(data stored in ACNUC9543 zone)

EMBL: CP000308

ID   CP000308; SV 1; circular; genomic DNA; STD; PRO; 4702289 BP.
XX
AC   CP000308;
XX
PR   Project:PRJNA16645;
XX
DT   10-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Yersinia pestis Antiqua, complete genome.
XX
KW   .
XX
OS   Yersinia pestis Antiqua
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4702289
RX   DOI; 10.1128/JB.00124-06.
RX   PUBMED; 16740952.
RA   Chain P.S., Hu P., Malfatti S.A., Radnedge L., Larimer F., Vergez L.M.,
RA   Worsham P., Chu M.C., Andersen G.L.;
RT   "Complete genome sequence of Yersinia pestis strains Antiqua and Nepal516:
RT   evidence of gene reduction in an emerging pathogen";
RL   J. Bacteriol. 188(12):4453-4463(2006).
XX
RN   [2]
RP   1-4702289
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   "Complete sequence of chromosome of Yersinia pestis Antiqua";
RL   Unpublished.
XX
RN   [3]
RP   1-4702289
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 166c54f11ffdf6c21b820352f32252af.
DR   BioSample; SAMN02598369.
DR   EnsemblGenomes-Gn; EBG00001242688.
DR   EnsemblGenomes-Gn; EBG00001242689.
DR   EnsemblGenomes-Gn; EBG00001242690.
DR   EnsemblGenomes-Gn; EBG00001242691.
DR   EnsemblGenomes-Gn; EBG00001242692.
DR   EnsemblGenomes-Gn; EBG00001242693.
DR   EnsemblGenomes-Gn; EBG00001242694.
DR   EnsemblGenomes-Gn; EBG00001242695.
DR   EnsemblGenomes-Gn; EBG00001242696.
DR   EnsemblGenomes-Gn; EBG00001242697.
DR   EnsemblGenomes-Gn; EBG00001242698.
DR   EnsemblGenomes-Gn; EBG00001242699.
DR   EnsemblGenomes-Gn; EBG00001242700.
DR   EnsemblGenomes-Gn; EBG00001242701.
DR   EnsemblGenomes-Gn; EBG00001242702.
DR   EnsemblGenomes-Gn; EBG00001242703.
DR   EnsemblGenomes-Gn; EBG00001242704.
DR   EnsemblGenomes-Gn; EBG00001242705.
DR   EnsemblGenomes-Gn; EBG00001242706.
DR   EnsemblGenomes-Gn; EBG00001242707.
DR   EnsemblGenomes-Gn; EBG00001242708.
DR   EnsemblGenomes-Gn; EBG00001242709.
DR   EnsemblGenomes-Gn; EBG00001242710.
DR   EnsemblGenomes-Gn; EBG00001242711.
DR   EnsemblGenomes-Gn; EBG00001242712.
DR   EnsemblGenomes-Gn; EBG00001242713.
DR   EnsemblGenomes-Gn; EBG00001242714.
DR   EnsemblGenomes-Gn; EBG00001242715.
DR   EnsemblGenomes-Gn; EBG00001242716.
DR   EnsemblGenomes-Gn; EBG00001242717.
DR   EnsemblGenomes-Gn; EBG00001242718.
DR   EnsemblGenomes-Gn; EBG00001242719.
DR   EnsemblGenomes-Gn; EBG00001242720.
DR   EnsemblGenomes-Gn; EBG00001242721.
DR   EnsemblGenomes-Gn; EBG00001242722.
DR   EnsemblGenomes-Gn; EBG00001242723.
DR   EnsemblGenomes-Gn; EBG00001242724.
DR   EnsemblGenomes-Gn; EBG00001242725.
DR   EnsemblGenomes-Gn; EBG00001242726.
DR   EnsemblGenomes-Gn; EBG00001242727.
DR   EnsemblGenomes-Gn; EBG00001242728.
DR   EnsemblGenomes-Gn; EBG00001242729.
DR   EnsemblGenomes-Gn; EBG00001242730.
DR   EnsemblGenomes-Gn; EBG00001242731.
DR   EnsemblGenomes-Gn; EBG00001242732.
DR   EnsemblGenomes-Gn; EBG00001242733.
DR   EnsemblGenomes-Gn; EBG00001242734.
DR   EnsemblGenomes-Gn; EBG00001242735.
DR   EnsemblGenomes-Gn; EBG00001242736.
DR   EnsemblGenomes-Gn; EBG00001242737.
DR   EnsemblGenomes-Gn; EBG00001242738.
DR   EnsemblGenomes-Gn; EBG00001242739.
DR   EnsemblGenomes-Gn; EBG00001242740.
DR   EnsemblGenomes-Gn; EBG00001242741.
DR   EnsemblGenomes-Gn; EBG00001242742.
DR   EnsemblGenomes-Gn; EBG00001242743.
DR   EnsemblGenomes-Gn; EBG00001242744.
DR   EnsemblGenomes-Gn; EBG00001242745.
DR   EnsemblGenomes-Gn; EBG00001242746.
DR   EnsemblGenomes-Gn; EBG00001242747.
DR   EnsemblGenomes-Gn; EBG00001242748.
DR   EnsemblGenomes-Gn; EBG00001242749.
DR   EnsemblGenomes-Gn; EBG00001242750.
DR   EnsemblGenomes-Gn; EBG00001242751.
DR   EnsemblGenomes-Gn; EBG00001242752.
DR   EnsemblGenomes-Gn; EBG00001242753.
DR   EnsemblGenomes-Gn; EBG00001242754.
DR   EnsemblGenomes-Gn; EBG00001242755.
DR   EnsemblGenomes-Gn; EBG00001242756.
DR   EnsemblGenomes-Gn; EBG00001242757.
DR   EnsemblGenomes-Gn; EBG00001242758.
DR   EnsemblGenomes-Gn; EBG00001242759.
DR   EnsemblGenomes-Gn; EBG00001242760.
DR   EnsemblGenomes-Gn; EBG00001242761.
DR   EnsemblGenomes-Gn; EBG00001242762.
DR   EnsemblGenomes-Gn; EBG00001242763.
DR   EnsemblGenomes-Gn; EBG00001242764.
DR   EnsemblGenomes-Gn; EBG00001242765.
DR   EnsemblGenomes-Gn; EBG00001242766.
DR   EnsemblGenomes-Gn; EBG00001242767.
DR   EnsemblGenomes-Gn; EBG00001242768.
DR   EnsemblGenomes-Gn; EBG00001242769.
DR   EnsemblGenomes-Gn; EBG00001242770.
DR   EnsemblGenomes-Gn; EBG00001242771.
DR   EnsemblGenomes-Gn; EBG00001242772.
DR   EnsemblGenomes-Gn; EBG00001242773.
DR   EnsemblGenomes-Gn; EBG00001242774.
DR   EnsemblGenomes-Gn; EBG00001242775.
DR   EnsemblGenomes-Gn; EBG00001242776.
DR   EnsemblGenomes-Gn; EBG00001242777.
DR   EnsemblGenomes-Gn; EBG00001242778.
DR   EnsemblGenomes-Gn; EBG00001242779.
DR   EnsemblGenomes-Gn; EBG00001242780.
DR   EnsemblGenomes-Gn; EBG00001242781.
DR   EnsemblGenomes-Gn; EBG00001242782.
DR   EnsemblGenomes-Gn; EBG00001242783.
DR   EnsemblGenomes-Gn; EBG00001242784.
DR   EnsemblGenomes-Gn; EBG00001242785.
DR   EnsemblGenomes-Gn; EBG00001242786.
DR   EnsemblGenomes-Gn; EBG00001242787.
DR   EnsemblGenomes-Gn; EBG00001242788.
DR   EnsemblGenomes-Gn; EBG00001242789.
DR   EnsemblGenomes-Gn; EBG00001242790.
DR   EnsemblGenomes-Gn; EBG00001242791.
DR   EnsemblGenomes-Gn; EBG00001242792.
DR   EnsemblGenomes-Gn; EBG00001242793.
DR   EnsemblGenomes-Gn; EBG00001242794.
DR   EnsemblGenomes-Gn; EBG00001242795.
DR   EnsemblGenomes-Gn; EBG00001242796.
DR   EnsemblGenomes-Gn; EBG00001242797.
DR   EnsemblGenomes-Gn; EBG00001242798.
DR   EnsemblGenomes-Gn; EBG00001242799.
DR   EnsemblGenomes-Gn; EBG00001242800.
DR   EnsemblGenomes-Gn; EBG00001242801.
DR   EnsemblGenomes-Gn; EBG00001242802.
DR   EnsemblGenomes-Gn; EBG00001242803.
DR   EnsemblGenomes-Gn; EBG00001242804.
DR   EnsemblGenomes-Gn; EBG00001242805.
DR   EnsemblGenomes-Gn; EBG00001242806.
DR   EnsemblGenomes-Gn; EBG00001242807.
DR   EnsemblGenomes-Gn; EBG00001242808.
DR   EnsemblGenomes-Gn; EBG00001242809.
DR   EnsemblGenomes-Gn; EBG00001242810.
DR   EnsemblGenomes-Gn; EBG00001242811.
DR   EnsemblGenomes-Gn; EBG00001242812.
DR   EnsemblGenomes-Gn; EBG00001242813.
DR   EnsemblGenomes-Gn; EBG00001242814.
DR   EnsemblGenomes-Gn; EBG00001242815.
DR   EnsemblGenomes-Gn; EBG00001242816.
DR   EnsemblGenomes-Gn; EBG00001242817.
DR   EnsemblGenomes-Gn; EBG00001242818.
DR   EnsemblGenomes-Gn; EBG00001242819.
DR   EnsemblGenomes-Gn; EBG00001242820.
DR   EnsemblGenomes-Gn; EBG00001242821.
DR   EnsemblGenomes-Gn; EBG00001242822.
DR   EnsemblGenomes-Gn; EBG00001242823.
DR   EnsemblGenomes-Gn; EBG00001242824.
DR   EnsemblGenomes-Gn; EBG00001242825.
DR   EnsemblGenomes-Gn; EBG00001242826.
DR   EnsemblGenomes-Gn; EBG00001242827.
DR   EnsemblGenomes-Gn; EBG00001242828.
DR   EnsemblGenomes-Gn; EBG00001242829.
DR   EnsemblGenomes-Gn; EBG00001242830.
DR   EnsemblGenomes-Gn; EBG00001242831.
DR   EnsemblGenomes-Gn; EBG00001242832.
DR   EnsemblGenomes-Gn; EBG00001242833.
DR   EnsemblGenomes-Gn; EBG00001242834.
DR   EnsemblGenomes-Gn; EBG00001242835.
DR   EnsemblGenomes-Gn; EBG00001242836.
DR   EnsemblGenomes-Gn; EBG00001242837.
DR   EnsemblGenomes-Gn; EBG00001242838.
DR   EnsemblGenomes-Gn; EBG00001242839.
DR   EnsemblGenomes-Gn; EBG00001242840.
DR   EnsemblGenomes-Gn; EBG00001242841.
DR   EnsemblGenomes-Gn; EBG00001242842.
DR   EnsemblGenomes-Gn; EBG00001242843.
DR   EnsemblGenomes-Gn; EBG00001242844.
DR   EnsemblGenomes-Gn; EBG00001242845.
DR   EnsemblGenomes-Gn; EBG00001242846.
DR   EnsemblGenomes-Gn; EBG00001242847.
DR   EnsemblGenomes-Gn; EBG00001242848.
DR   EnsemblGenomes-Gn; EBG00001242849.
DR   EnsemblGenomes-Gn; EBG00001242850.
DR   EnsemblGenomes-Gn; EBG00001242851.
DR   EnsemblGenomes-Gn; EBG00001242852.
DR   EnsemblGenomes-Gn; EBG00001242853.
DR   EnsemblGenomes-Gn; EBG00001242854.
DR   EnsemblGenomes-Gn; EBG00001242855.
DR   EnsemblGenomes-Gn; EBG00001242856.
DR   EnsemblGenomes-Gn; EBG00001242857.
DR   EnsemblGenomes-Gn; EBG00001242858.
DR   EnsemblGenomes-Gn; EBG00001242859.
DR   EnsemblGenomes-Gn; EBG00001242860.
DR   EnsemblGenomes-Gn; EBG00001242861.
DR   EnsemblGenomes-Gn; EBG00001242862.
DR   EnsemblGenomes-Gn; EBG00001242863.
DR   EnsemblGenomes-Gn; EBG00001242864.
DR   EnsemblGenomes-Gn; EBG00001242865.
DR   EnsemblGenomes-Gn; EBG00001242866.
DR   EnsemblGenomes-Gn; EBG00001242867.
DR   EnsemblGenomes-Gn; EBG00001242868.
DR   EnsemblGenomes-Gn; EBG00001242869.
DR   EnsemblGenomes-Gn; EBG00001242870.
DR   EnsemblGenomes-Gn; EBG00001242871.
DR   EnsemblGenomes-Gn; EBG00001242872.
DR   EnsemblGenomes-Gn; EBG00001242873.
DR   EnsemblGenomes-Gn; EBG00001242874.
DR   EnsemblGenomes-Gn; EBG00001242875.
DR   EnsemblGenomes-Gn; EBG00001242876.
DR   EnsemblGenomes-Gn; EBG00001242877.
DR   EnsemblGenomes-Gn; EBG00001242878.
DR   EnsemblGenomes-Gn; EBG00001242879.
DR   EnsemblGenomes-Gn; EBG00001242880.
DR   EnsemblGenomes-Gn; EBG00001242881.
DR   EnsemblGenomes-Gn; EBG00001242882.
DR   EnsemblGenomes-Gn; EBG00001242883.
DR   EnsemblGenomes-Gn; EBG00001242884.
DR   EnsemblGenomes-Gn; EBG00001242885.
DR   EnsemblGenomes-Gn; EBG00001242886.
DR   EnsemblGenomes-Gn; EBG00001242887.
DR   EnsemblGenomes-Gn; EBG00001242888.
DR   EnsemblGenomes-Gn; EBG00001242889.
DR   EnsemblGenomes-Gn; EBG00001242890.
DR   EnsemblGenomes-Gn; EBG00001242891.
DR   EnsemblGenomes-Gn; EBG00001242892.
DR   EnsemblGenomes-Gn; EBG00001242893.
DR   EnsemblGenomes-Gn; EBG00001242894.
DR   EnsemblGenomes-Gn; EBG00001242895.
DR   EnsemblGenomes-Gn; EBG00001242896.
DR   EnsemblGenomes-Gn; EBG00001242897.
DR   EnsemblGenomes-Gn; EBG00001242898.
DR   EnsemblGenomes-Gn; EBG00001242899.
DR   EnsemblGenomes-Gn; EBG00001242900.
DR   EnsemblGenomes-Gn; EBG00001242901.
DR   EnsemblGenomes-Gn; EBG00001242902.
DR   EnsemblGenomes-Gn; EBG00001242903.
DR   EnsemblGenomes-Gn; EBG00001242904.
DR   EnsemblGenomes-Gn; EBG00001242905.
DR   EnsemblGenomes-Gn; EBG00001242906.
DR   EnsemblGenomes-Gn; EBG00001242907.
DR   EnsemblGenomes-Gn; EBG00001242908.
DR   EnsemblGenomes-Gn; EBG00001242909.
DR   EnsemblGenomes-Gn; EBG00001242910.
DR   EnsemblGenomes-Gn; EBG00001242911.
DR   EnsemblGenomes-Gn; EBG00001242912.
DR   EnsemblGenomes-Gn; EBG00001242913.
DR   EnsemblGenomes-Gn; YPA_r001.
DR   EnsemblGenomes-Gn; YPA_r002.
DR   EnsemblGenomes-Gn; YPA_r003.
DR   EnsemblGenomes-Gn; YPA_r004.
DR   EnsemblGenomes-Gn; YPA_r005.
DR   EnsemblGenomes-Gn; YPA_r006.
DR   EnsemblGenomes-Gn; YPA_r007.
DR   EnsemblGenomes-Gn; YPA_r009.
DR   EnsemblGenomes-Gn; YPA_r010.
DR   EnsemblGenomes-Gn; YPA_r011.
DR   EnsemblGenomes-Gn; YPA_r012.
DR   EnsemblGenomes-Gn; YPA_r013.
DR   EnsemblGenomes-Gn; YPA_r014.
DR   EnsemblGenomes-Gn; YPA_r015.
DR   EnsemblGenomes-Gn; YPA_r016.
DR   EnsemblGenomes-Gn; YPA_r017.
DR   EnsemblGenomes-Gn; YPA_r018.
DR   EnsemblGenomes-Gn; YPA_r019.
DR   EnsemblGenomes-Gn; YPA_r021.
DR   EnsemblGenomes-Gn; YPA_r022.
DR   EnsemblGenomes-Gn; YPA_r023.
DR   EnsemblGenomes-Gn; YPA_r025.
DR   EnsemblGenomes-Gn; YPA_r026.
DR   EnsemblGenomes-Gn; YPA_r027.
DR   EnsemblGenomes-Gn; YPA_r028.
DR   EnsemblGenomes-Gn; YPA_r029.
DR   EnsemblGenomes-Gn; YPA_r030.
DR   EnsemblGenomes-Gn; YPA_r031.
DR   EnsemblGenomes-Gn; YPA_r032.
DR   EnsemblGenomes-Gn; YPA_r033.
DR   EnsemblGenomes-Gn; YPA_r034.
DR   EnsemblGenomes-Gn; YPA_r035.
DR   EnsemblGenomes-Gn; YPA_r036.
DR   EnsemblGenomes-Gn; YPA_r038.
DR   EnsemblGenomes-Gn; YPA_r039.
DR   EnsemblGenomes-Gn; YPA_r040.
DR   EnsemblGenomes-Gn; YPA_r041.
DR   EnsemblGenomes-Gn; YPA_r044.
DR   EnsemblGenomes-Gn; YPA_r045.
DR   EnsemblGenomes-Gn; YPA_r046.
DR   EnsemblGenomes-Gn; YPA_r047.
DR   EnsemblGenomes-Gn; YPA_r048.
DR   EnsemblGenomes-Gn; YPA_r049.
DR   EnsemblGenomes-Gn; YPA_r050.
DR   EnsemblGenomes-Gn; YPA_r051.
DR   EnsemblGenomes-Gn; YPA_r052.
DR   EnsemblGenomes-Gn; YPA_r053.
DR   EnsemblGenomes-Gn; YPA_r055.
DR   EnsemblGenomes-Gn; YPA_r056.
DR   EnsemblGenomes-Gn; YPA_r057.
DR   EnsemblGenomes-Gn; YPA_r058.
DR   EnsemblGenomes-Gn; YPA_r059.
DR   EnsemblGenomes-Gn; YPA_r061.
DR   EnsemblGenomes-Gn; YPA_r062.
DR   EnsemblGenomes-Gn; YPA_r063.
DR   EnsemblGenomes-Gn; YPA_r064.
DR   EnsemblGenomes-Gn; YPA_r065.
DR   EnsemblGenomes-Gn; YPA_r066.
DR   EnsemblGenomes-Gn; YPA_r067.
DR   EnsemblGenomes-Gn; YPA_r069.
DR   EnsemblGenomes-Gn; YPA_r070.
DR   EnsemblGenomes-Gn; YPA_r071.
DR   EnsemblGenomes-Gn; YPA_r072.
DR   EnsemblGenomes-Gn; YPA_r073.
DR   EnsemblGenomes-Gn; YPA_r074.
DR   EnsemblGenomes-Gn; YPA_r077.
DR   EnsemblGenomes-Gn; YPA_r078.
DR   EnsemblGenomes-Gn; YPA_r079.
DR   EnsemblGenomes-Gn; YPA_r080.
DR   EnsemblGenomes-Gn; YPA_r081.
DR   EnsemblGenomes-Gn; YPA_r082.
DR   EnsemblGenomes-Gn; YPA_r085.
DR   EnsemblGenomes-Gn; YPA_r086.
DR   EnsemblGenomes-Gn; YPA_r087.
DR   EnsemblGenomes-Gn; YPA_r088.
DR   EnsemblGenomes-Gn; YPA_r089.
DR   EnsemblGenomes-Gn; YPA_r090.
DR   EnsemblGenomes-Gn; YPA_r091.
DR   EnsemblGenomes-Gn; YPA_r092.
DR   EnsemblGenomes-Gn; YPA_r093.
DR   EnsemblGenomes-Gn; YPA_r094.
DR   EnsemblGenomes-Gn; YPA_r095.
DR   EnsemblGenomes-Gn; YPA_r096.
DR   EnsemblGenomes-Gn; YPA_r097.
DR   EnsemblGenomes-Gn; YPA_r099.
DR   EnsemblGenomes-Gn; YPA_r100.
DR   EnsemblGenomes-Gn; YPA_r101.
DR   EnsemblGenomes-Gn; YPA_r102.
DR   EnsemblGenomes-Gn; YPA_r103.
DR   EnsemblGenomes-Gn; YPA_r104.
DR   EnsemblGenomes-Tr; EBT00001588072.
DR   EnsemblGenomes-Tr; EBT00001588073.
DR   EnsemblGenomes-Tr; EBT00001588074.
DR   EnsemblGenomes-Tr; EBT00001588075.
DR   EnsemblGenomes-Tr; EBT00001588076.
DR   EnsemblGenomes-Tr; EBT00001588077.
DR   EnsemblGenomes-Tr; EBT00001588078.
DR   EnsemblGenomes-Tr; EBT00001588079.
DR   EnsemblGenomes-Tr; EBT00001588080.
DR   EnsemblGenomes-Tr; EBT00001588081.
DR   EnsemblGenomes-Tr; EBT00001588082.
DR   EnsemblGenomes-Tr; EBT00001588083.
DR   EnsemblGenomes-Tr; EBT00001588084.
DR   EnsemblGenomes-Tr; EBT00001588085.
DR   EnsemblGenomes-Tr; EBT00001588086.
DR   EnsemblGenomes-Tr; EBT00001588087.
DR   EnsemblGenomes-Tr; EBT00001588088.
DR   EnsemblGenomes-Tr; EBT00001588089.
DR   EnsemblGenomes-Tr; EBT00001588090.
DR   EnsemblGenomes-Tr; EBT00001588091.
DR   EnsemblGenomes-Tr; EBT00001588092.
DR   EnsemblGenomes-Tr; EBT00001588093.
DR   EnsemblGenomes-Tr; EBT00001588094.
DR   EnsemblGenomes-Tr; EBT00001588095.
DR   EnsemblGenomes-Tr; EBT00001588096.
DR   EnsemblGenomes-Tr; EBT00001588097.
DR   EnsemblGenomes-Tr; EBT00001588098.
DR   EnsemblGenomes-Tr; EBT00001588099.
DR   EnsemblGenomes-Tr; EBT00001588100.
DR   EnsemblGenomes-Tr; EBT00001588101.
DR   EnsemblGenomes-Tr; EBT00001588102.
DR   EnsemblGenomes-Tr; EBT00001588103.
DR   EnsemblGenomes-Tr; EBT00001588104.
DR   EnsemblGenomes-Tr; EBT00001588105.
DR   EnsemblGenomes-Tr; EBT00001588106.
DR   EnsemblGenomes-Tr; EBT00001588107.
DR   EnsemblGenomes-Tr; EBT00001588108.
DR   EnsemblGenomes-Tr; EBT00001588109.
DR   EnsemblGenomes-Tr; EBT00001588110.
DR   EnsemblGenomes-Tr; EBT00001588111.
DR   EnsemblGenomes-Tr; EBT00001588112.
DR   EnsemblGenomes-Tr; EBT00001588113.
DR   EnsemblGenomes-Tr; EBT00001588114.
DR   EnsemblGenomes-Tr; EBT00001588115.
DR   EnsemblGenomes-Tr; EBT00001588116.
DR   EnsemblGenomes-Tr; EBT00001588117.
DR   EnsemblGenomes-Tr; EBT00001588118.
DR   EnsemblGenomes-Tr; EBT00001588119.
DR   EnsemblGenomes-Tr; EBT00001588120.
DR   EnsemblGenomes-Tr; EBT00001588121.
DR   EnsemblGenomes-Tr; EBT00001588122.
DR   EnsemblGenomes-Tr; EBT00001588123.
DR   EnsemblGenomes-Tr; EBT00001588124.
DR   EnsemblGenomes-Tr; EBT00001588125.
DR   EnsemblGenomes-Tr; EBT00001588126.
DR   EnsemblGenomes-Tr; EBT00001588127.
DR   EnsemblGenomes-Tr; EBT00001588128.
DR   EnsemblGenomes-Tr; EBT00001588129.
DR   EnsemblGenomes-Tr; EBT00001588130.
DR   EnsemblGenomes-Tr; EBT00001588131.
DR   EnsemblGenomes-Tr; EBT00001588132.
DR   EnsemblGenomes-Tr; EBT00001588133.
DR   EnsemblGenomes-Tr; EBT00001588134.
DR   EnsemblGenomes-Tr; EBT00001588135.
DR   EnsemblGenomes-Tr; EBT00001588136.
DR   EnsemblGenomes-Tr; EBT00001588137.
DR   EnsemblGenomes-Tr; EBT00001588138.
DR   EnsemblGenomes-Tr; EBT00001588139.
DR   EnsemblGenomes-Tr; EBT00001588140.
DR   EnsemblGenomes-Tr; EBT00001588141.
DR   EnsemblGenomes-Tr; EBT00001588142.
DR   EnsemblGenomes-Tr; EBT00001588143.
DR   EnsemblGenomes-Tr; EBT00001588144.
DR   EnsemblGenomes-Tr; EBT00001588145.
DR   EnsemblGenomes-Tr; EBT00001588146.
DR   EnsemblGenomes-Tr; EBT00001588147.
DR   EnsemblGenomes-Tr; EBT00001588148.
DR   EnsemblGenomes-Tr; EBT00001588149.
DR   EnsemblGenomes-Tr; EBT00001588150.
DR   EnsemblGenomes-Tr; EBT00001588151.
DR   EnsemblGenomes-Tr; EBT00001588152.
DR   EnsemblGenomes-Tr; EBT00001588153.
DR   EnsemblGenomes-Tr; EBT00001588154.
DR   EnsemblGenomes-Tr; EBT00001588155.
DR   EnsemblGenomes-Tr; EBT00001588156.
DR   EnsemblGenomes-Tr; EBT00001588157.
DR   EnsemblGenomes-Tr; EBT00001588158.
DR   EnsemblGenomes-Tr; EBT00001588159.
DR   EnsemblGenomes-Tr; EBT00001588160.
DR   EnsemblGenomes-Tr; EBT00001588161.
DR   EnsemblGenomes-Tr; EBT00001588162.
DR   EnsemblGenomes-Tr; EBT00001588163.
DR   EnsemblGenomes-Tr; EBT00001588164.
DR   EnsemblGenomes-Tr; EBT00001588165.
DR   EnsemblGenomes-Tr; EBT00001588166.
DR   EnsemblGenomes-Tr; EBT00001588167.
DR   EnsemblGenomes-Tr; EBT00001588168.
DR   EnsemblGenomes-Tr; EBT00001588169.
DR   EnsemblGenomes-Tr; EBT00001588170.
DR   EnsemblGenomes-Tr; EBT00001588171.
DR   EnsemblGenomes-Tr; EBT00001588172.
DR   EnsemblGenomes-Tr; EBT00001588173.
DR   EnsemblGenomes-Tr; EBT00001588174.
DR   EnsemblGenomes-Tr; EBT00001588175.
DR   EnsemblGenomes-Tr; EBT00001588176.
DR   EnsemblGenomes-Tr; EBT00001588177.
DR   EnsemblGenomes-Tr; EBT00001588178.
DR   EnsemblGenomes-Tr; EBT00001588179.
DR   EnsemblGenomes-Tr; EBT00001588180.
DR   EnsemblGenomes-Tr; EBT00001588181.
DR   EnsemblGenomes-Tr; EBT00001588182.
DR   EnsemblGenomes-Tr; EBT00001588183.
DR   EnsemblGenomes-Tr; EBT00001588184.
DR   EnsemblGenomes-Tr; EBT00001588185.
DR   EnsemblGenomes-Tr; EBT00001588186.
DR   EnsemblGenomes-Tr; EBT00001588187.
DR   EnsemblGenomes-Tr; EBT00001588188.
DR   EnsemblGenomes-Tr; EBT00001588189.
DR   EnsemblGenomes-Tr; EBT00001588190.
DR   EnsemblGenomes-Tr; EBT00001588191.
DR   EnsemblGenomes-Tr; EBT00001588192.
DR   EnsemblGenomes-Tr; EBT00001588193.
DR   EnsemblGenomes-Tr; EBT00001588194.
DR   EnsemblGenomes-Tr; EBT00001588195.
DR   EnsemblGenomes-Tr; EBT00001588196.
DR   EnsemblGenomes-Tr; EBT00001588197.
DR   EnsemblGenomes-Tr; EBT00001588198.
DR   EnsemblGenomes-Tr; EBT00001588199.
DR   EnsemblGenomes-Tr; EBT00001588200.
DR   EnsemblGenomes-Tr; EBT00001588201.
DR   EnsemblGenomes-Tr; EBT00001588202.
DR   EnsemblGenomes-Tr; EBT00001588203.
DR   EnsemblGenomes-Tr; EBT00001588204.
DR   EnsemblGenomes-Tr; EBT00001588205.
DR   EnsemblGenomes-Tr; EBT00001588206.
DR   EnsemblGenomes-Tr; EBT00001588207.
DR   EnsemblGenomes-Tr; EBT00001588208.
DR   EnsemblGenomes-Tr; EBT00001588209.
DR   EnsemblGenomes-Tr; EBT00001588210.
DR   EnsemblGenomes-Tr; EBT00001588211.
DR   EnsemblGenomes-Tr; EBT00001588212.
DR   EnsemblGenomes-Tr; EBT00001588213.
DR   EnsemblGenomes-Tr; EBT00001588214.
DR   EnsemblGenomes-Tr; EBT00001588215.
DR   EnsemblGenomes-Tr; EBT00001588216.
DR   EnsemblGenomes-Tr; EBT00001588217.
DR   EnsemblGenomes-Tr; EBT00001588218.
DR   EnsemblGenomes-Tr; EBT00001588219.
DR   EnsemblGenomes-Tr; EBT00001588220.
DR   EnsemblGenomes-Tr; EBT00001588221.
DR   EnsemblGenomes-Tr; EBT00001588222.
DR   EnsemblGenomes-Tr; EBT00001588223.
DR   EnsemblGenomes-Tr; EBT00001588224.
DR   EnsemblGenomes-Tr; EBT00001588225.
DR   EnsemblGenomes-Tr; EBT00001588226.
DR   EnsemblGenomes-Tr; EBT00001588227.
DR   EnsemblGenomes-Tr; EBT00001588228.
DR   EnsemblGenomes-Tr; EBT00001588229.
DR   EnsemblGenomes-Tr; EBT00001588230.
DR   EnsemblGenomes-Tr; EBT00001588231.
DR   EnsemblGenomes-Tr; EBT00001588232.
DR   EnsemblGenomes-Tr; EBT00001588233.
DR   EnsemblGenomes-Tr; EBT00001588234.
DR   EnsemblGenomes-Tr; EBT00001588235.
DR   EnsemblGenomes-Tr; EBT00001588236.
DR   EnsemblGenomes-Tr; EBT00001588237.
DR   EnsemblGenomes-Tr; EBT00001588238.
DR   EnsemblGenomes-Tr; EBT00001588239.
DR   EnsemblGenomes-Tr; EBT00001588240.
DR   EnsemblGenomes-Tr; EBT00001588241.
DR   EnsemblGenomes-Tr; EBT00001588242.
DR   EnsemblGenomes-Tr; EBT00001588243.
DR   EnsemblGenomes-Tr; EBT00001588244.
DR   EnsemblGenomes-Tr; EBT00001588245.
DR   EnsemblGenomes-Tr; EBT00001588246.
DR   EnsemblGenomes-Tr; EBT00001588247.
DR   EnsemblGenomes-Tr; EBT00001588248.
DR   EnsemblGenomes-Tr; EBT00001588249.
DR   EnsemblGenomes-Tr; EBT00001588250.
DR   EnsemblGenomes-Tr; EBT00001588251.
DR   EnsemblGenomes-Tr; EBT00001588252.
DR   EnsemblGenomes-Tr; EBT00001588253.
DR   EnsemblGenomes-Tr; EBT00001588254.
DR   EnsemblGenomes-Tr; EBT00001588255.
DR   EnsemblGenomes-Tr; EBT00001588256.
DR   EnsemblGenomes-Tr; EBT00001588257.
DR   EnsemblGenomes-Tr; EBT00001588258.
DR   EnsemblGenomes-Tr; EBT00001588259.
DR   EnsemblGenomes-Tr; EBT00001588260.
DR   EnsemblGenomes-Tr; EBT00001588261.
DR   EnsemblGenomes-Tr; EBT00001588262.
DR   EnsemblGenomes-Tr; EBT00001588263.
DR   EnsemblGenomes-Tr; EBT00001588264.
DR   EnsemblGenomes-Tr; EBT00001588265.
DR   EnsemblGenomes-Tr; EBT00001588266.
DR   EnsemblGenomes-Tr; EBT00001588267.
DR   EnsemblGenomes-Tr; EBT00001588268.
DR   EnsemblGenomes-Tr; EBT00001588269.
DR   EnsemblGenomes-Tr; EBT00001588270.
DR   EnsemblGenomes-Tr; EBT00001588271.
DR   EnsemblGenomes-Tr; EBT00001588272.
DR   EnsemblGenomes-Tr; EBT00001588273.
DR   EnsemblGenomes-Tr; EBT00001588274.
DR   EnsemblGenomes-Tr; EBT00001588275.
DR   EnsemblGenomes-Tr; EBT00001588276.
DR   EnsemblGenomes-Tr; EBT00001588277.
DR   EnsemblGenomes-Tr; EBT00001588278.
DR   EnsemblGenomes-Tr; EBT00001588279.
DR   EnsemblGenomes-Tr; EBT00001588280.
DR   EnsemblGenomes-Tr; EBT00001588281.
DR   EnsemblGenomes-Tr; EBT00001588282.
DR   EnsemblGenomes-Tr; EBT00001588283.
DR   EnsemblGenomes-Tr; EBT00001588284.
DR   EnsemblGenomes-Tr; EBT00001588285.
DR   EnsemblGenomes-Tr; EBT00001588286.
DR   EnsemblGenomes-Tr; EBT00001588287.
DR   EnsemblGenomes-Tr; EBT00001588288.
DR   EnsemblGenomes-Tr; EBT00001588289.
DR   EnsemblGenomes-Tr; EBT00001588290.
DR   EnsemblGenomes-Tr; EBT00001588291.
DR   EnsemblGenomes-Tr; EBT00001588292.
DR   EnsemblGenomes-Tr; EBT00001588293.
DR   EnsemblGenomes-Tr; EBT00001588294.
DR   EnsemblGenomes-Tr; EBT00001588295.
DR   EnsemblGenomes-Tr; EBT00001588296.
DR   EnsemblGenomes-Tr; EBT00001588297.
DR   EnsemblGenomes-Tr; YPA_r001-1.
DR   EnsemblGenomes-Tr; YPA_r002-1.
DR   EnsemblGenomes-Tr; YPA_r003-1.
DR   EnsemblGenomes-Tr; YPA_r004-1.
DR   EnsemblGenomes-Tr; YPA_r005-1.
DR   EnsemblGenomes-Tr; YPA_r006-1.
DR   EnsemblGenomes-Tr; YPA_r007-1.
DR   EnsemblGenomes-Tr; YPA_r009-1.
DR   EnsemblGenomes-Tr; YPA_r010-1.
DR   EnsemblGenomes-Tr; YPA_r011-1.
DR   EnsemblGenomes-Tr; YPA_r012-1.
DR   EnsemblGenomes-Tr; YPA_r013-1.
DR   EnsemblGenomes-Tr; YPA_r014-1.
DR   EnsemblGenomes-Tr; YPA_r015-1.
DR   EnsemblGenomes-Tr; YPA_r016-1.
DR   EnsemblGenomes-Tr; YPA_r017-1.
DR   EnsemblGenomes-Tr; YPA_r018-1.
DR   EnsemblGenomes-Tr; YPA_r019-1.
DR   EnsemblGenomes-Tr; YPA_r021-1.
DR   EnsemblGenomes-Tr; YPA_r022-1.
DR   EnsemblGenomes-Tr; YPA_r023-1.
DR   EnsemblGenomes-Tr; YPA_r025-1.
DR   EnsemblGenomes-Tr; YPA_r026-1.
DR   EnsemblGenomes-Tr; YPA_r027-1.
DR   EnsemblGenomes-Tr; YPA_r028-1.
DR   EnsemblGenomes-Tr; YPA_r029-1.
DR   EnsemblGenomes-Tr; YPA_r030-1.
DR   EnsemblGenomes-Tr; YPA_r031-1.
DR   EnsemblGenomes-Tr; YPA_r032-1.
DR   EnsemblGenomes-Tr; YPA_r033-1.
DR   EnsemblGenomes-Tr; YPA_r034-1.
DR   EnsemblGenomes-Tr; YPA_r035-1.
DR   EnsemblGenomes-Tr; YPA_r036-1.
DR   EnsemblGenomes-Tr; YPA_r038-1.
DR   EnsemblGenomes-Tr; YPA_r039-1.
DR   EnsemblGenomes-Tr; YPA_r040-1.
DR   EnsemblGenomes-Tr; YPA_r041-1.
DR   EnsemblGenomes-Tr; YPA_r044-1.
DR   EnsemblGenomes-Tr; YPA_r045-1.
DR   EnsemblGenomes-Tr; YPA_r046-1.
DR   EnsemblGenomes-Tr; YPA_r047-1.
DR   EnsemblGenomes-Tr; YPA_r048-1.
DR   EnsemblGenomes-Tr; YPA_r049-1.
DR   EnsemblGenomes-Tr; YPA_r050-1.
DR   EnsemblGenomes-Tr; YPA_r051-1.
DR   EnsemblGenomes-Tr; YPA_r052-1.
DR   EnsemblGenomes-Tr; YPA_r053-1.
DR   EnsemblGenomes-Tr; YPA_r055-1.
DR   EnsemblGenomes-Tr; YPA_r056-1.
DR   EnsemblGenomes-Tr; YPA_r057-1.
DR   EnsemblGenomes-Tr; YPA_r058-1.
DR   EnsemblGenomes-Tr; YPA_r059-1.
DR   EnsemblGenomes-Tr; YPA_r061-1.
DR   EnsemblGenomes-Tr; YPA_r062-1.
DR   EnsemblGenomes-Tr; YPA_r063-1.
DR   EnsemblGenomes-Tr; YPA_r064-1.
DR   EnsemblGenomes-Tr; YPA_r065-1.
DR   EnsemblGenomes-Tr; YPA_r066-1.
DR   EnsemblGenomes-Tr; YPA_r067-1.
DR   EnsemblGenomes-Tr; YPA_r069-1.
DR   EnsemblGenomes-Tr; YPA_r070-1.
DR   EnsemblGenomes-Tr; YPA_r071-1.
DR   EnsemblGenomes-Tr; YPA_r072-1.
DR   EnsemblGenomes-Tr; YPA_r073-1.
DR   EnsemblGenomes-Tr; YPA_r074-1.
DR   EnsemblGenomes-Tr; YPA_r077-1.
DR   EnsemblGenomes-Tr; YPA_r078-1.
DR   EnsemblGenomes-Tr; YPA_r079-1.
DR   EnsemblGenomes-Tr; YPA_r080-1.
DR   EnsemblGenomes-Tr; YPA_r081-1.
DR   EnsemblGenomes-Tr; YPA_r082-1.
DR   EnsemblGenomes-Tr; YPA_r085-1.
DR   EnsemblGenomes-Tr; YPA_r086-1.
DR   EnsemblGenomes-Tr; YPA_r087-1.
DR   EnsemblGenomes-Tr; YPA_r088-1.
DR   EnsemblGenomes-Tr; YPA_r089-1.
DR   EnsemblGenomes-Tr; YPA_r090-1.
DR   EnsemblGenomes-Tr; YPA_r091-1.
DR   EnsemblGenomes-Tr; YPA_r092-1.
DR   EnsemblGenomes-Tr; YPA_r093-1.
DR   EnsemblGenomes-Tr; YPA_r094-1.
DR   EnsemblGenomes-Tr; YPA_r095-1.
DR   EnsemblGenomes-Tr; YPA_r096-1.
DR   EnsemblGenomes-Tr; YPA_r097-1.
DR   EnsemblGenomes-Tr; YPA_r099-1.
DR   EnsemblGenomes-Tr; YPA_r100-1.
DR   EnsemblGenomes-Tr; YPA_r101-1.
DR   EnsemblGenomes-Tr; YPA_r102-1.
DR   EnsemblGenomes-Tr; YPA_r103-1.
DR   EnsemblGenomes-Tr; YPA_r104-1.
DR   EuropePMC; PMC1482938; 16740952.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC3016324; 21143837.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3172189; 21931876.
DR   EuropePMC; PMC4010983; 24659774.
DR   EuropePMC; PMC4084870; 24832452.
DR   EuropePMC; PMC6620824; 31334249.
DR   GOA; P0C5Z5.
DR   InterPro; IPR011720; Thr_lead_pept.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; CP000308.
DR   SILVA-SSU; CP000308.
