..712951)
FT                   /locus_tag="PST_0627"
FT   CDS_pept        complement(712193..712951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78333"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH82"
FT                   /protein_id="ABP78333.1"
FT                   /translation="MIPFEIKPISPTHELHVINIESLDSNTTQHLDDFLVSICEGDSGS
FT                   ELELVKKRLKKFLEDKDTNTRMGAAAELFAHLYLNISGYKQEFLFFNLEEGSIKKGFDG
FT                   FFSKDSNTYILESKSGSISSQKVSHKEKLKHAYSDLNKYVSGKSDKGKNNPWKNAYNHA
FT                   SHVDVGTEKSIRKKIKSLQDMFDLGTFSKISEFNVITCSTIFLNGAWDAKKSSEILSDN
FT                   NFISDFDGKTIKAMCLTKSSLNNFIDYLGK"
FT   gene            complement(713019..713789)
FT                   /locus_tag="PST_0628"
FT   CDS_pept        complement(713019..713789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78334"
FT                   /db_xref="GOA:A4VH83"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH83"
FT                   /protein_id="ABP78334.1"
FT                   /translation="MDFTPIIAQVWGTLGWFIPLMLLIGLLKSPWAKGHIGELLVRLFA
FT                   HFQLDKQIYRRLHNVTLNTPDGTTQIDHVFLSPYGIFALETKNMSGWIFGSEKQAQWTQ
FT                   KLYKRTFKFQNPLRQNYKHLKTLEATLGVNPEHLHSVIAFVGGSTFKTEVPANVTQGIG
FT                   FIRYIKAFQQPLFSEAEVDSMLHALQTGRRAPTLATHREHVQNLKRRSDPTAERQCPKC
FT                   GSALVIRTMKSGAKAGQQFWGCHGFPKCRTVQSL"
FT   gene            complement(714070..715899)
FT                   /locus_tag="PST_0629"
FT   CDS_pept        complement(714070..715899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78335"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH84"
FT                   /protein_id="ABP78335.1"
FT                   /translation="MPTKKIECDNELFLSLRQASPEEVDVLVDVITDFARGRAGLDTDD
FT                   KKALVQAKHASRPNGYSEDQLMLLGHELQQFGGHSAFNLARRLLQKPAINYTEIVNDVY
FT                   RKLNGDQAKQKSVANKEREIALALFGENWRELPPKERFERSTSVKVLSGLFKLKDALPL
FT                   AGAGKLVGLSAANSAALFTAASAGMRLNPLGLAATAGLTLNSAVAEAYRVTVPFVAQMG
FT                   WIRLRREANSSTQPAPQTTQPQADEDVGSSDMVLRDENDSTLMKIRVIERASEQTGQPM
FT                   SPEQVSALNPLLSNVPGLAALAELHQGNYVVCSLPFDTLTKSASNEGSVRAFVTSGGRI
FT                   TEQAHLSMPDGLQNVLVSGAVWNALSSAVGQKHLHDINEKLTAIKRQLDAVQKELEHQR
FT                   WEKLAGLLDYVQSLLDHYPQEGITDAALTVLEMRQAEMIELTQFFERKMREELKLAEDV
FT                   EASKVFGVEASRMALQESLSRMNDWVSGYLQVTQLQVVSAALRYMAQPRELYRSAAVKV
FT                   LEGLSQLSAKAAESRKVYGSQMELTNSRVFSLGESQREQFTTSLDSLTNILTTGPLDTR
FT                   RLHRMLFEQGEHQVLLQIENGQFTKGQLLDPDI"
FT   gene            complement(715961..716581)
FT                   /locus_tag="PST_0630"
FT   CDS_pept        complement(715961..716581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78336"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH85"
FT                   /protein_id="ABP78336.1"
FT                   /translation="MSTNLQNALLDVRKAYRLLADYQQHMFELLGFIRERLGAKDYYHK
FT                   YLHPLPQGLDGLDKRDNSGLRYLPFYDLSAIWLKNQGQDAPWDNHMPGDLMFGVWVRSD