DR   UniProtKB/Swiss-Prot; P0C5Z5; LPT_YERPA.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773254
CC   Source DNA and bacteria available from Gary Andersen
CC   (glandersen@lbl.gov)
CC   Contacts: Gary Andersen (glandersen@lbl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4702289
FT                   /organism="Yersinia pestis Antiqua"
FT                   /strain="Antiqua"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:360102"
FT   gene            complement(270..710)
FT                   /locus_tag="YPA_0001"
FT   CDS_pept        complement(270..710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0001"
FT                   /product="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11970"
FT                   /db_xref="GOA:A0A0E1NNM9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNM9"
FT                   /protein_id="ABG11970.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDELT
FT                   LNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAIIK
FT                   LDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
FT   gene            complement(803..1264)
FT                   /locus_tag="YPA_0002"
FT   CDS_pept        complement(803..1264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0002"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11971"
FT                   /db_xref="GOA:A0A0E1NNG4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNG4"
FT                   /protein_id="ABG11971.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLTVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
FT   gene            1434..2426
FT                   /locus_tag="YPA_0003"
FT   CDS_pept        1434..2426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0003"
FT                   /product="aspartate-ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11972"
FT                   /db_xref="GOA:Q1CC50"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC50"
FT                   /protein_id="ABG11972.1"
FT                   /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQ
FT                   DNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDED
FT                   RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPFLPD
FT                   HIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWT
FT                   SPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLELEWHQS
FT                   LLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
FT   gene            complement(2525..3991)
FT                   /locus_tag="YPA_0004"
FT   CDS_pept        complement(2525..3991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11973"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC49"
FT                   /protein_id="ABG11973.1"
FT                   /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKRA
FT                   LMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDLHS
FT                   PFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQLLAE
FT                   LQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELIRLAE
FT                   QLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVMLGMSE
FT                   LEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTSGSMGGF
FT                   NEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQHFRGGTD
FT                   LAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHRFHAVAMSA
FT                   YGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
FT   gene            complement(3995..5482)
FT                   /locus_tag="YPA_0005"
FT   CDS_pept        complement(3995..5482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11974"
FT                   /db_xref="GOA:Q1CC48"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC48"
FT                   /protein_id="ABG11974.1"
FT                   /translation="MHRSLHIRLCLLAALSGESVFLLGPPGIAKSLIARRLKFAFRHAR
FT                   AFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGYLPEAEIVFLDEIWKAGPAILNT
FT                   LLTAINERRFRNGDREDSIPMRLLVTASNELPDADSSLEALYDRMLIRLWLDRVQEKQN
FT                   FRSLLISRQNENHNPVAENLSITDEEFHQWQPLIDKITLPDHCFELIFQLRQRLSALEH
FT                   APYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLKDCLWHDLNSFKLLQQQLEQLLT
FT                   EQGYQQQSLLMKLQDINSKWLQHQQQQSDHQALTVVKQSGMFSRKAQYALPDNLTDSTL
FT                   TLLLQKPLNLHDIQVNHLQVDKEALAQWLNKGGALRAKLNGVGYAQSIDAEIDDQLHII
FT                   ILDVSRQPSTLSLPGATTTSVPPELLLALTKLESTLAEQRRLFSQHQPCLFTPSSWLAK
FT                   IEASLLQVVEQLQFQQIQFQQIQFQQRKFQQQKHSGH"
FT   gene            5552..6574
FT                   /locus_tag="YPA_0006"
FT   CDS_pept        5552..6574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0006"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11975"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG11975.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            6574..7353
FT                   /locus_tag="YPA_0007"
FT   CDS_pept        6574..7353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0007"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11976"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG11976.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(7397..7507)
FT                   /locus_tag="YPA_0008"
FT   CDS_pept        complement(7397..7507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y434"
FT                   /protein_id="ABG11977.1"
FT                   /translation="MAQSSQLAERISRLSHALESGLYERQEAILSTTDEK"
FT   gene            7781..9649
FT                   /locus_tag="YPA_0009"
FT   CDS_pept        7781..9649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0009"
FT                   /product="potassium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11978"
FT                   /db_xref="GOA:Q1CC44"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC44"
FT                   /protein_id="ABG11978.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
FT   gene            9854..10273
FT                   /locus_tag="YPA_0010"
FT   CDS_pept        9854..10273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0010"
FT                   /product="ribose permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11979"
FT                   /db_xref="GOA:Q1CC43"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC43"
FT                   /protein_id="ABG11979.1"
FT                   /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALT
FT                   RGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALRYI
FT                   SHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
FT   gene            10324..11250
FT                   /locus_tag="YPA_0011"
FT   CDS_pept        10324..11250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0011"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11980"
FT                   /db_xref="GOA:A0A0E1NRQ1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRQ1"
FT                   /protein_id="ABG11980.1"
FT                   /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGAN
FT                   QAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSD
FT                   GENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVI
FT                   LNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIIT
FT                   LGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDVAVRFAHAAA
FT                   AIAVTRPGAQPSIPWRAEIDSFLQERV"
FT   gene            11303..11473
FT                   /locus_tag="YPA_0012"
FT   CDS_pept        11303..11473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11981"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4C8"
FT                   /protein_id="ABG11981.1"
FT                   /translation="MARAGLPIIAGYEVVSDFEFGGGLVALKQRLNNPEAEPQVLPLTP
FT                   ELIERGSVSLR"
FT   gene            complement(11470..12894)
FT                   /locus_tag="YPA_0013"
FT   CDS_pept        complement(11470..12894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0013"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11982"
FT                   /db_xref="GOA:A0A0E1NQP5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQP5"
FT                   /protein_id="ABG11982.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSPL
FT                   TMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLVAS
FT                   RVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTYTTW
FT                   HWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMGRPEI
FT                   ADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVP
FT                   FLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGITLIIGVL
FT                   IASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQ
FT                   LSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLKPRDGDNLI
FT                   QGRNVKKVAPQVKNNV"
FT   sig_peptide     complement(12814..12894)
FT                   /locus_tag="YPA_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.949 at
FT                   residue 27"
FT   gene            complement(12974..13666)
FT                   /locus_tag="YPA_0014"
FT   CDS_pept        complement(12974..13666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0014"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11983"
FT                   /db_xref="GOA:A0A0E1NTF4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF4"
FT                   /protein_id="ABG11983.1"
FT                   /translation="MQLNTQQQEAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELG
FT                   EQFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQV
FT                   MQHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQFHK
FT                   LIYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGALFAC
FT                   QVLLKTVD"
FT   gene            14253..15768
FT                   /locus_tag="YPA_r001"
FT   rRNA            14253..15768
FT                   /locus_tag="YPA_r001"
FT                   /product="16S RNA"
FT   gene            15905..15980
FT                   /locus_tag="YPA_r002"
FT                   /note="tRNA-Glu1"
FT   tRNA            15905..15980
FT                   /locus_tag="YPA_r002"
FT                   /product="tRNA-Glu"
FT   gene            16233..19139
FT                   /locus_tag="YPA_r003"
FT   rRNA            16233..19139
FT                   /locus_tag="YPA_r003"
FT                   /product="23S RNA"
FT   gene            19139..19371
FT                   /locus_tag="YPA_r004"
FT   rRNA            19139..19371
FT                   /locus_tag="YPA_r004"
FT                   /product="5S RNA"
FT   gene            19380..19455
FT                   /locus_tag="YPA_r005"
FT                   /note="tRNA-Thr1"
FT   tRNA            19380..19455
FT                   /locus_tag="YPA_r005"
FT                   /product="tRNA-Thr"
FT   gene            20351..21280
FT                   /locus_tag="YPA_0015"
FT   CDS_pept        20351..21280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0015"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11984"
FT                   /db_xref="GOA:Q1CC38"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC38"
FT                   /protein_id="ABG11984.1"
FT                   /translation="MPIRVPDELPAVSFLRNENVFVMASSRAKTQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQNFDGLI
FT                   VTGAPLGLVDFCDVAYWPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVK
FT                   LSGIYQHQTLEPLALLTRGFDETFLAPHSRYADFPVEVLQQYTDLDILVSSEEAGAYLF
FT                   ASKDKRVAFVTGHPEYDVDTLAGEYQRDLAAGLNPQVPLNYFPSDDASLRPKASWRSHG
FT                   HLLFANWLNYYVYQITPFDLRHMNPTLD"
FT   gene            complement(21480..21623)
FT                   /locus_tag="YPA_0016"
FT   CDS_pept        complement(21480..21623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y438"
FT                   /protein_id="ABG11985.1"
FT                   /translation="MSLPVKKAEFYGYFSPDRNKNNQLIHKIKNDFHFYGKYFFNLYLS
FT                   YR"
FT   gene            21701..23299
FT                   /locus_tag="YPA_0017"
FT   CDS_pept        21701..23299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0017"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11986"
FT                   /db_xref="GOA:A0A0E1NR64"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR64"
FT                   /protein_id="ABG11986.1"
FT                   /translation="MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQ
FT                   LLATRASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVIN
FT                   ALNANVKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLI
FT                   ARVRGLHLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAA
FT                   WWSDVFNFTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFS
FT                   YIKTLKNHPDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEK
FT                   NKLVLDKVRADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPI
FT                   TAAELLEPCSGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIW
FT                   QWIHHQKSLSNGQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQD
FT                   ELIDFLTLPGYALLA"
FT   gene            23346..24653
FT                   /locus_tag="YPA_0018"
FT   CDS_pept        23346..24653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0018"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11987"
FT                   /db_xref="GOA:A0A0E1NWH9"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWH9"
FT                   /protein_id="ABG11987.1"
FT                   /translation="MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECT
FT                   FAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTAS
FT                   SMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGF
FT                   GGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAAD
FT                   VLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYA
FT                   PYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDE
FT                   LSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFAS
FT                   HQQEVGTGYFDKVTNIIQGGASSVTALTGSTEEQQF"
FT   gene            24909..26636
FT                   /locus_tag="YPA_0019"
FT   CDS_pept        24909..26636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0019"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11988"
FT                   /db_xref="GOA:Q1CC34"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC34"
FT                   /protein_id="ABG11988.1"
FT                   /translation="MVAKLEQLIAQTILQGFDAQYGRFLEVTAGAQHRFEQADWHAVQQ
FT                   AMKKRIHLYDHHVGLVVEQLKYITDQRHFDVEFLARVKEIYTGLLPDYPRFEIAESFFN
FT                   SVYCRLFKHRDLTPDKLFVFSSQPERRFREIPRPLARDFIPKGDLSGMLQMVLNDLSLR
FT                   LHWENLSRDIDYIVMAIRQAFTDEQLASAHFQIANELFYRNKAAWLVGKLRLNGDIYPF
FT                   LLPIHHNESGELFIDTCLTSKAEASIVFGFARSYFMVYVPLPAAMVEWLREILPGKSTA
FT                   ELYTAIGCQKHGKTESYREYLAFIHQSSEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKD
FT                   QFAPQKEVTQARVLECYQLVKEHDRVGRMADTQEYENFVIDKHRISPELLAELQHEVPE
FT                   KLEDLGDKIVIKHLYMERRMTPLNLYMEQADDQQLKDAIEEYGNAIKQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDEMASEPWYSVSPNDVFPEE
FT                   FRHFLCSDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN"
FT   gene            complement(26756..27349)
FT                   /locus_tag="YPA_0020"
FT   CDS_pept        complement(26756..27349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0020"
FT                   /product="repressor of aceBA operon"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11989"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y209"
FT                   /protein_id="ABG11989.1"
FT                   /translation="MDHGGPHAFIVGSSFLQSRNLLAMVHPMLRRLMDESGETVNLAVL
FT                   DHSDYQAIIIDQVQCTALMRMSAPIGGKLPMHASGAGKAFLSTLPDDQLVQLLHKKGLH
FT                   AYTQHTRTNPTSLKENLALIRKQGYSFDDEEHALGLRCIAACLFDEHHEAFAAISISGP
FT                   ISRITDDRVTELGALVIHAAKEITQSYGGGTGVK"
FT   gene            27815..31510
FT                   /locus_tag="YPA_0021"
FT   CDS_pept        27815..31510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0021"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11990"
FT                   /db_xref="GOA:A0A0E1NU22"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU22"
FT                   /protein_id="ABG11990.1"
FT                   /translation="MVDTVIDNKVKELHQQLAQRILVLDGGMGTMIQSYRLEEADYRGA
FT                   RFADWASDLKGNNDLLVLSKPEVITAIHNAYLEAGADILETNTFNSTSIAMADYQMASL
FT                   SAEINYEAARLARICADEWSARTPEKPRYVAGVLGPTNRTASISPKVNDPAFRNVSFDQ
FT                   LVEAYRESTRALIEGGVDLIMIETVFDTLNAKAATFAVESEFEVMGVLLPVMISGTITD
FT                   ASGRTLSGQTTEAFYNSLRHVKPLSFGLNCALGPDELRQYVAELSRISEYYVSAHPNAG
FT                   LPNAFGEYDLEAKEMAEQIGEWARAGFLNIVGGCCGTTPRHIAAMVNAVAGVPPRPLPD
FT                   IPVACRLAGLEPLTIDANTLFVNVGERTNVTGSARFKRLIKEEKYGEALDVARQQVESG
FT                   AQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSRWDVIEKGLKCIQGKGI
FT                   VNSISMKEGVDAFIHHAKLVRRYGAAMVVMAFDETGQADTRARKIEICRRAYKILTETV
FT                   GFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEACADIKAELPHALISGGVSNVSFSFRG
FT                   NDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLSDELRDAVEDVILNRRDDSTER
FT                   LLDLAEKYRDSKSGEVAIQQAEWRGWPVVKRLEYSLVKGITEFIELDTEEARQQADRPI
FT                   EVIEGPLMSGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPYIEASKQKGTTAGKI
FT                   LLATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPTEKILRTAREEKVDIIGLSGLIT
FT                   PSLDEMVNVAKEMERQGFTLPLLIGGATTSKAHTAVKIEQNYSGSTTYVSNASRSVGVV
FT                   SALLSDTQREAFVAKTRKEYETVRIQHARKKPRTPPVSLQAARNNPTVIDWENYTPPVA
FT                   HKLGVQVVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEEAKRLLADANALLD
FT                   KLSAEDLLHPKGVVGLFPANSVGDDIEIYRDERRDEVLAISYHLRQQTEKTDFPNYCLA
FT                   DYVAPKSSGKADYFGAFAVTGGLEEDALADAYDAQHDDYNKIMIKALSDRLAEAFAEYL
FT                   HERVRKVYWGFAPNENLSNEELVRENYQGIRPAPGYPACPEHTEKGQIWQLLDVETHTG
FT                   MKLTESYAMWPGASVSGWYFSHPDSKYFAVAQIQRDQVEDYAARKGMPTAEVERWLAPN
FT                   LGYDAD"
FT   gene            complement(31606..36513)
FT                   /locus_tag="YPA_0022"
FT   CDS_pept        complement(31606..36513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0022"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11991"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLC8"
FT                   /protein_id="ABG11991.1"
FT                   /translation="MKKHTFKLSPAGKLAAAVTIISVSVATCYAAGIVGAGDSAHKPDV
FT                   SSVNGTSVINIVQPSASGLSHNQFQDFNVGEKGAVLNNATSAGNSILAGQLAANQNLNG
FT                   QAASIILNEVISRNPSLLLGQQEIFGMTADYILANPNGITCNGCGFMNTNRESLVVGNP
FT                   LIEQGSLKGFETFNNNNWLIIQDKGLTANKILDLIAPRIEVTGMVTSTEAINALSGNNQ
FT                   ISTDGQILESRQEDHPNRPTSLGGWFSSLFSSESEESIDGKYLGSMQSGRINLVSTREG
FT                   SGVKIAGSLNGSEEINATIKGKLQLEAAKLGGNDININANSIQAFGNLHKNEDNGGVTQ
FT                   SLERTQLKGKNIAIVANKKNQLSAVKIDADNVTLRGGELVLDERILTKTEQESSSDGGN
FT                   GVLGLGKWNWSENKEEKQQTSIGTTITAKNNASLESTQDDIKLSAATITAGKNLAIKAK
FT                   KDLHIDGAIEENSIHDYGHNYKHMVKDESWNNKTTKQTLNKTTLEAGKNLGLTAENKIT
FT                   TQGIKASAGGDVVIDANDVKIGVQKTSNQETTDGKHERNLGLGGVDHNNNDKYAETSHS
FT                   SEITADGNILISVKDDVAITGSKVKATKDGFVQAKEGGIKIDNAISTTTNKVDERTGVA
FT                   FDITGSSKKANNSEEKSTGSEVVSEANLKIISKKDVDVIGSLVKSAGELGIETLGDINV
FT                   AAAQEKQKIDEQKTLLTIDGFTSDDGKNQYQAGLKVEHTSESEKTEKVINHGSTLEGGT
FT                   VKLEADKDVTFTGSQLNTTKGDADITAENVSFVAAQDTTTSNKEKETVGVNAHYTGGMD
FT                   KAGSGAGVSYEETKTDSEKSTAVVSHTDVKGDLNLNAKQEITNQGTDHNVEGSYAANAT
FT                   NVNNLAAENSETTTTTTNTVDVKYGGNIAYDGVTRPVEKTIESGKKLDVGGVIENVGNV
FT                   APDSVNAGVDLSVNVGEKENKSSNSQAVVTSIKSGDISITAKEDVKDQGTHYQADKGGI
FT                   KIDAANHTFESAVNRAEESEKVVSGGVDMRIYTTTGEDINVDAKGKGENKQQEVKAEQA
FT                   QTGSMKAVGDIIINVQENARYQGTDLDSGDGKIAITAGEEIKFEQATSHLSENHNKIDA
FT                   NAKANFGTKPNSKDFGGGLGGGHSQGSTSADIAQVSHLHGKQGIELNAGKDLTLQGTEF
FT                   GSKNAATGDVQLTAGGKVDFQAAQSQSSKQDMTWSASVKAGKSKSNSTSENDDGTKTHT
FT                   NNKGFSAGAEANVKNTDETSLTHQGGIINSNGAVTIKADGKDQQAIHLQNTNIISQETI
FT                   LNADNGGIVMESAQDKEHKNNWNVNTNLNGSQKNTIKSDDQGVVDKDSAKKIHNAAIKL
FT                   DGGVDKLDSVTQQNTHINSDKVTLNSAKNTELAGAVLQANQISGQIGGDLNVISRENRL
FT                   NKVNVSAALGGSHSNAKQDSLISQVANASPIMSDKIKNKLEEKSTKIFDKVENKFNTLG
FT                   KEKDDSVQTISYTKDGQTVKISEADEKKETKDKWWQKGAKSVGKKIKSAVQDEQVVGGN
FT                   GSVKANVEVVESQGVEEQSAIRGTQNVDLTVKGKTDLVGGKISSKNSDVKLKTNGLETQ
FT                   DINGKYTEGGARLNASSSVMDMISDGAKDVMDGKAPLVSGHGKSEQKNATGGITRE"
FT   sig_peptide     complement(36421..36513)
FT                   /locus_tag="YPA_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.899 at
FT                   residue 31"
FT   gene            complement(36583..38082)
FT                   /locus_tag="YPA_0023"
FT   CDS_pept        complement(36583..38082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0023"
FT                   /product="hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11992"
FT                   /db_xref="GOA:A0A0H2Y306"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y306"
FT                   /protein_id="ABG11992.1"
FT                   /translation="MNYLVRPPPPAPVLPEDTQCLPINGVYIQGITLLTEDDLSELSAI
FT                   PEQCIHPDNINLLTRELTHIYMDKGYITARIQFIPPDADGKLGLDITEGFVEAIDSTDT
FT                   GLDGETVFPNMIGKPLNITRLDQGLDQANRLPSNKVTVDILPGTLPGGSILKLHNTPST
FT                   PWHLTTSMDNYGNKNTGKWLSRNALSFDNPLGLSDSVSINISNTVDRPQHNYSRAYSMF
FT                   YSVPYGALTFSGFGSYAEYRYPMKLQFNTAKLHGETQQHGLRADYVFYRDQSQINGLSA
FT                   QLTYKRASNYLNEEKIAISSPTLTIFELGLNHLHVLPMGLFNINVSLEQGLPWLGAERS
FT                   NGPLANYQDSQFTKAKTSITSNHYFALFDDTYLFSNQFYGQYTRDRLPGVEWLSITDSS
FT                   AIRGFSRNTLSADQGWYLQNTLSRRFTLGDATLTPRVGLDTGRLQQKPQGWVSAMGLSA
FT                   GVSLNYQNATLDIEASRGRLLSGPSKINDPTQILARFSYRF"
FT   gene            complement(38012..38359)
FT                   /locus_tag="YPA_0024"
FT   CDS_pept        complement(38012..38359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11993"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT79"
FT                   /protein_id="ABG11993.1"
FT                   /translation="MLPVNLTQGQKELRLQINLFGQSISQSDIMIRKRTALWLVLSTGA
FT                   QAETPLAIETPSSINESRQSLQNNAKEINQLVEEKRHQQITQHNTGQSELSRPAPPPCT
FT                   GVTRRYAVPTH"
FT   gene            complement(38840..40225)
FT                   /locus_tag="YPA_0025"
FT   CDS_pept        complement(38840..40225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0025"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11994"
FT                   /db_xref="GOA:A0A0E1NTB7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTB7"
FT                   /protein_id="ABG11994.1"
FT                   /translation="MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDV
FT                   RLVILSASAGITNLLVALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRML
FT                   ENIAMLSEAASLATSPALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDR
FT                   FGRAEPDTSALAELAQTLLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGE
FT                   ALNVSRIDIWTDVPGIYTTDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVR
FT                   SDIPMFVGSSKDPAAGGTLVCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEV
FT                   FNILARHSISVDLITTSEVSVALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLA
FT                   LVAIIGNNLSQACGVGKEVFGVLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYN
FT                   LFE"
FT   gene            40595..42241
FT                   /locus_tag="YPA_0026"
FT   CDS_pept        40595..42241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0026"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11995"
FT                   /db_xref="GOA:Q1CC27"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC27"
FT                   /protein_id="ABG11995.1"
FT                   /translation="MKNINPSQTAAWKALQQHFEQMKDVTISSLFAKDDQRFNRFSATF
FT                   DDQMLVDFSKNRITSETLEKLQDLAKETDLAGAIKSMFSGEKINRTEDRAVLHIALRNR
FT                   SNTPIVVDGKDVMPEVNAVLAKMKQFCDRVISGDWKGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLNMHFVSNVDGTHIAEALKPLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLSAAGDPAHVAKHFAALSTNAKAVGEFGIDTNNMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSVGFEHFEQLLSGAHAMDKHFAETPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGHPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLSDHHAKLLSNFFAQTEALAFGKSLEDVEAEFAAAGKTPEQVAHVA
FT                   PFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGVILNIYTFDQWGVELGKQLA
FT                   NRILPELADDQEVTSHDSSTNALINRFKNWR"
FT   gene            42376..42783
FT                   /locus_tag="YPA_0027"
FT   CDS_pept        42376..42783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0027"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11996"
FT                   /db_xref="GOA:Q1CC26"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC26"
FT                   /protein_id="ABG11996.1"
FT                   /translation="MAKNSRSQWIAKNLQRLLNVGLIMLAAILVVFLVKETIHLGKVLF
FT                   LSNQETSSYMLIEGIVIYFLYFEFIALIVKYFESGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ENPIDTLIYSGSILVLVVTLYLANTERLKRE"
FT   gene            complement(42926..43816)
FT                   /locus_tag="YPA_0028"
FT   CDS_pept        complement(42926..43816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0028"
FT                   /product="maltose transport system permease protein MalG"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11997"
FT                   /db_xref="GOA:A0A0E1NW61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW61"
FT                   /protein_id="ABG11997.1"
FT                   /translation="MAMVQPKSQRLRLLGTHFLMLCFIALIMFPLLMVIAISLRPGNFA
FT                   TGSLIPDQISWEHWKLALGMSVTHADGSVTPPPFPVMLWLWNSIKIALITAMGIVALST
FT                   TCAYAFARMRFRGKSALLKGMLIFQMFPAVLSLVALYALFDRIGQYMPFIGLNTHGGVI
FT                   FAYMGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITTVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   gene            complement(43830..45407)
FT                   /locus_tag="YPA_0029"
FT   CDS_pept        complement(43830..45407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0029"
FT                   /product="maltose transport system permease protein MalF"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11998"
FT                   /db_xref="GOA:A0A0E1NUY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUY7"
FT                   /protein_id="ABG11998.1"
FT                   /translation="MQLSHTELQSRKKKIAWWQSDALKWLVISLLSLFTCYLIVLMYAQ
FT                   GEYLFAIVTLILVSLGLYVFANRRAYAWRYVYPGVAGMGLFVLFPLICTIAIAFTNYSS
FT                   TNQLTFERAQSVLLDRQFQTGKTFTFGLYPSDNQWRLQLTNPDDGSLFISEPFSFEATG
FT                   EQKVMVAPTNTAQTSEPASLRIITQSRQALSSLVAILPDGAELRMSSLRQFSGTKPLYT
FT                   LGADGKELINQQTGVKYWPNPSTGFYQAVNADGQWENEKLSPGFTVSIGWKNFLRVLHD
FT                   EGIQKPFISIFIWTILFSVMSVTFTVAVGMVLACVVQWDSLKGKAIYRVMLILPYAVPS
FT                   FISILIFKGLFNQSFGEINLMLSHLFGIKPAWFSDPITAKSMILIVNTWLGYPYMMILC
FT                   MGLLKAIPDDLYEASAMDGAGPFQNFFRITFPLLIKPLTPLMIASFAFNFNNFVLIQLL
FT                   TNGGPDMIGTSTPAGYTDLLVNYTYRVAFEGEGGQDFGLAAAIATLIFILVGALAILNL
FT                   KASKMNFD"
FT   gene            complement(45594..46805)
FT                   /locus_tag="YPA_0030"
FT   CDS_pept        complement(45594..46805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0030"
FT                   /product="maltose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11999"
FT                   /db_xref="GOA:A0A0E1P2V5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2V5"
FT                   /protein_id="ABG11999.1"
FT                   /translation="MTRSFTKSGIGKTARVLALSALTTLVLSSSAFAKIEEGKLVIWIN
FT                   GDKGYNGLAEVGKKFEKDTGIKVTIEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYA
FT                   QSGLLAELTPSKAFQEKLFPFTWDAVRFNGKLIGYPVAVEALSLIYNKDLVKEAPKTWE
FT                   EIPALDKTLRANGKSAIMWNLQEPYFTWPVIAADGGYAFKFENGVYDAKNVGVNNAGAQ
FT                   AGLQFIVDLVKNKHINADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKINYGVTLLP
FT                   TFHGQPSKPFVGVLTAGINAASPNKELATEFLENYLITDQGLAEVNKDKPLGAVALKSF
FT                   QEQLAKDPRIAATMDNATNGEIMPNIPQMAAFWYATRSAVLNAITGRQTVEAALNDAAT
FT                   RITK"
FT   sig_peptide     complement(46704..46805)
FT                   /locus_tag="YPA_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            47393..47629
FT                   /locus_tag="YPA_0031"
FT   CDS_pept        47393..47629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRQ9"
FT                   /protein_id="ABG12000.1"
FT                   /translation="MRLIITLLDQYVEALFNVQPYTQAATPSGATLPLAWRHGAQRESH
FT                   QGTGGNQWVMPGFASTVFLHSDSYEKLFAQAKE"
FT   gene            47633..48742
FT                   /locus_tag="YPA_0032"
FT   CDS_pept        47633..48742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0032"
FT                   /product="maltose/maltodextrin transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12001"
FT                   /db_xref="GOA:Q1CC21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC21"
FT                   /protein_id="ABG12001.1"
FT                   /translation="MANVTLSSVYKAFGEAVISRDINLEIDDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELLIGGKRMNEVPPSERGIGMVFQSYALYPHLSVAENMSFGLKLAG
FT                   VKKAEIYQRVNQVAEVLQLAHLLDRRPKALSGGQRQRVAIGRTLVSEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLERTMIYVTHDQVEAMTLADKIVVLDAGNIAQVGKPLELY
FT                   HYPANRFVAGFIGSPKMNFLPVKVTAAEPRQVQIELPNHQRVWLPVEGDQVQVGANMSL
FT                   GIRPEHLLPSSASEVTLEGEIQVVEQLGNETQIHIQIPAIRQNLVYRQNDVVLVEEGAT
FT                   FSIGLPPHRCHLFREDGTACKRLYQELGV"
FT   gene            48813..50084
FT                   /locus_tag="YPA_0033"
FT   CDS_pept        48813..50084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0033"
FT                   /product="maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12002"
FT                   /db_xref="GOA:Q1CC20"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC20"
FT                   /protein_id="ABG12002.1"
FT                   /translation="MITLRKLPIALAVAAGVLSTQAMAVDFHGYARSGIGWTASGGEQQ
FT                   CFQTTGAQSKYRLGNECETYAELKLGQELWKEGDKSFYLDTNVAYSVSQRDDWESTDPA
FT                   FREANVQGKNLIESLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLETIDLGFGKL
FT                   SVAATRNSESGGSSAWIDNQRENAKYTINNVYDVRLAGLETNPGGSLELGVDYGRADTQ
FT                   EGYSLAPNASKDGVMLTAEHTQSLMGGFNKFVVQYATDSMTSYNTGHSQGTSVNNNGHL
FT                   LRVIDHGAINLAEKWDMMYVALYQDIDLDNNNGNTWYSVGVRPMYKWTPIMSTLLEAGY
FT                   DNVKSQHTGERNGQYKLTLAQQWQAGDSIWSRPAIRVFATYANWDEKWGYSDTTGVAQD
FT                   GTIGTNSRGKNNEVTFGAQFEAWW"
FT   sig_peptide     48813..48887
FT                   /locus_tag="YPA_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            50325..51236
FT                   /locus_tag="YPA_0034"
FT   CDS_pept        50325..51236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0034"
FT                   /product="maltose operon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12003"
FT                   /db_xref="GOA:A0A0E1NYD4"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYD4"
FT                   /protein_id="ABG12003.1"
FT                   /translation="MKKNLLSLCLVLALGGTAPLAVQAASTISPANVSIAPTISTTTLQ
FT                   QLPWQPLVPPVTQDIQLTAGSPHISQGEVEGAVAAFALPADRGSLEVTLSSLLTDKQLF
FT                   TPSVLVLDEQMRPAAYYPSSYFTYEKAGIMINDRLQGVMKLTPALGQKQIYLLVYTTRD
FT                   DLKKTTQLLDPAKAYAQGVGNAVPDIPDPIVNHSPTGTLRIKVTSEQGMGNIMIGLIQS
FT                   APTSAPVVVGSSIQPVAAPQSEPAKPAAPMLGETENYFNQAIKDAVKAGDVDKALKLLN
FT                   EAEHLGSTSARKTFIGSVKGKG"
FT   sig_peptide     50325..50399
FT                   /locus_tag="YPA_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            51575..51985
FT                   /locus_tag="YPA_0035"
FT   CDS_pept        51575..51985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM01"
FT                   /protein_id="ABG12004.1"
FT                   /translation="MSDINKQINHANDSHFFCHSMTLNMTGSSLVVEKNPVGNFLKFAM
FT                   NFPNLLLLFSDGTLIKQVERELKTHLICNEFVKNKSKIVTVYITLGNDALLLIYYSNRV
FT                   FYKKSYIKCGDIACMNYTVNEGYLTTEIILWR"
FT   gene            complement(52137..52655)
FT                   /locus_tag="YPA_0036"
FT   CDS_pept        complement(52137..52655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12005"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUY2"
FT                   /protein_id="ABG12005.1"
FT                   /translation="MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFE
FT                   HIVTVPTDPQSGQPSGQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIE
FT                   GKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGA
FT                   DDWRAPIEA"
FT   gene            53179..53676
FT                   /locus_tag="YPA_0037"
FT   CDS_pept        53179..53676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12006"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY17"
FT                   /protein_id="ABG12006.1"
FT                   /translation="MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGV
FT                   REETSIEERQVVSVNKNNFNSVMNEANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFS
FT                   PDNVAKKVPELKKILELREALVALKGPLGNIPAFRSRLQDLLGNEDMREQLLKELDILN
FT                   QK"
FT   gene            53744..55225
FT                   /locus_tag="YPA_0038"
FT   CDS_pept        53744..55225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12007"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMQ7"
FT                   /protein_id="ABG12007.1"
FT                   /translation="MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVA
FT                   AFISSILDTGTNEEPINKLLVDRMIIELDKKLSAQMDEILHANEFREIESSWRSLKLLV
FT                   DRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGFYKHVYSSGYGQFGGEPTAAIIGN
FT                   YAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIKDLKSVFEGPAH
FT                   TKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAFL
FT                   LASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFEL
FT                   AEEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFVINRL
FT                   AHYIKVLQREQIGSWKERQDLERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDV
FT                   EGDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
FT   gene            55232..55672
FT                   /locus_tag="YPA_0039"
FT   CDS_pept        55232..55672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12008"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXT5"
FT                   /protein_id="ABG12008.1"
FT                   /translation="MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNE
FT                   VLNSRPGACQSAVDLGVIDLNDATATSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLN
FT                   HGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRYCFNQET"
FT   gene            55672..56898
FT                   /locus_tag="YPA_0040"
FT   CDS_pept        55672..56898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12009"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ47"
FT                   /protein_id="ABG12009.1"
FT                   /translation="MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLL
FT                   EGFAFLTGNLREKIDDQFPELTHGLLNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVK
FT                   RGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCRDVWLFPMSIREISANSSNEQGIL
FT                   SIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAELVVNGITIPMPDF
FT                   DFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFSL
FT                   NLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYD
FT                   IFSVDRVDSWLSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVI
FT                   MDIFYNVTL"
FT   gene            complement(56788..57573)
FT                   /locus_tag="YPA_0041"
FT   CDS_pept        complement(56788..57573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0041"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12010"
FT                   /db_xref="GOA:Q1C0C3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C0C3"
FT                   /protein_id="ABG12010.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(57627..58163)
FT                   /locus_tag="YPA_0042"
FT   CDS_pept        complement(57627..58163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0042"
FT                   /product="insertion element IS1661 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12011"
FT                   /db_xref="GOA:A0A0H2Y324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y324"
FT                   /protein_id="ABG12011.1"
FT                   /translation="MIWRFGSMKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTR
FT                   WIRAFRRQGEAGLEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWM
FT                   KRYREGGKEALNPSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKA
FT                   LREEKALREQQKKPE"
FT   gene            complement(58229..58498)
FT                   /locus_tag="YPA_0043"
FT   CDS_pept        complement(58229..58498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0043"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12012"
FT                   /db_xref="GOA:Q1CC10"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC10"
FT                   /protein_id="ABG12012.1"
FT                   /translation="MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSE
FT                   HKKDHHSRRGLLRMVSTRRKLLDYLKRQDVARYASLIERLGLRR"
FT   gene            complement(58620..59594)
FT                   /locus_tag="YPA_0044"
FT   CDS_pept        complement(58620..59594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0044"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12013"
FT                   /db_xref="GOA:Q1CC09"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC09"
FT                   /protein_id="ABG12013.1"
FT                   /translation="MGRPRRRGRDINGVLLLDKPLGLSSNDVLQKVKRLFSANRAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDSDKRYRVVARLGQRTDTSDAEGALISEREVNLT
FT                   QAQIDTALESFRGESQQIPSMYSALKHQGKPLYEYARQGIEVEREARSITVYELLFIRW
FT                   EGNDLELEIHCSKGTYIRTIIDDLGELLGCGAHVSYLRRLQVATYPSERMVTLEQLTAM
FT                   VEAAQAEGRSPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHVSGAPSEGMV
FT                   RITEGKERNFIGIGTIAEDGRVAPKRLVVESVEVENLPVENKK"
FT   gene            complement(59594..60004)
FT                   /locus_tag="YPA_0045"
FT   CDS_pept        complement(59594..60004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0045"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12014"
FT                   /db_xref="GOA:Q1CC08"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC08"
FT                   /protein_id="ABG12014.1"
FT                   /translation="MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRD
FT                   LAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDN
FT                   SLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK"
FT   gene            complement(60070..62724)
FT                   /locus_tag="YPA_0046"
FT   CDS_pept        complement(60070..62724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0046"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12015"
FT                   /db_xref="GOA:Q1CC07"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC07"
FT                   /protein_id="ABG12015.1"
FT                   /translation="MTDVTVKSLAAEIQTPVDRLVQQFADAGIKKSDVDSVTQQEKEIL
FT                   LAHLNREHGSVPNKLTLQRKTRSTLNIPSTGGKSKSVQIEVRKKRTYVNTPEAEQAKAE
FT                   EQAQREAEATAQKIAEEKAKREAEEQAKREAAEKAKRQAAEKEKVTNQQTDEKTKPAQT
FT                   DKARREAEAAELKRSVEEETRRKVEEDAKRVAEEARKMAAENEGKWPEPVAEQTESADY
FT                   HVTTSQHARAAEDENDAKVEGDRRSRTRGGKATKQKKGNKLSESKADREEARAVGRKGK
FT                   RKPSTLQQSFNKPVVAVNRDVVIGETVTVAELANKMAVKGSQVIKAMMKLGAMATINQV
FT                   IDQETAQLVAEEMGHKVILRRENELEEALMSDRDIGVEAAAEHRAPVVTIMGHVDHGKT
FT                   SLLDYIRSTKVASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTSMRARGAQATDI
FT                   VVLVVAADDGVMPQTIEAIQHAKAANVPVVVAVNKIDKPEADPDRVKTELSQYGIQPEE
FT                   WGGESQFINVSAKAGIGIDELLNAILLQAEVLELKAVRTGMANGVVIESFLDKGRGPVA
FT                   TVLVQQGTLNKGDIVLCGFEYGRVRAMRDELGRDITSVGPSIPVEILGLSSVPAAGDEV
FT                   TVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANMTEGEVSELNIVIKSDVQGS
FT                   CEAICDSLEKLSTDEVKVRIVGSGVGGITETDATLAAASGAIILGFNVRADASARRVVE
FT                   TEGLDLRYYSVIYSLIDEVKQAMSGMLAPEYKQQIIGLAEVRDVFKSPKFGAIAGCMVT
FT                   EGVIKRNNPIRVLRDNVVIYEGELESLRRFKDDVSEVRNGMECGIGVKNYNDVRTGDVI
FT                   EVFEIIEIKRTIA"
FT   gene            complement(62749..64236)
FT                   /locus_tag="YPA_0047"
FT   CDS_pept        complement(62749..64236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0047"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12016"
FT                   /db_xref="GOA:A0A0E1NWM9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWM9"
FT                   /protein_id="ABG12016.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEV
FT                   RVSIDRKTGDFDTFRRWVAVDEVTMPTREITLDAAQFEDPSLQLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGHNAEAVIG
FT                   REDMLPRENFRPGDRIRGVLYDVRPEARGAQLFVSRSRSEMLVELFRIEVPEIGEELIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT
FT                   ADDLQAKHQAEAHAAIDTFTKYLDIDEDFATVLVEEGFSSLEELAYVPMKELLEIDGLD
FT                   EDTVEALRDRAKAALTTLALAQEESFGDQKPADDLLNLAGLERSMAFKLAARGVCTLED
FT                   LAEQGIDDLADIEGLSDEQAGELIMAARNICWFGDNA"
FT   gene            complement(64258..64710)
FT                   /locus_tag="YPA_0048"
FT   CDS_pept        complement(64258..64710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12017"
FT                   /db_xref="GOA:Q1CC05"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC05"
FT                   /protein_id="ABG12017.1"
FT                   /translation="MSTLEQKLTEIISAPVEALGYELVGIEFIRGRQSTLRIYIDSDDG
FT                   ITVDACADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPMFTAEHYTRYLGEEVTLVLR
FT                   MAMQNRRKWQGIIKAVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
FT   gene            complement(64926..65002)
FT                   /locus_tag="YPA_r006"
FT                   /note="tRNA-Met6"
FT   tRNA            complement(64926..65002)
FT                   /locus_tag="YPA_r006"
FT                   /product="tRNA-Met"
FT   gene            complement(65063..65149)
FT                   /locus_tag="YPA_r007"
FT                   /note="tRNA-Leu6"
FT   tRNA            complement(65063..65149)
FT                   /locus_tag="YPA_r007"
FT                   /product="tRNA-Leu"
FT   gene            complement(65242..65577)
FT                   /locus_tag="YPA_0049"
FT   CDS_pept        complement(65242..65577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0049"
FT                   /product="protein translocase subunit secG"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12018"
FT                   /db_xref="GOA:A0A0E1NUS6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUS6"
FT                   /protein_id="ABG12018.1"
FT                   /translation="MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGS
FT                   NGSGNFMTRMTAVLATLFFVISLILGNMSSNQGQKSSEWENLGQPLKTEQTATPVAPVK
FT                   PSSDIPQ"
FT   gene            complement(65800..67140)
FT                   /locus_tag="YPA_0050"
FT   CDS_pept        complement(65800..67140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0050"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12019"
FT                   /db_xref="GOA:Q1CC03"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC03"
FT                   /protein_id="ABG12019.1"
FT                   /translation="MSNRKYFGTDGIRGKVGESPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PFYDNGIKFFSIDGTKLPDDVEEAIEAEMEKPLTCVESAELGKANRIVDAAGRYIEFCK
FT                   GTFPSELSLNELKIVVDCANGATYHIAPSVLRELGATVITIGCEPDGMNINEECGATDV
FT                   RLLQERVLAEGAHVGLAFDGDGDRLMMVDHLGNKVDGDQILYIIAREGLRQGQLKGGAV
FT                   GTLMSNMGLQLALKDLGIPFVRAKVGDRYVLEAMQEKGWRIGAENSGHVILLDKTTTGD
FT                   GIVAGLQVLTAMVRNHMSLHDLCSGMKLLPQILVNVRFSGEHNPLKSDEVEEVTRQVEK
FT                   ELGGRGRVLLRKSGTEPLIRVMVEGDAEESLIAEMANRIADAVKAAG"
FT   gene            complement(67150..67983)
FT                   /locus_tag="YPA_0051"
FT   CDS_pept        complement(67150..67983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0051"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12020"
FT                   /db_xref="GOA:A0A0E1NM97"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM97"
FT                   /protein_id="ABG12020.1"
FT                   /translation="MHLTARGLTLDLSRPQVMGILNVTPDSFSDGGCHNNLDQALQHAQ
FT                   RMLSAGATLIDIGGESTRPGAAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAVIT
FT                   ESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQGQPKNMQHSPYYDDLMTDINR
FT                   FFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKS
FT                   MVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSAKG"
FT   gene            complement(68103..70037)
FT                   /locus_tag="YPA_0052"
FT   CDS_pept        complement(68103..70037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0052"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12021"
FT                   /db_xref="GOA:A0A0E1NRW5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRW5"
FT                   /protein_id="ABG12021.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRRVDYSTFMSDVTQDQ
FT                   VREARINGREINVSKKDNSKYTTFIPVNDPKLLDTLLTKNVKVVGEPPEEQSLLASIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTSFADVAGCDEAKEE
FT                   VSELVDYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   DTDIDASVIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISAS
FT                   RQKLESQISTLYGGRLAEEIIYGPEKVSTGASNDIKVATSIARNMVTQWGFSEKLGPLL
FT                   YAEEEGEIFLGRSVAKAKHMSDETARIIDQEVKLLVERNYQRARKLLLENMDVLHSMKD
FT                   ALMKYETIDAPQIDDLMNRKEVRPPAGWDNVTKNKSSDNDNTPTATMPADEPNTPTSGN
FT                   TVSEQLGDK"
FT   sig_peptide     complement(69954..70037)
FT                   /locus_tag="YPA_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.661) with cleavage site probability 0.339 at
FT                   residue 28"
FT   gene            complement(70094..70723)
FT                   /locus_tag="YPA_0053"
FT   CDS_pept        complement(70094..70723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0053"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12022"
FT                   /db_xref="GOA:Q1CC00"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC00"
FT                   /protein_id="ABG12022.1"
FT                   /translation="MSNKKRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQS
FT                   DKLFKQGMTVVDLGAAPGGWSQYAVTQIGSKGRVIACDLLPMDPIVGVDFLQGDFRDEL
FT                   VLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMYLVELALDMCRDVLAPGGSFLV
FT                   KVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
FT   gene            70870..71163
FT                   /locus_tag="YPA_0054"
FT   CDS_pept        70870..71163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12023"
FT                   /db_xref="GOA:A0A0E1NW44"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW44"
FT                   /protein_id="ABG12023.1"
FT                   /translation="MNLNNKQKQHLKSLAHPLKPVVMLGNNGLTEGVLAEIEQTLAHHE
FT                   LIKVKITAEERETKALIADAIVRETGAVNVQMIGNILVLYRPAKERKIILPR"
FT   gene            complement(71291..71767)
FT                   /locus_tag="YPA_0055"
FT   CDS_pept        complement(71291..71767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0055"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12024"
FT                   /db_xref="GOA:A0A0E1NVP2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVP2"
FT                   /protein_id="ABG12024.1"
FT                   /translation="MKQIPMTVRGADKLREELDYLKGVRRPKIISDIADAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDITKMPNNGRVIFGATVRVLNLNTEEEQN
FT                   YRIVGDDEADFKQNLISVNSPIARGLIGKEVDDVVVIHTPGGEVEYEILSVEYV"
FT   gene            72025..73473
FT                   /locus_tag="YPA_0056"
FT   CDS_pept        72025..73473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0056"
FT                   /product="D-Ala-D-Ala peptidase C. Serine peptidase. MEROPS
FT                   family S13"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12025"
FT                   /db_xref="GOA:A0A0E1NSL2"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSL2"
FT                   /protein_id="ABG12025.1"
FT                   /translation="MHFSRIVSGLACSIILNISVSNANAAQVENYTQYLPDGANLALMV
FT                   QKIGASTPAIDYHAQQMALPASTQKVLTALAALLQLGPDFRFNTTLESHGTITDGVLRG
FT                   NLIARFGGDPTLTRQQLRNMVATLRKAGVKQIAGDVVIDTSVFASHDKAPGWPWNDMTQ
FT                   CFSAPPAAAIVDRNCFSVSLYSAPNPGDTAFIRVASYYPVQMFSEVRTLAKGSPDAQYC
FT                   ELDVVPGELNRFTLTGCLTQRSEPLPLAFAVQNGASYAGAILKDELKKADIQIDGNLRR
FT                   QTIPSPAGNVLAQTQSAPLHDLLKIMLKKSDNMIADTVFRTIGHQRFGVPGTWRSGADA
FT                   VRQILRQKAGVDLGNSIVVDGSGLSRHNLISPATMMQVLQYIAQNDQELNFISMLPLAG
FT                   YDGTLRYRGGLHEAGVNGKVSAKTGALQGVYNLAGFITTASGQRMAFVQFLSGYAVPPE
FT                   DQKNRRAPLVRFESRLYKDIYQNN"
FT   sig_peptide     72025..72102
FT                   /locus_tag="YPA_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 26"
FT   gene            73479..74141
FT                   /locus_tag="YPA_0057"
FT   CDS_pept        73479..74141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0057"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12026"
FT                   /db_xref="GOA:A0A0E1NY30"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY30"
FT                   /protein_id="ABG12026.1"
FT                   /translation="MKLLIVEDDELLQRGIAMALTSEGYVCDCAATAAEAHSLLQTSQY
FT                   SMIILDLGLPDQDGTLLLRQWRRQHVTLPVLILTARDALEDRVDGLDAGADDYLVKPFA
FT                   LAELLARVRALIRRYQGQSDNLVQQDDLSLNLSTQQVCLQGQPLEITPKEFAILSRLIM
FT                   RAGQTVNRELLQQDLYTWNDDLSSNTLEVHIHNLRRKLGKDRIRTVRGIGYRLEALS"
FT   gene            74138..75205
FT                   /locus_tag="YPA_0058"
FT   CDS_pept        74138..75205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0058"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12027"
FT                   /db_xref="GOA:A0A0E1NN64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN64"
FT                   /protein_id="ABG12027.1"
FT                   /translation="MISMRRRLLLMLALILLVTQLISAFWLWHESQEQISFLVDETLSA
FT                   KARNEQVDKEIAEAIASLLAPSLIMMTITLLLSFWAISWIIRPLDQLQQKLAERSADNL
FT                   SPLVVNSEMQEIVSVTSTLNQLLLRLSNTIQQERLFTADAAHELRTPLAGIRLHLELME
FT                   KQGIAESKSLINRIDLLMHTIEQLLMLSRAGQNFASGHYQTLDWVNDVVPPLQEELAEM
FT                   CELRRQTIQWELPPHAKMEGDATLLRLMLRNLVENAHRYSPVGSQIIVTLSTENQGVLL
FT                   QVTDEGPGIKQNQAGELTQAFRRMDQRYGGSGLGLNIVIRIAQLHQGKLTLENRLDRTG
FT                   LKAQCWLPATTYSQK"
FT   sig_peptide     74138..74212
FT                   /locus_tag="YPA_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            complement(75300..76472)
FT                   /locus_tag="YPA_0059"
FT   CDS_pept        complement(75300..76472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0059"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12028"
FT                   /db_xref="GOA:Q1CBZ4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBZ4"
FT                   /protein_id="ABG12028.1"
FT                   /translation="MKFVDEAAILVVAGDGGNGCVSFRREKYIPNGGPDGGDGGDGGDI
FT                   YLLADENLNTLIDYRFVKSFRAERGQNGQSRDCTGKRGKDITIKVPVGTRVLDQGTGEI
FT                   VGDMVRHGQRLMVAKGGFHGLGNSRFKSSVNRAPRQKTMGTEGETRELMLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLIPSLGVVRMDYEQSFVIADIPGLIEGAS
FT                   DGAGLGIRFLKHLERCRVLLHLVDLAPIDESDPAENAKVIVNELQQYSENLAEKPRWLV
FT                   FNKIDLIDPEEAEKRAKAIVETLGWEGKYYMISAANRDNVNALCWDVMSFLNSQPKAMA
FT                   IAESVPEKVEFMWDDYHREQLAEVEAEAEDDWDDDWDEEDDDGVEIIYER"
FT   gene            complement(76473..77459)
FT                   /locus_tag="YPA_0060"
FT   CDS_pept        complement(76473..77459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0060"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12029"
FT                   /db_xref="GOA:A0A0E1P1U0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P1U0"
FT                   /protein_id="ABG12029.1"
FT                   /translation="MDTKQQAGLGIFLALTTAVFWGALPIAMKQVLEVMEPFTIVWYRF
FT                   MMAAIGLGIILASRRQLPSLKLFRQRRWLALLIIATCGLLGNFIFFSSSLQYLSPTTSQ
FT                   VIGQLSPVGMMVASVLVLKERMRITQVIGAGMLICGLLLFFNTSLHEIFTRLTDYTLGV
FT                   ALGVCAAVVWVSYGVAQKVLLRRMASQQILLLLYTLCAIALFPLAKPAVIFQLSGWQFA
FT                   CLLFCGVNTLVGYGALAEAMARWQAAQVSALITLTPLFTLFFSILLALAWPDMFAAPSL
FT                   NLVGYAGAFVVVAGAMFSAIGHRWWPRRTEINLVALQKQPVNDLRRK"
FT   gene            complement(77547..77804)
FT                   /locus_tag="YPA_0061"
FT   CDS_pept        complement(77547..77804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0061"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12030"
FT                   /db_xref="GOA:Q1CBZ2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBZ2"
FT                   /protein_id="ABG12030.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGEAVLAGSIIVRQRGTKF
FT                   HAGINVGCGKDHTLFALADGKVKFEVKGPKNRKFISIEAE"
FT   gene            complement(77824..78135)
FT                   /locus_tag="YPA_0062"
FT   CDS_pept        complement(77824..78135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0062"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12031"
FT                   /db_xref="GOA:Q1CBZ1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBZ1"
FT                   /protein_id="ABG12031.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMIANGE
FT                   EINIGAPLVDGGKIKAEIIAHGRGEKIKIVKFRRRKHYRKQQGHRQWFTDVKITGISA"
FT   gene            78395..79366
FT                   /locus_tag="YPA_0063"
FT   CDS_pept        78395..79366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0063"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12032"
FT                   /db_xref="GOA:A0A0E1P1A3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P1A3"
FT                   /protein_id="ABG12032.1"
FT                   /translation="MNLEKIIELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGK
FT                   RIRPMISVLVARALNYQGSKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDYIYTRSFQMMTGLQSMRVLTLMSEATNVIAEGEVLQLMNCNNPDITEESY
FT                   MQVIYSKTARLFEAAAQSAAILSDASEEQELALQNYGRYLGTAFQLIDDLLDYSAEGST
FT                   LGKNTGDDLNEGKPTLPLLHAMHNGTPEQAAMIRQAIEQGNGRHLLEPVLAAMEHCGSL
FT                   VYTRQRAEEEADKAIAALHALPESDYRLALEGLAHISVHRRF"
FT   gene            complement(79463..79810)
FT                   /locus_tag="YPA_0064"
FT   CDS_pept        complement(79463..79810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12033"
FT                   /db_xref="GOA:A0A0E1NMA0"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMA0"
FT                   /protein_id="ABG12033.1"
FT                   /translation="MKKEWFAAKELAGLEGLPSSPQGINLMAKREGWEQRRRRGVQGKA
FT                   VEYHIGSLPITILNSLQLREEPAQYATTRQDPLTLWVEAYYRFTEAEREQVISFIFREG
FT                   AKSLIERLEMD"
FT   gene            79994..80269
FT                   /locus_tag="YPA_0065"