FT                   TDFDKYSGQFNGLPAEQSRSVLVLSVVVCEQPMAKPCNWYGKIWDYMGYPKDDEVNDAD
FT                   VPGYRCYAKSIDLEQLSNRDAIETAISDWCTRASQKLNTPIGS"
FT   gene            complement(716578..717282)
FT                   /locus_tag="PST_0631"
FT   CDS_pept        complement(716578..717282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78337"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH86"
FT                   /protein_id="ABP78337.1"
FT                   /translation="MLNAVFSGKKRGTGLQSQQVSLELAEGAEDVLTAGVFERLAYLPD
FT                   ELLTAVLSELLGEPFGPLQAIEYWPSWCLQDGTRVEPDVLLQDAQRYVLIEAKRHDHVR
FT                   QQSARQLANELLAGWHGEYLGDSCILLTLGGLEDTSEAGRQQLLGEVLSRLPAGSATRF
FT                   TLVCRSWQQLYQALESQIDPDSPAGLQRLFDDIAKCYAWHGLRTHPMRWLVHLQSLGLD
FT                   AHPGAFDAWSRK"
FT   gene            complement(717297..718715)
FT                   /locus_tag="PST_0632"
FT   CDS_pept        complement(717297..718715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0632"
FT                   /product="type I restriction-modification system, S
FT                   subunit"
FT                   /note="Code: V; COG: COG0732"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78338"
FT                   /db_xref="GOA:A4VH87"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH87"
FT                   /protein_id="ABP78338.1"
FT                   /translation="MSELPSGWTRFALKDLGGLSGGKTPSKANPEFWSTRDVPWVSPKD
FT                   MKKNLLEDAEDRISQNAVDEAGMTLYPSGSVLMVTRSGILQHTFPVALAGVELTVNQDI
FT                   KVLRPIEGIVPKFSFYMLKSFGAEILSACSKDGTTVQSIDSEKLETFLFSLPPLAEQTR
FT                   IAQKLDELLAQVDTLKARIDAIPALLKRFRQSVLAAAVSGRLTEEWRGSIPASESAEEY
FT                   LSRVIQVRRQKPIVKFKEPVPPDLETRELEVPEGWIVASVSSFAECLDSMRVPVKKELR
FT                   ESGEGKYPYFGANGEVDRVDEYIFDDDLVLVTEDETFYGRVKPIAYKYSGKCWVNNHVH
FT                   ALRAHDAVARDYLCYVLMHYDVVPWLTGTTGRAKLTQGALLSLPIQVPPATEQTEIVRR
FT                   VEQLFAFADQLEARVNAAKACIDRLTQSILAKAFRGELVPQDPNDEPASVLLERIKAQR
FT                   AAAPKTKRGRKASA"
FT   gene            complement(718708..720255)
FT                   /locus_tag="PST_0633"
FT   CDS_pept        complement(718708..720255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0633"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="Code: V; COG: COG0286"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78339"
FT                   /db_xref="GOA:A4VH88"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH88"
FT                   /protein_id="ABP78339.1"
FT                   /translation="MTNSDIVQKLWNLCDVLRDDGINYSDYVTELVLLLFIKMEYEQVQ
FT                   NNDSFAHKLPEGARWPDLAGKSGLNLLGHYRQMLLDLGKNSDPLIAAIYADAQTRLKEP
FT                   RHLEQLIKSLDGIDWFSARQDGLGDLYEGLLEKNASETKSGAGQYFTPRPLIDSIINCL
FT                   KPQPGETIQDPAAGTAGFLIAADAYIKRHTDDHYDLDAKAQAFQRNRAFVGVELVPGTR
FT                   RLALMNTLLHSMEGDEEGVVHLGNALGQTGANLPKVDVILSNPPFGTAKGGGGPTRDDL
FT                   TYKTSNKQLAFLQHIYRGLKPGGRAAVVLPDNVLFEAGVGTDVRRDLLDKCNLHTILRL
FT                   PTGIFYAQGVKTNVLFFQKGTQDNPRQEQGCTQRVWIYDLRSNMPSFGKRTPFGAQHLK
FT                   PFEDAYGEDANSNSSRAENVEGIGELSRFRVFTRDFIRERGDSLDISWLKDADSLDAAD
FT                   LPAPEVLAGEAMAELTEALHELEELMKALGAGDEVAAQKQLMAEVMGLAVVEGNRDE"
FT   gene            complement(720338..721198)
FT                   /locus_tag="PST_0634"
FT   CDS_pept        complement(720338..721198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0634"
FT                   /product="abortive infection bacteriophage resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78340"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH89"
FT                   /protein_id="ABP78340.1"
FT                   /translation="MRPFQLSEDADHGFKPDTRLQALTRLYDFDRRLRLLVMDAIERIE
FT                   VAARALISNHMGPQYGEHWYLQARFFQRDYRHQALLDSIRSKQDKALQDHQRECHRIDT
FT                   SQAPDARKAQLKSLRAKESYARHYALTYNAPDLMPAWAAMEEITLGELSHLFKGLARDA
FT                   DKKAIARRLNLPSPLLQSWLHTLTTIRNICAHHARLWNRELGIRPELPRTVNFPWPQHL
FT                   QQPGQHARLFTVLCILNLLMRQVSPHTSWDRRLHELLNEFAEINLPAMGFPPDWQNDPF
FT                   WQAPS"
FT   gene            complement(721578..725051)
FT                   /locus_tag="PST_0635"
FT   CDS_pept        complement(721578..725051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0635"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /note="Code: V; COG: COG4096"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78341"
FT                   /db_xref="GOA:A4VH90"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH90"
FT                   /protein_id="ABP78341.1"
FT                   /translation="MAVSSNFAFLQEHDPVFLQLANTAEQVFASDPNTTLIKLRQLGEA
FT                   LAQDLASRAGIEFDATTQSDLLYKLSREIQLDQNIRSLFHTLRVEGNRATHEFRTQHRE
FT                   AMDGLKVARALAIWYHQSFGKNAHAFKPGPFVTPTDPSAPLHDLKNQIERLKTQLSESS
FT                   QELEDNQQLAELHKREAEEYAVLAEQMDAESRGHKQLAAEHEAALHKLRTEHERRIKAL
FT                   QLQLLTQPQAAQQVMHRTMQATSSFDLSEDLTRILIDQQLIDAGWEADSLDLTYSKGAR
FT                   PEKGKNKAIAEWPTSSPKACADYVLFAGLTPIAIVEAKRKRINIADRIPQAERYAREFN
FT                   LSVEHQQPSLLAGQTQSWSDGQGGHFRVPFAFACNGRPFIKQLAEQSGTWFRDLRSPAN
FT                   TRRPLQDFHKPDDLLDLLKRSQTDAEAKLKAEGFTYLKLRDYQEKAVQTVEQALANNQR
FT                   DCLLAMATGTGKTRTIIGLMYRFLKAERFKRILFLVDRSALGQQAIDSFNDTTLEQNHT
FT                   LAQIYDIKELGDMAAEAETRVQVATVQAMVSRIFRSDTPPPVGEFDCIIVDEAHRGYTL
FT                   DQEMTEGELAVRDHSQYLSQYRRVLDHFDACRIGLTATPAKHTSEIFGKPVFTYSYREA
FT                   VADDWLVDHEPPIRYETQLSQHGIRFEKGESVSVINTQTGEVDVAELEDELTFNIESFN
FT                   RRVITPAFDKVICDELAKELDPFGEEKTMIFCVNQAHAERVKNLLDEAFKTAYGEQYNE
FT                   AAVRIITGQSDKVEQLIRRYKNEPNPNIAITVDLLTTGIDVPKICNLVFMRRVRSRILY
FT                   EQMKGRATRRCDDIGKTVFRIYDPVDLYASLEAVDTMKPLVKNPNISLEQLVSELASGA
FT                   SHDAPGSQDDSSHAHDVLDQLSQRVMRILRKAQHKAENKPSLKQKLDELQDAWGVEPAK
FT                   LHTHLHELGPQQAANFVRQHSQLINQLAAVSALLGSENYPLISTHSDELMVREQNYGQN