FT   CDS_pept        79994..80269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0065"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12034"
FT                   /db_xref="GOA:A0A0E1NS29"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS29"
FT                   /protein_id="ABG12034.1"
FT                   /translation="MILRKSDWHPADIIAALRKKGTTLAALSRKAGLSSSTLANALTRP
FT                   WPKGEWLIAECLDIHPSEIWPTRYFDPKTGNLLDRKVRIRPTTTQP"
FT   gene            complement(80703..81641)
FT                   /locus_tag="YPA_0066"
FT   CDS_pept        complement(80703..81641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0066"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12035"
FT                   /db_xref="GOA:Q1CBY7"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBY7"
FT                   /protein_id="ABG12035.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSDLSLYDIAPVTPGVAVD
FT                   LSHIPTAVNIKGFSGEDATPALQGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLVEQ
FT                   IARTCPNALIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGITTLDTIRSNTFVAELKG
FT                   KQPQDIEVPVIGGHSGVTILPLLSQIPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFGLSLVRALQGESNVVECSYVEGDGKYARFFAQPILLGKNGVAERKDI
FT                   GKLSAFEQQALENMLDVLHKDIELGEKFVNQ"
FT   gene            82105..82575
FT                   /locus_tag="YPA_0067"
FT   CDS_pept        82105..82575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0067"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12036"
FT                   /db_xref="GOA:Q1CBY6"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBY6"
FT                   /protein_id="ABG12036.1"
FT                   /translation="MRNPAKQEDLIKAFKALLKEEKFSSQGEIVLALQEEGFENINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDYNDSVVVINTSPGA
FT                   AQLIARLLDSLGKAEGILGSIAGDDTIFTTPARGFTVKQLHEAILRLFEQEL"
FT   gene            82964..83227
FT                   /locus_tag="YPA_0068"
FT   CDS_pept        82964..83227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12037"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYN5"
FT                   /protein_id="ABG12037.1"
FT                   /translation="MNIKTTVATMSILSALSFGVFAADSINENQATQLQPMGTITVSGL
FT                   NGAPSDIRQALSDKADTVGAKAYKVIEVRSENNWHATANIYK"
FT   sig_peptide     82964..83032
FT                   /locus_tag="YPA_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(83523..84905)
FT                   /locus_tag="YPA_0069"
FT   CDS_pept        complement(83523..84905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0069"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-me
FT                   so-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12038"
FT                   /db_xref="GOA:A0A0E1NNS7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNS7"
FT                   /protein_id="ABG12038.1"
FT                   /translation="MRIHILGICGTFMGGLAMLARSLGHEVTGADANVYPPMSTLLENQ
FT                   GIDLIQGYDPAQLNPIPDLVIIGNAMTRGNPCVEAVLEQGIPYVSGPQWLHDHVLPERW
FT                   VLAVAGTHGKTTTAGMLAWILEACGYEPGFVIGGVPGNFDVSARLGNSPFFVIEADEYD
FT                   CAFFDKRSKFVHYSPRTLIMNNLEFDHADIFDDIKAIQKQFHHLVRLVPGKGKIILPDN
FT                   DNHLKQVMAMGCWSEQELVGETGSWFARKVSTDASVYEVLLDNNVVGEVNWSLVGEHNM
FT                   HNGLMAIAAARHVGVLPADACRALGDFINASRRLELRGEAHGVTVYDDFAHHPTAILAT
FT                   LAALRSKVGGTARILAVLEPRSNTMKLGLCKNELAPSLGRADEVFLFQPQHIPWQVVEV
FT                   AEACIQPAYWSADIDQLVDMIVKTAQPGDHILVMSNGGFGGIHDKLLSALDKKAEQATA
FT                   LF"
FT   sig_peptide     complement(84831..84905)
FT                   /locus_tag="YPA_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.918 at
FT                   residue 25"
FT   gene            85076..86089
FT                   /locus_tag="YPA_0070"
FT   CDS_pept        85076..86089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0070"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12039"
FT                   /db_xref="GOA:Q1CBY3"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBY3"
FT                   /protein_id="ABG12039.1"
FT                   /translation="MKTLGEFIVEKQLDFSHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGASGVSNIQGEDQMKLDLFANEKLKAALKARGEVAGIASEEEDDIVIFDGGRAEN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPFGTPITEEDFLQPGTKQVTAGYVVY
FT                   GSSTMLVYTTGYGVHAFTYDPSLGVFCLSHEKVRYPATGCMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDEATKRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPM
FT                   AFLAEQAGGKATDGVNRILDIVPEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEEAK"
FT   gene            86289..86816
FT                   /locus_tag="YPA_0071"
FT   CDS_pept        86289..86816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0071"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12040"
FT                   /db_xref="GOA:A0A0E1NQ69"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ69"
FT                   /protein_id="ABG12040.1"
FT                   /translation="MSLNQVPAGKDLPEDIYVVIEIPANADPIKYEIDKETGSLFVDRF
FT                   MSTAMFYPCNYGYINNTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLVAVPHSKLTKEYDHVKDVQDLPELLKAQIKHFFEHYKDLETGKWVKVDGWEDAAAAK
FT                   AEILSSFERAKK"
FT   gene            complement(86934..87290)
FT                   /locus_tag="YPA_0072"
FT   CDS_pept        complement(86934..87290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12041"
FT                   /db_xref="GOA:A0A0E1NMW2"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMW2"
FT                   /protein_id="ABG12041.1"
FT                   /translation="MRIIVYGSLRRKQGNSHWMTDAQLLGEHDLEGYEMYNLGHYPAVI
FT                   PGDGTVHCEVYRINSSIMNELDELKSNTKDYRRELIKTPYGSAWIYLYRLPTEGLPRIY
FT                   SGDWLKRHEEIDKP"
FT   gene            complement(87293..91210)
FT                   /locus_tag="YPA_0073"
FT   CDS_pept        complement(87293..91210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12042"
FT                   /db_xref="GOA:A0A0E1NSK0"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSK0"
FT                   /protein_id="ABG12042.1"
FT                   /translation="MKWVKRLSIAFLLIILLLVGALGGLLGTTSGLHFLINSAARWVPG
FT                   LDIASVSGGWRGLTLTGIQYQMPGVTVKAGQFYLSLQLSCLKNSELCVNALTAQDIDVV
FT                   VNTQAMPPTSSTPASTDPMGELSTPYPIFLRLLSLNNVKVTIDDTAISLDEFRTGAHWK
FT                   QRSLALMPTKINGLLIALPKTVSAGVPDAVKPAVETAMAAKEAVAQLSAAPGRSATASG
FT                   QSTTASGRSATASGQSATTGGQLATVPAEPATPLGESLKALFAKPLLPALPDFRLPLDL
FT                   QIEEISGQQLRLTGDNEVLISSLLLQASTQDQRITLDTLEIKSPQGGLSAQGQATLADK
FT                   WPLDLVVNSALNIDSLKGEKVKLTVGGALREELKVTLNLSGPVSAQLETETSLAKAGLP
FT                   LSLTLQSKQLRWPLTGEPQYQMNNLRMRLNGQATDYALSIRSDIKGTDLPPAVFTLEGK
FT                   GNVEQFNLTRLRLAALQGHTDLTGVVDWRQAISWNSVLTLSGINMAKQWPEWPAKLEGK
FT                   IVTRGSIHGGSWQLQVPELVLDGNVKQNRVTARGSLTGNAAGQWHIPGINLALGRNKLD
FT                   MKGELNDNWLLDANVDAPQLDGALPGLGGVVKGSLKLRGNLKTPQLLADLTANRLQWQE
FT                   LHINRIKVDGDVRSTDQIQGQLAVRVEQLKQADFVVSLLTLDARGSEKQHQLRLNMQGD
FT                   PVSGQLSLEGSFDKQQQRWRGTLNNTRFDTPVGEWRLSRAMTLDYQNSAQRITIGPHCW
FT                   LNPNAELCAPRPIEAGPSGQASVVLNRFDLAMIKPFLGPDTTMNGVFTGRAEVSWKEGG
FT                   KLPDVRVSLSGNGVKVQQMVQGSPLPIAFETLNLNGGLANGQVRADWLVKLVNNGQFSG
FT                   QVQVADPEGRRNLSGNVAISNLSLAMINPILSDGEKAAGILNANLRLAGNAKSPLVYGR
FT                   LALDKVDIDGSWMPFDITEGRLAMNFDGMTSTLEGLIRTSQGQLNLSGDADWRDISAWH
FT                   ARIAAKGNKLRVTIPPTARVDVSPDIVFEATPQLFTLNGSVDIPWARITVQEVPETAVG
FT                   VSSNEVMLNDQLQPIAPRSASIPISSNLVIRIGNDVRLNAFGLKARLQGDLRMMQDQRG
FT                   LGLNGQINIPSGSFRAYGQDLIVNKGILLFSGPPDQPLLNIEAIRNPDSTANGVIAGVR
FT                   VTGMADSPRMEVFSDPAMSQQEALSYLLRGQGLGNSGADSSMMTSMLIGMGVAQSGKLV
FT                   GKIGEAFGVSNLALDTQGVGDSSQVVVSGYVTKDLQIKYGVGIFDSLATLTLRYRLMPR
FT                   LYLEAVSGIDQALDLLYQFEF"
FT   sig_peptide     complement(91127..91210)
FT                   /locus_tag="YPA_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.361 at
FT                   residue 28"
FT   gene            complement(91207..92943)
FT                   /locus_tag="YPA_0074"
FT   CDS_pept        complement(91207..92943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12043"
FT                   /db_xref="GOA:A0A0E1NN71"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN71"
FT                   /protein_id="ABG12043.1"
FT                   /translation="MLRYPILCFVCLLLATPIAYAANVRLQVEGLSGDLERNVRARLST
FT                   IGTDEVTADGRFRSRVDEAIRQGLRALGYYDPTITFELQNRPAPARSVLIAKVVPGEPV
FT                   LIAGVDIVLQGGAKTDPDYQALVRRDTPKIGSVLNHGDFDNFTSSLTGLALRRGYFDAN
FT                   MIKSQLGVAAQLHEAFWDIDFDSGQRYRFGKVIFQGSQIREDYLQNLVPFHEGEFYTSD
FT                   ELAELNRRLAATNWFNSVVVSPDFQDAKESKILPLDAVVTPRTENTVELGGGYATDVGP
FT                   RLTASWRKPWMNSFGHSLTTTTALSAPEQTLDFSYRIPLLRNPLEQYYLIQGGFRRTDL
FT                   NDTNSDTTTLNVARFWDLSSGWQRAINLRWSLDHFTQGRVTDTTMLLYPGVSINRTRQR
FT                   GGAMPVWGDSQRYSIDVSDTTWGSDVDFGIFQAQNVWIRTLGEKNRFVARGNVGWIETN
FT                   NFDRVPPSLRFFAGGDRSIRGYKFRNISPRDSDGKLTGASKLATGSLEYQYNFTGRWWG
FT                   AVFVDSGEAVNNFSKSDLKTGAGVGVRWASPVGPIKLDIAAPIGDNETHGVQFYIGLGP
FT                   EL"
FT   sig_peptide     complement(92878..92943)
FT                   /locus_tag="YPA_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            93218..93856
FT                   /locus_tag="YPA_0075"
FT   CDS_pept        93218..93856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0075"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12044"
FT                   /db_xref="GOA:Q1CBX8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBX8"
FT                   /protein_id="ABG12044.1"
FT                   /translation="MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMDL
FT                   AFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPA
FT                   VISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQAMEK
FT                   AGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV"
FT   gene            94134..95465
FT                   /locus_tag="YPA_0076"
FT   CDS_pept        94134..95465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0076"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12045"
FT                   /db_xref="GOA:A0A0E1NPY6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPY6"
FT                   /protein_id="ABG12045.1"
FT                   /translation="MLNSILLILFLIAVSAFFSLSEISLAASRKIKLKLLADEGDTNAL
FT                   RVLKLQETPGMFFTVVQIGLNAVAILGGIVGDAAFSPSFKLVFERFMAPELADQASFVC
FT                   SFVLVTSLFILFADLTPKRIGMISPEAVAVRIVNPMRFCLMIFRPLVWFFNGMANLIFR
FT                   LFKLPMVRNDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRENV
FT                   IYFDLRESEDSIKDKISTHPHSKFLVCDGHIDQVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRSALIVPDTLTLSEALESFKTAGEDFAVILNEYALVVGIITLNDVMTTLMGDLVGQG
FT                   QEEQIVARDENSWLIEGGTPIEDVMRVLHIDDFPQSGNYETIGGFMMYMLRKIPKRTDF
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLSDQPAPILPKAPHESSDA"
FT   sig_peptide     94134..94214
FT                   /locus_tag="YPA_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 27"
FT   gene            complement(95573..95785)
FT                   /locus_tag="YPA_0077"
FT   CDS_pept        complement(95573..95785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12046"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPQ3"
FT                   /protein_id="ABG12046.1"
FT                   /translation="MRIFQRYNPAKVAMYVKTLFRGRLYIKDMGAFEFDNGKILVPKVK
FT                   DKRHFEVMAEVNRQVLRLQADTLLT"
FT   gene            96121..96684
FT                   /locus_tag="YPA_0078"
FT   CDS_pept        96121..96684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12047"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQH6"
FT                   /protein_id="ABG12047.1"
FT                   /translation="MIKNSLLIISLIFTPLLVSAHNIQDNQRVPPVGVRDKGELDYDKT
FT                   TNQFNYKNWNSSQLPGKTRVIQHIAGRTSAKEMNAPLIDAIKQANLPRERYQTTTIVNT
FT                   DDAIIGTAMFVRNSIESSKREFPWSQFIIDSKGNVAKAWGLTEKSSAIVVLDPQGNVKF
FT                   VKDGALTSAEVQQVIDQLHQLVQQ"
FT   sig_peptide     96121..96183
FT                   /locus_tag="YPA_0078"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            complement(96687..97427)
FT                   /locus_tag="YPA_0079"
FT   CDS_pept        complement(96687..97427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0079"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12048"
FT                   /db_xref="GOA:A0A0E1NTT6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTT6"
FT                   /protein_id="ABG12048.1"
FT                   /translation="MLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAAH
FT                   QIIKAGLARLTPDIPLLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNIAL
FT                   IDQGEPVLGVVYVPVTEVMYSAANGQAWKEECGRRMQIQVRDAQPPLVVVSRSHSDAEL
FT                   EDYLSQLGEHQTISVGSSLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHD
FT                   WQGKTLSYTPRESFLNPGFRVSLF"
FT   gene            97874..99832
FT                   /locus_tag="YPA_0080"
FT   CDS_pept        97874..99832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0080"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12049"
FT                   /db_xref="GOA:A0A0E1NWD7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWD7"
FT                   /protein_id="ABG12049.1"
FT                   /translation="MFKRPLTLSLLASLIAVATSLSAATVDLRVLETTDLHSNMMDFDY
FT                   YKDKPTEKFGLVRTASLIIAARQQATNSVLVDNGDVIQGSPLGDYIAAKGLNDGEIHPV
FT                   YKAMNTLDYAVGNIGNHEFNYGLDYLKKSLAGAKFPYVNANVIDVKTGKPLFQPYLIID
FT                   TPVKDRDGKSHNLRIGYIGFVPPQVMIWDKANLSGKVTVNDITETAKKWVPEMREQGAD
FT                   LVVAIPHSGLSSDPYKTMAENSVYYLSQVPGIDAIMFGHAHGVFPSKDFAAIKGADITQ
FT                   GTLNGIPAVMPGQWGDHLGVVDFVLNNDQGKWQVIDAKAEARPIYDKTAQKSLAAENAK
FT                   LVEVLAVDHQSTRDFVSQPIGKASDNMYSYLALIQDDPTVQIVNNAQRAYTEHFIQGDP
FT                   DLADLPVLSAAAPFKAGGRKNDPTSFVEVEKGKLTFRNAADLYLYPNTLVVVKASGAEV
FT                   KQWLECSAAQFNQIDINSSKPQSLINWDGFRTYNFDVIDGVEYEIDVSQPARYDGECTL
FT                   INDQAERIKNLTFNGKPIDPKATFLIATNNYRAYSGKFAGTGDSHIAFASPDENRAVLS
FT                   AYISAETKKKGQVIPQADNNWRLAILDSKQPLDIRFETSPTAKAADFIKQKAQYPMEAQ
FT                   GTDEVGFAVYHIDLQRK"
FT   sig_peptide     97874..97945
FT                   /locus_tag="YPA_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 24"
FT   gene            99987..100652
FT                   /locus_tag="YPA_0081"
FT   CDS_pept        99987..100652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12050"
FT                   /db_xref="GOA:Q1CBX2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBX2"
FT                   /protein_id="ABG12050.1"
FT                   /translation="MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLN
FT                   LDIDALEAQLSALQTEPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVER
FT                   VHGEKPTCPRGLAAELSAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDA
FT                   VGQQLDVVKQLTQNVTPPEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE"
FT   gene            complement(100750..101370)
FT                   /locus_tag="YPA_0082"
FT   CDS_pept        complement(100750..101370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0082"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12051"
FT                   /db_xref="GOA:A0A0E1NQ20"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ20"
FT                   /protein_id="ABG12051.1"
FT                   /translation="MTTPSFDSVEAQASYGIGLQIGQQLQESGLQGLLPEALLAGLRDA
FT                   MEGNTPTVPVDVIHRALQEVHEKADKVRIERQQALVDEGKTFLEENAKRDDVTTTESGL
FT                   QFSVLQAGDGPIPSRQDRVRVHYTGRLVDGTVFDSSVERGQPADFPVSGVIPGWIEALS
FT                   MMPVGSKWKLYIPHNLAYGERGAGATIPPFSALMFEVELLEIL"
FT   gene            101712..102452
FT                   /locus_tag="YPA_0083"
FT   CDS_pept        101712..102452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12052"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU79"
FT                   /protein_id="ABG12052.1"
FT                   /translation="MGRIAPRRRKNNRVYQPLLHSWLTIRQKVLPDAKNTDEQNLISEI
FT                   NAPEQRVDPDNVTEPALAPTQRKGVQSIKELWLKIWHLPDSFQWMEPLPFFHRRGVIIA
FT                   TTVLLLALLWPASRDNTDLSFPVSAPSTSVPLQAQLQDNNDVPVPPKVSPSETTQGNWQ
FT                   SYQVQTGKTLAQLFRDNNLPVNDVFAMAQVEGSDKPLSNLKAGQEVKIMLDAQGAVTAL
FT                   AIETPENTEVLFSRQNDGSYRREH"
FT   gene            102592..103047
FT                   /locus_tag="YPA_0084"
FT   CDS_pept        102592..103047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12053"
FT                   /db_xref="InterPro:IPR022231"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWC8"
FT                   /protein_id="ABG12053.1"
FT                   /translation="MMKYQLSFVLLLTPLAVFAEQHCPAIDAIKLIGGVYTAKATSGEE
FT                   WVGILQGPLPQESGIKRFSEALFVVEGENNGNNVTGSGKFQKCTYDLQAENIQLDMYYG
FT                   GTTWIASIRGKPYWEYEKGGFFEIYTCSNVAPEYCKFDILVPGSASR"
FT   sig_peptide     102592..102651
FT                   /locus_tag="YPA_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.827 at
FT                   residue 20"
FT   gene            complement(103169..103627)
FT                   /locus_tag="YPA_0085"
FT   CDS_pept        complement(103169..103627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0085"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12054"
FT                   /db_xref="GOA:Q1C048"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C048"
FT                   /protein_id="ABG12054.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(103823..104275)
FT                   /locus_tag="YPA_0086"
FT   CDS_pept        complement(103823..104275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0086"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12055"
FT                   /db_xref="GOA:Q1CBW7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBW7"
FT                   /protein_id="ABG12055.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFEARRAELEAKLADVLAAAEARATKINELVSVTISSKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVAKSEVRLPNGVLRTAGEHEVHFQVHSDVFAKLNVVVVPEA"
FT   gene            complement(104315..104542)
FT                   /locus_tag="YPA_0087"
FT   CDS_pept        complement(104315..104542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0087"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12056"
FT                   /db_xref="GOA:Q1CBW6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBW6"
FT                   /protein_id="ABG12056.1"
FT                   /translation="MARYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARCIKRARYLSLLPYTDRHQ"
FT   gene            complement(104547..104867)
FT                   /locus_tag="YPA_0088"
FT   CDS_pept        complement(104547..104867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0088"
FT                   /product="restart primosome assembly protein PriB"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12057"
FT                   /db_xref="GOA:Q1CBW5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBW5"
FT                   /protein_id="ABG12057.1"
FT                   /translation="MVTTNRLVLSGTVCKTPVRKVSPSGIPHCQFVLEHRSTQQEAGFS
FT                   RQTWCRMPIVVSGQQSQALTHSITVGSQLTVEGFISCHQGRNGLNKLVLHAEQIEFIDS
FT                   GD"
FT   gene            complement(104873..105265)
FT                   /locus_tag="YPA_0089"
FT   CDS_pept        complement(104873..105265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0089"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12058"
FT                   /db_xref="GOA:Q1CBW4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBW4"
FT                   /protein_id="ABG12058.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVK
FT                   AKDERRERHDFASEANDDSEAGDSEE"
FT   gene            complement(105279..105557)
FT                   /locus_tag="YPA_0090"
FT   CDS_pept        complement(105279..105557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLR0"
FT                   /protein_id="ABG12059.1"
FT                   /translation="MGLIEPSKNSFGNLVMILLVNLAKNSLVSTITGNEQKMRFKLAHR
FT                   HNRNKSPAVLEFPTAHKYSYASFFSRTQTRSLPPWAAVDPIRRLNNP"
FT   gene            complement(105632..106333)
FT                   /locus_tag="YPA_0091"
FT   CDS_pept        complement(105632..106333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12060"
FT                   /db_xref="GOA:A0A0E1NRE2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRE2"
FT                   /protein_id="ABG12060.1"
FT                   /translation="MWITIAPFVTLPTIFFYHGYTSSKEVYSYFAYAFAQAGFRTISPD
FT                   ADMHGARFNGNETQRLSHFWEILKSNIDELPDLKRHYQQAGLIEGERIGVAGASMGGMT
FT                   ALGAFARYPWIRVAADFMGSGYFTSLAHSLFPPRDAGREISQQAFERRLAPLADYELTH
FT                   QLEKITERPLLVWHGEADDVVPAAESARLVQALRTRGGDNNLTYLTEAGIGHKITPTAL
FT                   RAGSDFFTQYL"
FT   gene            106390..107412
FT                   /locus_tag="YPA_0092"
FT   CDS_pept        106390..107412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0092"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12061"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12061.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            107412..108191
FT                   /locus_tag="YPA_0093"
FT   CDS_pept        107412..108191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0093"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12062"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12062.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            108789..109004
FT                   /locus_tag="YPA_0094"
FT   CDS_pept        108789..109004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3G8"
FT                   /protein_id="ABG12063.1"
FT                   /translation="MTLSAIRNIADKERGASERAWTPAKSALGQGCPSRWLVSPKDAGG
FT                   LPAGQYFAQAAGAGGPASPPARLRRL"
FT   gene            complement(109156..111792)
FT                   /locus_tag="YPA_0095"
FT   CDS_pept        complement(109156..111792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0095"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12064"
FT                   /db_xref="GOA:Q1CBV8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBV8"
FT                   /protein_id="ABG12064.1"
FT                   /translation="MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKSS
FT                   RAGNEASRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEAL
FT                   AQLFTRLKDKKLSDQDMRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHN
FT                   DLADYERNKIMRRLRQLVAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLRE
FT                   FNEQLENSLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRD
FT                   IQVLVSELSMSECTPELRELAGGEEVLEPYRQLMKNVRTQLTNTQAYLEARLKGERVLP
FT                   PHDLLVSNDQLWEPLYACYQSLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQEST
FT                   RHTDAIAELTRYLGLGDYESWSESDKQAFLVRELNSKRPLVPLKWEPSAETQEVLETCR
FT                   VIAEAPQGSIAAYVISMAKVPSDVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVM
FT                   TQLLGIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKTCEKAGITLTL
FT                   FHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAG
FT                   AILEANLLPPPEPKKEWIEVMDLLSDASCDMYRSYVRENPEFVRYFRAATPELELGKLP
FT                   LGSRPAKRRPDGGVESLRAIPWIFAWTQNRLMLPAWLGAGAGLQRAIDAGKQDVLATMC
FT                   RDWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVDKSLWPLGQQLRDQLAADIKVVLAIA
FT                   NDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQQEHPDACVEQALMVTIAGVA
FT                   AGMRNTG"
FT   gene            complement(112166..113329)
FT                   /locus_tag="YPA_0096"
FT   CDS_pept        complement(112166..113329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0096"
FT                   /product="acetylornithine deacetylase / acetylornithine
FT                   deacetylase ArgE. Metallo peptidase. MEROPS family M20A"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12065"
FT                   /db_xref="GOA:A0A0E1NTE7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTE7"
FT                   /protein_id="ABG12065.1"
FT                   /translation="MKLPPFIELYRALIATPSISAADSALDQSNEALINLLAGWFADLG
FT                   FRVEIQPVPDTRHKFNLLASIGENENGEGHGGLLLAGHTDTVPYDEGRWTRDPFTLTEH
FT                   DHKLYGLGTADMKGFFAFILDAVRDIDASKLTKPLYILATADEETTMAGARYFAANTQL
FT                   RPDFAIIGEPTSLQPVRAHKGHISNAIRITGQSGHSSDPARGVNAIDLMHESITQLMAL
FT                   RTTLQERYHNPAFTIPYPTMNFGHINGGDAANRICACCELHMDIRPLPGLTLSDLNELM
FT                   TEALEPVSQRWPGRLSIDELHPPIPGYECPTDHHMVGVIEKLLGERTAVVNYCTEAPFI
FT                   QQVCPTLVLGPGSINQAHQPDEFIDMAFIEPTRELIGQLVDHFCQQK"
FT   gene            113580..114584
FT                   /locus_tag="YPA_0097"
FT   CDS_pept        113580..114584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0097"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12066"
FT                   /db_xref="GOA:A0A0E1NX53"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX53"
FT                   /protein_id="ABG12066.1"
FT                   /translation="MLNTLIVGASGYAGAELTAYLNRHPHMNITGLAVSAQSADAGKLL
FT                   SDLHPQLKGILDLPLQPLVDVAQAAKGIDVVFLATAHEVSHDLAPQFLAAGCVVFDLSG
FT                   AFRVRDAAFYSQYYGFEHQHPDWLDKAVYGLAEWQSEDIKQAQLIAVPGCYPTASQLAL
FT                   KPLVDGQLLNDAQWPVINAVSGVSGAGRKASMGNSFCEVSLQPYGLFTHRHQPEIVTHL
FT                   GTPVIFTPHLGNFARGILATITCRLKAGVTAQNIADAYHHAYQNKPLVRLYQQGVPALK
FT                   AVVGLPFCDIGFSVQGEHLIIVATEDNLLKGAAAQAVQCMNIRFGFPETQSLL"
FT   gene            114750..115526
FT                   /locus_tag="YPA_0098"
FT   CDS_pept        114750..115526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0098"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12067"
FT                   /db_xref="GOA:Q1CBV5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBV5"
FT                   /protein_id="ABG12067.1"
FT                   /translation="MMNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGG
FT                   CLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLCL
FT                   ADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNADQ
FT                   AATALAATLGADLILLSDVSGILDGKGQRIAEMTAQKAEQLIAQGIITDGMVVKVNAAL
FT                   DAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV"
FT   gene            115693..117066
FT                   /locus_tag="YPA_0099"
FT   CDS_pept        115693..117066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0099"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12068"
FT                   /db_xref="GOA:Q1CBV4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBV4"
FT                   /protein_id="ABG12068.1"
FT                   /translation="MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALV
FT                   TVGVLNADEQQQLEQALSVLLEEVQANPHAILASDAEDIHSWVETKLIDKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKFQITELQTAVQQLQQALVMTAEANQDAVMPGYTHLQRAQPV
FT                   TFAHWCLAYVEMLSRDESRLQDTLKRLDVSPLGCGALAGTAYAIDREQLAGWLGFASAT
FT                   RNSLDSVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNSGEAAFVDLSDRVTSGSSLMP
FT                   QKKNPDALELIRGKCGRVQGALTGMTMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLH
FT                   MAALVLDGIQVKRPRCKEAAEQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQG
FT                   KALEALALSDLQQFSSVIGDDVYPILALQSCLDKRVAKGGVSPQQVASAIAEAKARLF"
FT   gene            117665..120157
FT                   /locus_tag="YPA_0100"
FT   CDS_pept        117665..120157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0100"
FT                   /product="putative TonB dependent receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12069"
FT                   /db_xref="GOA:A0A0E1NQD4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQD4"
FT                   /protein_id="ABG12069.1"
FT                   /translation="MDNIIRDKKTIISVNKITTCILFALVTQGYSGQLAANTAETPTNN
FT                   NDMALDKLNVEGKGNAHDSDWIYDEPRSVSEITREQLDNRPARHAADILEQTPGVYSSV
FT                   SQQDPGLSINIRGIQDYGRVNMNIDGMRQNFMKSGHGQRNGSMYIDPEILSNVVIERGI
FT                   FNGIGGAGAIGGIATFNTINASDFLAPEKELGGHIRAMTGDNGTRFIGSGALALGNPNG
FT                   DILLAVSERNLKDYWPGNKGVLAGLRLYSPTRNVGDDLKNTKTLFTGYKMRSQLAKVGW
FT                   NFEAGQRLEFSYLQTQIASPNASMLSEVLALSPSGKEITKIGWRNTSFTNVENRNIALD
FT                   YRLNPEHISWLDATAKIYYVDTNDETDNANSLFKEYFWTQTRLKTRGLQLQNTNTFTPS
FT                   DAHQIRLKYGLEWFSDKSEGYSTRKLIERTTPPGKRAITSTFAQLNYEYDDWLRLEGGL
FT                   RYDQFRLKGNTWLHTRSFLQPYTFENPCDRRIHEQSEKPGSRCSSRRPATMRWDVDRCE
FT                   QQLSPTLAMGVKPGLEWLEFFGSYGKSWRPPAMTEVLATGTAHGYSWVLPNPFVAAERA
FT                   RTWEAGFNIQQSNLFIEDDHFAAKVAYFDTRIANYINLELGKAKPKFGGDSFTDVAYVN
FT                   NLLKTRFRGLEYQLSYDAGTFYTNINYTRMIGVNNVCSPYAWLGGLQSVKYKYVGKVEQ
FT                   IYAVENEVANNYVTCMNANVLFGSSAYLPGDRGSLTLGSRIFDRRLDFGTVIRYNKGYQ
FT                   DRSAQDENGNPLTAYVADWPKYIVYDLYASYKVTNNLILRSSIENITNRAYLVNYGDTL
FT                   SFAPSRGRTIQGGFEYKF"
FT   sig_peptide     117665..117775
FT                   /locus_tag="YPA_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.649 at
FT                   residue 37"
FT   gene            120379..120996
FT                   /locus_tag="YPA_0101"
FT   CDS_pept        120379..120996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0101"
FT                   /product="hemophore HasA"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12070"
FT                   /db_xref="InterPro:IPR010495"
FT                   /db_xref="InterPro:IPR036912"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTW3"
FT                   /protein_id="ABG12070.1"
FT                   /translation="MSTTIQYNSNYADYSISSYLREWANNFGDIDQAPAETKDRGSFSG
FT                   SSTLFSGTQYAIGSSHSNPEGMIAEGDLKYSFMPQHTFHGQIDTLQFGKDLATNAGGPS
FT                   AGKHLEKIDITFNELDLSGEFDSGKSMTENHQGDMHKSVRGLMKGNPDPMLEVMKAKGI
FT                   NVDTAFKDLSIASQYPDSGYMSDAPMVDTVGVVDCHDMLLAA"
FT   gene            121153..122970
FT                   /locus_tag="YPA_0102"
FT   CDS_pept        121153..122970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0102"
FT                   /product="ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12071"
FT                   /db_xref="GOA:A0A0H2Y3H3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3H3"
FT                   /protein_id="ABG12071.1"
FT                   /translation="MDAMESCKTPGASSVPPTILSVLAGNKKILWGIGLFTAVINLLML
FT                   APAIYMLQVYDRVLASANTMTLLMLTVLVLGVFVFIGLLEWVRSAVVIRLGTQIDMQLN
FT                   QPVFNAAFAANLKGHNTPAAQALNDLTVLRQFATGNALFAFFDAPWFPLYLLVIFLLHP
FT                   WLGMLAAAGAGILVVLAWLNQWICKKPLHDASIITSHATQQANANLRNADVIEAMGMLK
FT                   ALRERWLMQHANFLYQQNLASDKSSRVTAVAKSSRQALQSMMLGLGALLVIYNEITAGV
FT                   MIAGSILIGRVLGPIDQLIAVWKQWSHARLAYQRLSQLLAQHPSSPTGMVLPAPQGKLN
FT                   VTQLMACKPGTHIPVLHSINFELQPGDVLGILGPSGSGKSTLAKLLVASQPTFSGTVRL
FT                   DSADLSRWDKTQLGEFIGYLPQNIQLFRGTVAENIARFGAIDTAKVVAAAQLADVHDLI
FT                   LHLPQGYDTPLGDDGEGLSGGQRQRIALARAMYGIPRLIVLDEPNASLDKEGEQALLAS
FT                   IIQLKQQGCTIVMITHKPELLSGSDYLLFLKNGQMDLFDRTQAVLQNIQGKDKPAVQPE
FT                   AKILNSRSGWSNGVSYGIGPARTTSSPKP"
FT   gene            123046..124374
FT                   /locus_tag="YPA_0103"
FT   CDS_pept        123046..124374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0103"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12072"
FT                   /db_xref="GOA:A0A0E1NWS4"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWS4"
FT                   /protein_id="ABG12072.1"
FT                   /translation="MLPESVCYSVANANRQPPLQINSGRYLNIGGGLVVIGFIGFLLWA
FT                   GLAPLDKGVAVTGLLVVAENRKVIQPLQGGRIQQLHVTEGDEIVSGQLLVTLDDTAIRN
FT                   QRDNLQHQYLSALAQEARLTAEQNDLDVITFPQALLEHATQPAVERNIILQQQLLHHRR
FT                   QAHLSEIARLSTQLTRHQARLDGLQAMRSNHQRQSNLFQQQLDSVQLLAKDGHIAKNKL
FT                   LEMESQSTSLQARVEQSTSDIAEAHKLIDETEQHVLQRREQYQSENSEQLAKAQQNTQE
FT                   LVQRLNIAEYELSHTRIFAPVSGSVIALAQHTVGGVVSSGQALMEIVPSGQPLFVEAQL
FT                   PVELIDKVAVGLPVDLNFSAFNQSNTPRLQGSVWRIGADRIQPPPTSPPYYPLTVAIDL
FT                   DPTELAIRPGMAVDVFIRTGERSLLSYLFKPFTDRLHLALAEE"
FT   gene            124439..125242
FT                   /locus_tag="YPA_0104"
FT   CDS_pept        124439..125242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0104"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12073"
FT                   /db_xref="GOA:A0A0E1NY76"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY76"
FT                   /protein_id="ABG12073.1"
FT                   /translation="MNRLQQSSDKLIFWLVGALLACGIHIYALWWLSTASIPAIPTSYP
FT                   AAIMMELSAEPEFMQNLPQNSVVGITQNIIEPAVEQRVNQPDDIVDLPTLPEQPEGQRE
FT                   ITRKEPIKVKRPAENRATSRKPVNKETQESDSKQSSPAAAASAMLSGTSQQVAAAVNSD
FT                   SSHRQQAQVSWKSRLQGHLMGFKRYPSSARKQQQQGTAMIRFVVDKNGYVSSVQLSHSS
FT                   GTSALDREALAIIKRAQPLPKPPAELLSQGQITLSLPVDFNLKRK"
FT   gene            complement(125358..126821)
FT                   /locus_tag="YPA_0105"
FT   CDS_pept        complement(125358..126821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0105"
FT                   /product="putative pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12074"
FT                   /db_xref="GOA:A0A0E1P1U6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P1U6"
FT                   /protein_id="ABG12074.1"
FT                   /translation="MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCAR
FT                   VGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLINGREVMDRVKRERDRFVGFVLESV
FT                   ETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNELGDR
FT                   LIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRD
FT                   YAAKTLGDEFYLDPDVKVELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDK
FT                   LGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQLPLLHEASDQARIAGVNAGG
FT                   FPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVML
FT                   KNKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEE
FT                   GLRTALRDLQSKLKLGADEAERCLRCPGE"
FT   gene            complement(126916..127647)
FT                   /locus_tag="YPA_0106"
FT   CDS_pept        complement(126916..127647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0106"
FT                   /product="putative peroxiredoxin/glutaredoxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12075"
FT                   /db_xref="GOA:A0A0E1NX26"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX26"
FT                   /protein_id="ABG12075.1"
FT                   /translation="MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGA
FT                   FTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDGNG
FT                   EFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTMLKYL
FT                   APDFKVQESVAVFTKPGCPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVP
FT                   QIFIGGRHIGGSDDLEKYLPA"
FT   gene            127794..128711
FT                   /locus_tag="YPA_0107"
FT   CDS_pept        127794..128711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0107"
FT                   /product="oxidative stress transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12076"
FT                   /db_xref="GOA:A0A0E1P2E1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2E1"
FT                   /protein_id="ABG12076.1"
FT                   /translation="MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELGI
FT                   MLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKEMASLQGESMSGPLHIGLIPTVGPY
FT                   LLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPLFDE
FT                   PMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGSPLRGR
FT                   YEQLAEAIRDHMQERMAPSLEQAI"
FT   gene            complement(128694..130094)
FT                   /locus_tag="YPA_0108"
FT   CDS_pept        complement(128694..130094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0108"
FT                   /product="soluble pyridine nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12077"
FT                   /db_xref="GOA:Q1CBU5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBU5"
FT                   /protein_id="ABG12077.1"
FT                   /translation="MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGC
FT                   THWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIKSSFADILNHADRVINQQTRMRQGF
FT                   YDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNHERI
FT                   YDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDA
FT                   LSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLE
FT                   NIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLASAAYDQGRIAAQAMIKGEANV
FT                   HLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKIL
FT                   FHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAA
FT                   LNGLNRLF"
FT   gene            130312..130947
FT                   /locus_tag="YPA_0109"
FT   CDS_pept        130312..130947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0109"
FT                   /product="TetR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12078"
FT                   /db_xref="GOA:Q1CBU4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBU4"
FT                   /protein_id="ABG12078.1"
FT                   /translation="MGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVSREAGIAP
FT                   TSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPN
FT                   AFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRSFTEAQAEAMVTIVFS
FT                   AGAEVLDVDIEQRRQLEERLVLQLRMISKGAYYWYRREQEKLAASRVE"
FT   gene            130960..131367
FT                   /locus_tag="YPA_0110"
FT   CDS_pept        130960..131367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0110"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12079"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPR0"
FT                   /protein_id="ABG12079.1"
FT                   /translation="MEQSSRRETGTLLLALITGLAINGVCAALFSALVPFSVFPLLTLI
FT                   LAVYCLHQRYLNFAMPQGIPVLASACFLLGILLYSAIVRVEYPAIGSNFVPAVLSVVLV
FT                   FWILFKLRTRKSVQTHTDADIDINNSDQPQQ"
FT   sig_peptide     130960..131043
FT                   /locus_tag="YPA_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.823 at
FT                   residue 28"
FT   gene            complement(131501..132604)
FT                   /locus_tag="YPA_0111"
FT   CDS_pept        complement(131501..132604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0111"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12080"
FT                   /db_xref="GOA:Q1CBU2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBU2"
FT                   /protein_id="ABG12080.1"
FT                   /translation="MTPNILPIESYDHQLAEKSARLKAMMLPFQAPEPEIFRSPADHYR
FT                   MRAEFRVWHDEDDLYHIMFDQQTKQRIRVEQFPVASRLINRLMDALMTAIRAEPLLRRK
FT                   LFQIDYLSTLSGKLIASLLYHRQLDEEWQQKALELRDQLRAQGFDLQLIGRAAKTKIML
FT                   DHDYIDEVLPVAGREMIYRQVENSFTQPNAAVNIHMLEWALDVTQGATGDLLELYCGNG
FT                   NFSLALARNFERVLATEIAKPSVAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREFN
FT                   RLKGIDLGSYNCETIFVDPPRSGLDHETVKLVQAYPRILYISCNPETLCANLEQLQHTH
FT                   KISRLALFDQFPYTHHMECGVLLEKRH"
FT   gene            132736..132996
FT                   /locus_tag="YPA_r008"
FT   misc_RNA        132736..132996
FT                   /locus_tag="YPA_r008"
FT                   /product="cobalamin riboswitch"
FT   gene            133066..134961
FT                   /locus_tag="YPA_0112"
FT   CDS_pept        133066..134961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0112"
FT                   /product="putative vitamin B12 receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12081"
FT                   /db_xref="GOA:Q1CBU1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBU1"
FT                   /protein_id="ABG12081.1"
FT                   /translation="MIIKNTMTIKKYTLLTALSVTAFSGWAQGNNTTDNNDEMVVTANR
FT                   FPQPKSSVLAPVDVVTRADIDRWQSTNINDVLRRLPGVDIAQDGGMGQRSSLFIRGTNS
FT                   SHVLVLIDGVRLNQAGITGASDLSQIPISLVQRIEYIRGPRSAVYGSDAIGGVINILTG
FT                   RDKPGTTLSAGLGSNGYQTYDGSTQQKLGEDTTVTLAGNYTYSKGYDVVAGMPGAGGPR
FT                   QPDRDGFMGKMLWAGLEHQFNEQFNGFARVYGFDNRSDYDGYTNYSNPLALIDTRKLSS
FT                   RTYDTGLRYKNGIYASQFIASYNRTKDYNYSPLFGQHDITASLDEAEQYNLQWGNTFQL
FT                   TNGMISAGADWQEQRTERKSSNQNTTADFTQHNTGIYLTGQQQISDVTLEGAVRSDDNS
FT                   QFGWHSTWQTSAGWEFIDGYRLIGSYGTAYKAPNLMQLYSAYGGNANLKPEESKQWEGG
FT                   VEGLTGPLTWRLSAYRNDIDQLIDYSNLTNGYFNINKATIKGVEWTGSFDTGPLSHQVT
FT                   LEYLDPRNADTHEILVRRAKQQVKYQLDWQVADLDWSVTYQYLGQRYDKDYSTYPEETV
FT                   ELGGVSLWDLAVSYPVTSHLTVRGRIANLFDKDYEMVYGYQTPGREYYFTGSYNF"
FT   sig_peptide     133066..133149
FT                   /locus_tag="YPA_0112"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.871 at
FT                   residue 28"
FT   gene            134894..135769
FT                   /locus_tag="YPA_0113"
FT   CDS_pept        134894..135769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0113"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12082"
FT                   /db_xref="GOA:A0A0H2Y378"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y378"
FT                   /protein_id="ABG12082.1"
FT                   /translation="MRWFMATKPQDANTTSREAITSKADSPPRPTALIFDSGVGGLSVY
FT                   QEIRQLLPDLHYIYAFDNVAFPYGEKSGEFIVERVLEIVTAVQQRHPLAIVVIACNTAS
FT                   TVSLPALRERFAFPVVGVVPAIKPAVRLTRNGVVGLLATRATVHASYTLDLIARFATDC
FT                   KIELLGSSELVEVAETKLHGGVVPLEVLKKILHPWLSMREPPDTIVLGCTHFPLLTEEL
FT                   AQVLPEGTRMVDSGAAIARRTAWLISSQENVISSQDENIAYCMALDEDTDALLPVLQSY
FT                   GFPKLQKLPI"
FT   gene            136253..137768
FT                   /locus_tag="YPA_r009"
FT   rRNA            136253..137768
FT                   /locus_tag="YPA_r009"
FT                   /product="16S RNA"
FT   gene            137905..137980
FT                   /locus_tag="YPA_r010"
FT                   /note="tRNA-Glu2"
FT   tRNA            137905..137980
FT                   /locus_tag="YPA_r010"
FT                   /product="tRNA-Glu"
FT   gene            138233..141139
FT                   /locus_tag="YPA_r011"
FT   rRNA            138233..141139
FT                   /locus_tag="YPA_r011"
FT                   /product="23S RNA"
FT   gene            141139..141370
FT                   /locus_tag="YPA_r012"
FT   rRNA            141139..141370
FT                   /locus_tag="YPA_r012"
FT                   /product="5S ribosomal RNA"
FT   gene            141490..141566
FT                   /locus_tag="YPA_r013"
FT                   /note="tRNA-Asp1"
FT   tRNA            141490..141566
FT                   /locus_tag="YPA_r013"
FT                   /product="tRNA-Asp"
FT   gene            141575..141650
FT                   /locus_tag="YPA_r014"
FT                   /note="tRNA-Trp1"
FT   tRNA            141575..141650
FT                   /locus_tag="YPA_r014"
FT                   /product="tRNA-Trp"
FT   gene            142629..143585
FT                   /locus_tag="YPA_0114"
FT   CDS_pept        142629..143585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0114"
FT                   /product="putative periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12083"
FT                   /db_xref="GOA:A0A0E1NSG0"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSG0"
FT                   /protein_id="ABG12083.1"
FT                   /translation="MYRRLLLAAAVTAAMCSAVQAAPLVVGFSQIGSESGWRSAETKVA
FT                   KQEAEKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWTPVLQEAKEAK
FT                   IPVFLLDRMIEVNDPSLYTAAVASDSVYEGKVAGEWLLQDVAGKPCNVVELQGTVGSSV
FT                   AINRKKGFADGIASAPGVKIIRSQSGDFTRSKGKEVMESFIKAEQNGKNICAVYAHNDD
FT                   MAIGAIQAIKEAGLKPGSDIKIVSIDGVPDIFKAMSSGEANATVELTPNMAGPALDALI
FT                   VLKKDGTQPPKFIQTESRLLQPDTAKQEYELKKSLGY"
FT   sig_peptide     142629..142694
FT                   /locus_tag="YPA_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            143671..145161
FT                   /locus_tag="YPA_0115"
FT   CDS_pept        143671..145161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0115"
FT                   /product="putative sugar transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12084"
FT                   /db_xref="GOA:A0A0H2Y287"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y287"
FT                   /protein_id="ABG12084.1"
FT                   /translation="MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKST
FT                   LIKALTGVYKRSAGEVLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFIGR
FT                   EPLRWGLIDHNKMNQQAAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAKVLI
FT                   LDEPTASLDAKEVSMLLDILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTK
FT                   TVAELPRIELVQMMLGHSFDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDLSVSPG
FT                   EIVGLAGLLGSGRTETAQLIFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGYCPEDRK
FT                   TEGIVGAATVRENIILALQAQRGWLRPLSMREQTQIADDFIQQLGIRTPSPEQQIQYLS
FT                   GGNQQKVLLARWLATKPRFLILDEPTRGIDVGAHAEIIRLIEKLCDEGLALLIISSELE
FT                   ELAGYADRIIVLRDRRHVAQLDHDEISVPAIMQAIAVQ"
FT   gene            145173..146192
FT                   /locus_tag="YPA_0116"
FT   CDS_pept        145173..146192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0116"
FT                   /product="putative sugar transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12085"
FT                   /db_xref="GOA:A0A0H2Y3I1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3I1"
FT                   /protein_id="ABG12085.1"
FT                   /translation="MGNRSLSMTQRPRKVKWVLPKGATQFGALAVILLIDSLVAPHFFS
FT                   IHIQDGRLFGSIIDILNRGAPVALLALGMTLVIATGGIDLSVGAVMAIAGATAATLTSA
FT                   GYPFMTVLALSLAVGALCGLWNGFLVAVLQIQPIVATLMLMVAGRGIAQLITEGQIVTF
FT                   DSGGLATLGSSTLMYLPMSVVIACSMLILVWLLTRKTALGLFIESVGINLRSARNAGVS
FT                   TRLVLIAVYVICGVCAAVAGIIVTADIRGADANNAGLWLELDAILAVVIGGASLMGGRF
FT                   NLLLSVIGALIIQGMNTGILLSGYQPEFNLVLKAIVVLAVLVVQSPMISLSHLFQRRK"
FT   gene            146192..147184
FT                   /locus_tag="YPA_0117"
FT   CDS_pept        146192..147184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0117"
FT                   /product="putative sugar transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12086"
FT                   /db_xref="GOA:A0A0E1NQD2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQD2"
FT                   /protein_id="ABG12086.1"
FT                   /translation="MLKRNVPLLITIAVFILGYAFCLSQFPSFSSSRVWCDLLTDNAFL
FT                   GIVAVGMTFVILSGGIDLSVGSVIAFTGVLLAKLIGTYGIHPVYAFAIVLVMGAMFGAL
FT                   MGWIIDSLKLPAFIITLAGMFFIRGMSFIVSEESLPINHPIYETLANYAWRVPGGGRFT
FT                   LLAFIMLMVVAFGILLAHHTRFGHNVYAIGGNSVSAGLMGVPVRRTTIKIYMLSSTLAA
FT                   LSGIVFSLYTSAGYALAASGVELDAIAAVVIGGTLLAGGIGTVFGTLFGVLIQGLIQSY
FT                   ITFDGTLSSWWTKIVIGILLFSFIVIQKAMSAFYLNRRSRPQSSPLTPV"
FT   sig_peptide     146192..146284
FT                   /locus_tag="YPA_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.735 at
FT                   residue 31"
FT   gene            complement(147171..148052)
FT                   /locus_tag="YPA_0118"
FT   CDS_pept        complement(147171..148052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0118"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12087"
FT                   /db_xref="GOA:Q1CBT5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBT5"
FT                   /protein_id="ABG12087.1"
FT                   /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGA
FT                   NLFTRHRNNIRLTPAGERLVPYAEMLLNTWRLAKKEVIHSLQHTELSIGATASLWEAYL
FT                   TPWLQQLYEQQEELRLEARIALRNSLVKQLHERQLDLLITTEPPKMDELACLLLGHFSL
FT                   RLYSSFSLDLPKEDDTPNEHKNASEVPYIKLEWGADFHQQENRLLDSEQAPILTTTSAH
FT                   LTRQLLETTGGCAFLPEHWQKEYPQLVIHPDIPPIVRPLYAVWLQNSDQQALIRQLLKT
FT                   PMNNATQSVTRE"
FT   gene            148087..148509
FT                   /locus_tag="YPA_0119"
FT   CDS_pept        148087..148509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12088"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y384"
FT                   /protein_id="ABG12088.1"
FT                   /translation="MFCFTRCQAYLILRAINSTTMRELGACQMADSFITTNRFFDNKHY
FT                   PRGFSRHGDFTIKEAQLLERHGYAFNELDSGKREPVTEEEQRFVAVCRGEREPVSAEEK
FT                   VWSKYVIRTRQPKRFHTLSGGKPQMDAVEDYTDSDD"
FT   gene            complement(148766..150289)
FT                   /locus_tag="YPA_0120"
FT   CDS_pept        complement(148766..150289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0120"
FT                   /product="putative magnesium chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12089"
FT                   /db_xref="GOA:A0A0E1NR73"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR73"
FT                   /protein_id="ABG12089.1"
FT                   /translation="MSLATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEA
FT                   RDRVRSALINSGFNFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIPADKLAHY
FT                   EFLGELALSGALRRVSGAIPAALTCSEANRQLILPTANGLEIGLIPQGNSWVADHLLAV
FT                   CGFLQGENPLAQGQPFEPAPSPDNHLDLHDIIGQSQAKRALEIAAAGGHNLLLLGPPGT
FT                   GKTMLATRLTGLLPPLTDQEALEAAAITGLLHSNALPTQWRCRAFRAPHHSASMAALIG
FT                   GGSIPRPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKICFPAKVQ
FT                   LIAAMNPSPSGHYQGVHNRTPPQQILRYLAKLSGPFLDRFDLSIEVPLLPAGMLGAQKN
FT                   QGESSATVKQRVLQARQRQMDRAGKINTQLTSQEVAEFCYLAPEDAAFLEQVLLTLGLS
FT                   VRAWHHILKVARTIADLAQEKTIQKSHLSEALSYRCMDRLLLQLHKSLM"
FT   gene            150912..152558
FT                   /locus_tag="YPA_0121"
FT   CDS_pept        150912..152558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0121"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12090"
FT                   /db_xref="GOA:A0A0E1NNK9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNK9"
FT                   /protein_id="ABG12090.1"
FT                   /translation="MNGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAIAAIGYARATGKVGVCIATSGPGATNLITGLADALLDSVPVIAITGQVGSALI
FT                   GTDAFQEIDVLGLSLACTKHSFLVESLDALPEIMAEAFAIATSGRPGPVLIDIPKDIQL
FT                   AVGELTPHLKPVEEHSVDSAAELQHAWDMLANAQKPMLYVGGGVGMAQAVPALRDFIAM
FT                   TGIPAVATLKGLGAPDIAHPCYLGMLGMHGTKAANFAVQDCDLLVAVGARFDDRVTGKL
FT                   NTFASKAKVIHMDIDPAELGKLRQVHVALQGNLNVLLPALQQPLNIQSWRDEVMALKQQ
FT                   HHWRYDHPGQAIYAPLLLKQISERKAPETVVTTDVGQHQMWTAQHMNFTRPENFITSSG
FT                   LGTMGFGVPAAVGAQMARPDDMVICVSGDGSFMMNVQELGTIKRKQLPLKIVLLDNQRL
FT                   GMVRQWQQLFFDGRYSETNLSDNPDFITLASAFDIPGQRITRKDQVDAALDALFNSEGP
FT                   YLLQVSIDELENVWPLVPPGAGNETMLEKIS"
FT   gene            152555..152812
FT                   /locus_tag="YPA_0122"
FT   CDS_pept        152555..152812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0122"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12091"
FT                   /db_xref="GOA:A0A0E1NP06"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NP06"
FT                   /protein_id="ABG12091.1"
FT                   /translation="MIQHQLSIQARFRPEMLERVLRVVRHRGFQVCAMNMSPMIDAGNV
FT                   NIELTVASQRPVDLLSSQLSKLMDVACVEILQPNTLQIRA"
FT   gene            152835..153761
FT                   /locus_tag="YPA_0123"
FT   CDS_pept        152835..153761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0123"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12092"
FT                   /db_xref="GOA:A0A0E1NWI3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWI3"
FT                   /protein_id="ABG12092.1"
FT                   /translation="MTKKADYIWFNGEMVPWAEAKVHVMSHALHYGTSVFEGVRCYESH
FT                   KGPVVFRHREHMQRLHDSAKIYRMPVSQSVDELMEACRATLRKNNLTSAYIRPLVFIGD
FT                   VGMGVNPPEGYNTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRVAPNTIPTAAKAGGN
FT                   YLSSLLVGSEARRHGYQEGIALDVHGYLSEGAGENLFEVKDGILFTPPFTSSALPGITR
FT                   DAIIKLAKDMGLEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGIGKRGPVT
FT                   AKIQQAFFGLFTGETEDKWGWLDQVNP"
FT   gene            154072..155922
FT                   /locus_tag="YPA_0124"
FT   CDS_pept        154072..155922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0124"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12093"
FT                   /db_xref="GOA:Q1CBS9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBS9"
FT                   /protein_id="ABG12093.1"
FT                   /translation="MPKYRSHTTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGKLVAEQIVASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKIIKLD
FT                   LIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTANSMNCLNEALGLALPGNGSLL
FT                   ATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIANKAAFENAMILDIAMGGSTNT
FT                   VLHLLAAAQEGEIDFSMTDIDHLSRKVPHLCKVAPSTQKYHMEDVHRAGGVIGILGELD
FT                   RAGLLNRDVSNVLGLNLTQTLEAYDVMLTQDEGVKQMYAAGPAGIRTTKAFSQDCRYPS
FT                   LDTDREEGCIRTREHAYSQDGGLAVLYGNIAADGCIVKTAGVDKDSLTFRGPAKVFESQ
FT                   DEAVEAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFS
FT                   GGTSGLSIGHVSPEAASGGLIGLVQDGDFINIDIPNRGIVLDVSEAELAARRETEEAHG
FT                   DAAWSPKGRERQVSYALRAYAMLATSADKGAVRDKSKLGG"
FT   gene            155928..157472
FT                   /locus_tag="YPA_0125"
FT   CDS_pept        155928..157472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0125"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12094"
FT                   /db_xref="GOA:A0A0E1NUT7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUT7"
FT                   /protein_id="ABG12094.1"
FT                   /translation="MAVSQPLSAAPCGAEYLRAILRAPVYEVAQVTPLQVMEKISSRVG
FT                   NTVLVKREDRQPVHSFKLRGAYAMISSLTEEQKACGVVTASAGNHAQGVALSAHKMGIK
FT                   ALIVMPVATADIKVDAVRAFGGEVLLFGANFDEAKTKAIALAQEQGYTFVPPFDHPAVI
FT                   AGQGTLAMELLQQDAHLDRVFVPVGGGGLVAGVAVLIKQLMPQIKVIGVEAEDSACLRA
FT                   ALDAGQPVDLARVGLFAEGVAVKRIGDEPFRLCQEYLDDVITVDSDAICAAVKDLFEDV
FT                   RAIAEPSGALALAGLKKYVQQHNIQGERLAHVLSGANVNFHGLRYVSERCELGEQREAL
FT                   LAVTIPEQKGSFLRFCELLGGRSVTEFNYRYADAENACIFVGVRLTRGYAERVEILAEL
FT                   QDKGYQVVDLSDDEMAKLHVRYMVGGRPSKPLRERLFSFEFPESPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAAFELSATEPQFEERLAALGYYCHDETDNPAFKFFLAG"
FT   gene            complement(157603..158067)
FT                   /locus_tag="YPA_0126"
FT   CDS_pept        complement(157603..158067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0126"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12095"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQN9"
FT                   /protein_id="ABG12095.1"
FT                   /translation="MKAKSKKIICALLLLGSILLGYFFWLSLRPVEIVAIHKDGNFSAV
FT                   LVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDRLC
FT                   FSDMNTTKNCIEKEKYMTIYKIKNDEPLFSFDGNRYFLNENNKIVKMKRE"
FT   sig_peptide     complement(158002..158067)
FT                   /locus_tag="YPA_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.583 at
FT                   residue 22"
FT   gene            complement(158147..158608)
FT                   /locus_tag="YPA_0127"
FT   CDS_pept        complement(158147..158608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0127"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12096"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRW1"
FT                   /protein_id="ABG12096.1"
FT                   /translation="MKAKSKKTLYALLLIGSVLLGYFFWLSLRPVEIVAVHKDRNFSAV
FT                   LVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDRRC
FT                   FEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKHE"
FT   gene            complement(158592..159263)
FT                   /locus_tag="YPA_0128"
FT   CDS_pept        complement(158592..159263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12097"
FT                   /db_xref="InterPro:IPR017483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3J2"
FT                   /protein_id="ABG12097.1"
FT                   /translation="MPYGYAYDKNPESKKITRQECVRILFNEFRHESRSFAFYGPYKHL
FT                   IEKMIDHMQNGNGTPFRDLSLDAALKEQILSDYTEKNSTRLLLRKVLNENIDWRNKLYP
FT                   AEKKDDIRKFILDGRLPKFDRFQDNFNGMGITVHDTWATDITIKSLQIDNDRYRAMVHY
FT                   KIQDHFGLDNNDIKNTKFNRFHFFRIWFVLQRFNQFGFKPFMTNMEATIEITGGRNESK
FT                   K"
FT   gene            complement(159356..159547)
FT                   /locus_tag="YPA_0129"
FT   CDS_pept        complement(159356..159547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12098"
FT                   /db_xref="InterPro:IPR017483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4C5"
FT                   /protein_id="ABG12098.1"
FT                   /translation="MEAVNNIKGIYIMLETTKSTVQALYFPCTVFKTQKRMDDYGADDM
FT                   RCGDLSATQLKTDFNVVI"
FT   gene            160159..160368
FT                   /locus_tag="YPA_0130"
FT   CDS_pept        160159..160368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZ34"
FT                   /protein_id="ABG12099.1"
FT                   /translation="MEDNGAVAKETIEGTVGYIGDDISLLTSAMNNFSSQVSEQVSMLG
FT                   AIQSNVTGSIAMISCYSIGRVIAA"
FT   gene            complement(160423..161304)
FT                   /locus_tag="YPA_0131"
FT   CDS_pept        complement(160423..161304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0131"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12100"
FT                   /db_xref="GOA:A0A0E1NTG7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTG7"
FT                   /protein_id="ABG12100.1"
FT                   /translation="MDLRDLKVFLHLAESRHFGRSAKAMHVSPSTLSRQIQRLEETIGQ
FT                   PLFLRDNRTVQLTDAGNQLKAFAQQTLLQYQQLLHALGQHGPSLSGELRLFCSVTAAYS
FT                   HLPPILDRFRARHPLVEIKLTTGDAADAVNKVQSNEADLGIAGRPEVLPTSVAFTQIGE
FT                   IPLVLIAPALPCAVRSQVAVEKPDWAMIPFILPEHGPSRKRIDLWFRRQRITNPLIYAT
FT                   VSGHEAIVSMVALGCGVALIPSVVVDNSPEPVRNRISLLDDVSLVEPFELGVCVPKKRL
FT                   QEPLIDAFWGLL"
FT   gene            161590..163068
FT                   /locus_tag="YPA_0132"
FT   CDS_pept        161590..163068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0132"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12101"
FT                   /db_xref="GOA:Q1CBS1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBS1"
FT                   /protein_id="ABG12101.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHSAVVKAVQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALSEQLKEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFE
FT                   NAPQFEGKISEQEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKEKFMDSLQAGDLGKSIPGSAVDNAQ
FT                   LRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG"
FT   gene            163645..165087
FT                   /locus_tag="YPA_0133"
FT   CDS_pept        163645..165087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0133"
FT                   /product="colicin"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12102"
FT                   /db_xref="GOA:A0A0E1NS99"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS99"
FT                   /protein_id="ABG12102.1"
FT                   /translation="MGLLMQQQRVNADLETAKITEPQRVENARLTAEAAEKAARDRRIS
FT                   EEIAATEAKRQRMENERLAEQERQRVEGTKQQVSEASCAQQASAWQNRFTLPALQPSGS
FT                   AQYSFAASGMSAVGEAAELHNSFLAAQEQLSAIATISASGSVAAMIALGIYQTKVGESS
FT                   ERPPGWNVSPKFVGSISLSAMGLPATESLASQGEMALPVRMRIIDAKDWIGCTEIYAVK
FT                   TGVAGVLPKVKVGAAQYDESTGVYTFTTDSTPPRTLIFTPAQPPGAETRPILAPPGSTP
FT                   ATLQHTGEMIIKPVITPTILPLPQLYARDFHDYIIWFPADSGLEPVYVYLNSPYGKTTA
FT                   KGKYSGRDFNPDKAGGPIKNLDWKEIKIRGEGVDEVKLHTRRFGELEDNKLMIERLEKI
FT                   LTNKLTATDIDKHFYTHEIRELERYRMLGIPDDVNDKSVWNDAHTATLEDFKINEKTQP
FT                   LYTSEAEDAYIKAELKNSLGSK"
FT   gene            165087..165350
FT                   /locus_tag="YPA_0134"
FT   CDS_pept        165087..165350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTZ6"
FT                   /protein_id="ABG12103.1"
FT                   /translation="MSIMEKIIQNETVEDVLLAFTPNTAYQGIERMYVRYRFNIVSNRE
FT                   LLFTYQRLIKEAKLAEDEKGHTLKGPNWKEPKFVTDKKYGIE"
FT   gene            165603..165854
FT                   /locus_tag="YPA_0135"
FT   CDS_pept        165603..165854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0135"
FT                   /product="colicin"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12104"
FT                   /db_xref="GOA:A0A0E1NS96"
FT                   /db_xref="InterPro:IPR003060"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR037146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS96"
FT                   /protein_id="ABG12104.1"
FT                   /translation="MTFWREVANEPELVGQFKPNNVSLMKKGLSPHPVLSEKVGGRDTF
FT                   EIHHVNSIKSGGAVYDVDNLRVATPKRHIEIHSRRGGK"
FT   gene            165856..166113
FT                   /locus_tag="YPA_0136"
FT   CDS_pept        165856..166113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0136"
FT                   /product="colicin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12105"
FT                   /db_xref="GOA:A0A0E1NNA5"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNA5"
FT                   /protein_id="ABG12105.1"
FT                   /translation="MELKEKYEDYTEHEFLEFIRNICEVNTDSQSLHSSWVRHFTKITE
FT                   HPSGSDLIYYPEDGADDSPEGILELVKKWRAENGKPGFKK"
FT   gene            complement(166566..166724)
FT                   /locus_tag="YPA_0137"
FT   CDS_pept        complement(166566..166724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4L0"
FT                   /protein_id="ABG12106.1"
FT                   /translation="MGASSAQTLEAYYGLNITHNFSPCYIPVPLQDAGTLAALAHPSHL
FT                   VVDLKNK"
FT   gene            complement(166748..167566)
FT                   /locus_tag="YPA_0138"
FT   CDS_pept        complement(166748..167566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0138"
FT                   /product="putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12107"
FT                   /db_xref="GOA:A0A0E1NXY2"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXY2"
FT                   /protein_id="ABG12107.1"
FT                   /translation="MHMRKWLSVSNNIMLSRINRRLRGLLLLMTTCRVLTLPALTIGVL
FT                   IMSALATSAVASVIAERTRIVFSEGSTEESLQLVNSNSYPVAVQVWVDDGNLMATPDKA
FT                   VSPILVLPPVFRLQPQAQRSLRLILSGGSKLPADRESAFWLNIYEIPPKATPKSGDESF
FT                   VTLALRMQYKVFYRPKNLPAPGDILGKALTFSLERNGDSALIKVNNPTPYYASFAALTI
FT                   GSAEGPPEMVAPFSQLDFPLNRAPISDNKTVNFDLIDDLGNRNSFSHELK"
FT   sig_peptide     complement(167396..167566)
FT                   /locus_tag="YPA_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.727 at
FT                   residue 57"
FT   gene            complement(167532..168911)
FT                   /locus_tag="YPA_0139"
FT   CDS_pept        complement(167532..168911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12108"
FT                   /db_xref="GOA:A0A0H2Y3K4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3K4"
FT                   /protein_id="ABG12108.1"
FT                   /translation="MRKIMLRPTKPLISSGISQSTTAVYCRRPYFLAGMTLLIGLFSTS
FT                   AWSNCTRITAQNQISSSDGTAASWLGSRDDNNGSLNLPSIVDLSTNANFQPDGTLLASA
FT                   TSDFTTFAVNTGYALDQVLFRCDAADVDQLYEMYATNGDSTYGGRYEDGTIAGNVSYGY
FT                   ATTVMNVVIRFTNLATGEYYARIWKGRRLTGLDTDSSGRILVKAKNFSNVYTELFRIDY
FT                   ARSGANNTPSYLYGRSQPNAYIAFKGPGITGPIEGTDSYSNWPGWYSTWPASLGLYKYV
FT                   TFRRTTICAVSNFTPTVVLPRISVAELNNGNTSSADFNVDFQCQTGINSGVTAGTVAMG
FT                   FLVPAANAAKAQALGLMNGNGGVSHLVSDNYGAAGTAGGVGIRIYRNNSPMYLLSKNVT
FT                   QTGNNGGWYGILQGAQETTGSVDGGNSYTETFRAELSKISGQTVTAGAVNAHAQVVIRV
FT                   Q"
FT   sig_peptide     complement(168765..168911)
FT                   /locus_tag="YPA_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.800 at
FT                   residue 49"
FT   gene            complement(168916..171543)
FT                   /locus_tag="YPA_0140"
FT   CDS_pept        complement(168916..171543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0140"
FT                   /product="putative outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12109"
FT                   /db_xref="GOA:A0A0E1NW68"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW68"
FT                   /protein_id="ABG12109.1"
FT                   /translation="MVQARVILKKNFSGRRKALTLCITLILHIDTAFGQEEPQNFEFDE
FT                   SLFLGTKYASGLTQLNKKNSITAGNYDAVDVLVNNKLFKRMSVQFIKDANSSEVYPCLS
FT                   DELLTAAGVELGRENSTPPKEPHVTEANTPITETHAPTNQCLPLSTRVKGASFRFDQAK
FT                   LRLELSIPQALLQKRPRGYIERAEWQEGEKLAFINYSANAYRSDTRGQQKRTSDFGFIG
FT                   LKSGINLGLWQVRQQSNVRYASNDSGSDTQWNSIRTYVQRPIPQLDSQLTLGETFTDST
FT                   LFGSMSFLGAKMATDQRMWPVSMRGFSPEVRGVASTNARVIIRQNGREIYETNVAPGPF
FT                   VINDLFSTSSQGDLNVEVIEANGSRSTFTVPFSAVPDSMRPGVSRYNAVIGESRDFTNI
FT                   DNYFTDFTYERGLTNQLTANSGVRLAKDYTALLAGGVLGTPVGALGLNATYSHAKVEND
FT                   KTQDGWRMQATYSQTFNQTGTTFSLAGYRYSTKGYRDLNDVFGVRSMQKNGGTWDSSTY
FT                   KQRSQFTTTINQDLGNWGQLYASASTSDYYNDTARDTQLQLGYSNSYQQISYNLAVSRQ
FT                   RSVYTSTLYNWDSPDTDETATTTRYGNTENIATFTVSIPLNIGSNNQYLSMSASRNPKS
FT                   GNNYQTSLSGTAGERNSFNYALNAGYDDSNFGSSSNNWGANVQKQFPNATVNGSYSRGN
FT                   NYTQYGAGARGAAVIHRQGVTLGPYLGETFGLIEANGAQGARIDSNGFALVPALTPYNY
FT                   NTIGLDTKGINRNTELKENQGRVVPYAGAAVKVKFETLTGYAVLIQAEGEGLPLGADVY
FT                   NSKDELVGMVGQGNQIYARIADNKGTLDVRWGESSGDQCQLPYAFNRQDTEQDIIHITA
FT                   SCRR"
FT   sig_peptide     complement(171439..171543)
FT                   /locus_tag="YPA_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.806 at
FT                   residue 35"
FT   gene            complement(171571..172302)
FT                   /locus_tag="YPA_0141"
FT   CDS_pept        complement(171571..172302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0141"
FT                   /product="putative fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12110"
FT                   /db_xref="GOA:A0A0E1NWA3"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWA3"
FT                   /protein_id="ABG12110.1"
FT                   /translation="MLSIYARHYHYLFVTLLVAMSLSFANASVVMTGSRIIYPAAASEH
FT                   SIQLTNNDNFPNAVQVWLDSGDEKSTPETGKAPFIVTPPFFRIEANSGQTLRLKYTGSG
FT                   LPTDRESVFYLNFLQIPPVNKVEKDNKMLVLLRNRIKVFYRPESIIGRVDQVSTALTFS
FT                   LRKQGTNLVLTGKNPTGFYATIASGEIVSGSIKLKVKSNMIAPMSQVEWVIPNASVSSS
FT                   ATINFLIMNDFGGQDAGSYRI"
FT   sig_peptide     complement(172219..172302)
FT                   /locus_tag="YPA_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.708 at
FT                   residue 28"
FT   gene            complement(172366..172896)
FT                   /locus_tag="YPA_0142"
FT   CDS_pept        complement(172366..172896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0142"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12111"
FT                   /db_xref="GOA:A0A0E1NQQ9"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQQ9"
FT                   /protein_id="ABG12111.1"
FT                   /translation="MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGLE
FT                   ANPVVLLPTVSSSDLDASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGNLQ
FT                   NTGTAGNVELQLLKDATTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQSTPG
FT                   SVIASVQYAVSYL"
FT   sig_peptide     complement(172834..172896)
FT                   /locus_tag="YPA_0142"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 21"
FT   gene            complement(173706..174914)
FT                   /locus_tag="YPA_0143"
FT   CDS_pept        complement(173706..174914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0143"
FT                   /product="transposase for the IS285 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12112"
FT                   /db_xref="GOA:Q1C4W5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C4W5"
FT                   /protein_id="ABG12112.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(175011..175802)
FT                   /locus_tag="YPA_0144"
FT   CDS_pept        complement(175011..175802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12113"
FT                   /db_xref="GOA:A0A0E1NMQ5"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMQ5"
FT                   /protein_id="ABG12113.1"
FT                   /translation="MEILNIPRRCFTFLLIIITYSFPLSFADSKPLKYTFEVIRKIPHD
FT                   ETSFTQGLVIDDGKLYETTGLYKNSKIRELDLTNGKVIRSVNLPDNIFGEGITKLGDSF
FT                   YVLTWKEKKAFVINPNDLKIIKTFNYEGEGWGLTTDGINLIMGDGSDTLYFRNPADFSI
FT                   IKKISVTFDGRRIEKINELEWIDGMIYANVWYSDAILVIEPENGRVVKWIELSGLQFML
FT                   DSVNRNTNTLNGIAYDKSKNKIYLTGKNWSNIFEVKFLTSK"
FT   sig_peptide     complement(175719..175802)
FT                   /locus_tag="YPA_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.949 at
FT                   residue 28"
FT   gene            complement(176041..176322)
FT                   /locus_tag="YPA_0145"
FT   CDS_pept        complement(176041..176322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0145"
FT                   /product="peptidyl-prolyl cis-trans isomerase C"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12114"
FT                   /db_xref="GOA:A0A0E1NPM8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPM8"
FT                   /protein_id="ABG12114.1"
FT                   /translation="MANKASALHILVDDEKQANDILAQLNNGANFQELAKKFSNCPSKR
FT                   NGGDLGEFNKGDMVPAFDKAVFSCELLQPYGPVKTQFGYHIIKVLYRS"
FT   gene            176526..178547
FT                   /locus_tag="YPA_0146"
FT   CDS_pept        176526..178547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0146"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12115"
FT                   /db_xref="GOA:A0A0E1NWJ3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWJ3"
FT                   /protein_id="ABG12115.1"
FT                   /translation="MRLNPSQQEAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRQCGY
FT                   QPKHIAAVTFTNKAAREMKERVAQTLGRKEARGLMIATFHTLGLEIIKKEYVALGMKSN
FT                   FSLFDAQDQMGLLKDLTHKWLEDDKTLLQQLVSAISNWKNDLLDPAAAAATARSERDKL
FT                   FVHCYGLYDAHLKACNVLDFDDLISLPTLLLQKNLEVRERWQNRLRYLLVDEYQDTNTS
FT                   QYQMVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLVLLNEDFPALRVIKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKKLFSELSYGDELKVITANNEDHEAERVVGELIAHHFVKKT
FT                   QYSDYAILYRGNHQSRLFEKLLMQNRIPYRISGGDSFFSRPEIKDLLAYLRVLTNQDDD
FT                   SAFLRIVNTPKREIGAATVQKLGEWANLRNKSLFRASFDLGLGEHLKGRGLESLQRFTH
FT                   WMDGIIRLVEREPVAAVRDLIHGIDYESWLFETAPSPKAAEMRMKNVNLLFSWMTEMLE
FT                   GSELDEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLHASKGLEFPYVFLVGMEEG
FT                   LLPHQSSIDEDNVDEERRLAYVGITRAQRELFFTLCKERRQYGELIRPEPSRFLMELPQ
FT                   DDLNWENERKAVSPEERMQKGQSHLANLRAQLANAKKP"
FT   gene            complement(178715..179773)
FT                   /locus_tag="YPA_0147"
FT   CDS_pept        complement(178715..179773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0147"
FT                   /product="Guanosine-5'-triphosphate,3'-diphosphate
FT                   diphosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12116"
FT                   /db_xref="GOA:A0A0H2Y4L8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4L8"
FT                   /protein_id="ABG12116.1"
FT                   /translation="MVTGNGAQANILVSLSMGCVTWLERYFGDRHLAKENFERAELAAH
FT                   EMIKPVAQRFREHGWQVCVGASGTVQALQEIMVAQGMDELITLAKLQQLKQRAIQCGKL
FT                   EELEIPGLTLERALVFPSGLSILIAIFQELSIESMTLAGGALREGLVYGMLHLPVEQDI
FT                   RRRTLRNLQRRYLLDTEQAKRVSCLADNFFLQVEKEWHLDGRCREFLQNACLIHEIGLS
FT                   VDFKHAPQHAAYLIRNLDLPGFTPAQKLLLSALLQNQSDTIDLSLLNQQNALPADMAQH
FT                   LCRLLRLAIIFSSRRRDDTLPAVRLRADNNALYVLVPQGWLEQHPYRAEALEQESHWQS
FT                   YVQWPLLLEELS"
FT   gene            complement(179704..180210)
FT                   /locus_tag="YPA_0148"
FT   CDS_pept        complement(179704..180210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12117"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2C5"
FT                   /protein_id="ABG12117.1"
FT                   /translation="MMLSSTSLYAAIDLGSNSFHMLVVREVAGSIQTLARIKRKVRLAA
FT                   GLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRVVATATLRLASNADEFLRTATEI
FT                   LGCPIQVISGEEEARLIYHGVAHTTGGPEQRLVVDIGGAALSWLQAMGLRRIFWSAYQW
FT                   VVLPG"
FT   gene            complement(180214..181500)
FT                   /locus_tag="YPA_0149"
FT   CDS_pept        complement(180214..181500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0149"
FT                   /product="putative DEAD-box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12118"
FT                   /db_xref="GOA:Q1CBQ4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBQ4"
FT                   /protein_id="ABG12118.1"
FT                   /translation="MSKTHLTEQKFSDFALHPLVVEALENKGFQYCTPIQALALPLTLS
FT                   GRDVAGQAQTGTGKTLAFLASTFHYLLSHPAEEGRQTNQPRALIMAPTRELAVQIHSDA
FT                   ESLSQVTGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNYINLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRMPSVDKRLNMLFSATLSYRVRELAFEQMNNAEYVEVE
FT                   PLQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEEIWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILEDFTKGDLDILVATDVAARGLHIPLVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGESGHSISLACEEYALNLPAIETYTGHSIPVSKYNSDALLTDLPAPKRL
FT                   ARTRTGNGPRRNSAPRRSGAPRNNRKRPG"
FT   gene            181619..181945
FT                   /locus_tag="YPA_0150"
FT   CDS_pept        181619..181945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0150"
FT                   /product="thioredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12119"
FT                   /db_xref="GOA:A0A0E1NTX3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTX3"
FT                   /protein_id="ABG12119.1"
FT                   /translation="MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDE
FT                   IAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLLLFRDGEVVATKVGALSKGQLKAFL
FT                   DANL"
FT   gene            182425..183684
FT                   /locus_tag="YPA_0151"
FT   CDS_pept        182425..183684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0151"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12120"
FT                   /db_xref="GOA:A0A0E1NQQ0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQQ0"
FT                   /protein_id="ABG12120.1"
FT                   /translation="MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDFNRSGTRKEELLTTTDELQKMWILRRILHPMGEIDAMEFL
FT                   ISKLATAKTNDQFFDNMRRS"
FT   gene            184234..185316
FT                   /locus_tag="YPA_0152"
FT   CDS_pept        184234..185316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0152"
FT                   /product="putative undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12121"
FT                   /db_xref="GOA:A0A0H2Y3A7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3A7"
FT                   /protein_id="ABG12121.1"
FT                   /translation="MSTELIYIFLFSMAFLFVARKVAIKIGLVDKPNYRKRHQGLIPLV
FT                   GGISVFAGVCFAFLITNQQIPHFRLYLACAGLLVFVGALDDRFDISVKIRAFVQALVGI
FT                   AMMAVAGLYLRSLGHAFGPWEMVLGPFGYVVTLFAVWAAINAFNMVDGIDGLLGGLSCV
FT                   SFGAMGILLYQSGQMSLALWCFAMIATIIPYILLNLGLLGRRYKVFMGDAGSTLIGFTA
FT                   IWILLQATQGNAHPINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIHHLIMR
FT                   AGFTSRQAFVLITLAAALLAMIGVIGERLTFIPEWVMLALFLLAFLLYGYCIKRAWRVA
FT                   RFIKRFKRRMRRASKNKHES"
FT   gene            185334..186413
FT                   /locus_tag="YPA_0153"
FT   CDS_pept        185334..186413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0153"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12122"
FT                   /db_xref="GOA:A0A0H2Y4M2"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4M2"
FT                   /protein_id="ABG12122.1"
FT                   /translation="MMKPESMSTDKTGSTNNEPSVDNELDIRGLCRTLWRGKVWIIGMA
FT                   IIFAAIALGVSYLVKQQWSATAITDKPTVNNLGGYYSQQQFLRNLDIRLNSGLVSEQPG
FT                   ISDEAYGEFITQLAAYDTRRDFWLQSDYYKQRLEGDAKADAALLDELVNNIVFTARDDK
FT                   KIPNDSIKLTAETASDANKLLRGYIDFASQRASSHLNDEIQGAWAARTQSMKAQVKRQE
FT                   AVAQAVFDREVAAVKQALKVAGQQGITSSQTDTPAEQLADSKMFMLGKPMLEARLETLL
FT                   ATGPSFDIDYDQNRAMLATLNVGPTLDDKFQTYRYLRTPEDPVTRDSPRRVFLLIMWGA
FT                   IGALVGAGVVLVRRSSKAL"
FT   gene            186640..187824
FT                   /locus_tag="YPA_0154"
FT   CDS_pept        186640..187824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0154"
FT                   /product="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12123"
FT                   /db_xref="GOA:A0A0H2Y2D0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2D0"
FT                   /protein_id="ABG12123.1"
FT                   /translation="MRPTCRHCLRLTDLKRFTVKVLTVFGTRPEAIKMAPLVHALAQDD
FT                   AFESRVCVTAQHREMLDQVLRLFEIQPDYDLDIMRPGQGLTEITCRILEGLKPVLEEFK
FT                   PDVILVHGDTTTTLSASLAGFYHRIPVGHVEAGLRTGDLYSPWPEEANRQLTGHLAMYH
FT                   FAPTENSRQNLLREWVPENRIFVTGNTVIDALFWVRDRVMNTPDLRANLAQRYAFLDTN
FT                   KKMILVTGHRRESFGGGFERICSALAEIARKHPEVQVVYPVHLNPNVSEPVNRILKGID
FT                   NIILIDPQDYLPFVYLMNHAYLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTV
FT                   LLVGTNINKIVDAVTRLLTDETAYHQMTRAHNPYGDGYACQRILKALKNHQVTL"
FT   gene            187821..189083
FT                   /locus_tag="YPA_0155"
FT   CDS_pept        187821..189083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0155"
FT                   /product="putative UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12124"
FT                   /db_xref="GOA:A0A0E1NX14"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX14"
FT                   /protein_id="ABG12124.1"
FT                   /translation="MSFETISVIGLGYIGLPTAAAFASRKKKVIGVDVNAHAVETINRG
FT                   AIHIVEPDLDKVVKIAVEGGYLQAVTKPQAADAFLIAVPTPFKGDHEPDMIFVESAAKS
FT                   IAPVLKKGDLVILESTSPVGATEQMAQWLAEARPDLSFPQQAGEAADINIAYCPERVLP
FT                   GQVMVELIQNDRVIGGMTPKCSARASALYKIFLEGECVVTNSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICDEQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAAVADCLAASDKRASEVKIACFGLAFKPDIDDLRES
FT                   PAVGVARLIAEWHVGETLVVEPNVEQLPKSLMGLVTLKDTATALQQADVLVMLVDHKQF
FT                   KAIKPEDIKQQWIVDTKGVWR"
FT   sig_peptide     187821..187892
FT                   /locus_tag="YPA_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.603) with cleavage site probability 0.533 at
FT                   residue 24"
FT   gene            189074..190147
FT                   /locus_tag="YPA_0156"
FT   CDS_pept        189074..190147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0156"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12125"
FT                   /db_xref="GOA:A0A0H2Y4F7"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4F7"
FT                   /protein_id="ABG12125.1"
FT                   /translation="MALRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLES
FT                   LSVVAGSERYAFEQVDICDSSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNV
FT                   VGTYTLLEAARHYWQQLSVEAKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYS
FT                   ASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNG
FT                   AQVRDWLYVEDHARALYQVVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPAKPA
FT                   GIAHYRDLITYVKDRPGHDMRYAIDAGKIERELGWRPQETFESGIRKTVLWYLNNESWW
FT                   RRVQDGSYAGERLGLSD"
FT   gene            190391..191323
FT                   /locus_tag="YPA_0157"
FT   CDS_pept        190391..191323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0157"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12126"
FT                   /db_xref="GOA:A0A0H2Y3B2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3B2"
FT                   /protein_id="ABG12126.1"
FT                   /translation="MYQEIVCIRRLHVSGERMKGIILAGGSGSRLHPITRGVSKQLLPI
FT                   YDKPMIYYPLSVLMLAGIRDVLIISTPEDLPSFQRLLGNGDEFGINLSYAAQPSPDGLA
FT                   QAFIIGEAFIDNEPCCLVLGDNIYFGQGFSPKLKAVAARQQGATVFGYQVMDPERFGVV
FT                   EFDDNFRALSIEEKPSQPKSNWAVTGLYFYDNQVVDFAKQVKPSARGELEITSINQMYL
FT                   DRGELTVELLGRGFAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDD
FT                   GVKRAATALAKTGYGKYLLDLLHARPRQY"
FT   gene            191274..192038
FT                   /locus_tag="YPA_0158"
FT   CDS_pept        191274..192038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0158"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12127"
FT                   /db_xref="GOA:A0A0H2Y4M6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4M6"
FT                   /protein_id="ABG12127.1"
FT                   /translation="MANICWIYYMPVHASIEPLGWESEFFQRQSAKLIFSDSAPPLNPA
FT                   ELAAFTLVQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEKEGIGTENATSEPNMG
FT                   AYSLRVATEADIPQLRRVAASAFALSRFRAPWYDAQDSGRFYALWVEKAVLGTFDHQCL
FT                   LVLDPTDQPVGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQWCQHHGLHRL
FT                   RVATQMSNIAALRLYIRSGASIESTAYWLCRG"
FT   gene            192040..193170
FT                   /locus_tag="YPA_0159"
FT   CDS_pept        192040..193170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0159"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12128"
FT                   /db_xref="GOA:A0A0E1NV00"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV00"
FT                   /protein_id="ABG12128.1"
FT                   /translation="MIPFNTPPIVGTELGYMQAAMSSGKLCGDGGFTRRCQQWMEKRFN
FT                   CPKVLLTPSCTASLEMAALLLDIKPGDEVIMPSFTFVSTANAFVLRGAKMVFVDIRPDT
FT                   MNIDETKIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKG
FT                   KALGTIGHIGCFSFHETKNYTAGGEGGATLINDPSLIDRAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWGQLEAAEQINERRLALWHGYYNAFKPLADAGRIDLPV
FT                   IPGNVVQNAHMFYIKLRDIEERSAFISYLKEADIMAVFHYIPLHACPAGEAFGRMAGED
FT                   RFTSKESERLVRLPIFYNLTDVNQSTVINTVLSFFV"
FT   gene            193172..194428
FT                   /locus_tag="YPA_0160"
FT   CDS_pept        193172..194428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0160"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12129"
FT                   /db_xref="GOA:A0A0E1NVR8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVR8"
FT                   /protein_id="ABG12129.1"
FT                   /translation="MSLAKASIWTACSTLIKIGVGLLVVKLLAVTFGPSGVGQAGNFRQ
FT                   LIIVLGVLSGAGIFNGITKYVAEYHQQPERLRAMLGTSSTIVLGFSTLLALVFLLAAKP
FT                   VSIALFGHADYQNVVRAIAFIQMGIAYGNLFLAILKGYRDAMGNALAIIGGSLIGVVAY
FT                   YICFQIGGYSGALVGLGLVPALVVLPAAAMLYRRRTIPLRYLKPHWDKALASHLGKFTL
FT                   MALITSVTLPVAYVMMRHLLANNYGWDAVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLKDKGAISREIFRSLKFVLPAVAAASLTVWLLRDFAIWLLFSHQFTAMRDLFAWQLVG
FT                   DVLKVGSYVFGYLVIAKASLRFYILAEVSQFLLLTGFAYWLIPMNGSLGAAQAYMATYI
FT                   VYFALCSCAFLVYRRHSAP"
FT   gene            194451..195536
FT                   /locus_tag="YPA_0161"
FT   CDS_pept        194451..195536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12130"
FT                   /db_xref="GOA:Q1CBP2"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBP2"
FT                   /protein_id="ABG12130.1"
FT                   /translation="MITLTHVLGSDIPHHNLTVLRFFNDVLAKCLPVEQVRHFMVAAKE
FT                   TAPFSSFPQLDINTYSDKKALAEAVIARAQADRSARFFWHGQFNVTLWLALLSGKIKPG
FT                   QVYWHVWGADLYEDAKSLKFRLFYLLRRIAQGRVGHVFATRGDLIHYQQRHPRVPASLL
FT                   YFPTRMDPALTAINIDKPLAGPMTILVGNSGDTTNRHIEALKAIHQQFGPDVRVIIPMG
FT                   YPANNEAYIEQVRQAGLALFSQDNLRILTEQIPFDDYLNILRECDLGYFIFNRQQGIGT
FT                   LCLLTQFGVPFVLSRKNPFWQDLAEQHIPVFFYGDTLDEPMIREAQRQLAGLDKQAIAF
FT                   FNPNYIEGWKQALALAAGEHP"
FT   gene            195533..196897
FT                   /locus_tag="YPA_0162"
FT   CDS_pept        195533..196897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0162"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12131"
FT                   /db_xref="GOA:Q1CBP1"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBP1"
FT                   /protein_id="ABG12131.1"
FT                   /translation="MTLGQFGGLFCIYLIAVIFILTLTYQEFRRVKFNFNVLFSMLYLL
FT                   TFYFGFPLTCMLVFQFGVAVVPVEYLLYAMLSATAFYGIYYVTYKTRLRQPRSQPRTPI
FT                   FTMNRVETNLTWVLLALVAVGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGVALKRFFYF
FT                   FIPAMLVVYFLKQDRRAWFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGW
FT                   ITLWMLAAAGVFGIVGMFWLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGLLLQNY
FT                   DKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNTANYFTWDVLDNHSGLAISPTLIGSL
FT                   VVMGGVLFIPLGAIVVGLIIKWFDWLYEQGKAESNRYKAAILQSFCFGAVFNIIVLARE
FT                   GLDSFVSRVVFFCVIFGACLVLAKLLYWLFDTAGLIKRQGIKSNRLSTPNAGNQL"
FT   gene            196906..197646
FT                   /locus_tag="YPA_0163"
FT   CDS_pept        196906..197646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0163"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12132"
FT                   /db_xref="GOA:Q1CBP0"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBP0"
FT                   /protein_id="ABG12132.1"
FT                   /translation="MEPNTVIPKYNVRGFEIWGFRDMAQVLDHLLGSGPVKTGTLVAMN
FT                   AEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQAELSRVAGADLWEALMQRA
FT                   GQQGTPVFLVGGKPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFARIAASGAAI
FT                   VTVAMGSPKQEIFMRDCRKFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
FT                   AQPSRIRRQLKLLKFVGYYYSGRL"
FT   gene            198170..199561
FT                   /locus_tag="YPA_0164"
FT   CDS_pept        198170..199561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0164"
FT                   /product="putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12133"
FT                   /db_xref="GOA:A0A0E1NPP3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPP3"
FT                   /protein_id="ABG12133.1"
FT                   /translation="MADNAEKKGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAGP
FT                   SVLLAYIIAGLFVFFIMRAMGEMLYLEPVAGSFAVYAHKYLSPYFGYLTAWGYWFMWIA
FT                   VGISEITAIGVYVQFWFPEIPQWLPAIAGVAIVALANLAAVKLYGELEFWFAMIKVTTI
FT                   IVMILVGLGVIFFGFGNHGQPIGFDNLTAHGGFFAGGWKGFLFALCIVVASYQGVELVG
FT                   ITAGEARNPQVTLRRAINNILWRILIFYVGAIFVIVTIFPWNGIGTEGSPFVLTFAKIG
FT                   IVAAAGIINFVILTAALSGCNSGMYSGGRMLYALAKNRQLPAGLTKLSASGVPVYCIAI
FT                   TILCLLVGSSLNYIIPNPQQVFVYVYSASVLPGMVPWFVVLVCQLRFRQVHKAALQQHP
FT                   FKSILFPYVNYLTIAFLICVLVGMGINPDTRLSLLVGAIFLALVTGCYFVLGMHKPKAM
FT                   EAERL"
FT   gene            199710..199786
FT                   /locus_tag="YPA_r015"
FT                   /note="tRNA-Arg1"
FT   tRNA            199710..199786
FT                   /locus_tag="YPA_r015"
FT                   /product="tRNA-Arg"
FT   gene            199870..199945
FT                   /locus_tag="YPA_r016"
FT                   /note="tRNA-His1"
FT   tRNA            199870..199945
FT                   /locus_tag="YPA_r016"
FT                   /product="tRNA-His"
FT   gene            199962..200048
FT                   /locus_tag="YPA_r017"
FT                   /note="tRNA-Leu1"
FT   tRNA            199962..200048
FT                   /locus_tag="YPA_r017"
FT                   /product="tRNA-Leu"
FT   gene            200124..200200
FT                   /locus_tag="YPA_r018"
FT                   /note="tRNA-Pro1"
FT   tRNA            200124..200200
FT                   /locus_tag="YPA_r018"
FT                   /product="tRNA-Pro"
FT   gene            201073..202095
FT                   /locus_tag="YPA_0165"
FT   CDS_pept        201073..202095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0165"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12134"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12134.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            202095..202874
FT                   /locus_tag="YPA_0166"
FT   CDS_pept        202095..202874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0166"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12135"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12135.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            202890..203036
FT                   /locus_tag="YPA_0167"
FT   CDS_pept        202890..203036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2E3"
FT                   /protein_id="ABG12136.1"
FT                   /translation="MGRWWRYKWITFHPSLTVIKTPFDLLKQFAVWQLQMFNKKSKGGP
FT                   NEG"
FT   gene            203026..203484
FT                   /locus_tag="YPA_0168"
FT   CDS_pept        203026..203484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0168"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12137"
FT                   /db_xref="GOA:Q1C0I9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C0I9"
FT                   /protein_id="ABG12137.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(203677..204897)
FT                   /locus_tag="YPA_0169"
FT   CDS_pept        complement(203677..204897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0169"
FT                   /product="putative protoheme IX biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12138"
FT                   /db_xref="GOA:A0A0E1NTD6"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTD6"
FT                   /protein_id="ABG12138.1"
FT                   /translation="MLRVLLLFLVLTVGIVLGPMLAGHQGYVLIQTDNYNVTTSVTGLA
FT                   IMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRKRTRARNQMKAALIKLAEGDFLQVE
FT                   KLLTRNADHAEQPMVNYLLAAEAAQQRGDEFRTNQYLERAAEVADGDQLPVNITRVRIQ
FT                   LAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYRSLLDILPAMSKTQIHTPE
FT                   EVAALEQQAYIGIMNQCMADEGSEGLKRWWKDQSRKVRNEIPLQVALAEHLIECDDHDV
FT                   AQKIILDSLKHQYDERLALLIPRLKAGNPEPLEKSLRQQIKQHGATPLLNSTLGQLMLK
FT                   HGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPEDAAQARREGLLLTLRQNGESS
FT                   ALTKLIH"
FT   sig_peptide     complement(204826..204897)
FT                   /locus_tag="YPA_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.843) with cleavage site probability 0.760 at
FT                   residue 24"
FT   gene            complement(204900..206024)
FT                   /locus_tag="YPA_0170"
FT   CDS_pept        complement(204900..206024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0170"
FT                   /product="putative uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12139"
FT                   /db_xref="GOA:A0A0E1NM94"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM94"
FT                   /protein_id="ABG12139.1"
FT                   /translation="MTEQNTPSAPVEEPTTAVERPQQPEPKGHREKRTGPILGVIAIAL
FT                   VIALGAGLYYHGQQQAQLQSAENIALQEQLVALKQTLLQEKQQLESLLQQQGKALESAE
FT                   NQQASLTRQLNELQEKVATISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAVTLLKS
FT                   ADASLADMNDPSLIDVRRAITEDISALSAVSQVDFDGIILKLNQLSNQVDNLRLADNNI
FT                   DDSPMDANSDELSSSLSEWRQNLSKSWHSFMSDFISIRRRDSSAEPLLAPNQDVYLREN
FT                   IRSRLLVAAQAVPRHQDEVYKQSLETISTWVRAYFDVNDPSTKAFLDELENLSQQPISM
FT                   DVPDQLKSQPILEKLMQTRVRNLLAQTPVDAQGE"
FT   gene            complement(206055..206804)
FT                   /locus_tag="YPA_0171"
FT   CDS_pept        complement(206055..206804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0171"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12140"
FT                   /db_xref="GOA:A0A0E1NY86"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY86"
FT                   /protein_id="ABG12140.1"
FT                   /translation="MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLPE
FT                   LLQDMQAGDLVFALSQNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLHVT
FT                   FPPMGETSEMLLSLPLLQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQRSPI
FT                   YYDGSEQSAHWQRAGVDILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRLAALA
FT                   TQMGWTEVRVAENADNDALIRALQDLQ"
FT   gene            complement(206801..207742)
FT                   /locus_tag="YPA_0172"
FT   CDS_pept        complement(206801..207742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0172"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12141"
FT                   /db_xref="GOA:Q1CBN1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBN1"
FT                   /protein_id="ABG12141.1"
FT                   /translation="MLDKIIRIATRQSPLALWQAHYVQHLLQANHPGLQIELVPMVTRG
FT                   DIILDTPLAKVGGKGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDP
FT                   RDAFVSSHYAHLDDLPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGD
FT                   YQAIILAVAGLKRLGLENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHR
FT                   HTELRVCAERAMNIRLEGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAA
FT                   EAEQMGIELADELLSRGAREILAAVYLDNPAR"
FT   gene            complement(207963..208172)
FT                   /locus_tag="YPA_0173"
FT   CDS_pept        complement(207963..208172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12142"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2E9"
FT                   /protein_id="ABG12142.1"
FT                   /translation="MRLLLKNTKNILFEEYLANYCWKRDQSNTLPINRKESKAISTIVK
FT                   PLYARITGSNEFLGVISADHRAAA"
FT   gene            208236..210788
FT                   /locus_tag="YPA_0174"
FT   CDS_pept        208236..210788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0174"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12143"
FT                   /db_xref="GOA:A0A0E1NR04"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR04"
FT                   /protein_id="ABG12143.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQKVYSLLPILLHCH
FT                   HPQMPGYLDGNVPHGVCLFTPNEIQQDYLADVEARWGEPLAPSAGGELPITGVYSMGST
FT                   SSIGQCHTSDLDIWVCHQAWLDTEERNQLQQKCSLLEKWAASMGVEVSFFLVGENRFRH
FT                   NASGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRILWNMVPVKEEEHYDDYVLSLYAQG
FT                   VLTPNEWLDLGGLSTLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNSQLL
FT                   AMEIKQHLHAGEIVSFGLDAYCMMLDRVTRYLIQINDTTRLNLVRRCFYLKVCEKLSRT
FT                   PASTGWRREVLSQLVSEWGWSNEKLAVLDNRANWKIERVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEEHLTFIHVPAGR
FT                   ANRPGWYLYNQAPSMDAIVSHQPLEYNRYLNKLVSWAYFNGLLTSKTHLHIKSANLCDT
FT                   VKLQELVTDISHHFPLRLAAPTPKALYSPCEIRHLAIIVNLEHDPTTTFRNQVVHFDFR
FT                   KLDVFSFGEQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAPPE
FT                   SVDVFCYSQHLRGLIRTRIQQLVSECIDLRLSSTRQEPGRFKAVRVSGQTWGLFFERLS
FT                   VSVQKLENAVEFYGAISNNKLHGLSVQVETNQIHLPPVVDGFASEGIIQFFFEGTADEK
FT                   GFNIYILDEANRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   QLDGRTQVIPFRSNTLSQLCANIAEKEASLPTKQCQLH"
FT   gene            complement(211032..211352)
FT                   /locus_tag="YPA_0175"
FT   CDS_pept        complement(211032..211352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0175"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12144"
FT                   /db_xref="GOA:Q1CBM8"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBM8"
FT                   /protein_id="ABG12144.1"
FT                   /translation="MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFEN
FT                   GSKIVINRQEPLHQVWLATKAGGYHFNYRDGHWYCSRSGEEFLAKLSEAASAQAGENVS
FT                   FG"
FT   gene            211504..211692
FT                   /locus_tag="YPA_0176"
FT   CDS_pept        211504..211692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0176"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12145"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS52"
FT                   /protein_id="ABG12145.1"
FT                   /translation="MKKELRWPMAAMMVLALAGCGLKGPLYFPPADKAPVDAAPQVEKN
FT                   QQDLSATPQTPSTAESQ"
FT   sig_peptide     211504..211575
FT                   /locus_tag="YPA_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.656 at
FT                   residue 24"
FT   gene            211876..212700
FT                   /locus_tag="YPA_0177"
FT   CDS_pept        211876..212700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0177"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12146"
FT                   /db_xref="GOA:Q1CBM6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBM6"
FT                   /protein_id="ABG12146.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQM
FT                   LVVEPPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRM
FT                   ILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKTYILRAAEHTVLCGVVSMGNPHCVMQ
FT                   VDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGVVQDLLNENVHVELPGGSLHIRWQGPGHPLYMTGPATHVYDGFIHL"
FT   gene            212765..213469
FT                   /locus_tag="YPA_0178"
FT   CDS_pept        212765..213469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12147"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPB0"
FT                   /protein_id="ABG12147.1"
FT                   /translation="MKNYEEQALAGIELDDDAVMQYLLQNPDFFIRNARLVEQMHIPHP
FT                   VRGSVSLVEWQLGRQRNQIGQLEEEITLLMEQAGLNEVLFSRLLQLQANLAAADSLQDM
FT                   LNRLQRWARDFGLAGANIRLFSDRWQIGAPSDFTHLALSRHAFEPLRIQRLGNRHHYLG
FT                   SLNGPELLLLLPQAKLVGSVALSLLGADGDLGVVIFSSRDAQHYQQGMGTVMLNQLSTL
FT                   LPGLLARWIEPV"
FT   gene            213466..214377
FT                   /locus_tag="YPA_0179"
FT   CDS_pept        213466..214377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0179"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12148"
FT                   /db_xref="GOA:A0A0E1NMV4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMV4"
FT                   /protein_id="ABG12148.1"
FT                   /translation="MTEFSASLAPQVEAFLRYLSIERQLSPLTVTSYRRQLSALMEIGE
FT                   QMGLAHWQTLDAAQVRSLVSRSKRAGLHASSLALRLSALRSFLNWLVSQGVLPANPAKG
FT                   VSTPRSGRHLPKNIDVDEVNKLLSIDLNDPLAVRDRAMLEVMYGAGLRLSELVGMNCKH
FT                   VDLASGDVWVMGKGSKERKVPLGKTAVTWLQHWLALRELFEPQDDAIFLANTGKRISAR
FT                   NVQKRFAEWGVKQGVSSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTTQIYTH
FT                   LDFQHLATVYDAAHPRAKRGKS"
FT   gene            214377..215093
FT                   /locus_tag="YPA_0180"
FT   CDS_pept        214377..215093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0180"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12149"
FT                   /db_xref="GOA:A0A0E1NYF2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYF2"
FT                   /protein_id="ABG12149.1"
FT                   /translation="MHFYRPLERISAITFDLDDTLYDNRPVIARTEQQSVAFLQQYHPN
FT                   LALLQPADFQRLRAELLAQDPGIYHDVTQWRWQAIELGLMRHGLSKAEAQAGADAAMAN
FT                   FALWRSRIDVPQATHDTLSALAEHYPLVAITNGNADPKACGLDRYFQFVLRSGPHGRAK
FT                   PFRDMYHKAANHLDIPLKHILHVGDDLTTDVAGSLRCGMQACWINDRQQNLMTARDSRL
FT                   LPHIEISQLASLTALL"
FT   gene            215195..217357
FT                   /locus_tag="YPA_0181"
FT   CDS_pept        215195..217357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0181"
FT                   /product="ATP-dependent DNA helicase UvrD"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12150"
FT                   /db_xref="GOA:A0A0E1NMP3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMP3"
FT                   /protein_id="ABG12150.1"
FT                   /translation="MDVSDLLDSLNEKQRDAVAAPRGNLLVLAGAGSGKTRVLVHRIAW
FT                   LLSVENASPYSIISVTFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   ANLPQDFQILDSDDQLRLLKRLVKALNLDEKQWPPRQAMWYINGKKDEGLRPQHIESYG
FT                   NPVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNILVDEF
FT                   QDTNNIQYAWIRLLAGERSNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRLEQ
FT                   NYRSTSIILAAANALIANNDGRMGKNLWTDGAEGEPISLYCAFNELDEARFVVNRIKAW
FT                   QDNGGALNDCAILYRSNAQSRVLEEALLQTATPYRIYGGQRFFDRQEIKDSLAYLRLIS
FT                   NRNDDAAFERVVNTPTRGIGDRTLDVVRQTARDRQLTLWQSTRAMLQEKVLAGRAASAL
FT                   QRFVELIDSLARETADMPLHVQTDRVIRDSGLWSMYEQEKGEKGQARIENLEELVTATR
FT                   QYSYQDEDQDLMPLQAFLSHAALEAGDGQADAYQDAVQLMTLHSAKGLEFPQVFIVGME
FT                   EGMFPSQMSLDEGGRLEEERRLAYVGLTRAMQKLTLCYAESRRLYGKEVNHRPSRFIGE
FT                   LPQECVEEVRLRASVSRPVNHRRMGTPMHENDSGFSLGQRVRHPKFGEGTIVNLEGSGE
FT                   HNRLQVAFPGEGIKWLVAAYARLEPV"
FT   gene            complement(217471..218157)
FT                   /locus_tag="YPA_0182"
FT   CDS_pept        complement(217471..218157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0182"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12151"
FT                   /db_xref="GOA:A0A0E1NYB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYB8"
FT                   /protein_id="ABG12151.1"
FT                   /translation="MNTQNKQEGFSPSLTTIRARTRRLLIDTAMSMYERGAFPSITEVA
FT                   SAAQLSRATAYRYFPTQSALVSAMVDESLGPILAWQPTQPDARQRIAELLSFAYPRMLQ
FT                   HEGVLRAALHLSLQQWADARNSDSNNNSNDSNNSSNEEKLIRGNRKRLLKLAVEPLEET
FT                   LAPEALQRVIHAFSLIYGSEVFMVLKDIWHLDEAGIQDVTQWMGKAILLQAETDSQLAA
FT                   QDKTHS"
FT   gene            218585..219802
FT                   /locus_tag="YPA_0183"
FT   CDS_pept        218585..219802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12152"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNW8"
FT                   /protein_id="ABG12152.1"
FT                   /translation="MPRHIYIATTTDTKGQELAYVSELIQATGLTTVTVDLSTKESQRD
FT                   SGADICAETVAGYHPDGRQAVFCGDRGQAINAMAIAFERFMVSRVDVAALLGMGGSGGT
FT                   ALITPAMQRLPIGIPKLMVSTMASGDVSGYIGASDIAMMYSVTDIAGLNRISRRVLSNA
FT                   AHQVAGAVYFAQEASPVDDKPALGLTMFGVTTPCIQAVSAELSDEYDCLVFHATGSGGK
FT                   AMEKLAESGLLAGVLDLTTTEVCDLLFDGVLACGPERFDAIAHTHIPYVGSCGALDMVN
FT                   FGSPATIPAKYADRLFYKHNAQVTLMRTTEQENIEMARWIGEKLNRCQGEVRFLIPEGG
FT                   FSALDAPGQPFWDEKALTAFIRTLEETVIQTDKRRVVHYPFNINDPLFAQAAIENFKEI
FT                   VNRPSH"
FT   gene            219816..220658
FT                   /locus_tag="YPA_0184"
FT   CDS_pept        219816..220658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12153"
FT                   /db_xref="GOA:A0A0H2Y4P6"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4P6"
FT                   /protein_id="ABG12153.1"
FT                   /translation="MEKHMPKFQRQAILAKFREMIARREPIIGGGAGTGLSAKCEEAGG
FT                   IDLIVIYNSGRYRMAGRGSLAGLLAYGNANDIVVDMAKEVLPVVKNTPVLAGVNGTDPF
FT                   CQFDHFLDHLKALGFSGVQNFPTVGLIDGNFRANLEETGMGYGLEVEMIRLAHQKDLLT
FT                   TPYVFSAEDAIAMTQAGADIIVPHMGLTTGGNIGADTALKLADCVPLINDWAAAAKSVR
FT                   EEVIVLCHGGPISTPEDAQYIMDHCPQCDGFYGASSMERLPTEIALTDTTQKFKNITR"
FT   gene            221307..222257
FT                   /locus_tag="YPA_0185"
FT   CDS_pept        221307..222257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0185"
FT                   /product="magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12154"
FT                   /db_xref="GOA:A0A0E1NM65"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM65"
FT                   /protein_id="ABG12154.1"
FT                   /translation="MLSAFKLHNNRLSRLELDESDDLASSLWVDLVEPEEGERERVQTE
FT                   LGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDADDHAGNSTVAFTIRDGRLYTL
FT                   RERELPAFRLYRMRARNQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSRVIM
FT                   EGQQGDEYDAALSTLAEQEDIGWKVRLCLMDTQRALNFLVRKARLPSSQLEQAREVLRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELRWSFGYPGAIALMIIAGLAPYLYFKRKNWL"
FT   gene            complement(222355..223245)
FT                   /locus_tag="YPA_0186"
FT   CDS_pept        complement(222355..223245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0186"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12155"
FT                   /db_xref="GOA:A0A0E1NMZ3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMZ3"
FT                   /protein_id="ABG12155.1"
FT                   /translation="MDKQQTRQGIFFALAAYFIWGLAPAYFKLIQQVPADEILTHRVIW
FT                   SFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAVLIASNWLLFIWAVNHNHMLEASL
FT                   GYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGVLIQLWQFGSLPVIGLGLAITFAL
FT                   YGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIADSPTSHLSANAWSLNLLLAAAGVI
FT                   TTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFIFIWAALL
FT                   LFTLDALYTQRKLRR"
FT   gene            complement(223332..223802)
FT                   /locus_tag="YPA_0187"
FT   CDS_pept        complement(223332..223802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12156"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZZ0"
FT                   /protein_id="ABG12156.1"
FT                   /translation="MSVTPLTLEDARRMIGETFVYHMPFNRELGLKLVRFEQDYAEITF
FT                   DNDDKLVGNIAQKILHGGVIAAVLDVAAGLVCVGNSLIRHEPLIQEQLQIKLAKMGTID
FT                   LRVDYLRPGRGEHFIARSSILRSGNKVAVARVELHNEKQIHIASATATYLVG"
FT   gene            224024..224902
FT                   /locus_tag="YPA_0188"
FT   CDS_pept        224024..224902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0188"
FT                   /product="phospholipase A"
FT                   /EC_number="3.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12157"
FT                   /db_xref="GOA:A0A0E1NQH0"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQH0"
FT                   /protein_id="ABG12157.1"
FT                   /translation="MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQD
FT                   HDNPFLLYPYETNYLLYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIAGD
FT                   NSLLGASYTQRSWWQASNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGFNHQ
FT                   SNGKADPTSRSWNRVYTRVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYYRLKV
FT                   GYALGDSVFSLDGRYNWNTGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTR
FT                   VGVGIMLNDVL"
FT   sig_peptide     224024..224086
FT                   /locus_tag="YPA_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            224980..226812
FT                   /locus_tag="YPA_0189"
FT   CDS_pept        224980..226812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0189"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12158"
FT                   /db_xref="GOA:A0A0E1NX43"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX43"
FT                   /protein_id="ABG12158.1"
FT                   /translation="MSTAAVINRELLAVQVLRDTFGYQQFRPGQQEIINATLSGQDCLV
FT                   VMPTGGGKSLCYQIPALVTDGLTLVVSPLISLMKDQVDQLLAYGVGAGCLNSSQTREQQ
FT                   LAVMDGCRSGQIKLLYIAPERLVMESFLDQLYQWRPALLAVDEAHCISQWGHDFRPEYR
FT                   ALGQLKQRFPDLPVIALTATADEATRGDIVRLLNLDQPLIQISSFDRPNIRYTLVEKFK
FT                   PLDQLWRFVQDQRGKSGIIYCNSRAKVEDTTARLQSRGLSVAAYHAGLDNERRAQVQEA
FT                   FQRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRTIESYYQETGRAGRDGLPAEAVLLY
FT                   DPADMAWLRRCLEEKPAGAQQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGKQQPCGN
FT                   CDICLDPPKRYDGLADAQKALSCVYRVGQRFGLGYIVEVLRGANNQRIREMGHDKLSVY
FT                   GIGREQTHEHWVSVLRQLIHLGLLSQNIAQFSALQLTEAARPVLRAELPLQLAVPRIQS
FT                   LKVRSSANQKSYGGNYDRKLFAKLRKLRKSIADEGNIPPYVVFNDATLLEMAEQMPITA
FT                   SELLSVNGVGQRKLERFGAPFMALIRDHVDNNDD"
FT   gene            226919..227539
FT                   /locus_tag="YPA_0190"
FT   CDS_pept        226919..227539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0190"
FT                   /product="threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12159"
FT                   /db_xref="GOA:A0A0E1NVF1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVF1"
FT                   /protein_id="ABG12159.1"
FT                   /translation="MLMLFLTVAFIHLVALISPGPDFFFVSQTAASRSRGEAMMGVLGI
FT                   SLGIVIWAGVALMGLNLILQKMAWLHQIIMVGGGMYLCWMGWQLLKSARAKHDVAEEEV
FT                   QVVLPARGRTFIRGLLTNLSNPKAVIYFGSVFSWFVGDDVGAGARWGLFILIVGETFLW
FT                   FTVVACVFALPTMRRGYQRLSKWIDGLAGVLFAGFGIQLILSR"
FT   gene            complement(227590..228210)
FT                   /locus_tag="YPA_0191"
FT   CDS_pept        complement(227590..228210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0191"
FT                   /product="putative homoserine/homoserine lactone efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12160"
FT                   /db_xref="GOA:A0A0E1P024"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P024"
FT                   /protein_id="ABG12160.1"
FT                   /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIGG
FT                   LQLGLAVHIVLVGVGLGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHALAN
FT                   SMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDIIVMI
FT                   GYATLATRIARWIKSPQQMKLLNRIFGGLFMLIGALLATARKV"
FT   sig_peptide     complement(228136..228210)
FT                   /locus_tag="YPA_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.541 at
FT                   residue 25"
FT   gene            228424..229419
FT                   /locus_tag="YPA_0192"
FT   CDS_pept        228424..229419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0192"
FT                   /product="putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12161"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRL2"
FT                   /protein_id="ABG12161.1"
FT                   /translation="MNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPIRYVRFR
FT                   APHHTQVVVVVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDHNRGHVI
FT                   KFDDYIEDFAQLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVALCAPMFG
FT                   IHLPLPGWLARRIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRRYLRQYS
FT                   DTPEIRVGGPTYHWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHDAFSQAM
FT                   TLAGHPCEGGRPQVIQGARHEILFERDTLRAEALSAILRFFAQHQSSVGH"
FT   gene            229286..230263
FT                   /locus_tag="YPA_0193"
FT   CDS_pept        229286..230263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0193"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12162"
FT                   /db_xref="GOA:A0A0H2Y3E5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3E5"
FT                   /protein_id="ABG12162.1"
FT                   /translation="MKGGVLRSFKAHAMRSCLSGTRCVPRRLAPYCAFSRNINHQSAIR
FT                   RRRHQRLEHTIMYHVVASDLDGTLLSPNHTLTPYTKETLKLLTQRDVHFVFATGRHHID
FT                   VAQIRDNLEISAFMITSNGARVHNTEGELIFSHNLDADIARDLYNLEHHNPDILTNVYL