FT                   QKPADYLESFHEFIHKQLNQSAALGVVVNRPKDLTREQLREVRLLLDQHGFSEASLKSA
FT                   WRNQTNQEIAASIIGYIRQAAIGEALLPFDQRVAQAMQKIYALQPWTPVQRKWLERLAK
FT                   QLVHEVVIDPQQVNDAFRNDGGLKALDRNLGGNLDRVLEALNDNLWSAAG"
FT   mobile_element  726317..728332
FT                   /mobile_element_type="insertion sequence:RP1"
FT   gene            726688..727032
FT                   /locus_tag="PST_0636"
FT   CDS_pept        726688..727032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0636"
FT                   /product="ISPsy5, Orf1"
FT                   /note="Code: L; COG: COG3436"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78342"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH91"
FT                   /protein_id="ABP78342.1"
FT                   /translation="MIGLDSQARIWLCTEPTDMRKSFRGLSALVRNQLKQDPLSGQYFV
FT                   FVNRRKTQMKMLYFTPTGYCLWAKRLEQGQFRVRPSSSGQRPLNLTDLQLLIDGIEVQK
FT                   YRQFKRFRGT"
FT   gene            727154..728692
FT                   /locus_tag="PST_0637"
FT   CDS_pept        727154..728692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0637"
FT                   /product="ISPpu14, transposase Orf3"
FT                   /note="Code: L; COG: COG3436"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78343"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH92"
FT                   /protein_id="ABP78343.1"
FT                   /translation="MQRQLDWFKKQLFGPKSEKQVYDLPEQGGLFQSNDAASPEKPLDA
FT                   EKRPVRAYQRGTGKKQRDDDCLNDTGLRFTADVPVEVVEHLPPELSGPDADQYDILGTK
FT                   TTYRLAQRTSSYVVLQVERPVFRRKGSDKPVTTPAPSNVLDNSLADVSLLAGLMVDKFQ
FT                   FHLPLYRQHQRIQQAGITLSRSTLTNLIKRSIDLLRPIVDAQTDNVLRSRVLAMDETPI
FT                   KAGHQGRAGPQKGKMKSGWFWPLYGDADEVVFTYSNSRGRAHIEQVLNEQFSGTLISDG
FT                   YAAYARYAAAQQNIIHAQCWVHSRRYFIEAQKDHPITATEALQQIAKLYTNEEEIRVQQ
FT                   LTGEKKRQYRLLHSKPVVSDFFQWCRDQLAQGGLLPSDLLTKALNYVLSREASLTVFLE
FT                   DPDVQPDTNHLERALRPIPMGRKNWLFCWTELGAEHVGIIQSLITTCKLHDINPYTYLV
FT                   DVLQRISQHPASKVADLTPRLWKTRFADNPLRSLIDPRHSDRQTAQPKGTLHAH"
FT   gene            729117..729764
FT                   /locus_tag="PST_0638"
FT   CDS_pept        729117..729764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78344"
FT                   /db_xref="GOA:A4VH93"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH93"
FT                   /protein_id="ABP78344.1"
FT                   /translation="MRYLGECQNGINIGGEAFGSGSPFVSYGDVYKNDVLPAEVTGLVQ
FT                   SSPEDQQRYSIEYGDVFFTRTSETVDEIGFSATCLQELPNAVFAGFLIRFRPTGKSLTP
FT                   GFSKYYFRNQGLRIFFNKEMNLVTRASLSQDLLKLLPVTLPPVVEQIKISDFLDRVTAE
FT                   FASLLEQGIKAIDLLKERRSALISAAVTGKIDVRGWQPPANTQAPESVQEAV"
FT   gene            729764..732961
FT                   /locus_tag="PST_0639"
FT   CDS_pept        729764..732961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0639"
FT                   /product="type I restriction-modification system
FT                   endonuclease"
FT                   /note="Code: V; COG: COG0610"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78345"
FT                   /db_xref="GOA:A4VH94"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH94"
FT                   /protein_id="ABP78345.1"
FT                   /translation="MADSKEAQFQQDIIDAMVAQGWLTGPASGYDRRAALYTEDFLGYF
FT                   KEAWPERWDKFAKANPNAPEDVLVQKLVRELEQNGTLDVLRHGFKLPAVKVELCSFQPD
FT                   HGMNPDTLKRYQCNRLRVVPEVSYSPHFRESGAAGQSYNPRLDLVLFVNGIPTATLELK
FT                   SEFKQSVENAKRQYRYDRPVKDPLTRKPEPLLTFKRGALVHFAVGQNEVAMTTKLAGKD
FT                   TFFLPFNLGSEEGGAGNPLPVDDSQYATSYLWQRLFQPDAWLKVLGRFLHLDKKTSEGF
FT                   DGQPTTKETMVFPRYHQWDVVNRLINTTRDEGPGKRYLIQHSAGSGKSNSIAWTAHQLA
FT                   SLYDDAGQRLFSSVIVVTDRTVLDSQLQNTIYQFEHAQGVVKPITRDIGNQSKSEQLAE
FT                   ALAEQTRIIIVTIQTFPALFDALDKYPKLASGRYAVIADEAHSSQTGSSASKLKSILGS
FT                   DAPEGEEISAEELLDAAVQARQPNERISYYAFTATPKAKTLELFGRPADASLPASSSNK
FT                   PEAFHLYSMRQAIEEGFILDVLRNYTTYSTAWKIAHPDGDDDEVDSKKARMKLARWVRL
FT                   HPYNIDKKVEIIVEHFRANIRHLLNGQAKAMVVTSSRQEAVRYQLAVKAYVQQMGYSDV
FT                   HPLVAFSGSVLPDEVIPEEVTESSSLLNTGLNGRDLADAFDTQDFNVMIAANKYQTGFD
FT                   QPKLCAMYVDKKLQGVDCVQTLSRLNRTFPAKETFILDFFNEPQDILDAFLPYYTKAEL
FT                   TDVTDPQIIYDLQKKLDAEGIYHWAEVEAFATAFFDPKAAASKLSYYCQPAKERFAKRY
FT                   AFSQESRLHALDFKRTAEVNGDSAGLKKAEHALKEAGEQVDQLDLFKKNLQSFVRLYEF
FT                   LSQIVPYEDRELEQLCVYAKHLHPLLRIDRLQEDDVDVGELQLTHYRLSKRAEHQLRLS
FT                   EEGGDYTLKPGSDVGSGKPHDPEKKRLSEIIDALNDIFGAEVSDEDQLQFLTGIAQRIS
FT                   RQEDVMAQVNSHSVEQVMHGLFPKRVLDTVLDAMTDHEKLSLEVLDNETKSRAFALVIL
FT                   KMLKTAAGIDENARRGA"
FT   gene            734223..735764
FT                   /locus_tag="PST_0640"
FT   CDS_pept        734223..735764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PST_0640"
FT                   /product="phage Hau3 resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PST_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABP78346"
FT                   /db_xref="GOA:A4VH95"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4VH95"
FT                   /protein_id="ABP78346.1"
FT                   /translation="MEFHIIDREEKFPSVGVSAAYLKYDRWNDHSFITMFYVIVFDEFG
FT                   QAHDLENVKIGFKGQDTSTSTRSKLPDSFERLPEGFFSLGTNVEYYQKIANSFSGELRS
FT                   DFLRGMNDIVANPEILETINDEPVFSISLLRDVSLTSVKNQFTRVLLGGAVRTNFSFVY
FT                   TKQADSSTAGIELSFEVDVDSTPLTNVHALIGRNGIGKTTILNGITKAIHNGHTGADAI
FT                   HQAKFRGQQRAVITPDFFSSVVLVSFSAFDPFDPPPEQPDPAKGTCFFYVGLKSKGEDA
FT                   WHELKRRDALKSDFLAGMRGCLRDTHKRNRWRQAVTTLQSDENFAGLGFERLLSLSGEE
FT                   WGTTANEIFSNLSSGHSIVLLTITKLVERVEEKTLVLMDEPESHLHPPLLSALIRALSE
FT                   LLLDRNGVAIVATHSPVVLQEIPASCVWKIHRSNLVASAQRPTVETFGENVGILTREVF
FT                   GLEVASSGFHTL