FT                   GDEWFMNRECPEQEEFFRESVFNYQVFEPALLPTDGVCKVYFTCEDHDKLLILEEAINA
FT                   RWGDRVNVSFSFPTCLEVMGGGVSKGHALEQVAKIIGYSLKDCIAFGDGMNDVEMLSMS
FT                   GKGCIMRDAHQRLKDVLPNLEVIGSNADDAVPHYLRKMFLGKEE"
FT   gene            230540..231739
FT                   /locus_tag="YPA_0194"
FT   CDS_pept        230540..231739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12163"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNT1"
FT                   /protein_id="ABG12163.1"
FT                   /translation="MSDINVTSPHFIPMKSPITARLDNSDLIDERPQKINFLGNKLNSI
FT                   ADVNIDSKNKKITINIAEKKFSSDYIPEEYIYIAVWDAKGKMVFQKKLSDAEIKEEKIE
FT                   LPFEVGYQLEMYHPIPSRLVSSPDLYSIIDSNSPFTLLVMTPLGVTNPKMESYPTDIIE
FT                   ADFIHPNSVSVGVNADVIEPASTAEPTTSTPIAPDIPSASTDPIVSTSTRTGIDSTTKL
FT                   MVSFQFKLLGVCDYDIATVTIDEESKLAGIKIVTDTPHCHFGDELYASIKVTDKQGHIT
FT                   FEEKLYGTNANISNTIIPFEKGYKLDIFHAEPSRLRVSSGDSDTLIPESKQNSFIMTSI
FT                   GIENTRQGSAEAIISDQFDTEKLVQDMSSFGDSSIAPVDNVYGYMGEKNHYQNVVSHVE
FT                   "
FT   gene            complement(231813..232928)
FT                   /locus_tag="YPA_0195"
FT   CDS_pept        complement(231813..232928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0195"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12164"
FT                   /db_xref="GOA:A0A0E1NVC4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVC4"
FT                   /protein_id="ABG12164.1"
FT                   /translation="MQTHVKTLLASLILAASMAAPAYAAKPASADKSASAIDKVVIAHR
FT                   GASGYLPEHSLPAKAMAYAQGADYLEQDLVMTKDNELVVLHDHYLDRVTDVAERFPDRA
FT                   RKDGRYYAIDFTLPEIKSLKFTEGFDIDKNGKKVQSYPNRFPMGKSDFRVHTFQEEIEF
FT                   IQGLNHSTGKNTGIYPEIKAPWFHHQEGKDISTKVLEVLKEYGYTNKDDKVYLQSFDVN
FT                   ELKRIKNELEPKMGMDLKLIQLIAYTDWNETYEQLPDGKWVNYNYDWMFKPGAMKEVAH
FT                   YADGIGPDYHMLVVKTSTAKDIKLTDLVKEAHASNMMVHPFTIRADRLPKYATDINQLF
FT                   DIIYNQAQVDGVFTDFPDQGIQFLQKQQQHK"
FT   sig_peptide     complement(232854..232928)
FT                   /locus_tag="YPA_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            233553..235208
FT                   /locus_tag="YPA_0196"
FT   CDS_pept        233553..235208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0196"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12165"
FT                   /db_xref="GOA:A0A0E1NST2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NST2"
FT                   /protein_id="ABG12165.1"
FT                   /translation="MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIAT
FT                   GATGRNHGLLHSGARYAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSLAY
FT                   QLQFIARCRDAGIEAEAIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANMLDAR
FT                   EHGANILTYHEVIGLLRQGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIAEYAD
FT                   LRIRMFPAKGALLILGHRINNMVINRCRKPADADILVPGDTISLIGTTSTHINYDQIDN
FT                   MVVTAQEVDTLIREGAKLSPQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHA
FT                   SRDGVEGFITITGGKLMTYRLMAEWATDKVCEKLGISAACTTAQVPLPGSRQSAEQTLS
FT                   KVISLPASIRGSAVYRHGDRATQLLVGNRLDNSLVCECEAVTAGEVRYAVESLSVNNLL
FT                   DLRRRTRVGMGTCQGELCACRAAGLLSRFKVTTPQQSREQLTQFLNERWKGVRPIAWGD
FT                   ALRESEFTQWVYQGLCGLDEIPATVNAREKHDEI"
FT   gene            235198..236472
FT                   /locus_tag="YPA_0197"
FT   CDS_pept        235198..236472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0197"
FT                   /product="putative anaerobic glycerol-3-phosphate
FT                   dehydrogenase subunit B"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12166"
FT                   /db_xref="GOA:Q1CBK6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBK6"
FT                   /protein_id="ABG12166.1"
FT                   /translation="MKFDVIIIGGGLAGLACGIRLAEQGKYCAIVSSGQNALHFSSGSL
FT                   DLLAKLPDGQAVSQPLSALSALAELAPEHPYSKMRNITQLDELVQEAEALLRRCGLDIV
FT                   GSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGPLPWQRVAVIGIEGFLDFQPQMVASA
FT                   LQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSRLSSTAEM
FT                   ILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGLVMPG
FT                   DAVLRAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKIYEPILDLDI
FT                   LSLPHRADWSHSNLFAPQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGGYDPLQQG
FT                   CGAGVSLTSAVFVAEQIISEMAVTL"
FT   sig_peptide     235198..235266
FT                   /locus_tag="YPA_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.895 at
FT                   residue 23"
FT   gene            236469..237764
FT                   /locus_tag="YPA_0198"
FT   CDS_pept        236469..237764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0198"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12167"
FT                   /db_xref="GOA:A0A0H2Y4K2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4K2"
FT                   /protein_id="ABG12167.1"
FT                   /translation="MTGLPKHDASPEQDGMMVGDSRLTRDNSFESCIKCTVCTTYCPVA
FT                   KVNPLYPGPKQAGPDGERLRLKDPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRAKA
FT                   SHSTNKPKLRDAILSHTDIMGTLSTPFAPVINAVTGLKPVRVLLDKALKIDHRRELPKY
FT                   SFGTFRRWYRKQAEKQQQYTEQVAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQLLKRE
FT                   KCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGRDIPVVATSSSCTFTLRDEYPHLLDV
FT                   DTTPVRDKVELATRYLYRLLDQGRELPLKPLFSLNPLLASQEAPLRIAYHTPCHMEKMG
FT                   WTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFKSENYATSQGIGASLFQQIEDSGVDL
FT                   VITDCETCKWQIEMSTSKKCEHPITLLARALA"
FT   gene            complement(237926..238453)
FT                   /locus_tag="YPA_0199"
FT   CDS_pept        complement(237926..238453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0199"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12168"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3E9"
FT                   /protein_id="ABG12168.1"
FT                   /translation="MYKKIVRFLAVGLLVAGLSACDNSSDNNVGQTVSLLDGKVTFNLP
FT                   ADLSDQSGKMGNQANNMHVYANNTGDKAVIVILGEGTNEKLEVLTNRLAEQQRARDANL
FT                   QVVTNKTININGQPFQQLDSIITSSGQKAYSSIVMGTVGNQLMTLQITLPAENQQQAQT
FT                   EAESIISTLKLK"
FT   sig_peptide     complement(238379..238453)
FT                   /locus_tag="YPA_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.483 at
FT                   residue 25"
FT   gene            complement(238583..239251)
FT                   /locus_tag="YPA_0200"
FT   CDS_pept        complement(238583..239251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0200"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12169"
FT                   /db_xref="GOA:A0A0E1NNP1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNP1"
FT                   /protein_id="ABG12169.1"
FT                   /translation="MFSFTVQQRMTALVWLSLFHIVIITSSNYLVQLPIAIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALLISYLISALFYQGSWQGFPALTSF
FT                   NLVVARIAVASFMAYVLGQILDVQVFNRLRQRNAWWVAPTAAMFFGNISDTMAFFFIAF
FT                   YRSSDPFMAAHWVEIALVDYSFKLLICMLFFLPAYGVMLNVLLKYFARQTGQPVLATER
FT                   "
FT   gene            239394..239789
FT                   /locus_tag="YPA_0201"
FT   CDS_pept        239394..239789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12170"
FT                   /db_xref="GOA:A0A0H2Y2H8"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2H8"
FT                   /protein_id="ABG12170.1"
FT                   /translation="MVKLFAFVKPSDFVKLAAFVSLLTFYLSIKPLTDELLNRLLTNKR
FT                   TAMTDIFANPDKTLDALGLRCPEPVMMVRKTVRHMEEGQTLLIIADDPATTRDIPGFCR
FT                   FMDHQLLAQDTEQTPYRYLVRKGITAG"
FT   gene            complement(239908..242256)
FT                   /locus_tag="YPA_0202"
FT   CDS_pept        complement(239908..242256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0202"
FT                   /product="putative P-type cation-translocating membrane
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12171"
FT                   /db_xref="GOA:A0A0E1NNQ7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNQ7"
FT                   /protein_id="ABG12171.1"
FT                   /translation="MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHD
FT                   SVSEHSHHDGESCSHTHADEADEESDRLDTTIVSGTQRFSWQVKGMDCPSCARKIENAI
FT                   SGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATESRL
FT                   REYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIE
FT                   TLMSVAAIGAVFIGATAEAAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLK
FT                   DGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASFDESALTGESIPVERQQGEKV
FT                   AAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILF
FT                   SILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKG
FT                   GAALEQLGRSQIIAFDKTGTLTEGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAI
FT                   AIIQCTQQNQRAQQNTPMLPLAEERRALAGVGIEGVVDGLMVRVSAPSKLSPALLTDEW
FT                   QAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIDALKKLGIQGVMLTGDNP
FT                   RAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASSIGVAMG
FT                   SGTDVALETADTALTHNRLTGLAEIILLSRAANANIRQNITIALGLKAIFLVTTLLGLT
FT                   GLWLAVLADSGATALVTANALRLLRKRDV"
FT   gene            complement(242670..243284)
FT                   /locus_tag="YPA_0203"
FT   CDS_pept        complement(242670..243284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0203"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12172"
FT                   /db_xref="GOA:A0A0E1NQF5"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQF5"
FT                   /protein_id="ABG12172.1"
FT                   /translation="MLYFFLVGCLFVDATYRGPRWQRWVFKPVTLLLLLLLAWQAPALG
FT                   PAGYLIVLGLLATLLADALLLLPSERLLYALGAFFLSHLLYTISFASQMTLTLFWPLPL
FT                   VLIVVGALLLAALWTQLQDMRWPVVAFIGMTLLMVWMAGEQYFARSTDLGFSLLAGSVL
FT                   LLLSHAVWLLNRYRFSFRASDAIAAGCYFIGHFLIVRSLYL"
FT   gene            243590..243910
FT                   /locus_tag="YPA_0204"
FT   CDS_pept        243590..243910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12173"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTM9"
FT                   /protein_id="ABG12173.1"
FT                   /translation="MANEQLLYRIQFINNGKNYQLYVREIGSSSLFGFIEIADFVFDSQ
FT                   STLLVDPSTEKLKTEFSGVNRSYIPLHAVIRIDSVTEKGSARISELGNNVMNFPYLPGN
FT                   KP"
FT   gene            244122..244541
FT                   /locus_tag="YPA_0205"
FT   CDS_pept        244122..244541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0205"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12174"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNM1"
FT                   /protein_id="ABG12174.1"
FT                   /translation="MSKLPLLFIAVVVLIVVLATRQYWQKKQQDAENDRAPVRSVQVEV
FT                   VDKREVLAPNRRSRQREEIVAEEKRYEVYFRPLSSGIEIKNSLGLSGGNEIKSGSEIKM
FT                   VLPQQEYNRIEQGAQGILRLQGTRYIGFIPDAPHP"
FT   sig_peptide     244122..244181
FT                   /locus_tag="YPA_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.364 at
FT                   residue 20"
FT   gene            complement(244728..245000)
FT                   /locus_tag="YPA_0206"
FT   CDS_pept        complement(244728..245000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0206"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12175"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS19"
FT                   /protein_id="ABG12175.1"
FT                   /translation="MWINLGRLLMLGVWFFILLNLFQPYPKPLRYFIHVAMIFMVLMHG
FT                   LQLVLLKSTQPKDQPISGLQQFKIFVFGVFELLAWQKKQPQLPKK"
FT   gene            complement(244990..245652)
FT                   /locus_tag="YPA_0207"
FT   CDS_pept        complement(244990..245652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12176"
FT                   /db_xref="GOA:A0A0E1NWD8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWD8"
FT                   /protein_id="ABG12176.1"
FT                   /translation="MAKQPIAKRSIVKKASPQSAGQIRIIGGKWRGRKLPVPDSPGLRP
FT                   TTDRVRETLFNWLAPMIQGARCLDCFAGSGALGLEALSRYASETTLLEADRQVAKQLSD
FT                   NLTLLKAENGQVVNTNSLQWLAQPGQPFNLVFLDPPFRKGLLAETINLLEQFNWLAADA
FT                   WIYVEAEAESAVADVPANWLLHREKIAGQVAYRLFIRQQTDLPACASVAEQEQHHVD"
FT   gene            245934..247550
FT                   /locus_tag="YPA_0208"
FT   CDS_pept        245934..247550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0208"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12177"
FT                   /db_xref="GOA:A0A0E1NUC4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUC4"
FT                   /protein_id="ABG12177.1"
FT                   /translation="MAKEKKRGFFSWLGLGRQSEEPAAEPLATEKEGVTEQEDVIEQTG
FT                   VIEPTDVIEQTVEHVISEKTTEAPAENAFIEVELREQVAAVIPTEPNNAIMSEGVPDTL
FT                   PERAVAESVVAELVETGDNAAIVHDEIIEPITQVTEAGGELSLVKPGIEGDTTEQGGPT
FT                   DNLPKRSLTEDNLIIDVPTPQAVVEESRVDAVEQPTETSEVEEVEEVEEVEEVEEKIIP
FT                   VAAQEQERPTKEGFFARLKRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADV
FT                   GVETTRKIITSLTEHTSRKQLKDADALYGKLKEEMSEILSKVDKPLDVSGKSPYVILMV
FT                   GVNGVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGA
FT                   DSASVIFDAIQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVML
FT                   TLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEG
FT                   IEDLRPFKADEFIEALFARED"
FT   gene            247556..248224
FT                   /locus_tag="YPA_0209"
FT   CDS_pept        247556..248224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0209"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12178"
FT                   /db_xref="GOA:A0A0E1NP42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NP42"
FT                   /protein_id="ABG12178.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAMPL
FT                   IIAGASSEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADE
FT                   PTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARRRYPILTLSQGRMSGAHHGE
FT                   "
FT   gene            248214..249167
FT                   /locus_tag="YPA_0210"
FT   CDS_pept        248214..249167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0210"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12179"
FT                   /db_xref="GOA:A0A0E1NND7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NND7"
FT                   /protein_id="ABG12179.1"
FT                   /translation="MANNARKAKTKALKGGWREQWRYSWVNAIADMMRQPMATLLTVMV
FT                   ISISLTLPSVCYIVWKNVSQAAEQWYPTPQLTVYLDKALDDNAAENVVVTLKAEAGVEK
FT                   VNYLSREEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKLNFQSAETLNTLRDRISQV
FT                   EGVAEVRMDDSWFARLAALTGLVGQVAAMVGVLMVVAVFLVIGNSVRLSIFSRRDTINV
FT                   MKLLGATDGFILRPFLNGGAMLGFGGAVLSLILSEALVWQLGSVVKQVATVFGTQFTLH
FT                   GLSWDESLLLVLISAMIGWIAAWLATVQHLRRFTPQ"
FT   gene            249478..250335
FT                   /locus_tag="YPA_0211"
FT   CDS_pept        249478..250335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0211"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12180"
FT                   /db_xref="GOA:A0A0E1NR78"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR78"
FT                   /protein_id="ABG12180.1"
FT                   /translation="MTKEMQTLALVPQGSLEAYIRAANAYPMLTAEEERELAERLHYQG
FT                   DLGAAKQLILSHLRFVAHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVAKELGV
FT                   TSKDVREMESRMSAQDMTFDPSPDDEARDGQFMAPVLYLQDKTSDFADGIEEDNWDSHA
FT                   ADKLSYALEGLDERSQHIIRARWLDDENKSTLQELADQYGVSAERVRQLEKNAMKKLRM
FT                   AIEA"
FT   gene            250549..251007
FT                   /locus_tag="YPA_0212"
FT   CDS_pept        250549..251007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0212"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12181"
FT                   /db_xref="GOA:Q1C048"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C048"
FT                   /protein_id="ABG12181.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(251253..251690)
FT                   /locus_tag="YPA_0213"
FT   CDS_pept        complement(251253..251690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0213"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12182"
FT                   /db_xref="GOA:A0A0H2Y4P1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032900"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4P1"
FT                   /protein_id="ABG12182.1"
FT                   /translation="MNLGAISTLLLWLLAMKLTIERLITLTHQDVIDLAKIWPNQQPAA
FT                   WQQWITEGRPLFAARFNERLLGAVKVAVYDQQAELQDLCVREVTRRRGVGLYLIEETLR
FT                   QLPEIKHWYLNGGDLTAAERPQMNSFMLACGFSHEAQGWRR"
FT   gene            252067..253182
FT                   /locus_tag="YPA_0214"
FT   CDS_pept        252067..253182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0214"
FT                   /product="branched-chain amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12183"
FT                   /db_xref="GOA:A0A0E1NP08"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NP08"
FT                   /protein_id="ABG12183.1"
FT                   /translation="MKLTKGKVLLAGCMAMAMSHSVLAQDIKVAIVGAMSGPVAQYGDM
FT                   QFTGARQAIADINASGGIKGDKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLCSS
FT                   STQPASDIYEDEGVIMITPAATNADLTTRGYKMIMRTTGLDSDQGPTAAKYIVETIKPK
FT                   RIAVVHDKQQYGEGLARSVRDSLKEQGAEVVLFEGVTAGDKDFSTLVARLKKENVDFVY
FT                   FGGYYPEMGQILRQAKQAGLTARFMGPEGVGNSSLSNIAGEASEGMLVTLPKRYDQVPA
FT                   NQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMERTGSKEPADLANDLKTGKPVETVM
FT                   GPLSWDDKGDLKGFEFGIFEWHADGSSTAVK"
FT   sig_peptide     252067..252141
FT                   /locus_tag="YPA_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(253383..254162)
FT                   /locus_tag="YPA_0215"
FT   CDS_pept        complement(253383..254162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0215"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12184"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12184.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(254162..255184)
FT                   /locus_tag="YPA_0216"
FT   CDS_pept        complement(254162..255184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0216"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12185"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12185.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            255322..256248
FT                   /locus_tag="YPA_0217"
FT   CDS_pept        255322..256248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0217"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12186"
FT                   /db_xref="GOA:A0A0E1NUG1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUG1"
FT                   /protein_id="ABG12186.1"
FT                   /translation="MSEQFLYFLQQMFNGITLGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMISSYVSFIVIAALMMVGIDASWLLIGCAFLVSIVIASTYGWSIERVAYKPVRRSKR
FT                   LIALISAIGMSIFLQNYVSLTQGSRDLALPSLVTGQWTLGESNGFAATISTMQLTIWIV
FT                   TFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGINTDRVISLTFVIGALMAAVAGVL
FT                   LGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGVAEALTSAYLSTEYKD
FT                   AVSFALLIVVLLVMPTGILGRPEVEKV"
FT   gene            256245..257531
FT                   /locus_tag="YPA_0218"
FT   CDS_pept        256245..257531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0218"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12187"
FT                   /db_xref="GOA:A0A0E1NLL5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLL5"
FT                   /protein_id="ABG12187.1"
FT                   /translation="MKQLNFVNAIISSFVLLVLASFVMGLQLQLDGTRLVVQGASEVRW
FT                   LWIGAGCLVVFCFQLVRPLIQQGIKKVSGPAWVLPSFDGTTPRQKLLAAVVIIAAVAWP
FT                   FLVSRGSVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYYGLG
FT                   FWESLPLAGITAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGI
FT                   SQIPKPTLFGLEFSRTAKDGGWDTFHNFFGLTYDPSHRIIFLYLVALLLVILTLFVINR
FT                   LLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQGFVSPE
FT                   SFTFVESAFVLAIVVLGGMGSQFAVILAAVLLVVSRELMRDLNAYSMLLLGALMVLMMI
FT                   WRPQGLLPMKRPQLKLKVADVKAKQGEQA"
FT   sig_peptide     256245..256322
FT                   /locus_tag="YPA_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.799 at
FT                   residue 26"
FT   gene            257528..258295
FT                   /locus_tag="YPA_0219"
FT   CDS_pept        257528..258295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0219"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12188"
FT                   /db_xref="GOA:A0A0E1NNW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNW4"
FT                   /protein_id="ABG12188.1"
FT                   /translation="MNGQPLLTVEGLSMRFGGLLAVNNVGLTLNQGEIVSLIGPNGAGK
FT                   TTIFNCLTGFYRPTGGTIKLRERHLEGLPGQMIARMGVIRTFQHVRLFREMTVIENLLV
FT                   AQHQHLKSGIFAGLLKTPGFRRAEADALARAATWLERVGLLALANRQAGNLAYGQQRRL
FT                   EIARCMVTRPELLMLDEPAAGLNPKETDELNQLIMELRDQHQVSVLLIEHDMKLVMGIS
FT                   DRIYVVNQGTPLAQGLPAEIRNNPDVIRAYLGE"
FT   gene            258310..259041
FT                   /locus_tag="YPA_0220"
FT   CDS_pept        258310..259041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0220"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12189"
FT                   /db_xref="GOA:A0A0H2Y4U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4U9"
FT                   /protein_id="ABG12189.1"
FT                   /translation="MESGRGINNNMLSFNQVSAHYGKIQALHQVSLHIQQGEIVTLIGA
FT                   NGAGKTTLLGTLCGEPRATEGNIVFGEQDITHWQTARIMREAIAIVPEGRRVFSRMTVE
FT                   ENLAMGGFFADRQQYQQRIERVYDLFPRLFERRIQRAGTMSGGEQQMLAIGRALMSQPK
FT                   LLLLDEPSLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGRIV
FT                   LEDTGAALLANEAVRSAYLGG"
FT   gene            259269..259730
FT                   /locus_tag="YPA_0221"
FT   CDS_pept        259269..259730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2N2"
FT                   /protein_id="ABG12190.1"
FT                   /translation="MMDGISNKMDLQGLSAVRSFAFLTADLMLNITNKNGDNHEYKVTS
FT                   SHVNNDKLQGPKGILKATKNHAELKNETIASGEKKTISFDKLHVREIPDREQASYIDNL
FT                   SLNRNIYLDTSADRECRIPTQVLSPDQNVDSGTKKPFWISKYLCITTLY"
FT   gene            complement(259845..260951)
FT                   /locus_tag="YPA_0222"
FT   CDS_pept        complement(259845..260951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQQ2"
FT                   /protein_id="ABG12191.1"
FT                   /translation="MNIKNKPLLIGLLLLFLHPTTAAATKWVGNYFYPLANKYSNCNVT
FT                   LLEDNSVAVSFDVTLVADLFETDRGPHLQRWKKIIGTQQDVLLVQNNALLFLYFYHADG
FT                   SADFSIRPGDIQNMSLNGIPVQEIDYNLQEARFVSTHAFSNQSYHVSFNITANALKHIR
FT                   MGATIGGVLHSEGVSYSVRSPQGVAFNQSGNQCEFFDPTTEIAPSHALYIEPKFRLGSA
FT                   IWQLKSLDLDHLLDSTADNHGLHAPLVNGPANRFCIHYPAIGTQNRRYMISASNLNGLA
FT                   ESSRYFQLKDNQGEHIINYKVTLKNHEDSEADFSLPKEKKFIQLKSDTSSGGEAQMCWS
FT                   PRIRVYSTDTTDKGHYTDTLNFTITPLA"
FT   sig_peptide     complement(260883..260951)
FT                   /locus_tag="YPA_0222"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.472 at
FT                   residue 23"
FT   gene            complement(261183..261701)
FT                   /locus_tag="YPA_0223"
FT   CDS_pept        complement(261183..261701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX55"
FT                   /protein_id="ABG12192.1"
FT                   /translation="MNTIKMAITLLLLSWHTCWAATPLGDIDVKLEVTAQPRIEIEKPH
FT                   GGWYDNIKLHNSPENHAVYEVEVPVAVKLRRQEGYQISIKNPLILTRQSDAFSAIEQTF
FT                   SPAEVRWGNNRTNLRLLSAVPESFSVPPQATRHTTTDYVLQISAKAPAGDNTAGKYHGQ
FT                   LTLVFEVNS"
FT   sig_peptide     complement(261639..261701)
FT                   /locus_tag="YPA_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(261763..262410)
FT                   /locus_tag="YPA_0224"
FT   CDS_pept        complement(261763..262410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWQ8"
FT                   /protein_id="ABG12193.1"
FT                   /translation="MKNLVFAAISLLPLSAAGVIDIQPQVVELQQVNTVVTVINHGMTA
FT                   EYITVQLYRLNNPGVASELESLTPVGYQQQPLLFATPLKLTLGPRQSGKIFLHALGAPE
FT                   QEQVYRLAVVPSNHLKISGNNTAVVGVQISYMGLIRHLPASIQHQWTHRCIAGKPELHN
FT                   TGNTRLYWHQLQAQGQMIDDFTLYPGRYRQLAFNELQGKVEDQAVNLQCPSG"
FT   sig_peptide     complement(262354..262410)
FT                   /locus_tag="YPA_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.736 at
FT                   residue 19"
FT   gene            complement(262382..263068)
FT                   /locus_tag="YPA_0225"
FT   CDS_pept        complement(262382..263068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12194"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWD1"
FT                   /protein_id="ABG12194.1"
FT                   /translation="MKYLYSILSIALLLAPGSATHGQLLATPTRIAVEAQELKRTVQVY
FT                   NSGDTPLYLDITLQRVDNPGVNPERKTPISEISQPEMIFNPNRITLGPRQKRDITLIPL
FT                   KSPVQETLYRLYINPVLNIKAVGDGEDKSKVHAPMTISIGYGVLIHHLPPAAAQTRHWQ
FT                   HQCSTTGELTLTATGTVHSKFKQLESGGNAALADSLNLYPGTALTLPVKQLNGEVDGEK
FT                   FSLRCH"
FT   sig_peptide     complement(263000..263068)
FT                   /locus_tag="YPA_0225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.674 at
FT                   residue 23"
FT   gene            complement(263086..265419)
FT                   /locus_tag="YPA_0226"
FT   CDS_pept        complement(263086..265419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12195"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSJ4"
FT                   /protein_id="ABG12195.1"
FT                   /translation="MAYYSKINHSLLFTLALFTLKLAHAEAVKIEYLVPMGFSAAEENN
FT                   SLQLLGVLDSKTLPSPITFSEEEQQLQFNQQNYRHNNISEESIILLGEILSQIPYLQCK
FT                   TGCDYTLSGHRVALDKVNNTLTITNNNNRYLMPTTTWGLVSNQSLDLRMTAAHYRAMSV
FT                   RGQSYIGLPWQSYGFASWFYNAIQSQNTLQSQNTMPSQSTYQPVNRPQYQRLTQKGIGS
FT                   WYLQKNFSALYLRTGRQNNLDNNAGSVHTLINPALDQFVTLGSQSYLAIDKPSTGSIVL
FT                   YAAQDGDYEIYRDNQLIRRIPAQLGRNEIDYSQLPGGYYNVEIRLVDRLGRIVSQENQT
FT                   ISNIGNQTNNGWFLTMGKGPAKGKKTPRLVQFGRSRVIESVQTNITLLKDDAHHWAVEA
FT                   NVSRPLSLNKVNITPTGGLMSGEKRSGGYVRLNGGNNTLGYFSLARYQSPYVSRYAPDS
FT                   GSTSGSYTRRIGPTQLSYQFNQYRNNRQHRIQSGWDWQLPQFNLALSLGLQNGGQWNSH
FT                   NNYGVFLNTTLSFGQSNASINTAYTQQQLNTSASYQKEFIDNYGASTLGVSGSASGKLN
FT                   SVGGFAKRSGSRGDISGRVGIDNQITNGGISYNGMLALSSQGVALGRSSYSGAALLIKA
FT                   PALGGTPYSFHVEDSPITGGGTYAIPVPRYQDRFFVRTHTDRSDMDMNIQLPVNIVRAH
FT                   PGQVFSGEADITLNLLYSGFLKNAQGLPVSGVIEETGDTAYPNGLFSINAQNRLQAITV
FT                   HGPSGRYRCDMHSQPTHIYLCHAD"
FT   sig_peptide     complement(265342..265419)
FT                   /locus_tag="YPA_0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.956 at
FT                   residue 26"
FT   gene            complement(265686..266294)
FT                   /locus_tag="YPA_0227"
FT   CDS_pept        complement(265686..266294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12196"
FT                   /db_xref="GOA:A0A0H2Y3X4"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3X4"
FT                   /protein_id="ABG12196.1"
FT                   /translation="MSRNYLTPSFYITPPTSTLINHNAIPFWMGFYIKDYQVFMMKKTV
FT                   IAIITMATLTSTAAYANTIEKDIRVEAEIISLMDVKRADDSNINKIKLTYDTVTNDGTY
FT                   SHSEAIKVKARKQLGDKLKVSLAAPVILSEPNNNKEFTHVEVLLDGKKLLETADTRDLI
FT                   AFHGSELNAELKVSAKEPNNAVGGEKYSGVIQLRLEPSA"
FT   sig_peptide     complement(266109..266294)
FT                   /locus_tag="YPA_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.909 at
FT                   residue 62"
FT   gene            266732..268051
FT                   /locus_tag="YPA_0228"
FT   CDS_pept        266732..268051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0228"
FT                   /product="glycerol-3-phosphate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12197"
FT                   /db_xref="GOA:Q1CBH5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBH5"
FT                   /protein_id="ABG12197.1"
FT                   /translation="MFNNSIHKVSICIALTLTFSANAMAVTEIPFWHSMEGELGKEVDS
FT                   IADRFNQSQPDYKIVPVYKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIK
FT                   PVYQVFKDANIDFDESVFVPTVAGYYTDSKTGRLLSQPFNSSTPVLYYNKEAFKKAGLD
FT                   PEQPPKTWQELAADTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGFDGTD
FT                   AVLEFNKPLQVKHIQLLSDMNKKGDFTYFGRKDESTSKFYNGDCAITTASSGSLASIRH
FT                   YAKFNFGVGMMPYDADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLVKPEIAA
FT                   EWHQKTGYLPITTAAYELTKQQGFYEQNPGADVATRQMLNKPPLPYTKGLRLGNMPQIR
FT                   TVVDEELEAVWTAKKTPQAALDNSVKRGDVLLRRFEQANK"
FT   sig_peptide     266732..266809
FT                   /locus_tag="YPA_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.926 at
FT                   residue 26"
FT   gene            268349..269236
FT                   /locus_tag="YPA_0229"
FT   CDS_pept        268349..269236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0229"
FT                   /product="sn-glycerol-3-phosphate transport system,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12198"
FT                   /db_xref="GOA:Q1CBH4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBH4"
FT                   /protein_id="ABG12198.1"
FT                   /translation="MSPSRPGFSCSWLPYLLVLPQLAITAIFFLWPAGEALWYSVQTLD
FT                   PFGLSSEFVGLSNFIQLFQDEYYLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGS
FT                   RLYQTLLILPYAVAPAVAAVLWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVL
FT                   ASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVN
FT                   LVYAFFDTFPVIDAATGGGPVQATTTLIYKIYREGFAGLDLSSSAAQSVILMLLVIGLT
FT                   VIQFRFVERKVRYQ"
FT   gene            269233..270078
FT                   /locus_tag="YPA_0230"
FT   CDS_pept        269233..270078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0230"
FT                   /product="sn-glycerol-3-phosphate transport system,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12199"
FT                   /db_xref="GOA:Q1CBH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBH3"
FT                   /protein_id="ABG12199.1"
FT                   /translation="MIENRRGLDIFCHIMLIIGVLLILFPLYVAFVAASLDDSQVFQAP
FT                   MTLIPGPHLWQNISHIWHAGVGNNSTPFGLMLLNSFVMAFAITVGKITVSILSAYAIVY
FT                   FRFPLRNLFFWLIFLTLMLPVEVRIFPTIEVIANLNLLDSYTGLTLPLMASATATFLFR
FT                   QFFMTLPDELLEAARIDGAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILIT
FT                   SDASMGTAVAGIRSMISTSGAPTQWNQVMAAMILTLIPPVVVVLLMQRWFVRGLVDSEK
FT                   "
FT   gene            270085..271158
FT                   /locus_tag="YPA_0231"
FT   CDS_pept        270085..271158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0231"
FT                   /product="sn-glycerol-3-phosphate transport, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12200"
FT                   /db_xref="GOA:Q1CBH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBH2"
FT                   /protein_id="ABG12200.1"
FT                   /translation="MACLKLQAVTKSYDGVTPVIKQIDLDVADGEFIVMVGPSGCGKST
FT                   LLRMVAGLERTTTGDIYIGDQRVTDLEPKDRGIAMVFQNYVLYPHMNVFDNMAYGLKIR
FT                   GFGKEQIRQRVDEAARILELQPLLKRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLS
FT                   NLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVIVMNKGVAEQIGTPSEV
FT                   YKRPASLFVASFIGSPAMNLLDGTVSPDGRTFILSDGLTLPLEIPQPQWGGRRLTLGIR
FT                   PEHIQQTTSAQGVPMNLLTLELLGADNLAHGLWGGQSIIARLSHEEMPVAGSTLHLYLP
FT                   PAALHFFDTDSGLRIEP"
FT   gene            271155..271904
FT                   /locus_tag="YPA_0232"
FT   CDS_pept        271155..271904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0232"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12201"
FT                   /db_xref="GOA:A0A0E1NZ97"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZ97"
FT                   /protein_id="ABG12201.1"
FT                   /translation="MNRDWPYPPIVAHRGGGSLAPENTLAAIDVGARYGHKMIEFDAKL
FT                   SQDGQIFLLHDDTLERTSNGWGVAGELTWEKLIQLDAGDWFSKAFRGERLPLLSEVAAR
FT                   CAQHGMAANIEIKPTTGTDAPTGRAIALAARALWQGQPIPPLLSSFSVDALAAAQLAVP
FT                   ELPRGLLLDKWDDNWAALTTQLDCVSLHINHKQLTAERVALLKAAGLRILVYTVNQPER
FT                   ARELLNWGVDCICTDRIDLLGSDFTGC"
FT   gene            272005..272931
FT                   /locus_tag="YPA_0233"
FT   CDS_pept        272005..272931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0233"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12202"
FT                   /db_xref="GOA:A0A0E1NM42"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM42"
FT                   /protein_id="ABG12202.1"
FT                   /translation="MPAFVVSLWHQIVLSSPLFVLLALGYALVRFGKWPSTITDGLTRF
FT                   VFSLALPAMLFRMMCDFSERPAVDARLLIAFFGSCLVVFIIGRVIAKRVFHLDGVSGSV
FT                   FALGGIFSNNVMLGLPIATIMLGEKSIPAVALVLVFNGLILWTLVTISVEWARNGSPTM
FT                   AGFVKTTRSVLTNPLIIGIISGTLFSLTGLHLPVFIDQPVSMLGQVAPPLSLIVLGMGL
FT                   AEYRVTEGWQISTAICFLKLIVQPMVIWALAWAMDLPALETQVVVLLGSMATGVNVYLM
FT                   SRQFNVLTGPAAASLVIQRYWPPSPRH"
FT   gene            273280..274212
FT                   /locus_tag="YPA_0234"
FT   CDS_pept        273280..274212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0234"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12203"
FT                   /db_xref="GOA:A0A0H2Y4V7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4V7"
FT                   /protein_id="ABG12203.1"
FT                   /translation="MHFTLSLSQFIVLLLVITTILWAFSFSLIGEYLAGQVDSWFSVLM
FT                   RVGLAALVFLPFLRWRNIPWRVILLYMAVGSIQLGIMYLFSFRAYLYLTVPEFLLFTVM
FT                   TPLYVTLIYDLLRRQRLRWGYALSALLAVLGAAIIRYDQLSEHFWWGLALVQAANICFA
FT                   IGQVGYKRLMEVHPIPQHVAFSWFYLGAFVVAVVAWFAFGNPQRLPTTGLQWGILVWLG
FT                   VGASALGYFMWNYGATQVDAGTLGIMNNVHVPAGLLVNLAIWQEKPHWPSFIIGAAVIM
FT                   ASLWVHRRWIAPHPLQTANDRKRADEQNE"
FT   sig_peptide     273280..273351
FT                   /locus_tag="YPA_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.531 at
FT                   residue 24"
FT   gene            complement(274100..275053)
FT                   /locus_tag="YPA_0235"
FT   CDS_pept        complement(274100..275053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0235"
FT                   /product="lysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12204"
FT                   /db_xref="GOA:A0A0E1NSW8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSW8"
FT                   /protein_id="ABG12204.1"
FT                   /translation="MIELKHLRTLQALRNTGSLAAAATQLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTTQGEILLQLAEQVLPQIKQALQTCNEPHQTALRIAIECHSCIQWL
FT                   TPALDNFHKHWPQVTMDFKSGVTFDPQPALQQGELDLVLTSDILPRSGLHYSPMFDFEV
FT                   RLVLAPDHPLANKDRIEPEDLAPEVLMIYPVQRQRLDVWRHFLQPAGVSPSSKNVDNTL
FT                   LLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQPVTEAF
FT                   IRSARQHACDHLPFVKDAVRSNAGVPTAKPLSPQLQ"
FT   gene            275159..277435
FT                   /locus_tag="YPA_0236"
FT   CDS_pept        275159..277435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0236"
FT                   /product="methionine synthase (B12-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12205"
FT                   /db_xref="GOA:Q1CBG7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBG7"
FT                   /protein_id="ABG12205.1"
FT                   /translation="MTILNHTLGFPRVGLKRELKKAQESYWAGNSTQEELLNVGRELRA
FT                   RHWQQQQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGSIDIDTLFRIGRGRA
FT                   PTGKPAAAAEMTKWFNTNYHYMVPEFQQGQQFKLGWTQLLDEVDEALALGHKIKPVLLG
FT                   PITYLWLGKVKGEQFDRLSLLNDILPVYQQVLAELAKRGIEWVQIDEPALVLELPQEWL
FT                   DAYQPAYQALQGQVKLLLTTYFDSIGHNIDTIRALPVQGLHVDVVTGHDDLAVLNKNLP
FT                   KEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRPLWLGSSCSLLHSPIDLNEETRLDA
FT                   EVKSWFAFALQKCAELALLTQALNAPNDAKLAELAAYSAPIRARRSSSRVHNAQVEQRL
FT                   AAITSQDIERQLPYEARAETQRKRFNLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGK
FT                   NYRTGISEHIKHAIAEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGS
FT                   RCVKPPVIIGDISRPEAITVEWAKYAQSLTEKPVKGMLTGPVTILCWSFPREDVSRETI
FT                   AKQIALALRDEVEDLEKAGIGIIQIDEPALREGLPLRRADWQAYLQWAVDAFKLNAAVA
FT                   QNDTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEDFAYPNEIGPGVY
FT                   DIHSPNVPSVEWIEALLRKAAQRIPAERLWVNPDCGLKTRGWPETRQALANMVLAAQRL
FT                   REEQV"
FT   gene            complement(277490..278362)
FT                   /locus_tag="YPA_0237"
FT   CDS_pept        complement(277490..278362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0237"
FT                   /product="putative carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12206"
FT                   /db_xref="GOA:A0A0E1NR63"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR63"
FT                   /protein_id="ABG12206.1"
FT                   /translation="MKTDQLVRLRQAAGGFTPAGTPLMATAHHTDQLHSLQTHGIHCGE
FT                   TTIPSQGDELPAYIAKPDQHTGPYPVVIVVQEIFGVHEHIQDICRRLAKQGYLAIAPEL
FT                   YFRQGDAKDYSNINELVNNLVKKVPDRQVLVDLDHTAHWASRHGGDTKKLAITGFCWGG
FT                   RIAWLYAAHNPQLKAAVAWYGKLVGEKTLFLPKYPVDVAIDLCAPVLGLYGGKDTSIPA
FT                   EHIETMRQALRAANADAEIIVYPEAGHAFNADYRPSYHAESAQDGWQRMLDWFTQHGVS
FT                   AIPIPEETQ"
FT   sig_peptide     complement(278279..278362)
FT                   /locus_tag="YPA_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.614 at
FT                   residue 28"
FT   gene            278790..279551
FT                   /locus_tag="YPA_0238"
FT   CDS_pept        278790..279551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0238"
FT                   /product="uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12207"
FT                   /db_xref="GOA:A0A0E1NRK8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRK8"
FT                   /protein_id="ABG12207.1"
FT                   /translation="MAKSDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHLA
FT                   SHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINV
FT                   GDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSDTFY
FT                   PGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
FT                   RTQQEIPNEETMKATESHAVKIVVEAARHLL"
FT   gene            279672..280502
FT                   /locus_tag="YPA_0239"
FT   CDS_pept        279672..280502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12208"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3L3"
FT                   /protein_id="ABG12208.1"
FT                   /translation="MTMTTFSHPSLIPLDGGINFRDLGGNLAADGRRIKPGLLFRSGSL
FT                   DRLSTNDCDFLSHSNVTQIIDYRDADEVQAKPDVLWPGAHYHNIPANPLSSEVNANLEK
FT                   LTNETLATFDVRAFMFELYHRLPFNSLAYQQLVNLLQNCASTDPVASSVVHSGDVVHRG
FT                   IVQHCAVGKDRTGVGAALVLFALGADESTVLEDYLLTETTLKPFREHMLAELALKLNDQ
FT                   ALAQFTFVLSAREEFIQTTLRSIHERYGSRERWLKHEFGLGSIEREKLQSYFLE"
FT   gene            280866..282677
FT                   /locus_tag="YPA_0240"
FT   CDS_pept        280866..282677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0240"
FT                   /product="putative carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12209"
FT                   /db_xref="GOA:A0A0E1NPD4"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPD4"
FT                   /protein_id="ABG12209.1"
FT                   /translation="MQHAITFVIASACILTICYRLYGIFFVRKVLRVDDSEVTPSHTFE
FT                   DGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQYGYLPGFLWLLIGCVIGGAVHDTV
FT                   VLFASMKHQGKSLSEVAKSELGPVAGWCTGLAMLFIITITMAGLSMVVVHALERNPWGT
FT                   FAVFMTIPIAICVGLWERMTGSMKGASYVGIAAIMVCVFVGPYIEGTWLGEWLMLKADT
FT                   VSIILPMYAFFATALPVWMLLTPRGYLSSFMKIGVFGALIVGVVFINPEIQFPAVTQFI
FT                   HGGGPVLAGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGAMLAECM
FT                   VGVMALIAATSLHPADYFAINSSAEAWSALGMEVVNLPKLSEEIGLDLYGRTGGAVTLA
FT                   VGMTDIFIRVPWFNSLAAYFFQFVVMFEAVFILTAVDSGTRVARYLLQDFLGDIWAPLK
FT                   RTDWLPGTLVCSVIACALWGYLLNSGDINSVWALFGVSNQLMASVGLIIGATIILRLAT
FT                   KRVYMLTCVIPLAYLFVTVNYAGYWMITHVYFNSAAKGYNLFNGIISIIMMTLGVIILI
FT                   SALRKWRELWIRRSAEMAGNKVVTANA"
FT   gene            282949..283479
FT                   /locus_tag="YPA_0241"
FT   CDS_pept        282949..283479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0241"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12210"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV66"
FT                   /protein_id="ABG12210.1"
FT                   /translation="MTFNDAITTTIDFVRVHEAWAIPIVFILAFGESLAFLSLLLPATV
FT                   ILLGLGALIGESGIPFWPIWAAAAAGAFFGDWVSYWVGIHYKDRVATLWPLSRNPQLLV
FT                   RGHAFFERWGFFGAFFGRFFGPLRAIVPLVAGICAMPQRYFQLANITSALIWAFGILAP
FT                   GAFGIQWLSNWIG"
FT   gene            283687..285192
FT                   /locus_tag="YPA_0242"
FT   CDS_pept        283687..285192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0242"
FT                   /product="putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12211"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVM4"
FT                   /protein_id="ABG12211.1"
FT                   /translation="MDISLFYGLGGCLVGGLIGWLIASLSQQRTKAQQDIERRLLEQAL
FT                   QQAQQSIATLQMTQQRNEQQLRQSELEQRNLHSQLAANSEKLQQLAHWRNECEQLNQEL
FT                   RAQREINSAQEAELREVTIRLEETRLATEEKQRLLLNSEQRLTTQFENLANRIFEQTGR
FT                   RADEQNKQSLDRLLLPLREQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQMARE
FT                   ALNLTKALKGDNKTQGNWGEVVLAKVLEASGLREGHEYQTQVSVKIDQTSRMQPDVIVR
FT                   LPQGKDVVIDAKMSLVAYERYFNSEDDAEREVALNEHLSSLRGHIRMLGRKDYQQLPGL
FT                   RSLDYVLMFIPVEPAFLVAIDRQPELINEALQHNIMLVSPTTLLVALRTITNLWRYEHQ
FT                   SQNAQRIAERAARLYDKVRLFVDDMASLGQSLDKAQLSYHQAMNKLSQGRGNLVGQVES
FT                   FRTLGVEVKRPISPLLAEKACAEHQPEGDLALSDDAESGAFPE"
FT   gene            285284..286039
FT                   /locus_tag="YPA_0243"
FT   CDS_pept        285284..286039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0243"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
FT                   / demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12212"
FT                   /db_xref="GOA:Q1CBG0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBG0"
FT                   /protein_id="ABG12212.1"
FT                   /translation="MVDQEKETTHFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSF
FT                   GVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGEQGEVILADINESMLRMG
FT                   REKLRDKGIVGNVSYVQANAEALPFPDNFFDCITISFGLRNVTEKEKALRSMFRVLKPG
FT                   GRLLVLEFSKPLLEPLSKAYDAYSFHILPKIGELVAQDAESYRYLAESIRMHPDQETLK
FT                   GMMADAGFENVTYSNLTGGIVALHRGFKF"
FT   gene            286053..286703
FT                   /locus_tag="YPA_0244"
FT   CDS_pept        286053..286703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12213"
FT                   /db_xref="GOA:A0A0E1NLQ5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLQ5"
FT                   /protein_id="ABG12213.1"
FT                   /translation="MSLRTLMLKPFLLKPRLLTPLITAALETVLNGVLFNDKSLKAARS
FT                   RLVGKVLRIELREINFPLLFVFSERQVDVLSQWDDAADCLVKTDVAVLARLRDRQQLSP
FT                   LMRTGELVVEGDIQVVQQLVALLDLAEWDLAEWLAPYVGDVAAESLGQAIHKSSGFLSR
FT                   QLRQQQHYLAEAITEEWRMAPNLLEVMWFHEEVDATARATEALSSRLATMETK"
FT   gene            286703..288334
FT                   /locus_tag="YPA_0245"
FT   CDS_pept        286703..288334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0245"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12214"
FT                   /db_xref="GOA:Q1CBF8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBF8"
FT                   /protein_id="ABG12214.1"
FT                   /translation="MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLS
FT                   NRHKDKSLGERLRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGAL
FT                   ARKHIEIAMGGALETWFDDFDSQALASASIAQVHTARLKENGKEVVLKVIRPDILPIIK
FT                   ADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDS
FT                   PMLYIPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPHDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVA
FT                   ELHVDSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAE
FT                   KFPELPELVYDSLQQHKLLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTILFL
FT                   ADATEVSTGFIVAGALAWFIGWRRTC"
FT   gene            288514..288780
FT                   /locus_tag="YPA_0246"
FT   CDS_pept        288514..288780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0246"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12215"
FT                   /db_xref="GOA:A0A0E1NY21"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY21"
FT                   /protein_id="ABG12215.1"
FT                   /translation="MGSIGWAQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAMGD
FT                   DSQTPPTNVDKTSNDADFAKSITEKQQPVAKAEESKSHEKEQG"
FT   gene            288784..289446
FT                   /locus_tag="YPA_0247"
FT   CDS_pept        288784..289446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0247"
FT                   /product="Sec-independent protein translocase TatB"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12216"
FT                   /db_xref="GOA:Q1CBF6"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBF6"
FT                   /protein_id="ABG12216.1"
FT                   /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAAT
FT                   VQNELAQELKLQELQDSLKKVEQAGLQNLTPELKASMDELKEAAEALKRSYHVDAGSEA
FT                   PHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVVDSVVEAAPVTTVK
FT                   SVVQGEVLVKSTPVQEVGLADVMDKPVTKQQIDTIDSHGTDLSSAGPSRIHQPGGDQ"
FT   gene            289449..290225
FT                   /locus_tag="YPA_0248"
FT   CDS_pept        289449..290225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0248"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12217"
FT                   /db_xref="GOA:A0A0E1NNF6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNF6"
FT                   /protein_id="ABG12217.1"
FT                   /translation="MAVDDTQPLISHLIELRKRLLNCIITILVVFLVLVFFANDIYNLV
FT                   SAPLIKQLPAGASMIATDVASPFFTPIKLTMMVSVFVSAPMTLYQVWAFIAPALYKHER
FT                   RLMVPLLISSSLLFYLGMAFAYFVVFPLAFGFFAKTAPESVLIATDITKYLDFVMALFM
FT                   AFGISFEVPIAIILLCWAGVTTPEALKKKRPYVFVGAFVVGMLLTPPDVLSQTLLAIPM
FT                   YLLFEVGVFFARFYTGKQRRAATEEDEGIDSHPKAP"
FT   gene            290281..290820
FT                   /locus_tag="YPA_0249"
FT   CDS_pept        290281..290820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0249"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12218"
FT                   /db_xref="GOA:A0A0E1NTF9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF9"
FT                   /protein_id="ABG12218.1"
FT                   /translation="MFDIGVNLTSVQFAKDYHQVVNRAKEAGVLGILITGTDADESLAA
FT                   QTLAAEYPGYCWSTTGVHPHHASSWQDSVEQKIRTLAATASVVGIGECGLDFNRNFSTP
FT                   AQQEVAFTAQLALAAELSLPVFLHCRDAHERFIDLLVPWLDKIPAAVVHCFTGNSDCNE
FT                   RCNSDPHPTPEIRSRG"
FT   gene            290847..291869
FT                   /locus_tag="YPA_0250"
FT   CDS_pept        290847..291869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0250"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12219"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12219.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            291869..292648
FT                   /locus_tag="YPA_0251"
FT   CDS_pept        291869..292648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0251"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12220"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12220.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            292901..293485
FT                   /locus_tag="YPA_0252"
FT   CDS_pept        292901..293485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12221"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVS7"
FT                   /protein_id="ABG12221.1"
FT                   /translation="MQRGCCFLRSTTTAGVALIVAMTLSVSAWAISEQAKSEQATTVPN
FT                   NDIVCHVAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQQL
FT                   AVFRKVPRGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLGGTL
FT                   RLPFGRQMCAASGDTEFFSQAPVGPATNEVQ"
FT   sig_peptide     292901..292993
FT                   /locus_tag="YPA_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.742 at
FT                   residue 31"
FT   gene            complement(293602..294087)
FT                   /locus_tag="YPA_0253"
FT   CDS_pept        complement(293602..294087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0253"
FT                   /product="S-adenosylmethionine:2-demethylmenaquinone
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12222"
FT                   /db_xref="GOA:Q1CBF0"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBF0"
FT                   /protein_id="ABG12222.1"
FT                   /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDN
FT                   GLLFDLLEENGLGRVLVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDLAE
FT                   LDIGIQAMAAIPVGAADEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"
FT   gene            complement(294229..295158)
FT                   /locus_tag="YPA_0254"
FT   CDS_pept        complement(294229..295158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0254"
FT                   /product="1,4-Dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12223"
FT                   /db_xref="GOA:A0A0H2Y4W8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4W8"
FT                   /protein_id="ABG12223.1"
FT                   /translation="MKRKMSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDS
FT                   FKPAVALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVAL
FT                   IITVILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISV
FT                   LVFFGWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLA
FT                   VRLGPVVARYYHALLIGAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPTA
FT                   AGMRPMLEQMVKAALLTNILFAVGLVFS"
FT   sig_peptide     complement(295036..295158)
FT                   /locus_tag="YPA_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 41"
FT   gene            complement(295382..296713)
FT                   /locus_tag="YPA_0255"
FT   CDS_pept        complement(295382..296713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0255"
FT                   /product="ATP-binding heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12224"
FT                   /db_xref="GOA:Q1CBE8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE8"
FT                   /protein_id="ABG12224.1"
FT                   /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAL
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
FT   gene            complement(296784..297308)
FT                   /locus_tag="YPA_0256"
FT   CDS_pept        complement(296784..297308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0256"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12225"
FT                   /db_xref="GOA:Q1CBE7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE7"
FT                   /protein_id="ABG12225.1"
FT                   /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYT
FT                   NRFQTIEELTY"
FT   gene            complement(297408..298154)
FT                   /locus_tag="YPA_0257"
FT   CDS_pept        complement(297408..298154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0257"
FT                   /product="cell division protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12226"
FT                   /db_xref="GOA:A0A0E1NPB1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPB1"
FT                   /protein_id="ABG12226.1"
FT                   /translation="MALAVALLVVFVGGLYFITHNKPGELPLLPNHDPRTGNGLPPKPE
FT                   ERWRYIKELENRQIGVPMPTEPSAGGEVNAKTELTNEQRQLLEQMQADMRQQPTQLSEV
FT                   PYNQGMQQVPRSAVTIKPPATSVQPQPVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVT
FT                   PPKVEKEKEKTQRWMVQCGSFKAVDQAESIRAQLAFAGIESRITSGGGWNRVVLGPYNS
FT                   KAAADKALQRLQGAGQSGCIPLSVGG"
FT   gene            complement(298319..299323)
FT                   /locus_tag="YPA_0258"
FT   CDS_pept        complement(298319..299323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0258"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12227"
FT                   /db_xref="GOA:A0A0H2Y3Z7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3Z7"
FT                   /protein_id="ABG12227.1"
FT                   /translation="MTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVEQAVLAVGY
FT                   SPHALSRNIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGDCAQQTQQE
FT                   RTFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPTVHIDNLTA
FT                   AYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYIIRGDFSYE
FT                   AGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFDDLKLSQFC
FT                   DPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAPKH"
FT   gene            complement(299700..301898)
FT                   /locus_tag="YPA_0259"
FT   CDS_pept        complement(299700..301898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0259"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12228"
FT                   /db_xref="GOA:A0A0E1NZP2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZP2"
FT                   /protein_id="ABG12228.1"
FT                   /translation="MSVVQVALPVPLARTFDYRLDSAMACPVVGARVSVPFGKRKAIGI
FT                   VVGLSDTSTFPLEQLKTIDAILDNHSLFPPSLWRILCWATEYYHYPIGEVLFHALPILL
FT                   RQGRPAQSAPLWQWFVTEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMALTES
FT                   ALQALRSKGLIDLRAQEATTTDWRHSFSVLGERLRLNTEQATAVGAIRSEDNQFAAWLL
FT                   AGVTGSGKTEVYLSVLENILAQGRQALILVPEIGLTPQTIARFRERFNAPVEVLHSGLN
FT                   DSERLSVWLRARSGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWRYHARDL
FT                   AVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLTKRAGSAKPAAQHLLDLKGLPL
FT                   KVGLSQPLLKQMKTHLQAGNQVILFLNRRGYAPALLCHECGWIAECQRCDHYYTLHQNH
FT                   RQLRCHHCDSQRPVPQQCPKCGSTHLVSVGVGTEQLENELAPLFPETPITRIDRDTTSR
FT                   KGSLEQYLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQ
FT                   LYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALEERKSVFLPPYTS
FT                   HIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAKRGGRFRWQLLLQ
FT                   HPSRQLLQRLIKTSQPLISTLPQARKVKWTIDVDPIDS"
FT   gene            302141..302356
FT                   /locus_tag="YPA_0260"
FT   CDS_pept        302141..302356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0260"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12229"
FT                   /db_xref="GOA:Q1CBE3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE3"
FT                   /protein_id="ABG12229.1"
FT                   /translation="MKQGIHPKYEQVTASCSCGNVIKINSTVGHDLNLDVCGECHPFYT
FT                   GKQRDVASGGRVDRFNKRFSVPGAKK"
FT   gene            complement(302881..303348)
FT                   /locus_tag="YPA_0261"
FT   CDS_pept        complement(302881..303348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12230"
FT                   /db_xref="GOA:A0A0H2Y3M7"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3M7"
FT                   /protein_id="ABG12230.1"
FT                   /translation="MDLNMNPNYAKPSAAFTAASWSALLGGFVIFLIGLWNADMQLNER
FT                   GYYFAVLILGLFSAVSLQKTVRDKLEGLAITSIYYGLCWVAFIVAVLLLCIGLWNATLA
FT                   LSEKGFYGVTFFMTLFGAIAVQKNTRDSAMSSDTESASLFKKVRDQLKAED"
FT   gene            complement(303685..304002)
FT                   /locus_tag="YPA_0262"
FT   CDS_pept        complement(303685..304002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0262"
FT                   /product="transcriptional repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12231"
FT                   /db_xref="GOA:Q1CBE1"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE1"
FT                   /protein_id="ABG12231.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
FT   gene            304380..305369
FT                   /locus_tag="YPA_0263"
FT   CDS_pept        304380..305369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12232"
FT                   /db_xref="GOA:A0A0E1P079"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P079"
FT                   /protein_id="ABG12232.1"
FT                   /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSALHLVCTTFLQPGDLLVAPHDCYGGS
FT                   YRLFDSLSKRGAYRVLFVDQGDEAALNCALAEKPKLVLIETPSNPLLRVVDIAAICQAA
FT                   RAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVEL
FT                   AWWANNIGVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLP
FT                   QHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALELFTLAESLGG"
FT   gene            305396..305539
FT                   /locus_tag="YPA_0264"
FT   CDS_pept        305396..305539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0264"
FT                   /product="cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12233"
FT                   /db_xref="GOA:A0A0E1NPH2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPH2"
FT                   /protein_id="ABG12233.1"
FT                   /translation="MTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAV
FT                   TR"
FT   gene            305542..307977
FT                   /locus_tag="YPA_0265"
FT   CDS_pept        305542..307977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0265"
FT                   /product="homoserine dehydrogenase / aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12234"
FT                   /db_xref="GOA:A0A0E1NNX0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNX0"
FT                   /protein_id="ABG12234.1"
FT                   /translation="MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDL
FT                   MVVSAAGSTTNQLISWLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFI
FT                   HDLERLAGLLDNKIDDVIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERA
FT                   AQPQIDESRSYPLLQQLMAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALA
FT                   GAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDL
FT                   LLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVG
FT                   AGVSKNPLHSHRFYQQLKDQPVEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEK
FT                   RIGLMLFGKGNIGARWLELFAREQKSLSARSGFEFVLAGVVDSRRSLLSYDGLDASRTL
FT                   AFYNDEAKEQDEESLFLWMRAHPFDDLVVLDVTASPSLAEQYLDFASYGFHVISANKLA
FT                   GASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTL
FT                   SWLFLQFDGSVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQV
FT                   RVESLVPAGAESGSVDQFFENGEALNQQMIQRLEAAKEMGLVLRYVARFDANGKARVGV
FT                   EAVRTDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL"
FT   gene            308210..309094
FT                   /locus_tag="YPA_0266"
FT   CDS_pept        308210..309094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0266"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12235"
FT                   /db_xref="GOA:A0A0E1NMU5"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMU5"
FT                   /protein_id="ABG12235.1"
FT                   /translation="MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSSI
FT                   DRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDIAI
FT                   DYWNSGIRHIVALRGDLPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAKSAQ
FT                   ADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPNWMTSIFDGLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRP"
FT   gene            complement(309272..310057)
FT                   /locus_tag="YPA_0267"
FT   CDS_pept        complement(309272..310057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0267"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12236"
FT                   /db_xref="GOA:Q1C0C3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C0C3"
FT                   /protein_id="ABG12236.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(310111..310791)
FT                   /locus_tag="YPA_0268"
FT   CDS_pept        complement(310111..310791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0268"
FT                   /product="insertion element IS1661 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12237"
FT                   /db_xref="GOA:A0A0H2Y4X6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4X6"
FT                   /protein_id="ABG12237.1"
FT                   /translation="MPATARYVTEVAMAEQAIFMYFSGLTPLAVPFQRGHNALNPRSWI
FT                   FLSMIWRFGSMKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRRQGEA
FT                   GLEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGGKEAL
FT                   NPSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKALREQQ
FT                   KKPE"
FT   gene            310898..312322
FT                   /locus_tag="YPA_0269"
FT   CDS_pept        310898..312322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0269"
FT                   /product="Sodium:galactoside symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12238"
FT                   /db_xref="GOA:A0A0E1NRH0"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRH0"
FT                   /protein_id="ABG12238.1"
FT                   /translation="MSLDSQHLCSLKDEGDKRLKINMNNSGMKIPMKELASYFGYGMGQ
FT                   CFSFGLVGTFILFFYTDIMGISPVAASMIFLIARVWDAIHDPLIAGVMDTINMRRGKFR
FT                   PYLLFTPFLIFLVTVAAFYNIEASLMTKTIYAGVTYILWGTLYALSDIPFWSMSTVMTD
FT                   EPQERAKTATCAMLGVNAGIGATMILFPYISGLFAENSADRGYFAGVVILMVLGVILML
FT                   NGFFNTKERVNVTVTEKVTLKQTFIVVWQNKPLFFILSAFFMNVFSNIVNTFYIFFFTY
FT                   NMGDAELVSVIGLITFTCALACLGTPFLTRHFKKRDLFITLCVLEIIARVGFWFTGYNN
FT                   VVSVMVWLTVITAIFMMTNPLISAMIADTVEYSYYHTGKRCAAITFSGQTFVGKLSVAV
FT                   AGGVSGLILSILGYMPNVAQSTWTLNGLFFCISLLPAVGAVVRILIMRKYKFTEDEHAI
FT                   LREELKQGRFHSSVGK"
FT   gene            complement(312581..314761)
FT                   /locus_tag="YPA_0270"
FT   CDS_pept        complement(312581..314761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0270"
FT                   /product="putative ferric siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12239"
FT                   /db_xref="GOA:A0A0E1NRE9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRE9"
FT                   /protein_id="ABG12239.1"
FT                   /translation="MKHKHLWVLNPCLLVMLTPAAWAEDQLVVSANRSHRSVAEMAQTT
FT                   WVIEGQELEQQVQGGLEIKDILAQLIPGIDVSSQGRTNYGMNMRGRSIMVMIDGVRLNS
FT                   SRSDSRQLDSIDPFNIAHIEVISGATSLYGGGSTGGLINIVTKKGQEGKQVELQIGGKT
FT                   GFNSHNDHDENISAAMSGGTERAFGRFSVSYQRYGGWYDGKGNEVLIDNTQTGLQYSNR
FT                   LDVMGTGTLNIDENQQLQLTTQYFNSESDGKHGLYLGQNFSAVTGTGQASNSAALNSDR
FT                   IPGTERHLINLQYSNTDFWGQDLVAQVYYRDESLTFYPFPTLKDGKVSTIGASQQKTDF
FT                   YGSKLTLNSEPIDSLTLTYGIDLEHESFNANQQFFNLAKAQQSGGMTLENAYNVGRYPS
FT                   YTTTNLAPFLQTRYDINPIFTLSGGVRYQYTENKVDDFVGYAQQQAIASGSATSADPVP
FT                   GGKTDYNNFLFNAGLLAHLTESQQTWFNFSQGFEIPDLAKYYGSGSYTLVNGHYQLQNS
FT                   VNVNDSKLEGIKVDSYELGWRYTGDNLRTQMAGYYSLSDQTISINKTDMTINVLPDKRR
FT                   IYGVEGAVDYFFDNSEWSAGATFNLIKSETKVSGKWQKLTIDAASPSKATAYIGWAPGD
FT                   WNLRVQSQQTFDVSDSKGDKIDGYNTIDFLSSYALPVGKLSFSIENLLDKEYTTVWGQR
FT                   APILYSPTYGSPNLYSYKGRGRTFGVNYSVLF"
FT   sig_peptide     complement(314690..314761)
FT                   /locus_tag="YPA_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(314833..316161)
FT                   /locus_tag="YPA_0271"
FT   CDS_pept        complement(314833..316161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0271"
FT                   /product="putative siderophore biosynthesis protein IucD"
FT                   /EC_number="1.14.13.59"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12240"
FT                   /db_xref="GOA:A0A0E1NPY0"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPY0"
FT                   /protein_id="ABG12240.1"
FT                   /translation="MNQPLDFIGIGIGPFNLSIAALGSEVSGFNSKFLERKPHFSWHPG
FT                   MMVPDCHMQTCFLKDLVSTVSPTNTYSFLNYLVQHKKFYRFLTTEHRTVSREEFADYLR
FT                   WAASGMSSLEFSQDIQSVDFDDQQRHFVVTTPRNVYHARHVCLGIGKRIKLPDCVTEQN
FT                   DRCFHASEMALRNPDLTGKRVTIVGGGQSGADLFLNIFLAAWGQPKQLNWISRRNNYNA
FT                   LDEAAFANEYFMPEYVESFYTLNDSAKQHMLAEQRMTSDGITSESLLAIYRAMYHQFEV
FT                   LHEKPWARLLPSRSLTNMHTRGNGYQLLTHHHLDQGTETFDTDVVIFATGYQQDRPAFL
FT                   DPLADRLQTTADCQYQVAPDFVLDWQGPRENCLFAVNAGMHSHGIAEPQLSLMAWRSAH
FT                   ILNRALGRTQFDLTSTPAVIQWRSQQSGVPAHPEHPVLNCIDI"
FT   gene            complement(316158..317906)
FT                   /locus_tag="YPA_0272"
FT   CDS_pept        complement(316158..317906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0272"
FT                   /product="putative siderophore biosynthesis protein IucC"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12241"
FT                   /db_xref="GOA:A0A0E1NU49"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU49"
FT                   /protein_id="ABG12241.1"
FT                   /translation="MITTDYANWQQVNRHMIAKILSELEYERTLHAELHGETGRITLPG
FT                   AVYTFNGKRGIWGWLHIDPATLRCEGVPLAADHMLRQLALVLKMDDSQVAEHLEDLYAT
FT                   LRGDMQLLSARHGMSAEALIALNDDALQCLLAGHPKFIFNKGRRGWGLTALQHYAPEYQ
FT                   GQFRLHWVAAKRGSFIWCVDAEYPLDNLLNSAMDPAERQRFDRRWRECQLNDDWVPVPL
FT                   HPWQWQQKIALHFLPQLAEGELIELGEFGDHYLAQQSLRTLTNVSRRVPFDIKLPLTIY
FT                   NTSCYRGIPGKYISAGPAASRWLQQVFAQDRTLHESGAEILGEPAAGYMLHQTYATLAK
FT                   APYRCQEMLGVIWRENPSCYLREGEHAILMATLMETNNQGHPLIAAYIARSGLSAEAWL
FT                   EQMFRVVVVPMYHLMCCYGVALIAHGQNITLVMKDHAPQRILLKDFQGDMRLVDKDFPQ
FT                   AASLPNVVKDVTVRLSADYLIHDLQTGHFVTVLRFISPLMQACNLSEYRFYQLLAQVLE
FT                   RYMAQHPDLADRFTLFNLFKPQIIRVVLNPVKLTYSEQDGGSRMLPDYLQDLDNPLYLV
FT                   TKELAQ"
FT   gene            complement(317903..318853)
FT                   /locus_tag="YPA_0273"
FT   CDS_pept        complement(317903..318853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0273"
FT                   /product="putative siderophore biosynthesis protein IucB"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12242"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMW5"
FT                   /protein_id="ABG12242.1"
FT                   /translation="MGPHAKLIHSGGSFYCEHLGKALTLGLGLDGSAVLHLPGPLPPGW
FT                   LVQALDQLFIAAPQLTGIALPYAEWRDAPQAMALFALISSDYVAREIFYQLPLWLGAER
FT                   NRTAGQMQYDTERHLWYPQRPPRPDGEVYRRFDPNIKRTLSFRLPEVDHDAPQFTRWMN
FT                   SPRVDAFWEMSGPLDVQAAYLQRQLDSPYCYPLLGCFDDQPFGYFEVYWAAEDRIGRHY
FT                   RWQPFDRGLHMLVGEENWRGAQYIHSWLRGLTHYLYLDESRTTRVVAEPRIDNQRLFHH
FT                   LPAAGYHTLKEFDFPHKRSRLIMNQRADFFREGTR"
FT   gene            complement(318837..319907)
FT                   /locus_tag="YPA_0274"
FT   CDS_pept        complement(318837..319907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0274"
FT                   /product="siderophore biosynthesis protein, IucA familly"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12243"
FT                   /db_xref="GOA:A0A0E1NRJ8"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRJ8"
FT                   /protein_id="ABG12243.1"
FT                   /translation="MHPWQADHLLKQDWCQQLVQQNALHDLGEAGERWLPTSSSRSLYS
FT                   PSNRDMVKFSLSVRLTNSVRTLSVKEAKRGMRLARLAQTPRWQELQARYPTFRVMQEDG
FT                   WAGLRSADFTLQEESLLVLRDNLLFSQPDSQTNVLVTLTQAAPDGGDSLLASAVRRLAA
FT                   RLNLPLQQAAFCWLDAYCQHVLLPLFSTEADYGLVLLAHQQNILVEMQQDLPVGMLYRD
FT                   CQGSGFTQSALPWLAEIGEAEAENSFSEQQLLRYFPYYLLVNSSLAVTAALAAAGFDSE
FT                   ENLMVRVRDALSALRTCAKNTLCLDYVLDSPHWHCKGNFFCYLHDHNENTIVDPAVIYF
FT                   DFVNPLHQGVIHGATR"
FT   gene            complement(320000..320608)
FT                   /locus_tag="YPA_0275"
FT   CDS_pept        complement(320000..320608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12244"
FT                   /db_xref="GOA:A0A0E1NMG9"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMG9"
FT                   /protein_id="ABG12244.1"
FT                   /translation="MTIPVETLATDVAAQCFLNALIRETQDWQIVPAAGHQPYPQLHIP
FT                   LSSSHAIHIALCHISPTQHHHYLFPAYLHQQGNDRQDDDTPVKLGIEQLVTLLLEKPTV
FT                   KGELSDDVVARFRQRVLESHDNTQQAINIRLDWPSLRDKPLNFAQAEQGLLAGHAFHPA
FT                   PKSHQPFNEKQAQRYLPILPPASHYAGLQSINATCAAIA"
FT   gene            320748..321971
FT                   /locus_tag="YPA_0276"
FT   CDS_pept        320748..321971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0276"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12245"
FT                   /db_xref="GOA:A0A0E1NZZ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZZ4"
FT                   /protein_id="ABG12245.1"
FT                   /translation="MRISSESDARSSGLTSSTHWPLAFCVGLLGIGQNGLLVVLPVLVS
FT                   RTHLSLSVWAGLLTLGSMLFLVGSAWWGRQSEIRGCKFVVIMALAGYLLSFVLLALAVW
FT                   GLSAGWLSEMAGLGWLIVARIIYGLTVSGMVPASQTWALQRAGYEQRMAALATISSGLS
FT                   CGRLLGPLCAALALSIHPIAPLWLMAIAPLIALLVVYRQYNDPPLPPVVHQQNRLRLNM
FT                   LPYLLCALLLAATVSLMQLGLAPHLSRLFSHSATTVSHHVAILLSIAAGCTLLAQFLVV
FT                   RPQRFTPPQLLLVAALLMVLGLGLMCVQPLVLFYLGCALASFGAAMATPGYQLMLNDRL
FT                   STGKGSGVIATSHTLGYGMSALMVPVVAKFYGESQLVAAAFMMAILLGGISGWLWCQHR
FT                   TTAHSVGE"
FT   gene            complement(322261..323094)
FT                   /locus_tag="YPA_0277"
FT   CDS_pept        complement(322261..323094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12246"
FT                   /db_xref="GOA:A0A0E1NN37"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN37"
FT                   /protein_id="ABG12246.1"
FT                   /translation="MTNKIMPKVNREGRRSFLQKSIAVVATGVVTHAFSAPNITLEKDT
FT                   KPQPGTCILSVEQMAGPYIKSNMPIRRNIAENENGVPLLLKITVIDSNSCRPLEYYYVD
FT                   IWQCNARGRYSGWSYVDPDKDAPSGEVASINRTDEKSFLRGSQVTDSHGLVRFTSIYPG
FT                   FYAGRAVHIHFAIKPPKASPQEVDKYSFISQLYFPEEFNSEIEQRAEYSLRKIKRLINS
FT                   DDEIFNEANGENAVLAVSKINENDINDGVLAEITIAINKDILSKRIDPKDILKIT"
FT   sig_peptide     complement(322987..323094)
FT                   /locus_tag="YPA_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.864 at
FT                   residue 36"
FT   gene            complement(323471..324847)
FT                   /locus_tag="YPA_0278"
FT   CDS_pept        complement(323471..324847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12247"
FT                   /db_xref="GOA:A0A0E1NPL4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPL4"
FT                   /protein_id="ABG12247.1"
FT                   /translation="MLTRRKFLMMSAGAGLLLSVPMLARTGVQPAQAATAITQVFGDGI
FT                   RLTAVAVEYPTEVSAEGLNPADFHVEGRTVTGVWTSTSTNPADIAPSGRYMIIALSPDD
FT                   KNATLAEQVQPNSKNNSNKSANGRGGPGNAGDIPAYDTVYRTAQATVLRLPSVHTASGD
FT                   TLPASEKALTTQYVENLIVDDFQQLEFYDEKTGKKLKYNLFIPKDYSPDKDYSPDKNYS
FT                   PDKAWPLVLFMHDAGATSDVTRTTLYQGLGAIAWASPEDQAQRPCFVLAPQYEEIIADD
FT                   DSKTSDMLDTTIDLINVLSEQYNIDKSRIYATGQSGGCMMTIAMNIKYPDFFAASFLVA
FT                   GQWDPALVKPLAQQKLWILVSQDDNKAWPGQNAIIDVLEKEGVQISRAIWDGTWNEEQF
FT                   RQAFEQIEAEKSPINYVAFREGTVIPEGQSTEGASGHRNTWRIAYTISPIREWIFRQQR
FT                   "
FT   sig_peptide     complement(324746..324847)
FT                   /locus_tag="YPA_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 34"
FT   gene            325409..326152
FT                   /locus_tag="YPA_0279"
FT   CDS_pept        325409..326152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0279"
FT                   /product="quorum-sensing transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12248"
FT                   /db_xref="GOA:A0A0E1NR40"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR40"
FT                   /protein_id="ABG12248.1"
FT                   /translation="MHSVFNRSNEVIETLRDYIDRKLTIYDSPKYTYMVINKKNPGDIF
FT                   IVTSYPNEWAELYTNNNYQNIDPVVLIAFRRFSPFSWDENITVLSELKLSKIFTLSKKY
FT                   NIVNGFTFVLHDTMNNLAMLSLIMDDSALNGVESRVLNDRDRLQMLLIETHEKMLTLSQ
FT                   RNMNIQERQGKGMPGKAILSPRENEVLYWASMGKTYQEIAIITNITPRTVKYHIGNVVK
FT                   KLGVINAKQAIGLGVELEIIKPILA"
FT   gene            complement(326133..326783)
FT                   /locus_tag="YPA_0280"
FT   CDS_pept        complement(326133..326783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0280"
FT                   /product="N-acylhomoserine lactone synthase YspI"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12249"
FT                   /db_xref="GOA:A0A0E1NPQ8"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPQ8"
FT                   /protein_id="ABG12249.1"
FT                   /translation="MLEIFDVRYDELTDIRSEDLYKLRKKTFKDRLNWEVNCSNGMEFD
FT                   EYDNSDTRYLLGIYQGQLICSVRFIELHLPNMITHTFNALFDDVALPKRGYIESSRFFV
FT                   DKTRAKLLFGNHYPISYLFFLSIINYSRHNGYTGIYTIVSRAMLTILKRSGWQVEVIKE
FT                   AHITEKERIYLLHLPIDRDNQARLLLQVNQRLQDPCSVLSTWPISLPVMPESA"
FT   gene            327958..328608
FT                   /locus_tag="YPA_0281"
FT   CDS_pept        327958..328608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0281"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12250"
FT                   /db_xref="GOA:A0A0E1NWN3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWN3"
FT                   /protein_id="ABG12250.1"
FT                   /translation="MNGKIDRVTHALTCVSVWIGWFALSFSLLLFPGYVGIYRSGMATP
FT                   LLYIVFWLPFTLLAWKHYQKSFGLMPLGRITLQDMLIPGLALLGLTAIFQFFGQPEPWV
FT                   ESLLQPSTFTQILLVITICVFAPISEEIIFRGFLLNAGIGFGRRGRLLAVVITSLLFAL
FT                   VHTQYLYPATFVSLFVFSAILCEVRIRTGSLLMPMVLHSANNIASVAWVLTLS"
FT   gene            329059..329454
FT                   /locus_tag="YPA_0282"
FT   CDS_pept        329059..329454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0282"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3P4"
FT                   /protein_id="ABG12251.1"
FT                   /translation="MMNKFFKIISINLLAISLGGCGMMLNPLLMKQAEVEPNNLPDGKL
FT                   GQPYYAKLRITGGGGAIASFKGESMPVGSGLVLTSDNPERPPGRDELVIKGIPVISGDI
FT                   TFRVSGALFSSADKGYFGKEYKLKIAE"
FT   sig_peptide     329059..329154
FT                   /locus_tag="YPA_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.709 at
FT                   residue 32"
FT   gene            329522..329785
FT                   /locus_tag="YPA_0283"
FT   CDS_pept        329522..329785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0283"
FT                   /product="insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12252"
FT                   /db_xref="GOA:A0A0E1NZT2"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZT2"
FT                   /protein_id="ABG12252.1"
FT                   /translation="MACINVHCPRCDSALVYRHGQNPKGQSRFRCRECRSVFQLTYTYQ
FT                   ARKPEVKGQIVDIAFSGTGVWDTARTLKIGINTVIRTLKNSC"
FT   gene            331730..332230
FT                   /locus_tag="YPA_0284"
FT   CDS_pept        331730..332230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12253"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMS6"
FT                   /protein_id="ABG12253.1"
FT                   /translation="MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNG
FT                   QEQRPLSEREKLNINKNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEP
FT                   ENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAP
FT                   KEG"
FT   gene            332279..333817
FT                   /locus_tag="YPA_0285"
FT   CDS_pept        332279..333817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12254"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX39"
FT                   /protein_id="ABG12254.1"
FT                   /translation="MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIE
FT                   AFQNNDALAEATTDERVTAAVSVFLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLD
FT                   AVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEISQSGLY
FT                   AQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPEFFG
FT                   KENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRS
FT                   FNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYD
FT                   LGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADA
FT                   TANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDD
FT                   LQASHPLRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA"
FT   gene            333829..335181
FT                   /locus_tag="YPA_0286"
FT   CDS_pept        333829..335181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12255"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P096"
FT                   /protein_id="ABG12255.1"
FT                   /translation="MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVL
FT                   QATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPAEASDATVMLA
FT                   IPQLYANGGNCLQPDERGERPVRYRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENG
FT                   DYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMR
FT                   RESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTF
FT                   SLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLR
FT                   DPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVP
FT                   AAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA"
FT   gene            335178..335864
FT                   /locus_tag="YPA_0287"
FT   CDS_pept        335178..335864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0287"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12256"
FT                   /db_xref="GOA:Q1C9Z2"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C9Z2"
FT                   /protein_id="ABG12256.1"
FT                   /translation="MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQR
FT                   CVADIERVHQALKDAGHSEQSCQHIRYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHF
FT                   FNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLS
FT                   VQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLAT
FT                   LLPEPV"
FT   gene            335864..337600
FT                   /locus_tag="YPA_0288"
FT   CDS_pept        335864..337600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0288"
FT                   /product="putative OmpA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12257"
FT                   /db_xref="GOA:A0A0E1NTY9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTY9"
FT                   /protein_id="ABG12257.1"
FT                   /translation="MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICML
FT                   GGSRAGRQAAGASSDPLFAGLATENGLLPENSRLPVVLVCGDGLASWFGRERSHQSAQG
FT                   CWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVNPQQRRDERLLAADLQELRWQLMQ
FT                   LRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGSLADWQRAESRAV
FT                   QAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVDPLAPQQIIQQQVASLADPVPASLWQ
FT                   HWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLA
FT                   AMVALCSSAWQNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLHRDAGLLDEGYRNGE
FT                   PLRLGLGLYRGERLRPPLLAAIKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAG
FT                   STKMLVTALIDIKAKPGWLIVVAGHTDITGDAQANHILSLKRAEALRDWMLSTSDVSPT
FT                   CFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQGPDVKTASQDESDVSTQEM
FT                   EK"
FT   sig_peptide     335864..335959
FT                   /locus_tag="YPA_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.835 at
FT                   residue 32"
FT   gene            337604..338095
FT                   /locus_tag="YPA_0289"
FT   CDS_pept        337604..338095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12258"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C9Z0"
FT                   /protein_id="ABG12258.1"
FT                   /translation="MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDN
FT                   NTGKLTGTRIHTPFVFTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNT
FT                   KLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
FT                   "
FT   gene            338513..341161
FT                   /locus_tag="YPA_0290"
FT   CDS_pept        338513..341161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0290"
FT                   /product="Clp ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12259"
FT                   /db_xref="GOA:A0A0E1NQT3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQT3"
FT                   /protein_id="ABG12259.1"
FT                   /translation="MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLL
FT                   EQGEGDITVIARRYEWDMDSLWQGLLAYLDTLPRTVQGKPQLSAALQQLIKSAWLDASL
FT                   QENADAVRSVHLMAALINSPSLLAADAAWPLLSLSTTQLHRLLPLLDSQSDERPEIQQA
FT                   AALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARANQIDPIFGRDSE
FT                   IRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVSVRTLDLGLL
FT                   QAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALA
FT                   RGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGV
FT                   HILDAAITAAVTLSRRFLTGRQLPDKAVELLDTAGARVRMSIDTLPTALMAINAELAAL
FT                   AMEQQAIEQDLLLLPNVSSTRLPEIEQRRAALAVGQHTLEQQYKEEKRLTTLIIEARQD
FT                   IANVAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGVPLSSLLKDEQTDLLQL
FT                   ENHLATRVVGQDTALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETALALADS
FT                   LFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVE
FT                   KAHRDVLNLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHLMQLLDEQPEATHSD
FT                   LHELLRPILRDHFQPALLARFQTLIYRPLNAIALRTIVEMKLAQVAKRLNKHYGLHCTI
FT                   EESLYDTLVAACLLPDTGARNIDSLLNQQILPVLSQQLLSRMSEQQRTTSLTLGWDEAD
FT                   GITLEFEGGEK"
FT   sig_peptide     338513..338614
FT                   /locus_tag="YPA_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.977 at
FT                   residue 34"
FT   gene            341158..343506
FT                   /locus_tag="YPA_0291"
FT   CDS_pept        341158..343506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12260"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWB5"
FT                   /protein_id="ABG12260.1"
FT                   /translation="MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDI
FT                   QFTSADKAIDPATMLMHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEEC
FT                   RYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQ
FT                   VMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGM
FT                   HDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADN
FT                   YLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQ
FT                   FGKGVIVTRITSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVN
FT                   DTYGHIDKDGRYRVNLMFDRDSWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAF
FT                   EDGNPDRPYIASVLHDSAHGDHVTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYG
FT                   GKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISADGQAKAQGQVLEMQPAI
FT                   SLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGIALSSG
FT                   EHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGRITVQAQN
FT                   DLMELLARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYY
FT                   GRQEKANKPEDFPSVAPETTEPTSHFTFS"
FT   gene            343590..345743
FT                   /locus_tag="YPA_0292"
FT   CDS_pept        343590..345743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12261"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3Q7"
FT                   /protein_id="ABG12261.1"
FT                   /translation="MMPVSSRRGYPLNTSDSWHGGIHIPHTDSGALPEKVRAIADGTVV
FT                   SFRMPSKPWERDQFPLKYSPLRGTDDGYVLLKHETEIGSGDDGKVVFYSLYMHLKHLEA
FT                   EIKTDAKIYRKAPLGSSGMTDGQNEFHFQIFCDEANTRKLVGRTTGELNINESGRKDVV
FT                   YGDIHFYLPAGTKFYEARPSANIATTTNLNEVHTSAVPLYASMSLSKGAGTMITRQACA
FT                   NAEGAFEPVGSPLVNADGKDYEYNLYKTATSRYPQSPSAGYELLRFGRIINTEHETLVP
FT                   ADAPLWMTVNYPGGQGVVNLAVATVKKFSDADFPHWTGWQLIDDDKDMHSQCNSAAIRK
FT                   LREKDRYAAQSSKLICCIPFEWEKSTIDTRYKWLMTGLPWEQCTPEKTATWQIPGSQES
FT                   KDRILMNEEDYGRFKQHAEALCFDSGALGSGKVWHFDPRGFIENFRKSRWLDEIDLSRV
FT                   YSTTAKDVREKYRTSINFILIKYGMNNPIRTAHFLGQGAIESQNLNLMVEGSVSFSRHP
FT                   DHPSFAEEINGYYADPTDIYGYFHNYEREGNDLGNITKSDLRDSRNNLLTVVIGRDSNN
FT                   RPILTAPQRRTIDSNLSHIGDGMKFRGRGFKQLTGLANYTGYWTYRGWLRSTDYDNSWW
FT                   RNPNRLRVPLIDNPQNISTEPYNCIDSGGQFVAKNGVLRRADAGVTRDSSRSVSMVINR
FT                   WDQQSFERRFQSTQNTYSIVGDE"
FT   gene            346640..346915
FT                   /locus_tag="YPA_0293"
FT   CDS_pept        346640..346915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0293"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12262"
FT                   /db_xref="GOA:A0A0E1NNC9"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNC9"
FT                   /protein_id="ABG12262.1"
FT                   /translation="MAKVDVKCPFCEQFHPVKKHGPERTGHQRYRCQACRRSFQLEYEY
FT                   RACYPGMKEQIVDLAMNNAGIRDTARALHISINAVMRTLKNSRRSV"
FT   gene            346971..347228
FT                   /locus_tag="YPA_0295"
FT   CDS_pept        346971..347228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0295"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12263"
FT                   /db_xref="GOA:A0A0H2Y2U5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2U5"
FT                   /protein_id="ABG12263.1"
FT                   /translation="MVICGQQKAATLALVCLGASPQTYYCSYFWSSEQKTFRQLLGLLS
FT                   GFNIVFWCTDNFSAYEMLPDEKHIRSKLYTQRIEREPYLV"
FT   gene            347836..348471
FT                   /locus_tag="YPA_0296"
FT   CDS_pept        347836..348471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12264"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSK4"
FT                   /protein_id="ABG12264.1"
FT                   /translation="MQPAISLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTE
FT                   LKQAVLLLSAPKGIALSSGEHLQMSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVR
FT                   KLGIKLIANQGPITVQAQNDLMELLARKAITITSTEDEIKITAKKKITLNAGGSYITLD
FT                   ENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKTEDPIKRWLFS"
FT   gene            348487..350784
FT                   /locus_tag="YPA_0297"
FT   CDS_pept        348487..350784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0297"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12265"
FT                   /db_xref="GOA:A0A0E1NWG6"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWG6"
FT                   /protein_id="ABG12265.1"
FT                   /translation="MIISPLFLKDKSNSEDDASWVSRMMPVDPERGFPLNSHRSWHGGI
FT                   HIPHTDSGGTPEKIRAIADGTVHSLRQPVGDKKGIPPYNYNGATDCGYVLLKHETEIGS
FT                   GENAKVVYFSLYMHLASIDAAVKTGEKIYRKDPIGTVGQVDGGNAVHFQIFCDDTNLTK
FT                   LVGRTTPELDLTKNGRTDAVYGDMYFYLPTGTKFYSHAPANNATTTTEAETYTSTEPLF
FT                   VSMSFDKGKCTMLTRKKGVFSIGKYSEVGEKLENTDGADYEYNVYAQAKKLYPQSQSAG
FT                   YELLRFGRVINTDYETLVPADAPLWRTISYPGGKGVVNLALPAVKKFSDGDFPHWTGWQ
FT                   LIDDDTDENSQCNSEQVLCRIGDDMQGLICHLPLEWDASTLEKRLSWLKTTVINESLAN
FT                   QKASHQVDDTGNNASGYAFDNINPDMSVLNAQSTPSFEQAAKDTAMAEADWNALIEHAK
FT                   ALCFDVSGLPVGRVWHFNPISFIAHFRKCGWLDPEKIKSILTSALNKKRNVRKITLIEK
FT                   ASDSNYTFLNLAMRKYNILTPNRQSHFLGQGAVESDSLTAMQEVSQEQVIVNGKQTGGG
FT                   IVIKSTLNESELGHWYGSEPSELDIYYSGNKYNKNGGLIAGSYSWSNGNCGDVDAQKFR
FT                   GRGFKMLTGRDKYADYWVYRGWLLKSSFDAYWWDDVKYKSKNLKAMKKRPAIIDDPHKI
FT                   TASPYNCIDSGSFFITCFRRSTVKEIDKDQAESADDSVVTKVTQAINGGDIGLSQRKVM
FT                   TNNAKGKLNDKY"
FT   gene            350771..351538
FT                   /locus_tag="YPA_0298"
FT   CDS_pept        350771..351538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P0H6"
FT                   /protein_id="ABG12266.1"
FT                   /translation="MINIKKLTLKYFYILFFTPHLAHATYYNEVSFDDYIVLLDKNENA
FT                   ILHVKKNHTDIQCVIKNWNIKYNNGAGVISLTTDKKAILLANTQAYLYVDEVINCKEGG
FT                   VSLHKVPVPNSPPFGTVIDLNFDKKIYLSVVLEDIRTLSYTAIVSKFDSNKNIINAKGF
FT                   ENKQTTNKDNSFYLEGSSGGYGGKISINGKYIFPVNLDCSSDSFPGVWDLENKKRVVFS
FT                   SHKNSSITIDEKCHKLFNGVASLEELGGELVSK"
FT   gene            351634..351909
FT                   /locus_tag="YPA_0299"
FT   CDS_pept        351634..351909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0299"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12267"
FT                   /db_xref="GOA:A0A0E1NS18"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS18"
FT                   /protein_id="ABG12267.1"
FT                   /translation="MAKVDVKCPFCEQFHPVKKHGPGRTGHQRYRCQACRRSFQLEYEY
FT                   RACHPGMKEQIVDLAMNNAGIRDTARALHISINAVMRTLKNSRRSV"
FT   gene            351963..352331
FT                   /locus_tag="YPA_0300"
FT   CDS_pept        351963..352331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0300"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12268"
FT                   /db_xref="GOA:A0A0E1P1B6"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P1B6"
FT                   /protein_id="ABG12268.1"
FT                   /translation="MWSFVGNKKQQRWLWYAWESRLKRIIAHVFGRRSKKTFRQLLGLL
FT                   SGFNIVFWCTDNFSAYEMLPDEKHIRSKLYTQRIERENLNIRNRLKRLNRKTLGDSKSA
FT                   EMHDRIIGTFIEREHYLV"
FT   gene            352939..353574
FT                   /locus_tag="YPA_0301"
FT   CDS_pept        352939..353574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12269"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P0E3"
FT                   /protein_id="ABG12269.1"
FT                   /translation="MQPAISLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTE
FT                   LKQAVLLLSAPKGIALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVR
FT                   KLGMKLIANQGSITVQAQNDLMELLARKAITITSTEDEIKITVKKRITLNAGGSYITLD
FT                   ENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKAKPPTQKYPFS"
FT   gene            353658..353906
FT                   /locus_tag="YPA_0302"
FT   CDS_pept        353658..353906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0302"
FT                   /product="integrase"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12270"
FT                   /db_xref="GOA:A0A0H2Y4V4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4V4"
FT                   /protein_id="ABG12270.1"
FT                   /translation="MDSPPLRSFFRRLSVECRCTISPHRFRHTIATEMMKSPDRNLKVV
FT                   QTLLGHSSIAVTLEYVEGDIDSLRLALEETFERKEVF"
FT   gene            complement(354159..354234)
FT                   /locus_tag="YPA_r019"
FT                   /note="tRNA-Phe2"
FT   tRNA            complement(354159..354234)
FT                   /locus_tag="YPA_r019"
FT                   /product="tRNA-Phe"
FT   gene            354731..354883
FT                   /locus_tag="YPA_0303"
FT   CDS_pept        354731..354883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3R4"
FT                   /protein_id="ABG12271.1"
FT                   /translation="MVDAETSSPITQACISAGETCAFNDINLPALHQCSALCDVIDMPK
FT                   WQPHT"
FT   gene            354738..357065
FT                   /locus_tag="YPA_0304"
FT   CDS_pept        354738..357065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0304"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12272"
FT                   /db_xref="GOA:A0A0H2Y508"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="InterPro:IPR027568"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y508"
FT                   /protein_id="ABG12272.1"
FT                   /translation="MLRPVHLSLRRVFPPGKRAHLMTSIYRHCISAPHSVMSSICQNGS
FT                   LIPDRLRVSDMTLLKIATSARLASYVETQRGVVYLNQTDFTDVAAVVMSVEDANAGILS
FT                   MLHDLGFAIPAFIAVTAEQTVSADYLPLIKGVITLGEANKAFYNAQVEAAASEYQKNLL
FT                   PPFFSTLKKYVEMNNSTFACPGHQGGEFFRKHPAGRQFFEFYGETIFRSDMCNADVKLG
FT                   DLLIHEGAAKDAQKYAAKVFNADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRNNHKS
FT                   NHHGALIQAGATPVYLETARNPFGFIGGIDAHCFNEDYLRQQLREVAPERAEEARPFRL
FT                   AIIQLGTYDGTVYNARQVVDSIGHLCDYILFDSAWVGYEQFIPMMKDFSPLLLELNEND
FT                   PGIIVTQSVHKQQAGFSQTSQVHKKDNHIKGQKRHCNHKRFNNAFMLHASTSPFYPLFA
FT                   ALDVNAKIHSGDSGRRMWMDCVKLGIETRKSLLARCSMLRPFIPPVVGGKNWQDYATDV
FT                   IANDARFFNFVPDERWHGFEGYNQDQYLVDPCKLLLTTPGIDASTGRYTSFGIPAAILA
FT                   TFLRENGIVPEKCDLNSILFLLTPAENTAKMAHLVDMLVQFERYVEQDAKLCDVLPTIY
FT                   RKNEERYHGYTLRQLCQEMHDLYVSHDVKQLQKDMFRKASFPQVVMNPQDANIQFIRDN
FT                   IELIPIAEAEGRIAAEGALPYPPGVLCVVPGEVWGGAVQRYFLALEEGINLLPGFSPEL
FT                   QGVYIEKGDVSWRRIFGYVITQ"
FT   gene            357621..358580
FT                   /locus_tag="YPA_0305"
FT   CDS_pept        357621..358580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0305"
FT                   /product="putative sugar ABC transporter periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12273"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU87"
FT                   /protein_id="ABG12273.1"
FT                   /translation="MKKRLIGLLLAGVTISMSVSAAEPLKIGFANRTLNGAFFNGLTEY
FT                   MKIHAKEKGYTLITTDARGDLNKQIADVEDMLSQGINYLILNPQDPQAGLRITEIAKRA
FT                   GVPTVILDSDIALEAPVITRVQANNAKNNNLIGEYAVGQFGDKPMNCIFLSGNQGNLVG
FT                   QARRDNFLLGVAEAQLRKYNRTNVNFLSQGWGNWDQQGGLKAMEDIIVAQGDKINCVYS
FT                   EMDDMALGAIRALKAANKLDNVKVYAHDGYKKGLEAVKKGELQATASNNPDLLTSTVLE
FT                   VIGQYQAGQTSFPDYVYIPSILITKDNVDKYYKEDSIF"
FT   sig_peptide     357621..357686
FT                   /locus_tag="YPA_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 22"
FT   gene            358626..360125
FT                   /locus_tag="YPA_0306"
FT   CDS_pept        358626..360125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0306"
FT                   /product="putative sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12274"
FT                   /db_xref="GOA:A0A0E1NVL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVL7"
FT                   /protein_id="ABG12274.1"
FT                   /translation="MDQYAIEVIQVTKSFGGIHALKSINLQIRTGSIHAIIGENGAGKS
FT                   TLMKILSGIYTKDSGRIMIHGEEKNFTSPIHSKESRIGIIYQELALSPDLTVAENIFLD
FT                   DLGFGTGMINWKRLNEKASLILNELGFQIDPRARVGDLSVAYQQMVEIAKSLAKDVNIL
FT                   ILDEPSAVLSGKEVAILFTQLRKLKARGVTIIYISHRLEELMVIADVITVIKDGETVKT
FT                   LDPQSCSEDEIITSMVGRKLESLYPEKNVPGNEVVLEVKALSTRALLHGINLTLHKGEI
FT                   VGLAGLVGAGRSEVARCLFGIDKIAGGTVSKAGTPIQINHPSQAMSHGIGLVPESRKEQ
FT                   GAILVRPIRENMTLSNLKAVSGWMGFIRRRQERETSQKLQQKLAIKLGSVEDPIASLSG
FT                   GNQQKVVIAKWLNTDCHILILDEPTRGVDVGAKAEIYNIIHQLAERGYSILVISSEMVE
FT                   VINLCHRIYVMSEGRITKELQHDEISEENIMRYAIPKRETI"
FT   gene            360206..361141
FT                   /locus_tag="YPA_0307"
FT   CDS_pept        360206..361141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0307"
FT                   /product="putative sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12275"
FT                   /db_xref="GOA:A0A0H2Y4V8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4V8"
FT                   /protein_id="ABG12275.1"
FT                   /translation="MKRTALFLLDNSTTVVFIVMLIAAGFFSDRFYSGDNITNVLRQSV
FT                   PLGLAALGMLFVILTGGIDLSIGSIMAFVSVLVGLLIPEFGLWPALIAGVGIATLMGAF
FT                   SGFLVTWFNIAPFIATLAMMTIARGVALIISKGQPVFIDNDAFVNFGTGYFLGIPLPVY
FT                   VFLGFAIICQLVYKNSVFGRLVVSIGSNETATRFAGIRVNNYKLAVYAISAFACGAAGI
FT                   ISATRTGVGSPVLSIGFELDVIAAVVVGGASLAGGHGNVVNTIIGVFILSIISNLMNLM
FT                   NISGYNQQVVKGVIIIIAVMVQSLKSRSKA"
FT   gene            complement(361224..363368)
FT                   /locus_tag="YPA_0308"
FT   CDS_pept        complement(361224..363368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0308"
FT                   /product="putative hydroxamate-type ferrisiderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12276"
FT                   /db_xref="GOA:A0A0E1P070"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P070"
FT                   /protein_id="ABG12276.1"
FT                   /translation="MNKINMFMLSTFMRSMFMRSTLIPSTFILSTLLLPAVVLAEDTII
FT                   VERNRSQTDSYQATTSVTANRSPANIIDTPQNVTVVTHPVLEDYDVTNLGEALYFVSGI
FT                   TQSNTLGGTQDALIKRGFGNNRDGSILHDGIRSIQARNFTPTSERVEVLKGPSSMLYGM
FT                   NEPGGLINVISKKPQLDPHVHLEANASSFKGGGGQLDVTGPLGESGFAGRLIIDHQETD
FT                   YWRNFGRNRQTVVAPSLDWYGENTTVHLAWERMEYLVPFDRGTVIDPRTGKPVDTPRDR
FT                   RFDESYNATRGDQDTVTFSINHDLNEFWSTQLNYAFSRNSYSDNQARATAFNAETGVLT
FT                   RQSDATANAKSHSQAVQWVVNGDLDWGFTHHQLMFGIDYEARRVFRGDMIRGSKNNGFN
FT                   VYDPIYGTLPPSTAVSAADSDQRENIDSRALFIQDSMRLNEHWLLLGGLRYDSFDVMAG
FT                   KGRPFKKNTDSSDSRLVPRAGVVYNLNDWSSLYVSYTESFKPNVSIATAIDALPPEYGK
FT                   SWEAGYKIDINNRVTGTLAVYDIHKRNIMVSELVDGETVTRTAGKARSRGLELDMAGKV
FT                   TDSLSLIGSYAYTDARLTEDPDNNGNDLPNVARHTAALFLSRDFGSTSLISGDEVKAGI
FT                   GARYVGKRAGDAANSFWLDNYTVADAFIAWKMPLSGYQLKWQLNVKNLFDKTYYPSSAN
FT                   NLRIAIGEPRQVVLQGSIDF"
FT   sig_peptide     complement(363246..363368)
FT                   /locus_tag="YPA_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 41"
FT   gene            complement(363361..364461)
FT                   /locus_tag="YPA_0309"
FT   CDS_pept        complement(363361..364461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12277"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ90"
FT                   /protein_id="ABG12277.1"
FT                   /translation="MRLLLLIFLLCTWAVSAKTITDITGQRIEIPDNPQRIVLGESRML
FT                   YTLALLEPGYPAARVVGWPLDLKKYDPQSWALYTDKFPQMTHIPALGSTGLRDINPEKV
FT                   LELAPDLVILPVLAKTTHEEIALISLLKQAHIPVIRVDLRVDLLNHTIPSLRLLGEALN
FT                   RQDRAEAFISLYQSHMDRIHQRIAAYQGPHPSVLLQLHLGRGDECCTTTLKGNLGQLLE
FT                   FAGGNNIAAAQVKGVFGQLSEEYVLARSPEIYIATGMATAGSQAKTLALGPQVSTAQAQ
FT                   ESFRRVIATQSKLQHLPAIQNGHAWGLWHNFYLSPLHVVAAEFFAKTLYPHLFADVSPQ
FT                   DTLQTIYQQFLPLDFTGTFWSHLDNE"
FT   sig_peptide     complement(364408..364461)
FT                   /locus_tag="YPA_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.844 at
FT                   residue 18"
FT   gene            complement(364743..365831)
FT                   /locus_tag="YPA_0310"
FT   CDS_pept        complement(364743..365831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0310"
FT                   /product="membrane-bound lytic murein transglycosylase C"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12278"
FT                   /db_xref="GOA:Q1CB94"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB94"
FT                   /protein_id="ABG12278.1"
FT                   /translation="MACKMKKILALLVIAPLLVSCSGNKNQVENEVFVKDTNGFEILMG
FT                   QFAHNIENIWGLKEVLIAGPKDYVKYTDQYQTRSHINFDAGTITIETIATTNPAAHLRQ
FT                   AIITTLLMGDDPGSIDLYSDVNDIQISKEPFLYGQVLDNNGEPIRWEWRAAHFADYLLQ
FT                   NKMQTRTSGLHVISFVTIQLVPNHLDKRAHKYLPLVRKSAARYGVEESLILAIMQTESS
FT                   FNPYAVSRSDALGLMQVVQHTAGKDVFKLKGKSGQPSRSYLFDPENNIDAGTAYLSILQ
FT                   NTYLGGIQNATSRRYAVITSYNGGAGSVLRVFHSDKNKAVGIINTMSPGDVFQTLTTKH
FT                   PSGESRRYLVKVNSAQKNYRRY"
FT   sig_peptide     complement(365754..365831)
FT                   /locus_tag="YPA_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.522 at
FT                   residue 26"
FT   gene            complement(366002..366274)
FT                   /locus_tag="YPA_0311"
FT   CDS_pept        complement(366002..366274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12279"
FT                   /db_xref="GOA:Q1CB93"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB93"
FT                   /protein_id="ABG12279.1"
FT                   /translation="MSRTIFCTFLKKDAERQDFQLYPGEIGKRIYNEISKEAWSQWITK
FT                   QTMLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPPSK"
FT   gene            complement(366452..367570)
FT                   /locus_tag="YPA_0312"
FT   CDS_pept        complement(366452..367570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0312"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12280"
FT                   /db_xref="GOA:A0A0E1NVR9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVR9"
FT                   /protein_id="ABG12280.1"
FT                   /translation="MMQAQQFAHVVLDWYQHFGRKTLPWQLDKTPYQVWLSEVMLQQTQ
FT                   VATVIPYFQRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGE
FT                   FPTTFDQILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEG
FT                   RLWQISEDVTPANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPG
FT                   KKPKQTLPEKTAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIP
FT                   ANETQQLTAFRHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVER
FT                   LLHQLLKDPLAKDELTQQQLTKQSPTQPALFD"
FT   gene            367905..368624
FT                   /locus_tag="YPA_0313"
FT   CDS_pept        367905..368624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0313"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12281"
FT                   /db_xref="GOA:Q1CB91"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB91"
FT                   /protein_id="ABG12281.1"
FT                   /translation="MINDVISPEFDENGRALRRIRSFVRRQGRLTKGQQLALDSYWPVM
FT                   GVEYQAAPVDLNTLFGREAPIVLEIGFGMGTSLVTMATNNPQQNFLGIEVHSPGVGACL
FT                   SSAHDAGLSNLRIMCHDAVEVLENMIPEASLDMVQLFFPDPWHKARHNKRRIVQTPFVE
FT                   LVKSKLKVGGVFHMATDWQPYAEHMLEVMSGVSGYLNLSEQNDYVPRPDSRPLTKFELR
FT                   GQRLGHGVWDLMFERKE"
FT   gene            368624..368950
FT                   /locus_tag="YPA_0314"
FT   CDS_pept        368624..368950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12282"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPI4"
FT                   /protein_id="ABG12282.1"
FT                   /translation="MAKNRSRRLRKKMHIDEFQELGFSVQWAFDEGTSVDVIDETVDAF
FT                   IDEVIEANGLAFDGSGYLQWEGLICLQEIGHCTDEHRALVTKWLEARKLKNVETSELFD
FT                   IWWD"
FT   gene            369061..369987
FT                   /locus_tag="YPA_0315"
FT   CDS_pept        369061..369987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0315"
FT                   /product="L-glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12283"
FT                   /db_xref="GOA:A0A0E1NYL4"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYL4"
FT                   /protein_id="ABG12283.1"
FT                   /translation="MVTTLDNALLNDILQQVRPLIGQGKVADYIPALAEVPANKLGIAV
FT                   CTLDGQIFQAGDADERFSIQSISKVLSLTLALSRYSEQDIWQRVGKEPSGQPFNSLVQL
FT                   ELEKGKPRNPFINLGALVVCDMLQSRLSAPKQRLLEVVRQLVKDDSISYDPRVARSEFE
FT                   HSDRNAAIAYLMKSFGNFDNDVLTVLQTYFHYCAMRMSCVELARCFVYLANQGRSISGS
FT                   ESLITPMQARQINALMITSGMYDGAGEFAFRVGMPGKSGVGGGIIAIVPDEFCIAVWSP
FT                   ELDHAGNSLAGTAALERLAQQMGRSIF"
FT   gene            370099..370629
FT                   /locus_tag="YPA_0316"
FT   CDS_pept        370099..370629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12284"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVF3"
FT                   /protein_id="ABG12284.1"
FT                   /translation="MLHKIKVLRTAGLALLMLTAGQAQAEYQCSVKPQDDVIISPQSVQ
FT                   IVGASGNLQISPDGDVTRNGKTLTLTDAQRQQAFRYQTALRKDLPWIDQGAQQRLEKAR
FT                   VSLDKVIVQQLGSSSNVRNRLTTLSEQLKQQMARIIEKRSDGLAFHHQAIAQVEKEAVS
FT                   WSSRAWVACCRIA"
FT   sig_peptide     370099..370176
FT                   /locus_tag="YPA_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 26"
FT   gene            370587..370832
FT                   /locus_tag="YPA_0317"
FT   CDS_pept        370587..370832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12285"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y518"
FT                   /protein_id="ABG12285.1"
FT                   /translation="MVQQSMGGVLQDSLNEMGVKQATSSGNNPLQAILGNLGGLQQAIK
FT                   NEWNEQEQDFQQFGREVCGRVTTLEQQRIALLKSLE"
FT   gene            371331..380663
FT                   /locus_tag="YPA_0318"
FT   CDS_pept        371331..380663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0318"
FT                   /product="putative virulence determinant"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12286"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR020974"
FT                   /db_xref="InterPro:IPR038383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2W7"
FT                   /protein_id="ABG12286.1"
FT                   /translation="MPNGNEMAGFYIDKLSLSQRLSIVSETYDRVNKNNKKEKLKYSYD
FT                   DIEMIKKRFVKYIDAQLYSLIREGLSVPATLTQEEKIKITDLAIDAALFNDYERFNELI
FT                   IYISSLGISVTPPLPQEEGGSRLYIYFSGDIHAYMDVWRGDLLLGSGTELSDIQSITGL
FT                   RFMIDMAESLKLNIINPADKAMVDLINHLRYEMISYASSFCATYSAERGGTVYLSSPDG
FT                   LRINNYFWNSELPVLRALQKKGLIGDIRILHKPLEFYKDTPLDELGDLLTAKDISMTVE
FT                   YQFLPVWLQEKLLVDIYQQWLDEEFQPSLLAVRKEIINTIDIDRHAPEVELLRYFLRKI
FT                   HEQLDEITEFKVLKEAERIDSIKKKLAVGSEIESWLDNVPAIDVNERKIILESLLQKES
FT                   LLFSNVRDIKKSIIPLDFNSDVININTSLLKNTFIPFNLLRESWDVIISDRSLVEGTLT
FT                   IHFSVGRKIMIKVDANRNQLKQMATLERFLLANFTPRNTPQDLKIIDNVIMSGDVVLAE
FT                   RRDDKGWHNDQQMIEKVKLSEFDYFLKSNDLGVKINDNGFVLYLISDPEDNRDVIIKPN
FT                   DDYNLKSIKDFIENNYLFFDDVPEYLIVKKNVENKECIFAHDEGETYQVAYRDGEAWVL
FT                   LSKMNTSDQIKNLNEITMSVNLNNAESRSVALILSLLNKHARLVSILPDTHPKVMENFL
FT                   DIDSLLKNSTHPFEHPLYRKLLNSISNDINKYMESLNEIKDSYHLLPFDVRPGQYMNTW
FT                   SKIDRDTVIEYSFKQNDKNHHLQFIVLLQDDSLSKRVGEIIASYNNNKSIVLQFDARSS
FT                   EARIAYGTQNNITEMGKFELSFVTHGTTDGVYSFSVANVIEIYKLTINSFALPPPVKIR
FT                   LVICSIADNGQGAQGFNGTHPALGIVNMMHQEGFDIPILAYTTKVGVSVEHPGELVVFN
FT                   SEKPGEVLKNIDDYQVLYHYKNNILLTDGVPVVELLLKDVRNKIKSVDQLIESYSQYLV
FT                   PFFSDDNGVVDRELLELTINDFDTYSKFENFLDIIRQRPELRNSDNWQLVVANNATGFL
FT                   ITTLDEPVVKYPDIVKVNEWDLPAIANIDKTATASQYDMQIVFQCENNPTVNRAATRLA
FT                   GKHAKNSIIIQLDVDNNHRAFIIDDNTHAEWREISHNELVTKLKIQPENGKIRWQVVGH
FT                   GRSEGGNDKHPTLAGQRPEQLTARLNQFSDYLQTEHQINISPQQVSLVGCAMSSSDRYT
FT                   SFAHKFMSHLNENGIRTNVSASTKAIEVDPQGHKHDVDTPDIDSYNNKYLSSIKGTEKL
FT                   YWNRWGEITTERKKDINGRLNNIDSLLDKLITRQLSVNQLNKKQQRKLAEIFPQLTDKK
FT                   LNKGELLLTLHDSWRMQALKYDLLFLQKISDRPDFDTELWRVTDRWRITETDGNTLQDV
FT                   RIKSGSQHKTDLATYPHSITSDPDLKTSAPELKTSNPKARTAIFGRFGYGMQGYGFISA
FT                   LRLSADYQRWMSNGDLTEKQEEEIQLQLAMAWGGIGANLATDGLQYAFGKWGIGYLQKL
FT                   VSKGGRLSPALLSQLTLLKRNPALLLAPGFLKDLRKLALNQFAHGAARFSMPLLSALTS
FT                   GIDIYQAYHAFSQLATETDPHVRRDLIASGVFSTINATIGLGVAFAMAMGGTAATAAGP
FT                   AGIALAFTMIIVGDIYSAVSQIERIRDIVPDMTGSQRFENGLRLFLKFGLTPGLDNQIR
FT                   YNQTMESVYQRQRDYYEALLASKQGVDTLFYSRGEAVLKAIPFIKRDERSQTERDLEKI
FT                   SIFSGDPFTNAKIYTTYAEMGKHEYYELDKINDVDDYVIADFFEDNNRSVVKLQNKNLH
FT                   QAFSELDIDSTYSPFILSADVDRNGLNDFIVINEKYNTTIASRKNSVGMTVIDDYVSRW
FT                   HYELYTWLAQPDGSYLKIDTRLEWEKLFHAIEVDKFNEVVFPVLGDFNGDNVFELVIFH
FT                   DDKMTTYHYDSLDFNQSGKDNHNVINIGDFIEPVRLAFEGEKSKNYPYSLVGDINNDGF
FT                   DDILLLNKSGDMLHLMGNSSGVFRQHKTKLSSELTSLLSSSNLHRSQLQLTDLNKDGGL
FT                   DLVIILNDGIYYQALGDKIDGEYHFDTPSMVNKITIKNEGGDSVRYQQNRLSQIDKHKI
FT                   IAISPSDQGENRLISLSDSGELLAHPLREIKENDVAALFDLGGGDDVAKGYHKKKNIFT
FT                   IGSGFKQYQGGENADTFILTSAVASKSHILSGGEGNDTVALGEVLGNEIDSIIDISNGY
FT                   YSQVNGGVEKQVALLYDFENILGHENVNDTIIGNDVDNYLNGMGGDDKIWGNGGNDLLA
FT                   LQSGLAQGGTGLDSYHILKSTHEKSLQIRIEEVSENNNTDMQISNIFLEHKLNQIKSIE
FT                   LDNIDVLININNDNGFMTQIRLVGVYNINNNQKQQVLNFTIQTVDGFTMVPLWPSYLNE
FT                   ITEFSPNMVAYYSSLVDRNYKELVGKGDPDDIVVRFSLDNGYQQQQVTHLQRVEGEKDI
FT                   VLRQAILPDFIRLSPQEHSMLMGFLPRYELLGDNKDNLLQVLSGEGLLEGRGGQDTYLI
FT                   QEKEGSPTDIIINNFDDSLASDNLVLSSWLLCDVIVERSDDDLLLRYRDQPEKHQSIRL
FT                   VNYMNDERYRHLKITDKSGQSQYRDPVTGTFIDYQINLDKNGHPFIAAQQAPVVSSGND
FT                   EVVITSATFLPGNYIDTGDGNDAIIYIRGHEGTMLKGGGGDDTYYYSAGSGAINIADTS
FT                   GLDHLYLDKHILLHTLSAERRENNLVLNIADNTSGRIIFVDWYLADENKVEFIWVEDSQ
FT                   ITFDELFSLRPYSDEYYQLCQHLKSMGLSLTVRQLADLDSQDGYNTLNQLRTIKAWVTK
FT                   NPIYDVADLDYLVAMSSIAWRGNARNTDPLPLIEQKIDAFFQPLIAERISLTEEHVTWI
FT                   QREEFDTVDIAKWVKNYHLRSQNEINYLLEQLGLLKESPLSDKALDFTFKNRIDLAQAD
FT                   IELCQQECGINRQSLINLAMKYHVTGRGHFELLISNIQVLKEYGVVVSESEQPLVLRKP
FT                   IDLRQYFNQKNLTKDHVGRLAEHDMSFDELTLLLDKNIPIEQAFTQRLQTQLGPLKLFN
FT                   DERVFNKGDVFDQDISQLAEAMGGLESTESYSLPLERQTVMAITTHQFVSDSIAAY"
FT   gene            complement(380853..381995)
FT                   /locus_tag="YPA_0319"
FT   CDS_pept        complement(380853..381995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0319"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12287"
FT                   /db_xref="GOA:A0A0H2Y452"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y452"
FT                   /protein_id="ABG12287.1"
FT                   /translation="MRCAMLKLPPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVE
FT                   HVLADLDADVPLVSGREISTIFIGGGTPSLLSAEAMQQLLDGVRARLPVASDAEITMEA
FT                   NPGAVEADRFSGYQRAGINRISIGVQSFSAQKLTRLGRIHGPDEARRAAELATSLQLRS
FT                   FNLDLMHGLPDQTLEEALDDLRQAIALNPPHLSWYQLTIEPNTGFSSRPPILPDDDALW
FT                   DIFQQGHQLLSAAGYLQYETSAYAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFNDGR
FT                   ILRTIKTKHPRGFMQGKYLDKQYEVAAVDRPFEFFMNRFRLLEAAPRADFYHFTGLTES
FT                   TIRPQLDEAIAKEYLIETTEYWQITEKGKLFLNSLLELFL"
FT   gene            complement(381976..382569)
FT                   /locus_tag="YPA_0320"
FT   CDS_pept        complement(381976..382569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12288"
FT                   /db_xref="GOA:A0A0E1NXJ4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXJ4"
FT                   /protein_id="ABG12288.1"
FT                   /translation="MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLT
FT                   FIENAILKARHAAQTTGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLV
FT                   ALQNVPDEKRGAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVP
FT                   ALGKTAAELTREEKHAVSHRGQALKLMLDALRDA"
FT   gene            complement(382669..382959)
FT                   /locus_tag="YPA_0321"
FT   CDS_pept        complement(382669..382959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12289"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB83"
FT                   /protein_id="ABG12289.1"
FT                   /translation="MSAVLSTENGLILKLYIQPKASRDQIVGLHGDELKVAITAPPVDG
FT                   QANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTILLE"
FT   gene            complement(382956..383510)
FT                   /locus_tag="YPA_0322"
FT   CDS_pept        complement(382956..383510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0322"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12290"
FT                   /db_xref="GOA:A0A0E1NZU9"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZU9"
FT                   /protein_id="ABG12290.1"
FT                   /translation="MLTLTFLAKTVIDLYVMVLLLRIWMQWVHSDFYNPLSQFVVKITQ
FT                   PIVGPLRRVVPSMGPIDSASLLLAFLLMTIKYPLLLLIDSGSLSLSIYNLLFGLIALVK
FT                   AVGYLIFWVMIIRALMSWISQGRSPVDYLLLQLTEPLMAPIRRILPAMGGIDFSAMVVI
FT                   LILYLLNFLGMDLFGAMWVML"
FT   gene            complement(383798..384619)
FT                   /locus_tag="YPA_0323"
FT   CDS_pept        complement(383798..384619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0323"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12291"
FT                   /db_xref="GOA:A0A0E1NSU5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSU5"
FT                   /protein_id="ABG12291.1"
FT                   /translation="MQHRNITFIGAGNMARAIIAGLVAGGYPAKMISVCAPSAKNRDAL
FT                   ATEFGVISSDDNIRESQKAEVVVLAVKPQLMADVCQQLQKQVDFSDKLVLSIAAGVQVA
FT                   RFYALLGNKLNLVRIMPNTPSLVGKGMSGLYAPEQVSAADRDFTTELMSAIGKVCWVDN
FT                   EDGINSIIAAAGSSPAYFFLFMEAMQQETERLGFDSETARQLVQQAASGACALVEANPH
FT                   VPLSALREQVTSKGGTTAEAIRVFNEQHLPEMVANAMRAAIARAKEMEKLF"
FT   gene            complement(384752..385450)
FT                   /locus_tag="YPA_0324"
FT   CDS_pept        complement(384752..385450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12292"
FT                   /db_xref="GOA:A0A0E1NTA5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTA5"
FT                   /protein_id="ABG12292.1"
FT                   /translation="MSTIQQNLQDVRARIATAAHNCGRSPEEVTLLAVSKTKPVAAIEK
FT                   AIAAGQYAFGENYVQEGVDKIHSFVDNKTLEWHFIGPLQSNKSRLVAENFAWCHTVDRL
FT                   KIAQRLSAQRPAAMPALNVLIQINISDEQSKAGISLSELPALADSISTLPNLCLRGLMA
FT                   IPAPEHDYQRQLAVFTQMNQAFLTLKARYPQIDTLSMGMTDDMDAAISAGSTLVRIGTA
FT                   IFGARVYNAD"
FT   gene            385470..386594
FT                   /locus_tag="YPA_0325"
FT   CDS_pept        385470..386594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12293"
FT                   /db_xref="GOA:A0A0E1NTF7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF7"
FT                   /protein_id="ABG12293.1"
FT                   /translation="MDFTSLNNQHSDLNNPVFSRIKAKRIDLENPDLASDGFNKQDFAN
FT                   KVAASVDHNASDLHLCTGFHPVLRIDGELKTFTDWPKVTAGWLNGLRRHMLSDAQESRL
FT                   QQQGQVDCAYTTVGSQRLRANIFQQRQGQSIAFRIIPAICPSLTQLAAPPILNQLIQQD
FT                   NGLILVTGATGSGKSTTLSAMISAINQQQARHIITLEDPIEFIHSSQSCLIQQRELGRH
FT                   THCFSRALNGALRQDPDIILLGELRDLETIRLALTAAETGHLVLATLHTRTATQAIDRL
FT                   IDVFPPEEKAVIRTQLAASLRGVITQKLCRQNGGGRIAVFEILTQTTAVSHLIREGKTY
FT                   QLPTVIQAGGQWGMQTFEQSIAQRQKQGVLAINH"
FT   gene            complement(386703..387818)
FT                   /locus_tag="YPA_0326"
FT   CDS_pept        complement(386703..387818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12294"
FT                   /db_xref="GOA:A0A0H2Y4X0"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4X0"
FT                   /protein_id="ABG12294.1"
FT                   /translation="MSVQDTMLQQQALPGTPRQDGFFMPAEWAPQDAVWMLWPYRQDNW
FT                   RGKAIPAQQTFAKVAEAISRATPVFMGVPAEFMAQAKATMPANVTLVEMASDDAWMRDT
FT                   GPTMVINGAAERRAVDWQFNAWGGLNGGLYADWQQDEKVAVQVSDFLKNAHYSAPLILE
FT                   GGSIHTDGEGTLLTTAECLLNPNRNPHLNQAQIEQLLCDYLGVTHFIWLQDGVYNDETD
FT                   GHIDNMCCFVRPGEVALHWTDDQQDPQYARSVAAFEVLSNTVDAKGRKLKIWKLPAPGP
FT                   LYNTEEETFDVLTSDAVPRTAGERLAGSYVNFLISNQQIIFPLLDSRTDGQANDLLQQM
FT                   FPGYAIVGVPAREILLGGGNIHCITQQIPAA"
FT   gene            complement(387822..388706)
FT                   /locus_tag="YPA_0327"
FT   CDS_pept        complement(387822..388706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0327"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12295"
FT                   /db_xref="GOA:A0A0E1NUA1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUA1"
FT                   /protein_id="ABG12295.1"
FT                   /translation="MTKVTVAATQMACSWDLPKNIENAEKLVRQAHAKGAQIILIQELF
FT                   AAPYFCIDQSPEHYALAQELDNSPLIKHFSKLAAELEVVLPLSFFEKANNAYYNSLVMI
FT                   DADGSVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKVGVGICWDQWFPETAR
FT                   SLALLGAEVIFYPTAIGSEPAYPEIDSQPHWTRVQQGHAAANLVPVIASNRIGTEKSKY
FT                   IDGLEMTFYGSSFIADQTGALLAQANKTDEAVLVHEFDLQEIAAQRASWGLFRDRRPEM
FT                   YQTLATSDGKTRR"
FT   gene            complement(388886..389308)
FT                   /locus_tag="YPA_0328"
FT   CDS_pept        complement(388886..389308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12296"
FT                   /db_xref="GOA:Q1CB76"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB76"
FT                   /protein_id="ABG12296.1"
FT                   /translation="MANRTIIAFDFGTKSIGVAIGQEVTGTARALTAFKAQDGTPDWQQ
FT                   VEKLLKEWQPNLVVVGLPLNMDGTEQPLTARARRFANRLHGRFGVQVALQDERLSTVEA
FT                   RANLFDRGGYRALDKGSVDAASAVIILESWFDEQAG"
FT   gene            complement(389308..389871)
FT                   /locus_tag="YPA_0329"
FT   CDS_pept        complement(389308..389871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12297"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB75"
FT                   /protein_id="ABG12297.1"
FT                   /translation="MNLQHHFLIAMPSLQDPQFKRSVIYICEHGEKGAMGLVINKPLEQ
FT                   LTVETILEKLKIKSPSRDPAIRLDNVVLAGGPLAEDRGFILHSPQEGFASSIHISPETM
FT                   ITTSKDVLETLGTSGQPKNLLVALGYASWRQGQLEQELLDNVWLTTEADTHILFNTPIA
FT                   ERWQAAANKLGINIFNIAPQAGHA"
FT   gene            complement(389987..390946)
FT                   /locus_tag="YPA_0330"
FT   CDS_pept        complement(389987..390946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0330"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12298"
FT                   /db_xref="GOA:A0A0E1NRQ0"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRQ0"
FT                   /protein_id="ABG12298.1"
FT                   /translation="MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMGDLYM
FT                   RGGDGRARTRRLNVKQDKDNWFSFGAEQDLPLYDLDVILMRKDPPFDTEFIYATYILER
FT                   AEDKGTLVVNKPQSLRDCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLD
FT                   GMGGTSIFRVKQDDPNLSVIIETLTELSSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYC
FT                   LARIPAQGETRGNLAAGGRGEARPLSESDWEIARTVAPILKQKGLIFVGLDIIGDRLTE
FT                   INVTSPTCVREIEAAFPEISITGMLMDAIERRLADKKA"
FT   gene            complement(390972..391703)
FT                   /locus_tag="YPA_0331"
FT   CDS_pept        complement(390972..391703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12299"
FT                   /db_xref="GOA:A0A0E1NLQ1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLQ1"
FT                   /protein_id="ABG12299.1"
FT                   /translation="MRIPRIYHPQPLQANTELALTDEAANHVGRVLRMTEGQSLQLFDG
FT                   SNQIFDAEIIRADKKNLIVRLAEGQWEDRESPLNLHLGQVISRGEKMEFTVQKSIELGV
FT                   NVITPLFSARCGVKLDGERLTKKIQQWQKIAIAACEQCGRNTIPEIRDAMQLADWCAES
FT                   DDSLKLNLHPRASNSINTLPSSLNKVRLLIGPEGGLSADEIAMTSRLGFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   gene            391744..391911
FT                   /locus_tag="YPA_0332"
FT   CDS_pept        391744..391911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y464"
FT                   /protein_id="ABG12300.1"
FT                   /translation="MMSTARNKRKINKQLRIAEAGKFQPIENCSPSGNSTTSSENNTTS
FT                   SENNDIRDKV"
FT   gene            complement(391955..392662)
FT                   /locus_tag="YPA_0333"
FT   CDS_pept        complement(391955..392662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0333"
FT                   /product="endonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12301"
FT                   /db_xref="GOA:A0A0E1NT55"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT55"
FT                   /protein_id="ABG12301.1"
FT                   /translation="MLRNILFLLVLSSPLLPLISHSHGINNFSQAKAVAAKIHQDAPGS
FT                   FYCGCQIDWQGKKGIPDLNSCGYQPRKNAARAARIEWEHVVPAWQFGHQRQCWQQGGRK
FT                   NCAKDPVYRQIETDLHNLQPAIGEVNGDRNNFMYSQWNGGSGQYGQCAMKVDFKNKLAE
FT                   PPVRARGAIARTYFYMRDQYQLRLSSQQSKLFGVWDRQYPVTDWECLRDERIAKTQGNH
FT                   NPYVQRACQRPKS"
FT   sig_peptide     complement(392594..392662)
FT                   /locus_tag="YPA_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.937 at
FT                   residue 23"
FT   gene            complement(392760..393317)
FT                   /locus_tag="YPA_0334"
FT   CDS_pept        complement(392760..393317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12302"
FT                   /db_xref="GOA:A0A0H2Y3T3"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3T3"
FT                   /protein_id="ABG12302.1"
FT                   /translation="MSACIWLSTVLFFRIMSTLRIPIALQQAVMQCLRHYLQLANQHLG
FT                   TAYPEPKVNYHQRGTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYRQF
FT                   GRVAPHGKEWRWMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHALTIRRHNKVLR
FT                   GESEYRCRQCGEKLQFITINPD"
FT   gene            complement(393465..394619)
FT                   /locus_tag="YPA_0335"
FT   CDS_pept        complement(393465..394619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0335"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12303"
FT                   /db_xref="GOA:Q1CB69"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB69"
FT                   /protein_id="ABG12303.1"
FT                   /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVLVGGEVTTNAWVDIEEITRRTIREIGYVHSDMGFDANSCAVLSAIGKQSPDIN
FT                   QGVDRENPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAEVRKNGALPWLRP
FT                   DAKSQVTFQYDDGKIVGIDAVVLSTQHSEDINQKDLHEAVMEEIIKPVLPAEWITAHTK
FT                   YFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVEAFGTEKIPADQLTLLVREFFDLRPYG
FT                   LIKMLDLLHPIYRETAAYGHFGREHFPWEKTDKAALLRDAAGLK"
FT   gene            395826..397805
FT                   /locus_tag="YPA_0336"
FT   CDS_pept        395826..397805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0336"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12304"
FT                   /db_xref="GOA:A0A0E1NRC2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRC2"
FT                   /protein_id="ABG12304.1"
FT                   /translation="MSDDNLISRPLTAGAHVSLRSMQEVAMNDRNASKMLSTYNVAYWG
FT                   GNYYDVNELGHISVCPDPDIREARVDLAQLVKKMQLEQGQRLPALFCFPQILQHRLRSI
FT                   NAAFKRARESFGYEGGYFLVYPIKVNQHRRVIESLVNSGEPLGLEAGSKAEMMAVLAHA
FT                   GMTRSVIVCNGYKDREYIRLALIGEKLGHKVYLVIEKMSEIKMVLEEAERLNVVPRLGV
FT                   RARLASQGSGKWQASGGEKSKFGLSATQVLQLVDMLREANSLESLQLLHFHLGSQLSNI
FT                   RDISTGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNV
FT                   IWGIGDACNEHGLPHPTVITESGRAVTAHHTVLVSNVIGVERNEFCEPQPPEAGAPRAL
FT                   ESLWDTWQEMQEPENRRSLREWLHDSQMDLHDVHTQYAHGMLDLTHRAWAEQLYLSICN
FT                   EIQKQLDPSNRAHRPIIDELQERMADKLYVNFSLFQSMPDAWGIDQLFPVLPLEGLDKP
FT                   PERRAVLLDITCDSDGTIDHYIDGDGVATTMPMPPYDPENPPLLGFFMVGAYQEILGNM
FT                   HNLFGDTAAVDVYVFPDGTVEVEQTDEGDTVADMLEYVQLNPEKLLEHFRGQVKETDLD
FT                   TELQAQFLEEFEAGLYGYTYLEDE"
FT   gene            398006..398464
FT                   /locus_tag="YPA_0337"
FT   CDS_pept        398006..398464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0337"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12305"
FT                   /db_xref="GOA:Q1C048"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C048"
FT                   /protein_id="ABG12305.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            398675..398995
FT                   /locus_tag="YPA_0338"
FT   CDS_pept        398675..398995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0338"
FT                   /product="putative Rieske protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12306"
FT                   /db_xref="GOA:A0A0E1NNC1"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNC1"
FT                   /protein_id="ABG12306.1"
FT                   /translation="MGWFSVCKVNDIKPDFPFSAQAGNNRVGIYLVEGEYFAMEDICPH
FT                   AYALLSQGINDGEIIECPLHGALFNVRTGQCLREPGDRDLNTYAVRINGDQIDVNLDGD
FT                   GE"
FT   gene            complement(399285..400064)
FT                   /locus_tag="YPA_0339"
FT   CDS_pept        complement(399285..400064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0339"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12307"
FT                   /db_xref="GOA:A0A0H2Y4Y0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4Y0"
FT                   /protein_id="ABG12307.1"
FT                   /translation="MANPQEERVMKIRTSMIALSLAALLSGCQSLNTEGLMQSGAQAFQ
FT                   AATLNDADVKALSEKSCVEMDQKAQIASADSQYGKRMAKIAAALGDNINGTPANYKVYV
FT                   TKDVNAWAMANGCIRVYSGLMDMMTDNEVEGVVGHEMGHVALGHTRKAMQVAYGTTALR
FT                   TAIASAGGVVGTLSQSQLADLGEKLVNAQFSQKQESEADDYSFDLLKKRGIDPNGLVTS
FT                   FEKLASMEAGRNSSMFDDHPSSQARAEHIRQRIAAEK"
FT   sig_peptide     complement(399963..400064)
FT                   /locus_tag="YPA_0339"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.656 at
FT                   residue 34"
FT   gene            400528..402522
FT                   /locus_tag="YPA_0340"
FT   CDS_pept        400528..402522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0340"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12308"
FT                   /db_xref="GOA:A0A0E1NUW7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUW7"
FT                   /protein_id="ABG12308.1"
FT                   /translation="MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDYL
FT                   NHNPTNPHWADRDRFVLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEYG
FT                   YTAGVETTTGPLGQGIANAVGFAIAERTLGAQFNRPGHDIVDHHTYAFMGDGCMMEGIS
FT                   HEVCSLAGTMKLGKLTAFYDDNGISIDGHVEGWFTDDTAARFEAYGWHVVRGVDGHNAD
FT                   SIKAAIEEAHKVTDKPSLLMCKTIIGFGSPNKAGTHDSHGAPLGEAEVAATREALGWKY
FT                   PAFEIPQDIYAAWDAKEAGKAKEAAWNEKFAAYAKAYPELAAEFKRRVSGELPANWAVE
FT                   SKKFIEQLQANPANIASRKASQNALEAFGKVLPEFLGGSADLAPSNLTIWSGSKSLSDD
FT                   LAGNYIHYGVREFGMSAIMNGIALHGGFIPYGATFLMFVEYARNAVRMAALMKIRSVFV
FT                   YTHDSIGLGEDGPTHQPVEQMASLRVTPNMSTWRPCDQVESAVAWQYALERKDGPSALI
FT                   FSRQNLAQQPRTAEQLANIAKGGYVLKDCAGQPELILIATGSEVELAVAAADQLTATGR
FT                   KVRVVSMPSTDAFDKQDAAYRESVLPSAVSARVAVEAGIADYWYKYVGLNGAVVGMTTF
FT                   GESAPAELLFKEFGFTVENVVAKAQALLK"
FT   gene            402829..403287
FT                   /locus_tag="YPA_0341"
FT   CDS_pept        402829..403287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0341"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12309"
FT                   /db_xref="GOA:Q1C0I9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C0I9"
FT                   /protein_id="ABG12309.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            403628..404644
FT                   /locus_tag="YPA_0342"
FT   CDS_pept        403628..404644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0342"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12310"
FT                   /db_xref="GOA:Q1CB62"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB62"
FT                   /protein_id="ABG12310.1"
FT                   /translation="MAIRIAINGFGRIGRSVLRALYESGRRAEISVVAINELASAEGMA
FT                   HLLKYDSSHGRFAWDVRQECDSLYVGDDIIRLIHQSEIEQLPWSELGIDVVLDCSGVYG
FT                   SREDGEAHVASGAKKVLFAHPGGHDLDATVVYGVNHQDLRAEHRIVSNASCTTNCIIPI
FT                   IQLLDIAYGIESGTVTTIHSSMNDQPVIDAYHQDLRRTRAASQSIIPVDTKLAAGITRI
FT                   FPKFCDRFEAISVRVPTINVTAIDLSVSVTHPVGVAEVNQLLQKAARGAFRGIVDYTEL
FT                   PLVSMDFNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAKSGF"
FT   gene            404747..405910
FT                   /locus_tag="YPA_0343"
FT   CDS_pept        404747..405910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0343"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12311"
FT                   /db_xref="GOA:Q1CB61"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB61"
FT                   /protein_id="ABG12311.1"
FT                   /translation="MSVIKMTDLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIE
FT                   AALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKEKLSSPVRLAKDYLDGVEIAAG
FT                   ELVVLENVRFNKGEKKDDEALSKKYAALCDVYVMDAFGTAHRAQASTHGVGKFAPIACA
FT                   GPLLSAELEALGKALGNPARPMVAIVGGSKVSTKLTVLGALSKIADKLIVGGGIANTFV
FT                   AAQGHNVGKSLYEADLIPEAKRLLETCDIPVPTDVRVATEFSETAAATLKPANEIKDDE
FT                   QILDLGDESAERLAEILKNAKTILWNGPVGVFEFPNFRKGTEIVARAIAESEAFSIAGG
FT                   GDTLAAIDLFGIADQISYISTGGGAFLEFVEGKKLPAVVMLEERAKQ"
FT   gene            406030..407109
FT                   /locus_tag="YPA_0344"
FT   CDS_pept        406030..407109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0344"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12312"
FT                   /db_xref="GOA:A0A0E1NYS5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYS5"
FT                   /protein_id="ABG12312.1"
FT                   /translation="MSKIFDFVKPGVITGDDVQKVFAVAKENNFALPAVNCVGTDSINA
FT                   VLETAAKVRAPVIVQFSNGGAAFIAGKGVKTDAPQGAAILGAISGAHHVHQMAEHYGVP
FT                   VILHTDHCAKKLLPWLDGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSKYLT
FT                   RMSKIGMTLEIELGCTGGEEDGVDNSHMDASSLYTQPQDVDYAYEKLNAISPRFTIAAS
FT                   FGNVHGVYKPGNVKLTPTILRDSQDYVSKKHNLPHNSLNFVFHGGSGSTAEEIKEAVSY
FT                   GVVKMNIDTDTQWATWEGILNYYKKNEGYLQGQLGNPEGADKPNKKYYDPRVWLRAAQV
FT                   TMITRLELAFKELNAIDVL"
FT   gene            407547..408416
FT                   /locus_tag="YPA_0345"
FT   CDS_pept        407547..408416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0345"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12313"
FT                   /db_xref="GOA:A0A0E1P2I3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2I3"
FT                   /protein_id="ABG12313.1"
FT                   /translation="MEELNVVEGINNASTWLANNQDLLIQYAVNIIAALLILIVGSIIA
FT                   KVLSGMLNRVMRLRGIDVTVADFLSAMVRYSILAFTIVAVLGRLGVQTASVIAVIGAAG
FT                   LAVGLALQGSLSNFAAGVLLVAFRPFKAGEYVDLGGVAGTVVQVQIFSTTLRTVDDKII
FT                   VVPNGKIIANNIINTSREPNRRTDMIVGVAYDADIDVVKKVLGDIIAADSRIIHEKGVT
FT                   VRLNEMAPSSLNFAVRVWTTNGDAQEVFWDLTENFKRALDAHKIGIPYPQMDVHLHQVA
FT                   KAEAEKPE"
FT   gene            408679..409152
FT                   /locus_tag="YPA_0346"
FT   CDS_pept        408679..409152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0346"
FT                   /product="putative LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12314"
FT                   /db_xref="GOA:A0A0E1NS16"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS16"
FT                   /protein_id="ABG12314.1"
FT                   /translation="MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCAL
FT                   SDIILICAGIFGGSALLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSV
FT                   TQGRWRILVTLLAVTWLNPHVYLDTFVVLGSLGGQLLPDIRPWFALVSTTDEK"
FT   gene            complement(409196..409975)
FT                   /locus_tag="YPA_0347"
FT   CDS_pept        complement(409196..409975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0347"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12315"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12315.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(409975..410997)
FT                   /locus_tag="YPA_0348"
FT   CDS_pept        complement(409975..410997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0348"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12316"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12316.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            411050..411256
FT                   /locus_tag="YPA_0349"
FT   CDS_pept        411050..411256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0349"
FT                   /product="putative LysE/YggA type lysine exporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12317"
FT                   /db_xref="GOA:A0A0H2Y2Z3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2Z3"
FT                   /protein_id="ABG12317.1"
FT                   /translation="MGVDHYCTVRYTLGAVTASIVWFFALALLAAWLSPWLNRPVAQRI
FT                   INLFVGGVMGFIAFQLARQGFGL"
FT   sig_peptide     411050..411142
FT                   /locus_tag="YPA_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.725) with cleavage site probability 0.717 at
FT                   residue 31"
FT   gene            411425..412225
FT                   /locus_tag="YPA_0350"
FT   CDS_pept        411425..412225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12318"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y479"
FT                   /protein_id="ABG12318.1"
FT                   /translation="MHILGGTVKLKTLALAAMIGLGTLPLALQAQAAEVPEGPHVVTSG
FT                   TASVEATPDIATIAIEVSVSAKDAADAKKQVDTRVAQYFDFLNKSGIEKKDVKAANIRT
FT                   QPEYDYQKSGEAVLKGYRAVRQVQVTLRQLDKLNDLLDGALKSGLNEIRAVELGVASPE
FT                   TYREQARKKAIENTITQAGALADGFKVKLGPVYSIRYHIANYQPMPVARMYKSAGAASD
FT                   TAVEQTYEQQTINFDDQVDVVFELQTGANPASIAATANKTVAAQ"
FT   sig_peptide     411425..411523
FT                   /locus_tag="YPA_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 33"
FT   gene            complement(412236..413144)
FT                   /locus_tag="YPA_0351"
FT   CDS_pept        complement(412236..413144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0351"
FT                   /product="chromosome initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12319"
FT                   /db_xref="GOA:Q1CB53"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR023490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB53"
FT                   /protein_id="ABG12319.1"
FT                   /translation="MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENL
FT                   FGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLAT
FT                   WLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALD
FT                   YLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVN
FT                   SSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRK
FT                   VTDALLSYGRQVLRQDSFIGQ"
FT   gene            413486..414142
FT                   /locus_tag="YPA_0352"
FT   CDS_pept        413486..414142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0352"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12320"
FT                   /db_xref="GOA:A0A0E1NQQ6"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQQ6"
FT                   /protein_id="ABG12320.1"
FT                   /translation="MTQDELKKAVGWAALDYVKPGTIVGVGTGSTAAHFIDALGSIKHQ
FT                   IEGAVSSSDASTAKLKSYGIPVFDCNDVDVLDIYVDGADEINGQMQMIKGGGAALTREK
FT                   IIAAIARKFICIADESKQVGVLGKFPLPVEVIPMARSYVARELIKLGGLPEYRQNVLTD
FT                   NGNVILDVHNLSILDAIALENQINGIAGVVTVGLFANRGADVALIGTANGVKVIG"
FT   gene            414449..415690
FT                   /locus_tag="YPA_0353"
FT   CDS_pept        414449..415690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0353"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12321"
FT                   /db_xref="GOA:A0A0E1NSX5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSX5"
FT                   /protein_id="ABG12321.1"
FT                   /translation="MAKVSLEKDRIKFLLVEGVHQSAVDNLRAAGYSNIEYHKGALDAE
FT                   SLKASIRDAHFIGIRSRTHLSEDVFAAAEKLVAVGCFCIGTNQVDLKAATKRGVPVFNA
FT                   PFSNTRSVAEMVLGELLLMFRGIPSANAKAHRGEWNKLAVGSFEARGKKLGIIGYGHIG
FT                   TQLGILAESIGMKVFFYDIENKLSLGNAQQVRQLSDLLNMSDVVSLHVPENHTTKNMIG
FT                   AEQLAQMKPGALLINASRGTVVDIPALCDALSSNHLSGAAIDVFPEEPATNKDPFNSPL
FT                   CEFDNVLLTPHIGGSTQEAQENIGDEVAGKLAKYSDNGSTLSAVNFPEVSLPAHGDNTR
FT                   RLLHIHENRPGILTSINTIFAEQNVNIAAQYLQTSADIGYVVIDVETDDADNAEKALQA
FT                   MKAIPGTIRARLLY"
FT   gene            complement(415955..416551)
FT                   /locus_tag="YPA_0354"
FT   CDS_pept        complement(415955..416551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0354"
FT                   /product="putative 5-formyltetrahydrofolate
FT                   cyclo-ligase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12322"
FT                   /db_xref="GOA:A0A0E1NV84"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV84"
FT                   /protein_id="ABG12322.1"
FT                   /translation="MPQNPQHALERQRIRAEIREHRRLLTPVQQQQSAHLAAQHIAEHP
FT                   KIQQAHTVAVFLSFDGELDTQPIIEQLWQQKKQVYLPVLHPFSPGNLLFLRYRPESPLI
FT                   RNRLKILEPQLDVREVLPLHQLDVVITPLVAFDRHGQRLGMGGGFYDRTLQRWQQNGPY
FT                   PIGLAHDCQLVDKLPSEYWDVPLPEIVTPAKVWQW"
FT   gene            complement(416678..416859)
FT                   /locus_tag="YPA_r020"
FT   misc_RNA        complement(416678..416859)
FT                   /locus_tag="YPA_r020"
FT                   /product="6S RNA"
FT   gene            complement(416915..417244)
FT                   /locus_tag="YPA_0355"
FT   CDS_pept        complement(416915..417244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0355"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12323"
FT                   /db_xref="GOA:Q1CB49"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR023771"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB49"
FT                   /protein_id="ABG12323.1"
FT                   /translation="MSAQPVDIQVFGRSLRVNCPPEQQDALNMAAEDLSQRLQDLKVRT
FT                   RVNNTEQLVFIAALNVCHELAQERLKTRDYASNMEQRIRMLQQTIEQALLEQGRISDRQ
FT                   DTQFE"
FT   gene            417581..418159
FT                   /locus_tag="YPA_0356"
FT   CDS_pept        417581..418159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12324"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB48"
FT                   /protein_id="ABG12324.1"
FT                   /translation="MSIENTLPTYPSLALALSQQAVALTPAEMHGLISGMLCGGSKDNG
FT                   WQTLVHDLTNEGVAFPQALSLPLQQLHEATQEALENEGFMFQLLIPEGEDVTVFDRADA
FT                   LSGWVNHFLLGLGMLQPKLAQVKDEVGEAIDDLRNIAQLGYDEDEDQEELAQSLEEVVE
FT                   YVRVAAILCHIEFTQQKPTAPEMHKPTLH"
FT   sig_peptide     417581..417652
FT                   /locus_tag="YPA_0356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.921 at
FT                   residue 24"
FT   gene            418247..419560
FT                   /locus_tag="YPA_0357"
FT   CDS_pept        418247..419560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0357"
FT                   /product="aminopeptidase P. Metallo peptidase. MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12325"
FT                   /db_xref="GOA:A0A0E1NTL6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTL6"
FT                   /protein_id="ABG12325.1"
FT                   /translation="MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNS
FT                   DFSYLTGFNEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDR
FT                   ALPFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPATLTDW
FT                   RPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGA
FT                   RYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFT
FT                   PAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGLVELGILKGDIEQLIAEQ
FT                   AHRPFFMHGLSHWLGMDVHDVGDYGSSDRGRILEPGMVLTVEPGLYIAPDADVPPQYRG
FT                   IGIRIEDDIVITATGNENLTASVVKDPDDIEALMALNH"
FT   gene            419629..420807
FT                   /locus_tag="YPA_0358"
FT   CDS_pept        419629..420807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0358"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase /
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12326"
FT                   /db_xref="GOA:A0A0E1NM37"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM37"
FT                   /protein_id="ABG12326.1"
FT                   /translation="MSVIIVGGGMAGVTLALAISSLTHGQVPVALVEAQQPNDRQHPGF
FT                   DARAIALAQGTCQQLARIGAWSALADCATAIDHVHVSDRGHSGFVNLRAEDYGVPALGH
FT                   VLELHDAGERLFALLMKAPGVTLHCPAKVVDVVRTAESARVTLDDGQQLAAKLLVAADG
FT                   SHSALAQSCAIQWQRQDYQQVAIIANITTSELPNGRAFERFTRNGPLALLPMSQGRSSL
FT                   VWCHAKHDQQQIDSWDDARFLAELQQAFGWRLGKMLQAGKRHSYPLQLLIASRHISHRL
FT                   ALVGNAAQTLHPIAGQGFNLGLRDVMSLAETLAEAAAMGNDLGDYTVLSHYQQRRQQDQ
FT                   QATIGVTDGLIRLFANRYGPLVAGRNLALMAMEQMPTIRDTFARRTLGWVER"
FT   sig_peptide     419629..419706
FT                   /locus_tag="YPA_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.953 at
FT                   residue 26"
FT   gene            420857..422200
FT                   /locus_tag="YPA_0359"
FT   CDS_pept        420857..422200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0359"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12327"
FT                   /db_xref="GOA:A0A0H2Y4Z4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4Z4"
FT                   /protein_id="ABG12327.1"
FT                   /translation="MGWHKCCSNRSRPICFSFAASLHREIYRVNKVHIFMGKCFGMQSF
FT                   DIVIAGGGMVGLALACGLQGSGLRIAIIEHQPAPMPLTAPLTGELALRVSAINAASERL
FT                   LQKIGVWETIQALRASPYHGMEVWDKDSFGKIAFHADEYGFSHLGHIIENQVIQQALWQ
FT                   RASQLPEVTVLAPASFKQVAWGETEAFITLTDDRMLSARLVVGADGAHSWLRQHADIPL
FT                   TFWDYAHHALVATIRTDEPHQATARQVFHGDGILAFLPFSDPHLSSIVWSLPPERAAEL
FT                   AVLPAEQFNRELAMTFDMRLGQCQLESERQTFPLTGRYARSFAAHRLVLVGDAAHTVHP
FT                   LAGQGVNLGFMDVAELVSELRRLQRQGKDIGQHLYLRRYERRRKHSAAMMLASMQGFRD
FT                   LFAGNNPAKKLLRDIGLTLADHLPGVKPQLVRQAMGLNDLPEWLERSQ"
FT   gene            422921..424018
FT                   /locus_tag="YPA_0360"
FT   CDS_pept        422921..424018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0360"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12328"
FT                   /db_xref="GOA:Q1CB44"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB44"
FT                   /protein_id="ABG12328.1"
FT                   /translation="MAKQTPLYDQHVACGARMVDFHGWMMPLHYGSQIDEHHFVRQDAG
FT                   MFDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFL
FT                   SEDYFRLVVNSATRDKDLAWISQHAEPYQVEVTVRDDLALIAVQGPQAQQKVATLLTTE
FT                   QQQAIAGMKPFFGIQTGDLFIATTGYTGEAGYEIALPKQQVVAFWQQLLAAGVKPAGLG
FT                   ARDTLRLEAGMNLYGQEMDEKTSPLAANMGWTVAWQPEDRQFIGRAALERQRMKGTEQL
FT                   VGLIMTEKGVLRNELPVYFFDAAGNQHVGVITSGSFSPTLGFSIALARVPAGIGEHAVV
FT                   QIRNREMPVRVTKPGFVRAGKAIVL"
FT   gene            424087..424473
FT                   /locus_tag="YPA_0361"
FT   CDS_pept        424087..424473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0361"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12329"
FT                   /db_xref="GOA:Q1CB43"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB43"
FT                   /protein_id="ABG12329.1"
FT                   /translation="MSNVPTELKYALSHEWVRADGDGVYSVGITEHAQELLGDMVFVDL
FT                   PEVGSDVSAGSDCAVAESVKAASDIYAPISGEIVAVNTELENSPELVNSAPYTDGWLFS
FT                   IKAADESELDNLLDADAYLAAIEE"
FT   gene            424685..427564
FT                   /locus_tag="YPA_0362"
FT   CDS_pept        424685..427564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0362"
FT                   /product="glycine dehydrogenase (decarboxylating) beta
FT                   subunit / glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12330"
FT                   /db_xref="GOA:Q1CB42"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB42"
FT                   /protein_id="ABG12330.1"
FT                   /translation="MTQNLSQLEHNDAFIQRHIGSSVEQQQQMLAAVGASSLSTLIQQI
FT                   VPADIQLPGPPPVGEAATEHQALAELKGIASQNQCYKSYIGMGYSPVLTPPVILRNMLE
FT                   NPGWYTAYTPYQPEVSQGRLEALLNFQQLTQDLTGLDLASASLLDEATAAAESMALAKR
FT                   ASKLKDANRFFVADDVHPQTLDVVLTRAETFGFDVIVDRAEKVLELDGIFGVLLQQVGT
FT                   TGELHDYSALLAELKKRKIITSVAADIMALVLLTAPGAQGADVVFGSAQRFGVPMGYGG
FT                   PHAAFFACRDEFKRSMPGRIIGVSRDAAGNTALRMAMQTREQHIRREKANSNICTSQVL
FT                   LANIASLYAVYHGPQGLQRIAGRIHRMTDILAAGLQHAGLTLRFKHWFDTLTVEVKDKA
FT                   AVLARALSFGINLRTDIHGAVGITLNETTSREDIQTLFALFVGDNHGLDIDQLDAAVSQ
FT                   HSQSIQDSMLRRDPILTHPVFNRYHSETEMMRYMHRLERKDLALNQAMIPLGSCTMKLN
FT                   AAAEMIPITWPEFAELHPFCPPEQAAGYQQMIGQLSQWLVQLTGYDAVCMQPNSGAQGE
FT                   YAGLLAIRRYHESRNQANRHICLIPSSAHGTNPASAQMAGMSVVVVACDKQGNIDLHDL
FT                   RQKAEHAGDELSCIMVTYPSTHGVYEETIREVCQIVHQFGGQVYLDGANMNAQVGITTP
FT                   GYIGADVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFVPGHSVVQIDGMTTQQGAVS
FT                   AAPFGSASILPISWMYIRMMGADGLKQASQVAILNANYIATRLKNAYPVLYTGHDGRVA
FT                   HECILDIRPLKEATGISEMDIAKRLIDFGFHAPTMSFPVAGTLMVEPTESESKVELDRF
FT                   IDAMLAIRAEIEKVAQGEWPLEDNPLVNAPHTQAELVGEWTHPYSRELAVFPVAGVLEN
FT                   KYWPTVKRLDDVYGDRNLFCSCVPISDYE"
FT   gene            427942..428379
FT                   /locus_tag="YPA_0363"
FT   CDS_pept        427942..428379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12331"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ33"
FT                   /protein_id="ABG12331.1"
FT                   /translation="MINNRFIGSWSLISQHFILPDNSIHYPMGQNMLGRINYEKQGTMA
FT                   AQLYRGDRAKFTTEDWLQGSDSEIKNAFLTALTYFGRYHIDEEQGIVTHTVEGCLFPNW
FT                   VGNQQIRHYQFEEDRLTLRTPPLQMNNSSLVGVLIWQKVKK"
FT   gene            428751..428876
FT                   /locus_tag="YPA_0364"
FT   CDS_pept        428751..428876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12332"
FT                   /db_xref="GOA:A0A0H2Y568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y568"
FT                   /protein_id="ABG12332.1"
FT                   /translation="MCWCILIYIIIRIHQLIFLWFYFIGIFSGFLSSNDSFIHDK"
FT   gene            429428..429592
FT                   /locus_tag="YPA_0365"
FT   CDS_pept        429428..429592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12333"
FT                   /db_xref="GOA:A0A0H2Y303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y303"
FT                   /protein_id="ABG12333.1"
FT                   /translation="MESGMENIIKYDINYFLRFVCFNYFMNIKFYRGLFSISIVMIYLS
FT                   LAPQLLSFM"
FT   gene            429625..431565
FT                   /locus_tag="YPA_0366"
FT   CDS_pept        429625..431565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0366"
FT                   /product="putative surface protein"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12334"
FT                   /db_xref="GOA:A0A0H2Y490"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y490"
FT                   /protein_id="ABG12334.1"
FT                   /translation="MDGPSVGPITSPNCNTPSIGIINTNAGQLFVGGTGAAVSGTLGPT
FT                   FWTGTFATPVGTSNTATAYGMVVQSGGAYITGNTYVQGGLFLNGQKATNLAPATISSTS
FT                   TDAVVGSQLYNLVQDGTRYFHANSVNPTDSLASGLETIAVGPATVVSGDNGVGIGNTAL
FT                   VGAAATGGIAIGFGTQVTAAGATAIGSAAQAQGAQSLALGAGAVTSQANSIALGAASIN
FT                   TVGAQSSYSAYALTAPQASVGELGIGTALGNRKITGVAAGSASSDAVNVAQLTAVGDQV
FT                   QQNTANITSLGGRVTTIEGSMASIANGGGVKYFHANSTQPDSVASGTNSVAIGPASLAS
FT                   GNAALASGAGAVAIGDGAAASADGSVAIGQGSGDNGRGVENYIGKYSNASNTSSGTVSV
FT                   GNTATGETRTVSNVADGLQATDAVNLRQLDGIAASIVVVENNVSGLQNGTDGMFQVNNS
FT                   SGLAKPSATGANSATGGAGSVASGNNSTAFGSGAKATAANSAALGANSVADRANSVSVG
FT                   SVGNERQITNVAPATQGTDAVNFDQLKSISNQTNAYTNQRYSELKQDLRKQNSVLSAGI
FT                   ASAMSMASLTQPYTSGSSMTTIGAASYRGQSALSLGVSSISDSGRWVSKLQASSNTQGD
FT                   FGIGVGVGYQW"
FT   gene            431669..432772
FT                   /locus_tag="YPA_0367"
FT   CDS_pept        431669..432772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRD3"
FT                   /protein_id="ABG12335.1"
FT                   /translation="MSSFKTLGFFFLSLSLLFSSLLVLLSLLLFAGLLLFPSLLPFSRF
FT                   LPFAGFSPASGFSLATKYDEGFSGNVSYRGDLNDSPKTDPLWIPLPALPLIQQAVTELV
FT                   PTVQGQYQEHVMSQVCALARGERTQEQVAQTLRSYDIDISNIPPQGHPLSLLVSTDQSS
FT                   RVIGCAAYIASSVMAIPKSDEFMVSTDKPADALPGKKNEAASKEKTLSIDPKKLAQYLQ
FT                   TQLAVAKANADIFAIIAVELEKKPGLTVNEYSVQIKKVFSEVASAYLQRVKALYAVGAG
FT                   VNYKLITYSDEGFKFISNDGYLFEYGYDSLSLYFNRIPWYGSGKILGKEYFFSVSYIEP
FT                   NLVKRIREEKREEKSEGVLNQESGVAP"
FT   sig_peptide     431669..431764
FT                   /locus_tag="YPA_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 32"
FT   gene            432974..433675
FT                   /locus_tag="YPA_0368"
FT   CDS_pept        432974..433675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0368"
FT                   /product="putative hemolysin III"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12336"
FT                   /db_xref="GOA:A0A0E1NLU8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLU8"
FT                   /protein_id="ABG12336.1"
FT                   /translation="MKNKSGTQPLFATPSVPAAQTATPTPAYPWAEELANSLSHGIGVV
FT                   FGIVGLVLLLVQAVNSGADTKALTSYSLYGSSIILLFLASTLYHAIPHRRAKLWLQKFD
FT                   HCAIYILIAGTYTPFLLVGLDSPLARGLMAVIWGLALIGVIFKLAFAHRFEVLSLVTYL
FT                   TMGWLSLIVIYQLAVKLEIGGLALLAIGGLLYTVGVIFYASKRIRFGHAIWHGFVLGGS
FT                   VCHFMAIYLYV"
FT   sig_peptide     432974..433039
FT                   /locus_tag="YPA_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.601 at
FT                   residue 22"
FT   gene            433933..434430
FT                   /locus_tag="YPA_0369"
FT   CDS_pept        433933..434430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0369"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12337"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY67"
FT                   /protein_id="ABG12337.1"
FT                   /translation="MIMRLSKALMVCAIALFATLVVFGNMTDYNTNFVFVHHVLQMDTI
FT                   FPDATISYRAIHSPWLQQLGYIGIILLETLTAVFCWVGGIGLLINRKAPAKVFNRKKGI
FT                   AIIGLTLGFLTWQVVFMSIGGEWFGMWMSKQWNGVPNAFRFFVTTILVLIYLVQPDGEL
FT                   DE"
FT   sig_peptide     433933..434007
FT                   /locus_tag="YPA_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.982 at
FT                   residue 25"
FT   gene            complement(434503..435495)
FT                   /locus_tag="YPA_0370"
FT   CDS_pept        complement(434503..435495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12338"
FT                   /db_xref="GOA:Q1CB34"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR023758"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB34"
FT                   /protein_id="ABG12338.1"
FT                   /translation="MAYHTPFAAQPPVASSGLPLTLISLDDWALVTLTGADRVKYLQGQ
FT                   VTADIDALSADQHVLCAHCDAKGKMWSNLRLFYRGEGLAFIERRSLLDNQLSELKKYAV
FT                   FSKVVIEPQPDAVLIGVAGSQAKTALAEIFTELPSAEHPVTQMGNSTLLHFSLPAERFL
FT                   LVTDTEQAQQLVEKLAGRAQFNDSKQWLALDIEAGFPIIDAANSAQFIPQATNIQALNG
FT                   ISFTKGCYTGQEMVARAKYRGANKRALYWLAGNASRVPAAGEDLEWQLGENWRRTGTVL
FT                   SAIQLNDGTVWVQAVLNNDLAADSVLRVRDDALGTLAIQPLPYSLAEDK"
FT   gene            435812..436078
FT                   /locus_tag="YPA_0371"
FT   CDS_pept        435812..436078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12339"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWZ7"
FT                   /protein_id="ABG12339.1"
FT                   /translation="MEIDNKARIHWACRRGMRELDISIMPFFEYEYDSLSDNEKQAFIR
FT                   LLECDDPDLFNWLMNHGEPQDSELYQMVKLIQSRNKARGPVAM"
FT   gene            436059..436484
FT                   /locus_tag="YPA_0372"
FT   CDS_pept        436059..436484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12340"
FT                   /db_xref="GOA:A0A0H2Y494"
FT                   /db_xref="InterPro:IPR009883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y494"
FT                   /protein_id="ABG12340.1"
FT                   /translation="MAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVL
FT                   LTLVVFECIRSQKRIKSCQGEIRLKPGNLVRWKRHEWTVVKPPWITRYGVLLHLQQTGG
FT                   HATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM"
FT   gene            436484..437182
FT                   /locus_tag="YPA_0373"
FT   CDS_pept        436484..437182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0373"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12341"
FT                   /db_xref="GOA:A0A0E1NSJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSJ6"
FT                   /protein_id="ABG12341.1"
FT                   /translation="MKPLIWLVEDEPSIADTLIYTLESEGFTLRWFDRGEPALAALSSG
FT                   SPALAIVDVGLPDINGFDLCRRMLAAAPDLPVIFLTARSEELDRIVGLEIGADDYIAKP
FT                   FSPREVSARVRTILRRLQKSHLLAVTSTSYQFGHFSLDEAGARVTYHQQILGLTRYEYL
FT                   LLKTLLLAPERIFSRQQLMDIVWAQAEESQDRTVDTHIKTLRSKLRTVYAEDSPIRTHR
FT                   GLGYSLGYQP"
FT   gene            437207..438625
FT                   /locus_tag="YPA_0374"
FT   CDS_pept        437207..438625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0374"
FT                   /product="putative histidine kinase sensor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12342"
FT                   /db_xref="GOA:A0A0E1NX66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX66"
FT                   /protein_id="ABG12342.1"
FT                   /translation="MKIGVRLLLGYFLIVAIAGYFVIRIFLQEVKPGVRRATEGTLVDT
FT                   ATLLAQFARQDILQNKVADGQLAQAFSSLNLRPIGANIEGIRKDRNEYRVYLTDTDGQV
FT                   IFDSSGRALGQDYSRWNDVWLTLRGEYGARSSRTDPDDAESSVMYVAAPVIVENRIVGV
FT                   LSIGKPNLSMVPVIKRSERKILFAGGLLLGIALLIGLGFVWWINRAIGKLVDYAERVAE
FT                   GQAVALPAMGSSELNDLALALESMRLKLDGKAYIEQYVHTLTHELKSPLAAISGAAELL
FT                   RESPPPETAQRFLINIEQQSARIQQLVDKMLVQARLESRVDLQLSPLEISHILKQSFSA
FT                   KEAQAVSRGVTLRLKSVDNAMLIGDGLLLSQALNNLIDNALDFTPAGGEISVSGERQDD
FT                   TYLITVEDSGSGIPGYAQEKIFDRFYSLPRANSVKSTGLGLNFVREVAAIHQGSICLEN
FT                   RLPQGVSARLTLPL"
FT   gene            438725..440203
FT                   /locus_tag="YPA_0375"
FT   CDS_pept        438725..440203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0375"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12343"
FT                   /db_xref="GOA:A0A0H2Y577"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y577"
FT                   /protein_id="ABG12343.1"
FT                   /translation="MLKGVQVMFKSVLFWKIVTLLGLMLLMMIPKGMLLHVIDERSGYR
FT                   QSVIDKVSDSTSRSQKILGPLIVVPYREWVETEVDGKKQGKWTHFYHYILPNVMTVKGT
FT                   PDVEVRQLGIYKTQVYQGEFDFHGEFEVSSLDDLDREGVIIGKPSLVLALSDARGIQRI
FT                   SPLSVGKTKINFEPGAFSGHSVQGVHAPLTIEQVLQGKFDVDFTMSLAGTTSLSVVPVG
FT                   RNSELTLQSNWPHPNFVGNFLPLQRKVDEKGFRAHWSSNWLANSMNTNFTGGDAAFHFG
FT                   SLPAFTTSLIEPVDHYQLTERAIKYAILFIGLTFFSFFLFESLTSLRLHPMQYLLVGAA
FT                   LVLFYLMLLAFSEHIGFTLAYLLASLSCSLLIAIYLSAVLGGWLRGTLFACGLLLLYGI
FT                   LFGLLQSEDNALLLGAGLLFVVLTVVMLLTRRLDWYQVADTQRLTEWRAPEPSAEESPS
FT                   KTAPEGESMKDDNKKKDDHVKKDANEKDEFRLWK"
FT   gene            complement(440293..440874)
FT                   /locus_tag="YPA_0376"
FT   CDS_pept        complement(440293..440874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0376"
FT                   /product="flavodoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12344"
FT                   /db_xref="GOA:A0A0H2Y312"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y312"
FT                   /protein_id="ABG12344.1"
FT                   /translation="MTGQIWYTRCYSLLAMLRLYIMKIGLFYGSSTCYTEMVAEKIRDI
FT                   LGEDLVDLHNLKEVSPRLMEEYSILILGIPTWDFGELQEDWEAIWPQLTQLNLKGKIVA
FT                   MYGMGDQFGYSEWFLDALGMLHDHIAPLGVKFIGFWPTDGFEFTSPKPLSADGKQFVGL
FT                   ALDEVNQYDLSEERIEQWCEQILLEMEALL"
FT   gene            440918..441817
FT                   /locus_tag="YPA_0377"
FT   CDS_pept        440918..441817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0377"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12345"
FT                   /db_xref="GOA:A0A0E1NX25"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX25"
FT                   /protein_id="ABG12345.1"
FT                   /translation="MKQQDNPLIEQFLDALWLERNLAENTLASYRLDLHALVGWLTHHN
FT                   SDLLRASPQDLQSFLAERIEGGYKATSSARLLSAMRRLFQYLYREKLREDDPTALLSSP
FT                   KLPQRLPKDLSEAQVDALLNSPNVDIPLELRDKAMLEVLYATGLRVSELVGLTISDVSL
FT                   RQGVVRVIGKGNKERLVPLGEEAVYWIENYMEHGRPWLVNGASLDVLFPSNRSQQMTRQ
FT                   TFWHRIKHYAILAGIDSERLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYT
FT                   HVATERLRQLHQQHHPRA"
FT   gene            441848..442564
FT                   /locus_tag="YPA_0378"
FT   CDS_pept        441848..442564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0378"
FT                   /product="thiol:disulfide interchange protein DsbC"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12346"
FT                   /db_xref="GOA:A0A0E1NPL9"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPL9"
FT                   /protein_id="ABG12346.1"
FT                   /translation="MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPI
FT                   PGISTVMTESGVLYISADGKHLLQGPLYDVSGDQPINVTNQALLKKLEALSSEMIVYKA
FT                   PEEKHVITVFTDITCGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCM
FT                   ADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKE
FT                   MLQMLNAHQASLKAGG"
FT   sig_peptide     441848..441913
FT                   /locus_tag="YPA_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            442571..444304
FT                   /locus_tag="YPA_0379"
FT   CDS_pept        442571..444304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0379"
FT                   /product="exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12347"
FT                   /db_xref="GOA:A0A0E1NSJ8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSJ8"
FT                   /protein_id="ABG12347.1"
FT                   /translation="MTLKTQLRRREAADDSHLPAQLPPLLRRLYASRGVKDAQELERGV
FT                   KGLLAWQKLDGIDAGVTLLQQALADRRRIVIVGDFDADGATSTALAVLALRSMGGSNLD
FT                   YLVPNRFEDGYGLSPEVVEQVAARGAELIVTVDNGISSHAGVDLAHAKGIQVLVTDHHL
FT                   PGETLPAADAIINPNLAGCDFLSKSLAGVGVTFYLMLALRARLRECGWFEQRTLAVPNL
FT                   AELLDLVALGTVADVVPLDANNRILVHQGLSRIRAGKCRPGIRALLEVANRDARQLVAN
FT                   DLGFSLGPRLNAAGRLDDMSIGVALLLSDDIAQARALAIDLDTLNQTRREIEQGMQVEA
FT                   LQLCDQLERTSSELPYGIAMYHPEWHQGVVGILASRIKERFHRPVIAFAPAGEGLLKGS
FT                   GRSVAGLHMRDALERLDTLNPGLILKFGGHAMAAGLSLEEGKFDEFRQRFADLVGEWMD
FT                   ASQLEGVIWSDGELNGAELSLETAELLRDGGPWGQSFPEPTFDGKFRILQQRLVGERHL
FT                   KLMVEPLNGGPLLDGIAFNVDTTLWPDSSVREVKLAYKLDINEYRGNRSVQLLVQHLWP
FT                   Y"
FT   gene            444649..445581
FT                   /locus_tag="YPA_0380"
FT   CDS_pept        444649..445581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0380"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12348"
FT                   /db_xref="GOA:A0A0E1P2F7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2F7"
FT                   /protein_id="ABG12348.1"
FT                   /translation="MGKERSTLEEIVTTIDQLEQGLEDVSGLLELAVEADDEETFNETI
FT                   AELEVLDGKLGQLEFRRMFSGEYDRANCYLDLQAGSGGTEAQDWASMLLRMYLRWAESR
FT                   GFKTEIIEESDGDVAGLKSATVKIIGEYAFGWLRTETGVHRLVRKSPFDSGGRRHTSFS
FT                   SAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQHVNKTESAVRITHIPTNIVTQCQND
FT                   RSQHKNKDQAMKQLKAKLYEFEMQKKNADKQVLEDNKSDIGWGSQIRSYVLDDSRIKDL
FT                   RTGVETRNTQAVLDGDLDKFIEASLKAGL"
FT   gene            445591..447108
FT                   /locus_tag="YPA_0381"
FT   CDS_pept        445591..447108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0381"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12349"
FT                   /db_xref="GOA:Q1CB23"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB23"
FT                   /protein_id="ABG12349.1"
FT                   /translation="MSEQKPQVAEQAQELNSELQARREKLAVLRGKGIAFPNDFRRENL
FT                   SDQLHAEFDSKENEELEALNIDVTVAGRMMTRRIMGKASFVTLQDVGGRIQLYVSRDDL
FT                   PEGVYNEEFKKWDLGDILGARGKLFKTKTGELSIHCSELRLLTKALRPLPDKFHGLADQ
FT                   ETRYRQRYLDLIANDESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGASARP
FT                   FVTHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELY
FT                   MAYADYKDLIVLTEELFRTLTETILGSSVVQYGEQTFDFGKPFAKLTMKEAICKYRPET
FT                   NVADLDDMDKAVAIAESLGIKVEKSWGLGRIQCEIFEETAESHLIQPTFITEYPAEVSP
FT                   LARRNDDNPFITDRFEFFIGGREIGNGFSELNDAEDQAQRFADQVSAKEAGDDEAMFYD
FT                   EDYITALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK"
FT   gene            447302..447375
FT                   /locus_tag="YPA_r021"
FT                   /note="tRNA-Gly1"
FT   tRNA            447302..447375
FT                   /locus_tag="YPA_r021"
FT                   /product="tRNA-Gly"
FT   gene            447541..447747
FT                   /locus_tag="YPA_0382"
FT   CDS_pept        447541..447747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0382"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12350"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNM8"
FT                   /protein_id="ABG12350.1"
FT                   /translation="MKLNARQVETAKPKDKAYKLADGGGLYLLVNTNGSRYWRLKYRFA
FT                   GKEKLLALGVYPDVSLAVAVNDG"
FT   gene            complement(447798..448577)
FT                   /locus_tag="YPA_0383"
FT   CDS_pept        complement(447798..448577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0383"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12351"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12351.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(448672..449601)
FT                   /locus_tag="YPA_0384"
FT   CDS_pept        complement(448672..449601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0384"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12352"
FT                   /db_xref="GOA:A0A0H2Y512"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y512"
FT                   /protein_id="ABG12352.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEEKRV"
FT   gene            449658..450716
FT                   /locus_tag="YPA_0385"
FT   CDS_pept        449658..450716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0385"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12353"
FT                   /db_xref="GOA:A0A0E1NV37"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV37"
FT                   /protein_id="ABG12353.1"
FT                   /translation="MWITIAPFVTVARVKRDEAKKIVAGGGDPSQNKQQEKLARQGEAT
FT                   NTFEAITREWYQRRYDRWSESYRLEMMSTFESDVFPYIGYRPIKEIKPLELMAVLSKLE
FT                   KRGATEKMRKVRQRCGEVWKYAIITGRAEYNPAPDLASAFAPHKREHYPHLTINEIPEF
FT                   LSSLASYSGSMLVKLAMRLLILTGTRPGELRQAEWAEFDFDNALWEIPAVRMKMRRPHM
FT                   VPLPDQAITILKQIQPISGRYQFVFPGRIQHSKPISEMTLNVLIRRIGYGGRATGHGFR
FT                   HTMSTILHEQGFNTAWIETQLAHVDKNSIRGTYNHAQYLDGRREMLQWYADYMDSLENG
FT                   ENVIHGRFGKRA"
FT   gene            complement(450798..450983)
FT                   /locus_tag="YPA_0386"
FT   CDS_pept        complement(450798..450983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12354"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXC1"
FT                   /protein_id="ABG12354.1"
FT                   /translation="MYDNTPREVEEVIDHCRALIYAIITLESPEVKEILNFVLQQQIDL
FT                   LHQTYHQATSEPLEAE"
FT   gene            complement(451084..451209)
FT                   /locus_tag="YPA_0387"
FT   CDS_pept        complement(451084..451209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12355"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y322"
FT                   /protein_id="ABG12355.1"
FT                   /translation="MVGWTGASKDAPGSLLTGLLTPFSPPPKGISSSWWWDKAIN"
FT   gene            451581..451841
FT                   /locus_tag="YPA_0388"
FT   CDS_pept        451581..451841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12356"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPC1"
FT                   /protein_id="ABG12356.1"
FT                   /translation="MVKVDWSRKAVKQLLSIDARYRKPISEKVNKLTNFPAVDLDIKKL
FT                   QMGDSQFRMRVGNYRVIFQIVEGTPVICTIQEVKRRTTATY"
FT   gene            451904..452266
FT                   /locus_tag="YPA_0389"
FT   CDS_pept        451904..452266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0389"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12357"
FT                   /db_xref="GOA:A0A0E1NVK2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVK2"
FT                   /protein_id="ABG12357.1"
FT                   /translation="MAKLQYIHDEAGKPQFVVLPVAEYQQLISNAKYEDIPYVADNDDD
FT                   QTIPNEVVQIMVNDGVSLLAAWRIYRGFSQYEIAELLGTTQSAVSQWEAVDSRPQKKTR
FT                   EKLAAIYKCRAAQMIL"
FT   gene            452430..452726
FT                   /locus_tag="YPA_0390"
FT   CDS_pept        452430..452726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12358"
FT                   /db_xref="GOA:A0A0E1NW62"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="InterPro:IPR038493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW62"
FT                   /protein_id="ABG12358.1"
FT                   /translation="MEKRTPHTRLLKVKELVLKGNIKTTRTARDGAEELGLSFRDMCDA
FT                   VSELISADFYKSMTTHQDHTIWQDVYRPMLSCGRVYLKITVIDDVLNVSFKEI"
FT   gene            452726..453124
FT                   /locus_tag="YPA_0391"
FT   CDS_pept        452726..453124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12359"
FT                   /db_xref="GOA:A0A0H2Y590"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y590"
FT                   /protein_id="ABG12359.1"
FT                   /translation="MMKCPVCGGVELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETV
FT                   MTEAESDVYAAKTMLLRKMVNTESIAPAYIVQIRKKLGLNQREASEIFGGGVNAFSRYE
FT                   KGKALPHPSTIKLLQVLDKHPELLNEIR"
FT   gene            complement(453524..455815)
FT                   /locus_tag="YPA_0392"
FT   CDS_pept        complement(453524..455815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0392"
FT                   /product="plasmid and phage DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12360"
FT                   /db_xref="GOA:A0A0E1NRY4"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRY4"
FT                   /protein_id="ABG12360.1"
FT                   /translation="MNQFITEVAAQARGKWGFILDALAISHSKQHSPCPACGGKDRFRF
FT                   DDRQGAGTWFCNQCEPQSGDGLDLVKNVRQCSLTEAAQLVADILGVSPKSKAPDLASLM
FT                   AKTTPGESRYLINKGLSSHKLPILPDGSLLLILQNMAGDCTGAQIIRPDGTKKLIAGSR
FT                   KKGTFIPLKPLPEQAETVVLAEGYATAQSLELLLPAAVIIAAIDAGNLLPVAQAFRIYW
FT                   PAAKIIIAADNDINPQDTANVGQLSAEKAANAVNGWVTLPPTPHKADWDDYRQQAGTGQ
FT                   ARNSFYHGLYQPPPVSQLAENKGLHPTLSQMAASQRGQLLAEHYGQIAVHAESETVYHY
FT                   DDERWDKLPDGVLRRELVMIFNANDTPYSPAGIRNAIEAMKLQIPIMGEPPRHLIGFQN
FT                   GVYDLKAKQFRPHRANDWLQHHNDIIFTEPQPDENLAHHAPHFTKWLAHAANDELPKMA
FT                   RIKAALFMILSNRFDWQLFLEVTGEGGSGKSVFTYIATLLAGRQNTASGNMAALDQARG
FT                   RAQFVGKSLITLPDQVKYVGEGAGIKAITGGDLVEIDGKYEKQFSTLLTAVVLATNNEP
FT                   MSFTERQGGIARRRVIFAFNHPVKEADKDPLIGEKIAAELPVVIRCLLAEFADQDKARK
FT                   LLLEQRDSREAMGVKRDADPLYGFCAHIVELGEAVGMYMGTLAISPHAPRIYLYHAYLA
FT                   YMEAYGHQRSLSLTKFGKDFPKVMEEFGAEYKKARTDKGFRYNMDLSDTANDWLPALAL
FT                   PHHPQPEEPH"
FT   gene            complement(455944..456603)
FT                   /locus_tag="YPA_0393"
FT   CDS_pept        complement(455944..456603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12361"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4B4"
FT                   /protein_id="ABG12361.1"
FT                   /translation="MSALVHYSECIPFNVSSMMAKSWRSSRSYSALTAGFFSIRATTCS
FT                   WDRLGGWRLLSKSQLLHSFSGFAFLFPRHISRFLHHNMQNNNLPVYLCHKNDAVPAFRL
FT                   IKTQLKHIFVVMHRDSINHLNTVALHTFSQANKIGLQADGLGKKLGDDIIIVIFNGVVH
FT                   RLKNNRNVIFLRLRMYQKERPDITQYCRGVYPPRSKGGAVDTMSLRIFPLGATTGQ"
FT   gene            456115..456441
FT                   /locus_tag="YPA_0394"
FT   CDS_pept        456115..456441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12362"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVM5"
FT                   /protein_id="ABG12362.1"
FT                   /translation="MNYTIEYYDDDVITQLLAQPISLQANFISLAKRMKRYGIKMVDAV
FT                   PMHYHEDVFELCFYEPKGWNRVIFMAQIDWQIVILHIVVQKTAYMPWKEKGKAAKRMKE
FT                   LRFG"
FT   gene            complement(456600..456800)
FT                   /locus_tag="YPA_0395"
FT   CDS_pept        complement(456600..456800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0395"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12363"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN44"
FT                   /protein_id="ABG12363.1"
FT                   /translation="MTYSSLIRLPEVLKRTGFSRPWVYKLLKQKRFPPPIKIGGRAIAF
FT                   VESEVNDWIEQQIAHSRGNKQ"
FT   gene            complement(456982..457314)
FT                   /locus_tag="YPA_0396"
FT   CDS_pept        complement(456982..457314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQE4"
FT                   /protein_id="ABG12364.1"
FT                   /translation="MEGWVKANGFHWPLPLGAALVPEQRQAEESWGGFAGKETALAFIA
FT                   GMAITLARNNPQYRRGVKMNKTAIARVATQAMFNAGFSGEMVTEKQMSNLISEALLVSL
FT                   PGADNP"
FT   gene            complement(457320..457556)
FT                   /locus_tag="YPA_0397"
FT   CDS_pept        complement(457320..457556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZE7"
FT                   /protein_id="ABG12365.1"
FT                   /translation="MNCYDYVGFNRTEIEQLLQINLRDSDEEYQNILKDKLPKWLTPFL
FT                   SRINITIKETAALIVGVMPYSIQIDDIGMVIIN"
FT   gene            complement(457569..457934)
FT                   /locus_tag="YPA_0398"
FT   CDS_pept        complement(457569..457934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUF6"
FT                   /protein_id="ABG12366.1"
FT                   /translation="MINPAEKLKAKQQEFISIRELIQRISRLHPTMSQAQIANWLLIEL
FT                   TDARPVSPPLLIQDALGVTRSPGFDDPQFCYFDLLSAAMANPKMDGAPCDGWIPESYKP
FT                   DEFNHRPDEEDDHELPF"
FT   gene            458203..459345
FT                   /locus_tag="YPA_0399"
FT   CDS_pept        458203..459345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12367"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMX3"
FT                   /protein_id="ABG12367.1"
FT                   /translation="MPKFNHYDLALLNPSFDSPLVDALTELELLRHLRLETDVHPLLFA
FT                   QLKSIFHMLESLGSARIEGNHTTLADYVESKVEGAEDSTDQLKEIGNIEHAMNFIDEHL
FT                   HAGEDITEYFVRELHAMTVNGLEREGDKTPGAYRSHGVSIAQSTHLPPEFIHVPAYMQE
FT                   LVGFMNRADAPKYDLMKVALAHHRFGWIHPFGNGNGRTVRLLTYSLLIKYGFNVKTSGR
FT                   VLNPTAVFCNDRERYYSMLAEADTGAVEGLEQWCLYVLTGISAELKKVDKLSDLHFLNS
FT                   KVLYPALEYSKGRGVINETESKILKRTISQGTVKTSDLKEVLPGLKPAQITYQIGKLVD
FT                   RGLLQPVEVGSRIYTAGFSKSDLMRGVIHALRKEGFIPDF"
FT   gene            459852..461390
FT                   /locus_tag="YPA_0400"
FT   CDS_pept        459852..461390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12368"
FT                   /db_xref="GOA:A0A0E1NTT3"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTT3"
FT                   /protein_id="ABG12368.1"
FT                   /translation="MAKGYYLVVGDETTCGGVITEGEPTHTIMGRAVAREQDRITCGKH
FT                   PGTYIIVGHIPGDTILGRKFAGSLHSTSNCPCKARFIPSMMNDAYELIGSPTSGQSSIA
FT                   PSFTETSESPPDVTPVFAKSCLREKGCTDAGTEGEPHRNFGKMGFYQTIPPSPTSPTDN
FT                   NEVDQRAQTARRKPVETEPDVKTPWYKRVLGRTSAAPAAVVVPVSTGAGLAALEQAGIQ
FT                   GMRFVGGNLMTAGRWMVGSSPVGAAIMGMMPGTLNEGETDLLDKLKLENIAKNGGSAPT
FT                   RVRFRWVDSGNGRLKAEGYHMSAEGGLDRVPVRKMTLNVFTGNYEFWEDGAAGPTILWT
FT                   PNDPGFKAPSNTGNNDGPIIRTTITVLPMPEADETGEHSTTLPMPEEKDFRDYILIHPL
FT                   LDLPPLYIYLSKNPDTPIWTKTKRLEPVSNAYEHWVKHGHEFSDQPFNNAKEYVESTHD
FT                   FVNNPPEGTLTKTRPNGDELFYHPQLNTFAVKTKDGVPKTMFKPSDKMGYWNKQ"
FT   gene            461387..461581
FT                   /locus_tag="YPA_0401"
FT   CDS_pept        461387..461581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12369"
FT                   /db_xref="InterPro:IPR025983"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM29"
FT                   /protein_id="ABG12369.1"
FT                   /translation="MSDEYSCQCCGSKTIDNLGDYEICPICKWEDDPIQSKEPDYVGGA
FT                   NKMSLNEAKEAYKQGRKVI"
FT   gene            462862..465057
FT                   /locus_tag="YPA_0402"
FT   CDS_pept        462862..465057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y337"
FT                   /protein_id="ABG12370.1"
FT                   /translation="MKINSKLWMGLLMGMLGMAVPPSQASSDNTGCVWGKYCPLSGVPF
FT                   LDVYNDTRVNMMLLVGEPKNFILPRLTMPADITRSRNYHFGEFYYDEMSFPKREKSLTD
FT                   ENNDSPSEETPFDKMAKTLGINSASFKGTNARYREARHISNNPASVEQFFTALLADSSL
FT                   TADDRHNLALWRSNIFHNVDAPVDGGITPPPFNIVPGSHVDAFSDYLHGANAFYRGDYP
FT                   EATALFSALQKSSQAWVAETATYMLFRVALNESSTNASDKYGMFETKNINQDAARQALD
FT                   YSRAYLVAYPQGIYAESIQGLERRIYWYLSDWQQLARLYEETLLAAPNAEALWDTVSEV
FT                   DAKFISKDAFGGEPFISDMQAPLLTFTQTLRWLRLGGRQSGSELEVTQEKLASYKPMFV
FT                   DADRLPLWQYLQTAWLYYHEQDYAGVVATVSAVDSLPATDIVTFSQQILYGDALVAQQQ
FT                   WSQAEAHWRKLLGLVQSPQQQQYLQLKLAAVLVNSDQIEAIFTADSPIKNLRYRSLILK
FT                   TKAQKALLQQQVISGANDEEKTIALHTLLLRDLMLGDYQGYEQDKQLSPHIQQSVDQKS
FT                   FADVDLAAFDWQGDNVEQGYACAALDGTVKALVKNKTDGHALNCLGEFFRVTDININTY
FT                   QEGEGNEVLNVAVHAHETVITQPNRFDYYQHVINDPKAEPEDKSYALYRAVMCYAPSGY
FT                   NQCGGEDVDIATRKRWFSSLKTQYKGSRWAERLNYYW"
FT   sig_peptide     462862..462939
FT                   /locus_tag="YPA_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 26"
FT   gene            465027..465794
FT                   /locus_tag="YPA_0403"
FT   CDS_pept        465027..465794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12371"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV76"
FT                   /protein_id="ABG12371.1"
FT                   /translation="MGRTAQLLLVSCLLALFMPPAMAEVSDKLQLSHKVYAHDYQAFWL
FT                   WSGVNPQPALQQANQVYLHQGEVVIRQRAAWFQKMGLPSSRLTLPAMWVTVRITTLDVP
FT                   DDILAILIDLPRRWAAAGNQVIGLQIDFDAGTYRLDDYAGFLRRVRTKLDPNFALGVTG
FT                   LLDWAKTGSIQQLNALPIDELVIQTYQGRSTVNQYSRYLPALLQLRLPFKIGLVQHGEW
FT                   DPQWEQYLAASPFYRGEVVFLLNHLRSEPANGK"
FT   sig_peptide     465027..465098
FT                   /locus_tag="YPA_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            466399..467178
FT                   /locus_tag="YPA_0404"
FT   CDS_pept        466399..467178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0404"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12372"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2K9"
FT                   /protein_id="ABG12372.1"
FT                   /translation="MKKVNLLVWIGLSLNLVLVLASWFFTVDYQELYGELGYRDRMLLD
FT                   AIAVLRYYFAVSLVLQILSVIFLDKANKLSFGLAIISCLGMLPLSIVFLIGYLFTYNDY
FT                   VYRGLKTFSLNETGKLDTYLNFATVRYFMLGAFATVAGVFMFFTDMPMSMLIIVVGVLN
FT                   MINGIRLGPRPVIALMGDNLVFTPALMSNTYIISIEHVDLVESKKGKFKIKLNLEGLEK
FT                   KITFQKNIMENDKDSSALEKILAKIEKNNGEKQHIFL"
FT   sig_peptide     466399..466464
FT                   /locus_tag="YPA_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.816 at
FT                   residue 22"
FT   gene            467395..467700
FT                   /locus_tag="YPA_0405"
FT   CDS_pept        467395..467700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12373"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3Y9"
FT                   /protein_id="ABG12373.1"
FT                   /translation="MPISEINRKIEVYMKGVICIGDKTTHGGQVLSGSGKMKFAGIGVA
FT                   RLNDPVSCPQHGNTFIIEAHPSFKDNGIPVAFHGHRCGCGCTLISSQKGATVIAMR"
FT   gene            complement(467783..468103)
FT                   /locus_tag="YPA_0406"
FT   CDS_pept        complement(467783..468103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12374"
FT                   /db_xref="InterPro:IPR024476"
FT                   /db_xref="InterPro:IPR038194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU02"
FT                   /protein_id="ABG12374.1"
FT                   /translation="MPGYRYRITIEPLTDRKGEAIDKAPVTFEAENHDEILSIIERLQA
FT                   REDLGFGQEKTAAFALGLKLFSETMMENRKHPLFEPLRGAFKDFMILLKKGSPRDRSDH
FT                   AE"
FT   gene            complement(468103..468783)
FT                   /locus_tag="YPA_0407"
FT   CDS_pept        complement(468103..468783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0407"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12375"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNT0"
FT                   /protein_id="ABG12375.1"
FT                   /translation="MFGHSKHDHRHGGHRHEGQGHCGEKMRRGGRHNVMAEDAESARGG
FT                   KHGRGRGGKMHRLFEHGDLRVVLLALLNKTPSHGYELIKAIEEASSGLYVPSPGVIYPT
FT                   LTLLEEQDFVTPVATGNGRKSYQITDAGKFELQKNQAMVDVIFARLAQVNRHKEGNLAE
FT                   GIADAMHRLRHILRSNMMRADLTPEQVARINTALLAAVDTIEEELQPVGVQPAAVDTTV
FT                   QEKN"
FT   gene            complement(469207..470064)
FT                   /locus_tag="YPA_0408"
FT   CDS_pept        complement(469207..470064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0408"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12376"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNJ0"
FT                   /protein_id="ABG12376.1"
FT                   /translation="MRSIGWRFFTLGWLILLAGCATDVSLSGKNKSTEANRIQFQRMGS
FT                   APESGAADVTSLDLQPGDILLSSSTGINSLGIRIFSLAPVSHAAIYLGEEQVAEATSTG
FT                   VNIVSLNEAIDHNTAVIAFRYPGLTPEHAAKLREFALDKEGSDYNFGGIVLIAPYMITK
FT                   RICELPLFNATVRNHCLSLLATVQLGDGGSLTEDQRFFCSQFVLEAYNYAGHPISDSNP
FT                   VWITPADLLHMREGDSSSFRSNQPLSYIGHLKQRSSLFTGNKGLAMNNADTLLEDKSPR
FT                   MLSQ"
FT   gene            complement(470440..470958)
FT                   /locus_tag="YPA_0409"
FT   CDS_pept        complement(470440..470958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQI5"
FT                   /protein_id="ABG12377.1"
FT                   /translation="MKNKIFTAIVLLFSFSLSIQAIANKKNDKKIIINNLTLSSTWVRT
FT                   AISESIDSPSNTINKDDIKRMAAGKHIYIMDNKITIEGVCTFKYVIKKSSPLNYWHSDK
FT                   TVNLYKEEFLKNGFKLSENLAFISAEDPSNDCDSPYSQIAITDNVIFTVYNGHIVFYTN
FT                   SNNVNELAL"
FT   sig_peptide     complement(470893..470958)
FT                   /locus_tag="YPA_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.537 at
FT                   residue 22"
FT   gene            complement(471737..472738)
FT                   /locus_tag="YPA_0410"
FT   CDS_pept        complement(471737..472738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0410"
FT                   /product="sugar-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12378"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ30"
FT                   /protein_id="ABG12378.1"
FT                   /translation="MKKTMLQTLLAATLILSFAASVQAAPVKIAILMYGMKAEFVQLME
FT                   KSAKEHPAVTQGLTTLTLFDGRYDPLVQNNQAETAIRTRYDAIIIVPIDFEANVDVVTM
FT                   ANKANIPVIVANARLNTDKATSGIFSDDVQGGYLEAKAVLDKMQCQGNVVVIEGPIGQS
FT                   AQIQRGQGNDKAIAECGPGKINVLERKTANWSRAEAMPLMENWLQKHRGKINGVIGQND
FT                   EMALGAIEAIKSAGLNVQDFAIAGIDGVSDAIRAVKQGEMMSILQDGQAQIQGAIDIAM
FT                   RSVQGERYQPMSTIWQQYQGKMDWQQGTAKMYEVPWTEVTPQNADELLKMRQ"
FT   sig_peptide     complement(472664..472738)
FT                   /locus_tag="YPA_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(473173..474177)
FT                   /locus_tag="YPA_0411"
FT   CDS_pept        complement(473173..474177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0411"
FT                   /product="sugar transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12379"
FT                   /db_xref="GOA:A0A0E1NTJ4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTJ4"
FT                   /protein_id="ABG12379.1"
FT                   /translation="MSLTRTSKFRKAIHQYGIILAFVGLCAVIALAGEFAVNSGTWSEN
FT                   YFLSRDNTLIILRQVSINGILAIGMTFVIITAGVDLSVGAVLGLAGIVAARFATNNSAI
FT                   ALGGTDWPLLVPIVIAIGIGLVCGAINGFILGKYRLQPFIVTMGMLSVARGLTLLTTGG
FT                   NPVSQLTDEFRWLGNGYILGIPVPVLIFIILFAIAWFVLNKMTFGRYVYAVGGNEKSAR
FT                   TSGINVLRIKVAVYTLCGILAAIAGLILTARTGSAQTGAGVSYELDAIAAVVIGGTSMA
FT                   GGIGTLRGTLFGVLIIGVMNNGLDLLGVQSYYQQIIKGVLIVFAVMLDPSRKQ"
FT   sig_peptide     complement(474079..474177)
FT                   /locus_tag="YPA_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 33"
FT   gene            complement(474249..475757)
FT                   /locus_tag="YPA_0412"
FT   CDS_pept        complement(474249..475757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0412"
FT                   /product="sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12380"
FT                   /db_xref="GOA:A0A0E1NPN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPN4"
FT                   /protein_id="ABG12380.1"
FT                   /translation="MIRNEILAKKPDYLLEATGLKKSFGDVIALNNAEFCLKRGSIHAL
FT                   CGGNGAGKSTFLGLLMGFIQPDDGAFFINGQYCEFDSPGQALAAGITIVQQELSGVQDL
FT                   SVAENIYLGSEPRRFGIVDFRALNRQADVLLHELGFAISPKAKMRSLSVAEQQRVEIAK
FT                   ALSHTHADIIIMDEPTSALGEEDAQKLFQTIKKLASLGKGVIYVSHRLSEIFQIADSYT
FT                   VFRDGCYICEGETSHITREQLIEHIIGGEIDGEFSKYNTPTNVPLFKASGICWKSKVND
FT                   VSLTLHCGEILGIYGLVGSGRSEFLNLLFGLERADHGSIHIGDEILLKHTPEKAINAGI
FT                   AYVTEDRQETGLVLNHSVSENINISSLNVISRMSIINENDIQRRADHTIRIFNIKTPSR
FT                   QQRVANLSGGNQQKVVLGRWALLDPKVLLLDEPTRGIDIGAKKEIYRFMSDFALKGKGI
FT                   VMVSSELSEIIGMSDRILVFKKGKIVGEITGTEATQAKLMSMAV"
FT   gene            complement(476306..477406)
FT                   /locus_tag="YPA_0413"
FT   CDS_pept        complement(476306..477406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0413"
FT                   /product="sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12381"
FT                   /db_xref="GOA:A0A0E1NUD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUD0"
FT                   /protein_id="ABG12381.1"
FT                   /translation="MSSIRLRNVTKRFGKTETLHNINLDIEDGEFAVFVGPSGCGKSTL
FT                   LRMIAGLEEISDGEVLIDDEVINDVAPSHRGVAMVFQSYALYPHMTVAENMGYGLKVNK
FT                   VPKEQIRHQIEMVAKTLQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPKVFMFDEPLSN
FT                   LDAELRVEMRLHIAKLHQEMKTTMVYVTHDQVEAMTLADKIVVMNYGKIEQMGSPMSLY
FT                   YNPVNKFVAGFIGSPKMNFLPATVESWQPDSVTVAEGHSLTLALHTSPLQAGDPVTIGI
FT                   RPEHLSVADSTVQTLDFHCEVVERLGNNTYLFGQCHGHDGFKMLLAGDVHFRPYQKLNL
FT                   SFDAGYCMVFNADGLRINAEIPVPHE"
FT   gene            477769..479004
FT                   /locus_tag="YPA_0414"
FT   CDS_pept        477769..479004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0414"
FT                   /product="putative sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12382"
FT                   /db_xref="GOA:A0A0E1NXJ7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXJ7"
FT                   /protein_id="ABG12382.1"
FT                   /translation="MKINKITALVLTALAVTQFAGFAAHAATQQLTVWEDIKKSAGIKE
FT                   AIADFEKQHQVKVNVLEMPYAQQIEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLLTPL
FT                   SVDPTIVTTFTKPSIAAFTMDNALYGLPKAVETLVMIYNKDMLPTPLATLDEYAAFSKK
FT                   QRAENKYGLLAKFDQIYYSWGAIEPMGGYIFGKDANGSLKANDIGLNTPGAVEAVTYLK
FT                   TFYANGLFPIGTIGDNGLNAIDSLFTEKKAAAVINGPWAFQPYEAAGINFGVSPLPALP
FT                   NGKDMSSFLGVKGYVVSTWSKDKALAQQFIEFINQPQYVKTRYQVTKEIPALTAMIDDP
FT                   LIKNDEKASAVAIQASRASAMPGIPEMGEVWGPANSALELSVTGKQEPKVALDNAVKQI
FT                   NMQIEAMQASNQ"
FT   sig_peptide     477769..477849
FT                   /locus_tag="YPA_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            479164..480471
FT                   /locus_tag="YPA_0415"
FT   CDS_pept        479164..480471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0415"
FT                   /product="putative maltodextrin transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12383"
FT                   /db_xref="GOA:A0A0E1NR39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR39"
FT                   /protein_id="ABG12383.1"
FT                   /translation="MIISSGDNGAAAKQSSRHAIAAVLCAVVPGFGQFYHRQWAKGLVF
FT                   LVLISSFVGVFFDFLQEGLWGLYTLGEEVPRDNSIFLLAEGIISVLIIGFGVALYYFSL
FT                   RDAWVNGKKRDAGIPLNSVRKQYQLLLSEGFPYLMITPGFILLVFAVIFPILFGFSIAF
FT                   TNYNLYHTPPAKLVDWVGFKNFVNIFTLSIWRSTFFDVLQWTVVWTLLATTLQCTVGVL
FT                   LAILVNQKDLRFKPLIRTIFILPWAVPGFVTILVFAGMFNDSFGVINNSILAFFGIAPK
FT                   AWMTDPFWTKTALIMMQTWLGFPFVFAMTTGVLQAIPDDLYEAATMDGASTSTKLRTIT
FT                   LPLVLYSIAPIIITQYTFNFNNFNIIYLFNNGGPAVAGSNAGGTDILVSWIYKLTMSSS
FT                   QYAIAATITILLSIFVVGLALWQFRATKSFKNDDMA"
FT   gene            480483..481334
FT                   /locus_tag="YPA_0416"
FT   CDS_pept        480483..481334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0416"
FT                   /product="putative maltodextrin permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12384"
FT                   /db_xref="GOA:A0A0E1NSY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSY3"
FT                   /protein_id="ABG12384.1"
FT                   /translation="MAKSQSIKQEKWIRLSLSWLVIILVSVIIIYPLIWTVGASLNAGN
FT                   SLLSTSIIPENLSFQHYADLFNGEVNYMTWYWNSMKISFLTMVLTLISVSFTAYAFSRF
FT                   RFKGRQNGLMLFLLLQMIPQFSALIAIFVLSQLLGLINSHMALVLIYVAGMIPMNTYLM
FT                   KGYLDAIPKDLDESARMDGASNFRIFIEIIMPLSKPIVAVVALFSFTGPLGDFILSSTI
FT                   LRTPDKYTLPIGLYNLVAQKMGASYTTYAAGAVLIAVPVAILYLALQKYFVSGLTSGST
FT                   KG"
FT   gene            481339..482541
FT                   /locus_tag="YPA_0417"
FT   CDS_pept        481339..482541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0417"
FT                   /product="putative galactosidase"
FT                   /EC_number="3.2.1.89"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12385"
FT                   /db_xref="GOA:A0A0E1P038"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P038"
FT                   /protein_id="ABG12385.1"
FT                   /translation="MKFFKPALLTVCLSLSLMVGANAAEPFTIAPLKNVPADFIKGADI
FT                   STLAEVERQGGKFFNEQNVQQDAMAILKANGVNYVRLRLWVDPKDSDGQSYGGGSNDLA
FT                   TTLALAKRAKAQGLKVLLDFHYSDFWTDPGKQFKPKAWQKMNYDQLKVAIHDYTRDTIA
FT                   TFKKEGVLPDMVQIGNESNGGLLWPEGKSWGEGGGEFDRLAGLLNAAIGGLRENLSSPS
FT                   DVKIMLHLAEGTKNDTFHWWFDEITKRNVPFDIIGLSMYTYWDGPISALQTNMDDISQR
FT                   YQKDVIVVEAAYGYTLENCDNAENSFTAKEEKDGGYPGTVQGQANFIHDLMQSVINVPD
FT                   GRGKGIFYWEPTWISVPGNTWATPAGMKYINDNWKEGNARENQALFDCQGKVLPSMKVF
FT                   N"
FT   sig_peptide     481339..481410
FT                   /locus_tag="YPA_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 24"
FT   gene            482592..484652
FT                   /locus_tag="YPA_0418"
FT   CDS_pept        482592..484652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0418"
FT                   /product="puative beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12386"
FT                   /db_xref="GOA:A0A0E1P108"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P108"
FT                   /protein_id="ABG12386.1"
FT                   /translation="MSKFPPLSAKVSALLHGADYNPEQWENYPDIIDKDIAMMKQAKCN
FT                   VMSVGIFSWVKLEPSEGEYNFSWLDELIEKLYAAGIHIFLATPSGARPAWMSQKYPEVL
FT                   RVGRDRVPALHGGRHNHCMTSPVYRQKVRQINQKLAERYAHHPAVIGWHISNEYGGECH
FT                   CHSCQQKFRLWLQDRYQTLDNLNEAWWSAFWSHTYSDWSQIESPAPQGEVSIHGLNLDW
FT                   RRFNTAQVTEFCSEEAKPLKAANPELPVTTNFMEYFYDYDYWKLAQVIDFISWDSYPMW
FT                   HREKDETQLACYTAMYHDLMRTLKQGRPFVLMESTPSATNWQPTSKLKKPGMHILSSLQ
FT                   AVAHGADAVQYFQWRKSRGSVEKFHGAVVDHVGHIDTRVGREVSELGRILEAMSPVMGS
FT                   KVDADVAIIFDWESRWAMDDAEGPRNCGLEYEKTVAEHYRPFWERGIAVDIINADCDLS
FT                   GYKLVIAPMLYMVREGFAERATRFVEQGGQFVATYWSGIVNESDLCHLGGFPGPLRPLL
FT                   GIWSEEIDCLADGESNQVQGLAGNKAGLQGPYQAIHLCDLIHLEGATAVARYRDDFYAD
FT                   RAAVTVNFVGEGKAWYVASRNDAAFQRDFFMNIAEELNLARALDTQFPYGVTAHRRTDG
FT                   ESEFIVVENYSNDSKSLVLPAVYRDMVDQQPVQGSLTLAPWGSRVLTRYLE"
FT   gene            484764..485075
FT                   /locus_tag="YPA_0419"
FT   CDS_pept        484764..485075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0419"
FT                   /product="PTS transport protein"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12387"
FT                   /db_xref="GOA:A0A0E1NU29"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU29"
FT                   /protein_id="ABG12387.1"
FT                   /translation="MISLKSFMHYFSHPKPTPSFIDEEKQQAEMLLHYLGGKENIKNID
FT                   ACITRLRVTVNDLSKVNSEALQQAGALGVIILGQEVHAIFGKQSDNLRKILDEHFSQS"
FT   gene            complement(485448..486707)
FT                   /locus_tag="YPA_0420"
FT   CDS_pept        complement(485448..486707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0420"
FT                   /product="maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12388"
FT                   /db_xref="GOA:Q1CAY4"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAY4"
FT                   /protein_id="ABG12388.1"
FT                   /translation="MKTSLRTLSVALAAALVSPSVLAIEKIDFHGYMRAGVGVSSDGGL
FT                   AEWQKTMVGRLGNESDTYGEIGLGAEVYKKEDVSFYLDSMVSMLSDGSNDSETTIGDDA
FT                   QFGLRQLNLQIKGLIPGDKEAVIWGGKRYYQRHDLHIIDTKYWNISGSGAGIENYTVGP
FT                   GAVSVAWVRGDANDVDTRITGDSDVNINYIDVRYAGFKPWAGSWTEVGIDYAMPNPTKQ
FT                   QKEYGGLYDADNAVMLTGEISQDMFGGYNKLVLQYANKGLAQNMISQGGGWYDMWHKTD
FT                   EAKGYRVINTGLIPITDKFSFNHVLTWGSANDITEYTDKTNLISLVGRAQYQFTQYVRA
FT                   IGEVGGFYQKDTYHNGSNYKQGGEKYTIALGLAEGPDFLSRPELRVFASYLNDSENGKP
FT                   FEDGTSNDTWNFGVQVEAWW"
FT   sig_peptide     complement(486636..486707)
FT                   /locus_tag="YPA_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.799 at
FT                   residue 24"
FT   gene            486979..488052
FT                   /locus_tag="YPA_0421"
FT   CDS_pept        486979..488052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0421"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12389"
FT                   /db_xref="GOA:A0A0E1NVV3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVV3"
FT                   /protein_id="ABG12389.1"
FT                   /translation="MKSKSTTLEDVARHAGVSYQTVSRVLNKSAKVSEATRRKVEQSIE
FT                   LLRYVPNRLAQQLVGKQSMTMGLVTTSLALHAPSQVAAAIKRYAHIEGYQVLISMIDES
FT                   VNQSIQHSINDLKSQWVGKVIINVPLETAVAEKIAADNDDVTCLFLDVDPYSSVFNVSF
FT                   NPADGTRASVKYLYELGHREIALLAGPKQSVSANLRLKSWLETLADYGLSPVSVIHGNW
FT                   DAQSGYSGALQMLRETPQFSAVLVANDQMALGVLSAFHQNQLAVPGEKSVIGYDDTYES
FT                   SFFYPALTTVSLDLDLQGKEAVRRMLSASDNESMRSSSILPAKLVVRNSTGPQAKEHRD
FT                   LQKIAEELRLIAQRLAS"
FT   gene            complement(488365..490740)
FT                   /locus_tag="YPA_0422"
FT   CDS_pept        complement(488365..490740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0422"
FT                   /product="putative glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12390"
FT                   /db_xref="GOA:A0A0E1NS82"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS82"
FT                   /protein_id="ABG12390.1"
FT                   /translation="MKTLKNWLLINEYPDHLELRVDDRHIFCLYVLEPNLCRVLIKREG
FT                   ELALSRTWSIAPQGDVPWSGRDRLSLEGFSLPGYQLEKHEQQLVVTTECLRVTIHQPLH
FT                   LTWEYKNPHGEWLPLAADRPTSAYLLSPQGEAIAHYQRRYPNEQYYGLGEKAGDLNRAG
FT                   RRFEMRNLDAMGYNAASTDPLYKHIPFTITRRDDVSFGLFYDNLSSCWLDLGNEIDNYH
FT                   LAYRRYQAEAGDLDYYLFLGPKVLDVTKAFVRLTGKTQFGPKWSLGYSGSTMHYTDAPD
FT                   AQVQLQKFIALCQQHDIPCDSFQLSSGYTSIKNKRYVFNWNYDKVPQPKVMSQTFLQAG
FT                   IKLAANIKPCLLQDHPQYQQAAERGLFIRDSETDLPERSTFWDDEGSHLDFTNPDTVNW
FT                   WQENVTKQLLEMGIGSTWNDNNEYEVWDGEARCNGFGKSIAIKHIRPVMPLLMMRASME
FT                   AQKAFAPEMRPYLISRSGCAGMQRYAQTWSGDNRTCWQTLRYNIRMGLGMSLSGLYNLG
FT                   HDVGGFSGDKPEPELFVRWVQNGVMHPRFTIHSWNDDNTVNEPWMYPAATPMIRDAMAL
FT                   RYRLLPYFYTLQWQASHDDEPMLRPTFLDHEHDSLTFKENDDFMLGRDLLVASVVDAGQ
FT                   RQRQIYLPDNQVGWYCFHSGQWYSGGQTITLDAPLERLPLLVRAGAALPLSRRIAFVNP
FT                   EADCQRELALYPTQGGGQSSGMLFEDDGESHRWQQGHALWLNWQVTTDNHRIDITFSRT
FT                   GNYQPAWRELTINLPTNESRTLSINGVAGNTLDLTKLA"
FT   gene            complement(490891..492198)
FT                   /locus_tag="YPA_0423"
FT   CDS_pept        complement(490891..492198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0423"
FT                   /product="putative sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12391"
FT                   /db_xref="GOA:A0A0E1NRK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRK9"
FT                   /protein_id="ABG12391.1"
FT                   /translation="MSIDINQSAKIVGRRKIKSLRWWMLALFLLGVTVNYITRNSLGIL
FT                   APELKTSLNMTTEQYSWIVASFQLAYTVFQPLCGWLIDVIGLKMGFLVCASVWAVVCMM
FT                   HAGAGTWFQLAVLRFFMGSAEAAATPANAKAISDWFPKKERPIAAGWAGVGFSIGAMLA
FT                   PPIIVLAHVALGWQGAFLFSGALAMIWVLLWWRFYHSPDTHPNLSQEEFELIHQDNEPV
FT                   LPRLPFLKSLAILSKNKKFYGIAIPAFLAEPAWAVFSFWVPLYLATERGMDLKQIAMFA
FT                   WLPFLAADIGSVASGYLTKLYQKWFGCSRVNSVVASSVTGAFMMVSLAFVAVTKDPYLA
FT                   IALISIGGFGHQVISCMLSALVVDSFDKNQVATVNGLRGSSAWIASFLFTLLIGAVSDT
FT                   IGFNPLFIAMGFFDLIGAVFLIALFAERRNKPQPTV"
FT   gene            492592..493674
FT                   /locus_tag="YPA_0424"
FT   CDS_pept        492592..493674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0424"
FT                   /product="LacI-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12392"
FT                   /db_xref="GOA:A0A0E1NV59"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV59"
FT                   /protein_id="ABG12392.1"
FT                   /translation="MNGKLKIQEIANQTGLSISTVSRVLAGKGNTSAKAKQQVMAYAKS
FT                   QGILQNLSSGRLMLNNIMVFAPHRAFDVRTDIFYYKVIQGITQAVSQHEVMIRYCGLSE
FT                   THSDISLFLDKMTHPQSEAAIIIGIDDPRIHALAASLHKPAVLINCRDKEMSLDSVSPD
FT                   HQSIGEFSAHYLIQQGHRRILTLQCLRRNTMELRLLGIKDAFASNNMRFDDHQHLITTH
FT                   GFGAEEAEQAITTFFTACEDESRLPTAILVGGDYMAVGAVNALNKLNVNVPNRVSVMSM
FT                   DGFNLAEIHDVPLTAVHVPRDELGAEAIQLLQRRVLRPDAPFSNLLLQGKLVVRSSVKQ
FT                   VNQNRAMPAANKPTDQIYDL"
FT   gene            complement(493915..494493)
FT                   /locus_tag="YPA_0425"
FT   CDS_pept        complement(493915..494493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0425"
FT                   /product="ThiJ/PfpI-family thiamine biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12393"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN84"
FT                   /protein_id="ABG12393.1"
FT                   /translation="MTKHVAVLLAHGFEEAEAVIFIDIMRRLDIRVDILSCEATTALST
FT                   YFETPISADALLSDRLDHHYDAVMMPGGPKGTDSLTANPQVIAFLRRHIAQDKYICALC
FT                   SSGAKVLAAHHLLAGRTYSTGDKLADKFADGAYLDQDVVVDGKFITAKGLGVSFEFAFT
FT                   VARHLLSDNLPKVEHQASHIYFKHGSAQT"
FT   gene            complement(494517..495371)
FT                   /locus_tag="YPA_0426"
FT   CDS_pept        complement(494517..495371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0426"
FT                   /product="tagatose-bisphosphate aldolase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12394"
FT                   /db_xref="GOA:A0A0E1NWJ7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011288"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWJ7"
FT                   /protein_id="ABG12394.1"
FT                   /translation="MFLVSSREMLRQAQIGGYAIPAFNIHNLETIQAVVETAAEMASPV
FT                   ILAGTPSTFSYAGTEYLVQICQQAARHYRMPFALHLDHHESYDDITQKVAAGIKSIMID
FT                   GSHFNFEQNIALTRQVVEYCHRWDGTVEAELGRLGGQEDDLTVDEKDALYTDPGSAAHF
FT                   IQATGIDSLAIAIGTAHGMYKEAPSLDFDRLALIRRNTDIPLVLHGGSGIPDEDVRRCI
FT                   ELGISKVNVGTELKIAFSGALKAYFLENKGANDPRHYMVPAKAAMKKVIQDKINVCGSA
FT                   GKR"
FT   gene            complement(495480..496967)
FT                   /locus_tag="YPA_0427"
FT   CDS_pept        complement(495480..496967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12395"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZI1"
FT                   /protein_id="ABG12395.1"
FT                   /translation="MSVDISAKPRPIIPYEHPDAAMYYQLFKQHMIRQWHKKRPYARHD
FT                   ARLQALFQNQKVSLQSQCDYLVRYVAEAFDHYAVWDYTHAYYPGRPSQQNARTDALEGV
FT                   SRVLPTLAAWLHSQPTRLDNTRLADLKGGELDIVAILRRAFLAGTDPTHRGYWGTLHDY
FT                   DQRICESADLALALWLSHESVWQAFTPPEQQQVTRWFSQVNTLQTVDNNWHLFPLTVQF
FT                   VMRSLNGTGDISDDKYQRIKEFHVGEGWFRDGAQGNYDYYNAWGFHYSLYWLDQINPDY
FT                   DRQFIRSCMAEFVAAYRYLITPQGIPFFGRSACYRLAVSAPLLAVASHSTDPVHTGEAK
FT                   RALEATLRYFIGHGAMRFGAPTQGLFADDERLVDNYSGPASSFWSLRALNIALYCANDC
FT                   GLWQCESSQLPIETEDFSFTINAIDLFVMGTFETKEVVVTFRYDYTKEQTPLTRRLVSQ
FT                   PWLERVKENVTGRAERPKNNLLRKGVTSYSSKMTSLF"
FT   gene            complement(497090..498697)
FT                   /locus_tag="YPA_0428"
FT   CDS_pept        complement(497090..498697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0428"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12396"
FT                   /db_xref="GOA:A0A0E1NUZ7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUZ7"
FT                   /protein_id="ABG12396.1"
FT                   /translation="MKLPAGKRSLLAGMIAAAGMSMTPVTLAAPAEKPNVLLVIMDDLG
FT                   TGQLDFTLNNLDKKALSQRPVPVRYQGDLDKMIDAAQRAMPNVSLLAKNGVKMTNAFVA
FT                   HPVCGPSRAGIYTGRHPTSFGTYSNDDAMQGIPLDIKLLPALFQEHGYATANIGKWHNA
FT                   RIEKKAFVADEVKSRDYHDNMISVSAPGYAPEKRGFDYSYSYYASGAALWHSPAIWQNS
FT                   KNIAAPGYLTHNLTDETLKFIDDSGKKPFFISLAYSVPHIPLEQASPAKYMDRFNTGNV
FT                   EADKYFAAINAADEGIGRIVQHLQEKGELDNTLIFFISDNGAVHESPMPMNGMDRGHKG
FT                   QMYNGGVHIPFVAYWPKQIPAGTQSDALVSALDILPTALKAAGIAIPAEMRVDGKDILP
FT                   VLAGKEQTSPHQYMYWAGPGAKHYSDENQSFWHDYWKWITYEHQQAPKNDHVETLSKAS
FT                   WAIRDQEWALYFYDDGTNTPKLFNDKHDPMESKDLADQYPERVSAMKAAFYDWIKDKPK
FT                   PVAWGQDRYQILASSAKS"
FT   sig_peptide     complement(498611..498697)
FT                   /locus_tag="YPA_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 29"
FT   gene            complement(498718..499944)
FT                   /locus_tag="YPA_0429"
FT   CDS_pept        complement(498718..499944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0429"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12397"
FT                   /db_xref="GOA:A0A0E1NQM4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQM4"
FT                   /protein_id="ABG12397.1"
FT                   /translation="MAQPHTQQAYFHMMAKPTSYRCNLDCEYCFYLEKETVLPPQKNPS
FT                   PTMSDSMLRRYVRDYLRSHAGDTVDFAWQGGEPTLAGLDFYRKAVEYQQHYANGKTVTN
FT                   SFQTNGIAINRQWAAFFAEHRFLIGLSVDGLEAVHDKYRIAVNGQPTFARVKKALDLLR
FT                   EYQVDFNTLTVVNDQNWDKGRETYQALKALGSTFMQFIPIVEVDTRCLSRTTGHYSPPA
FT                   NPPMAPFTVPAAGYGRFMNDVFDAWVTEDVGTVYVREFDSLLGTWMGYPAASCIQSVTC
FT                   GQALIIEANGDIYSCDHYVYPAHRLGNIADTSLVKLATSRQQQRFGDAKQEKLTQACIR
FT                   CEVKALCQGGCPKHRIMALPDEKHKHNYLCASYKHFFNHTAPLMQAMCQIIQRGGIAAD
FT                   IMPQLTQPK"
FT   gene            complement(500188..501246)
FT                   /locus_tag="YPA_0430"
FT   CDS_pept        complement(500188..501246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12398"
FT                   /db_xref="GOA:A0A0E1NXX1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXX1"
FT                   /protein_id="ABG12398.1"
FT                   /translation="MSNMTQQTRTQQARETMKRVYRYQAANQTRSVIRRSGKTRFIKDT
FT                   DWERGVFWSCVAAAWLATDDAEYLEGVMNYTLHTGFRPGPNLRFADDLICCQAYLDVWP
FT                   QIAVPEALEPTIKAVSAMVDEPKPGREDWWWCDSLFMAPATFAALSQRTGDARYLAYMD
FT                   TAFWDAVDYLRDPDSGLFYRDHRYIPDGTGTELREENGEKVFWSRGIGWVLAAIPRLLA
FT                   RMPEDYTGRQRYLDLFTDLADNVIRYQQADGLWRTSLLDPQRFPAPESSATALFCYGLS
FT                   WGINQGILAPETYLPVVEKAWDALQGCIHDNGMMGWVQLPAFNPRDVKFEHNMDYGAGA
FT                   YLLAASEMLRLA"
FT   gene            complement(501262..502017)
FT                   /locus_tag="YPA_0431"
FT   CDS_pept        complement(501262..502017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0431"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12399"
FT                   /db_xref="GOA:A0A0E1NN13"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN13"
FT                   /protein_id="ABG12399.1"
FT                   /translation="MQPFDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPE
FT                   TQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEVMGHIDILINNAGIIRRQDLLEFGN
FT                   KDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASKSAV
FT                   MGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDL
FT                   AGPAIFLSSSASDYVTGYTLAVDGGWLAR"
FT   gene            complement(502213..503379)
FT                   /locus_tag="YPA_0432"
FT   CDS_pept        complement(502213..503379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0432"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12400"
FT                   /db_xref="GOA:A0A0E1NTF1"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF1"
FT                   /protein_id="ABG12400.1"
FT                   /translation="MRTAYLADRTFTPQGIETGVAVIVEQGEIVAVTRELPADAEIVHL
FT                   TGKTLIPGLIDIHIHGRQGADVMDASAEALRTIARALPQTGVVAWVGTTVSAPIQDIFA
FT                   ALAQVRDFIADPDNARDTRTATLLGSFLEGPYFTAPFRGSHPEKYLTTPTPQELEQLRH
FT                   SAGNTLLRAAIAPESPEALAAIRWLVNHGIKTSVAHTAANFEQVTAAYQQGADCGVHLY
FT                   NGMSGLHHREPGCCGAVLYHDMLAELIADGIHVHPVMMNLAYRMKGYRRIALITDCMRA
FT                   GGLGEGRYLLGAQHITVRQGEARTDDGSLAGSTCSLDQALRNMIQHAQVPEWEAVQMAS
FT                   AVPAAYLGLASTLGSIQMGAQASMVVMESDFTVAATLIKGEWAYRHSA"
FT   gene            complement(503382..503822)
FT                   /locus_tag="YPA_0433"
FT   CDS_pept        complement(503382..503822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0433"
FT                   /product="putative PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12401"
FT                   /db_xref="GOA:A0A0E1P162"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P162"
FT                   /protein_id="ABG12401.1"
FT                   /translation="MIGIVVSGHINFASGMASAVRAITGEQSQMLFIDFVESMSTDMLE
FT                   SELRRAAHEVDSGEGVLFLTDIPGGSPCNRALNILMSGSNVELLAGVNLPMIANAAFER
FT                   EGASLSELVEILMDIGASSVQNLRAELDTALVTDSGENEDGL"
FT   gene            complement(503908..504798)
FT                   /locus_tag="YPA_0434"
FT   CDS_pept        complement(503908..504798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0434"
FT                   /product="putative PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12402"
FT                   /db_xref="GOA:A0A0E1NXF2"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXF2"
FT                   /protein_id="ABG12402.1"
FT                   /translation="MASDITVDKDHTAKAKTDSLVDKIDSYQDLEVRKVVTRKDLWKCA
FT                   IRGLFMEGNFNFERMQAGGFAYSMIPALKKIHGNNRADLAKSLKNHLQFFNASPKLFTF
FT                   LLGTAVAMEENKEKPSMINVMKVAGMGPTGGIGDAIDHMTLMPLTLALGASIAIEGSIA
FT                   GPFVFFILYQTVHFLVYFGLMFMGYRAGTAAMVNMGDATEKLAKAANIMGIFVIGALCA
FT                   TFIRLQTTAAIDLGGKTVELQTALFDKIMPNLLPLALVFFMFKMVKGTGFWAKPPVLIF
FT                   STLAAGVVGHLLGIV"
FT   gene            complement(504788..505576)
FT                   /locus_tag="YPA_0435"
FT   CDS_pept        complement(504788..505576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0435"
FT                   /product="putative PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12403"
FT                   /db_xref="GOA:A0A0E1NPS8"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPS8"
FT                   /protein_id="ABG12403.1"
FT                   /translation="MLFEATLVGIWAFLCGIDKYDVALNIHRPLITGPVVGLIMGNMEV
FT                   GLIAGATLELAWLGLVPNAGAQPPDVTMGTIAAVAFAVMTGQSPEVAMGVGMPIAVLMQ
FT                   MIIIGFFAMTAFTMGRADKYAEQADTAGISRLLIGTLLTRSMLYFVIAFVTVYFGEHAA
FT                   TWIDENTPTALLEGLGIGAKMVPAIGFAMLLKIMWSKEVAGVFFIGFVMTTYLKLPIMA
FT                   IAILGAAVAVLYYFFSGNNNGSNNNGNNTNKQPEDFEDGI"
FT   gene            complement(505623..506120)
FT                   /locus_tag="YPA_0436"
FT   CDS_pept        complement(505623..506120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0436"
FT                   /product="putative PTS transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12404"
FT                   /db_xref="GOA:A0A0E1NXD2"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXD2"
FT                   /protein_id="ABG12404.1"
FT                   /translation="MTRPNIVWTRIDERLLHGQIRITWGKHTEANLILVANDDAADGPN
FT                   SAFMQAGMKASAGGEYAVRFFSIQKTIDVIHKASPQQKVFILCNSPTDVARLVEGGVPI
FT                   TQCNVGNMHYHDGKRQIAKTVSVDEKDLDAFQRMAALGVACTVQNTPDQTPINVIELAA
FT                   RA"
FT   gene            complement(506138..507304)
FT                   /locus_tag="YPA_0437"
FT   CDS_pept        complement(506138..507304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0437"
FT                   /product="putative phosphosugar isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12405"
FT                   /db_xref="GOA:A0A0E1NLU6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR014180"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLU6"
FT                   /protein_id="ABG12405.1"
FT                   /translation="MTQYLGYSREELTRLHASWTAQEIEQQPACWGKTQRIVEESQAAI
FT                   NDFLHQALAASNTRIIFTGAGTSAFAGRALAPLLAPYLSHRIEAIATTDLVATPEQYFS
FT                   EDIPTLLVSFARSGNSPESVAALQVASACLSRCFHLVLTCNQGGQLYQYCQTAPGALAV
FT                   LMPAETNDQSLAMTSSFSSMMMAAMAIFAGIDKYSKEIERFCKGSADWFKEINHKIIDN
FT                   TKSSQYQRVIYLGSGGLQGLAQESALKLLELTAGKVVATFDTPLGFRHGPKSIVNPDTL
FT                   VVVYISNDPYTRQYDLDLLAEVRANNVAGKVIAIAAQSDAYVTAGDHVLVPGMAESSDL
FT                   GLLFAYLMFAQSFAFHSSVALNNTPDSPSPTGEINRVVQGVTIYPFKK"
FT   gene            complement(507301..508599)
FT                   /locus_tag="YPA_0438"
FT   CDS_pept        complement(507301..508599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0438"
FT                   /product="tagatose-bisphosphate aldolase noncatalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12406"
FT                   /db_xref="GOA:A0A0E1NLF2"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF2"
FT                   /protein_id="ABG12406.1"
FT                   /translation="MHPLEKLVQRHKAGEQIGIYSVCSAHPLVIEAALEQALENDSELL
FT                   IEATSNQVDQFGGYTGMTPVDFRDYVFAKADALHFPLEKLILGGDHLGPNRWQHLPANE
FT                   AMAHADDLIAAYVAAGFKKIHLDCSMSCADDPVPLSDEIVAERAARLAAIAEATEYQHF
FT                   NTHTAVYVIGTEVPIPGGATEELDEIEVTSPEAARKTIECHQKAFEKSGVAECWPRVIG
FT                   LVVQPGVEFDHTGVIDFCPEKAHELSKVMDEYDYQVFEAHSTDYQTDDAYRALVKGHFA
FT                   ILKVGPALTFALREALFSLCHIEEELFPAEQCSRLRQVMEDVMLKSPEYWKRYYLGDTE
FT                   QVRLARVYSFSDRMRYYWPMEAVQAAQEKLFANLNSAPIPLPLLSQYMPRQFTAVREGT
FT                   LSFEATALVKQQIKNTLIGYVNACHLFNGNTSK"
FT   gene            complement(508649..509425)
FT                   /locus_tag="YPA_0439"
FT   CDS_pept        complement(508649..509425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0439"
FT                   /product="DeoR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12407"
FT                   /db_xref="GOA:A0A0E1NNT4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNT4"
FT                   /protein_id="ABG12407.1"
FT                   /translation="MKAAIERRMEIFNIVTQQGKARVEDLAERFNVSSVTIRSDLSFLE
FT                   KNGYIVRSHGSAIPNTGVIAELTVHEKRRRNSGVKSLIGQAAAKLINSGDTVILDSGTT
FT                   TREIAANLRSVENVVVMTNGLDVAMELASAPGVEVLISGGVLRKSAMSFSGSQAEASLK
FT                   NFRFDKVFLGVDGFDLRVGITTYNEQEASLNRLMCDISEQIIAVADSTKFGKRSCHMIR
FT                   EFGDIDILVTDSDIPEEYVQRLRDMRIEVIIAEKEK"
FT   gene            510265..511818
FT                   /locus_tag="YPA_0440"
FT   CDS_pept        510265..511818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0440"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12408"
FT                   /db_xref="GOA:A0A0E1NNL1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNL1"
FT                   /protein_id="ABG12408.1"
FT                   /translation="MSLTRRNLLKGIAVSGALGATAAATGVLSTAQAVVPAKKTGKQPN
FT                   LLIIFPDEMRTQSLGFMGQDPSITPFINQFASQSVVLKQAVSNYPLCTPFRGMLMTGQY
FT                   PYRNGLQGNCHTGADGNFGGKDFGIELKKESVTWSDILKKQGYSMGYIGKWHLDAPEAP
FT                   FVPSYNNPMEGRYWNDWTPPEKRHGFDFWYSYGTYDLHLNPMYWTNDTPRDKPLKINQW
FT                   SPEHEADIAIKYLRNEGGKYRDNDQPFALVVSMNPPHSPYDQVPQKYLDRFKDHTSESL
FT                   NTRPNVVWDKAYQDGYGPKYFKEYMAMVNGVDEQFGRIVAELDRLNLDKDTLVVFFSDH
FT                   GCCMGSNGQPTKNVHYEESMRIPMMFRWPGKLPVREDELLFSAPDIYPTLLGLMGMSEH
FT                   IPDQIEGTDFSNTVAGRPGDKRPTSQLYTFMPYGGQSYGQRGVRTDRYTLVIDRKVGKP
FT                   LTYTLHDNKNDPYQMKNIAAENMALVNQLIADELIPWLEHSGDVWRPTEVAANAAKAYL
FT                   "
FT   sig_peptide     510265..510366
FT                   /locus_tag="YPA_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 34"
FT   gene            complement(512270..512704)
FT                   /locus_tag="YPA_0441"
FT   CDS_pept        complement(512270..512704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0441"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12409"
FT                   /db_xref="GOA:A0A0H2Y424"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y424"
FT                   /protein_id="ABG12409.1"
FT                   /translation="MWITIAPFVTVFAPKYRRQVFYREKRRAIGSILRKLCEWKNVNIL
FT                   EAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYV
FT                   DTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            512761..513783
FT                   /locus_tag="YPA_0442"
FT   CDS_pept        512761..513783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0442"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12410"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12410.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            513783..514562
FT                   /locus_tag="YPA_0443"
FT   CDS_pept        513783..514562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0443"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12411"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12411.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(514613..514738)
FT                   /locus_tag="YPA_0444"
FT   CDS_pept        complement(514613..514738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0444"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4F8"
FT                   /protein_id="ABG12412.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFVNDG"
FT   gene            complement(514907..518020)
FT                   /locus_tag="YPA_0445"
FT   CDS_pept        complement(514907..518020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12413"
FT                   /db_xref="GOA:A0A0E1NZQ2"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015176"
FT                   /db_xref="InterPro:IPR015177"
FT                   /db_xref="InterPro:IPR024200"
FT                   /db_xref="InterPro:IPR039174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZQ2"
FT                   /protein_id="ABG12413.1"
FT                   /translation="MYAPSRLKLIALTMTTLLGTAAYTPHLSANNTKSAKTEVSQKALM
FT                   QSSIIDFDGNQLPDFVTASSGSTLSLSSTRYIMGQQSLKWEWQAGSTMTIEHPITLVTD
FT                   KVASKTWGRKATQVLSFWIYNETPVDDYMIVDLGRGLGPSGAPDAGIKVKMNFSGWRTV
FT                   GVSLQNDLEGREIEGIGFDDNAEGESGGRSTIAGGAKSDMDSIRFRAPLKAPAGIFYID
FT                   RVMLSIDDARYQWSDDHVKTRYQIPEINFRLPAKLPAPTAGEIAAADDIRGALIRVFTE
FT                   GQGGENGLVVVDNREKLRAHFAALKIQRDADGQLSGRHIITDKQKVLYQPEFMDDIDQQ
FT                   RFSDYVLLGDYTTLMFNISRAYQRSTSEEVRQELADMYILMTQHLLDQGYMDGSGLVTT
FT                   HHWGYSSRWWYISAMLMANELDKHQLRQPVSDALLWYSREFKANFDMVPGPESSDLDYF
FT                   NTLSRQHLALLMLESDPAKRVALLKRFGEYINVALSQTPPGGYDGLRPDGTAWRHEGNY
FT                   PGYSFPAFKNAGQLVYMLHGTPFAVSDEGRAALKKAMLSAWVYSNPATSLGLAGRHPFN
FT                   SSSVTLFQDAFRWLALTGDPKTGDKVDKALAAAYLQITETPESESEAIFGVRIAPAELP
FT                   QGNWTFNGGAFGIHRFSDKMVTLKAYNSNVWSSEIYYRDNRYGRYQSHGAIQVLPYGNQ
FT                   KEIGFVQDGWDWNRNPGTTTIHLPLAELDSPNTHTLMLRGNHPFSGHSSLSGKYGMFAF
FT                   KFDAPSMPKFDSSFTARKSALETENRLVLLGSNISNNTEKYATETTLFQHGITDKASDL
FT                   WVNGERITALPYQRALEEGDWLIDGHGNGYLLTKGAKGEVRRQHQVSANDKSRDPTEGN
FT                   FSLAWLDHGAKPQNAQYEYLMVLEATPEGMQQLATDYRAGKKVYEVLRQDASAHIVRDN
FT                   VTQTTGYAAFSSVTPDEGVVKNIAQPAIVMTQMQSHGQLKISGVTPDLNMTRTTKATPL
FT                   AIAVTLNGQWQATENNPQVSVKLAGETTQLVFTSYFGMPQEVTLKPMN"
FT   sig_peptide     complement(517931..518020)
FT                   /locus_tag="YPA_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.775 at
FT                   residue 30"
FT   gene            complement(518090..520276)
FT                   /locus_tag="YPA_0446"
FT   CDS_pept        complement(518090..520276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12414"
FT                   /db_xref="GOA:A0A0E1NZF8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZF8"
FT                   /protein_id="ABG12414.1"
FT                   /translation="MHNKFKANTLAISIAAILLSVSFNTLAVVCPPEAPAGSSCDAFIA
FT                   NDGKAVSLANDLYITNGNALTYSGNTPFVAQYLRKNIIATGTDAHAIYADANTVFNNNI
FT                   NLERGISIISENGTAIKIDGSFSHTAAAPNFGIAVKDGSIVRGNGAAIDFRDAQTAIRM
FT                   DINGSIYGDILGNGVTGNKINFAYQGAAANALFDGYTISGVEKLENWGNLSIIAKDRTI
FT                   TWSGDFTNKNNASLDFKIGDEVDLASPILLVEGKTVFNTGSKALFSYVGSNINDIVNKD
FT                   IILIQSNGGMSGPIDVAQNEITVVSNLSPLLAQTDSWVTTTDPIVNGGISGNQLVVRYG
FT                   VNYEGTDNFLDLALQGGANQYQLNAANYIVSYALSQYNKTQSEASGELLALLTSAGNSS
FT                   AGIASIADQITPNAEGGEVRAALRMVDKMRDQIDNRSLYLRNQSAATPWNFWAQTLYAH
FT                   SRQSSGTYTPGYQTNGYGINVGVDRRFNDESLFGVSLGYQNANINIHSYGNEKDVDSYE
FT                   LMAYTGWFDDRYFFNGNVNMGYNSNSSTRNIGENTGYQGNTKATADYNSLQMGYQVKAG
FT                   MTFDLDVVKLQPSVAYNYQWLRVDDYAEFGSPASLEVDRQSYSVKHLGAGLTAFNTYEL
FT                   GMGLLTPSLTLMGYRDLNDTEIIVKKAGLTTDQGKGKGRFIVEGDSVGNNIFEAKMNSN
FT                   LQLKNNLSLDGNINYYKRGDYNEGYIGLSVSKHF"
FT   sig_peptide     complement(520193..520276)
FT                   /locus_tag="YPA_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 28"
FT   gene            complement(520391..521341)
FT                   /locus_tag="YPA_0447"
FT   CDS_pept        complement(520391..521341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12415"
FT                   /db_xref="InterPro:IPR031605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR48"
FT                   /protein_id="ABG12415.1"
FT                   /translation="MKAKLLITSGKLLVTSGTAACLGIMAALMPADVQAAQVNATLSWV
FT                   TGDYGTTYDYSGPRLDMTINPDGSNWYYDLGFRKQLHDTDQRYQRMEVSAGYRFRFAEG
FT                   WVQPSFRLREDLSTYASGNRTTINFYDAKVAGQYQLSERFAFVGNMIVGMEREEANTAS
FT                   NLVERNSDRLSWEIEPGIRFKSSANTQMTLNYFNAGKRSDKGETWGLSDDSKNQQVRFY
FT                   FNWNTPIGLVLTPYARYSLDYGETSGWYESAAFSETKTMSKVDRLALQLAYPLSDTFRL
FT                   QAEYYIENVKYQEGYTMGKDDSRVKYMRVGVRATF"
FT   sig_peptide     complement(521234..521341)
FT                   /locus_tag="YPA_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 36"
FT   gene            complement(521363..521557)
FT                   /locus_tag="YPA_0448"
FT   CDS_pept        complement(521363..521557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y376"
FT                   /protein_id="ABG12416.1"
FT                   /translation="MCYFVIHRKHSKAYKGYNHTHSTSLHQVINHKKAIYLQAGQKISG
FT                   NGAIDAGTSLHIPQCSVFL"
FT   gene            complement(521944..522252)
FT                   /locus_tag="YPA_0449"
FT   CDS_pept        complement(521944..522252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4G2"
FT                   /protein_id="ABG12417.1"
FT                   /translation="MLIFLQNLRFFSTYCHHDSYYFEMIFQRVLSVTDRESKQDMYKTI
FT                   TVGCFVGLMVAWLPPAAVQQYVMQFELLAQRWKTSHTGVPDQTFDDNQLKEIARYPE"
FT   gene            522628..523383
FT                   /locus_tag="YPA_0450"
FT   CDS_pept        522628..523383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0450"
FT                   /product="putative carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12418"
FT                   /db_xref="GOA:A0A0E1NST3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NST3"
FT                   /protein_id="ABG12418.1"
FT                   /translation="MSKITDCCSEENHPNSRRSVLKAALGMTAAGVIGGIGLGLPQISY
FT                   AAALTQEERDKLTPDQIVESLKQGNKRFTSGKALQHDYLAQKRASAEGQFPAAVILSCI
FT                   DSRAPAEIILDTGIGETFNARVAGNIANDDLIGSLEFASAAAGAKVILVMGHTACGAIK
FT                   GAIDNVELGNLTGLLNRIKPAIEVTQFDGEKSSKNEKYVDAVAKTNVKNTMDEIRKNSE
FT                   IIRKLEQEGKVKIVGSMYNLNNGEVEFFM"
FT   gene            524126..524542
FT                   /locus_tag="YPA_0451"
FT   CDS_pept        524126..524542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12419"
FT                   /db_xref="GOA:A0A0E1NRK4"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRK4"
FT                   /protein_id="ABG12419.1"
FT                   /translation="MYVDTVSVVSGSKFIDINGKGVIDYEKEMSLDCCMNKIHFHTRKV
FT                   SIDINEKQKRLVMCLFNDVNRKQDIIKVVWYENHKSISDNNYHQLIHKFRVHLKSFGIP
FT                   EGIIKTINRYGIRLDPSLLITVMSTKMNERFSGY"
FT   gene            524580..525113
FT                   /locus_tag="YPA_0452"
FT   CDS_pept        524580..525113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0452"
FT                   /product="general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12420"
FT                   /db_xref="GOA:A0A0H2Y5E9"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5E9"
FT                   /protein_id="ABG12420.1"
FT                   /translation="MLSLFIMRFFLLKIRLKNPFRTLNCNQFIFIELSIVFLVAFHTVM
FT                   VFWSIIYNDSNDMFILYDGQSYDSQNSTEKAKVIDSSNLSKMFDRKINKPDKKIEMNDV
FT                   LFYSPEYIGEIKLVGVIEHSAPSESIAILEVKGKQTTHLTRENINYEDIVIVKIFTDRV
FT                   IIKRNGKYYSLIIN"
FT   gene            525194..527116
FT                   /locus_tag="YPA_0453"
FT   CDS_pept        525194..527116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0453"
FT                   /product="general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12421"
FT                   /db_xref="GOA:A0A0E1NTF5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF5"
FT                   /protein_id="ABG12421.1"
FT                   /translation="MYISGKGIKSIHGMIFLFTLIMPLDIISANFSVSFKDVDIKEFIN
FT                   SVSKNINKTIIIDPTVQGLISIRSYENLDKDTYYQLFLNVLDVYGYAAIEMPHNVLKVI
FT                   SSKRAKGVVAPLPKEGVTFDGDELINRVIPLRYISAKKITPLLRQLNDNTESGSIINYD
FT                   PSNILLITGRAAVVNRLHSIVTDLDQAGDNEIELYKLNYAIAADVVKIVNEAINPINNL
FT                   KQEVSIVGKVIADERTNSILISGDTYIRKKSILMIKKLDKRQSSDGNTKVVYMKYAQAS
FT                   KLLDVLNGISEGFHNEKKTKQSNQWNQRPVAIKAYDQTNALVITADPDMMLALGEVIEK
FT                   LDIRRAQVLVEAIIVETQNGEGINLGVKWENKRSDDINFIKNSDGLLNNNGWGIATTIT
FT                   GLTAGFYKGNWDVLLSALSTNTNNNILATPSIVTLDNMEAEFNVGQEVPVLISTQTTTT
FT                   DKVYNSISRQSIGVMLKVKPQINKGDSVLLEIRQEVSSIADSSTVNTHNLGSVFNKRVV
FT                   NNAVLVKSGETVVVGGLLDKKSSTIVNKVPFLGDLPLIGWLFRQTKEKVEKSNLILFIK
FT                   PTILRESDDYSVVTSKEYNKYKKDNMNGYTLADDIVLSDKKYLSVIPSIRKDINNFYTL
FT                   LDSEL"
FT   gene            527263..528624
FT                   /locus_tag="YPA_0454"
FT   CDS_pept        527263..528624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0454"
FT                   /product="general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12422"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4G7"
FT                   /protein_id="ABG12422.1"
FT                   /translation="MAHSPILFNLVTDEEFENNLTERYQNNSADPYQTMSVISNEIDIY
FT                   SFANELSDDDDLLDINDEAPVIKLINSILVEAIKELASDIHIESFDKKLTVRFRIDGVL
FT                   RKILELQRHVALLLVSRIKVMAKLDIAEKRIPQDGRIALNLAGRALDVRVSVLPSSHGE
FT                   RVVMRLLDKNSIKLDLPSLGMSKDNCISMNTQVHKPHGIILVVGPTGSGKSTTLYAALM
FT                   GIDANEKNIMTVEDPIEFDIPGISQTQVNPKIEMTFARSLRAILRQDPDVILIGEIRDI
FT                   ETAQIAVQASLTGHLVLSTLHANSAIGAVTRLKDMNVEAFMLSSSLLAIISQRLVRRLC
FT                   IACRQESSVTEKVLQRLNIDDKCSLVGSVYRAKGCNKCNLTGYRGRIALHEFLVVDNLL
FT                   RGAIYKGLGEFELAKLASGAINSLLSDGISKVIAGLTTIEELVRICQEDDNGCI"
FT   gene            528766..529812
FT                   /locus_tag="YPA_0455"
FT   CDS_pept        528766..529812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0455"
FT                   /product="putative general protein secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12423"
FT                   /db_xref="GOA:A0A0H2Y575"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y575"
FT                   /protein_id="ABG12423.1"
FT                   /translation="MVKKNSNKTDLVLITRQIATLVNASMPLDEVLDIVGKQNSKSKMI
FT                   EIIQRIRVNIQEGHSFADALSPFPAVFSPLYKTMVTAGEVSGHLGLVLVRLADHIEQTQ
FT                   KIQRKIIQALIYPCVLVLISLSVIIILLTAVVPNIVEQFSFSETALPLSTKVLMILSYS
FT                   IKENVIFIMAIGVSAVIFLNRLLKINKINVFFHRHYLSLPMLGNMFVRINTSRYLRTLT
FT                   TLHSNGVTIVQAMSISNAVLTNVYIKNKLNISVKLVSEGCSLSSSLVDSGVFPPIILHM
FT                   IISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPI
FT                   LEINSLVM"
FT   gene            529832..530269
FT                   /locus_tag="YPA_0456"
FT   CDS_pept        529832..530269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0456"
FT                   /product="general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12424"
FT                   /db_xref="GOA:A0A0H2Y435"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y435"
FT                   /protein_id="ABG12424.1"
FT                   /translation="MANKKTKGFTLLEIMVVIVILGLLASLTIPSLMSNKNRADQQKAV
FT                   SDISALENALDMYRLDNGDYPTEQQGIAALVTKPNVPPLPQRYPSDGYIRRLPTDPWGN
FT                   SYQMNNPGKHGQIDIFSIGPDRLPETEDDIGNWITLSISET"
FT   sig_peptide     529832..529951
FT                   /locus_tag="YPA_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.414 at
FT                   residue 40"
FT   gene            530274..530816
FT                   /locus_tag="YPA_0457"
FT   CDS_pept        530274..530816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12425"
FT                   /db_xref="GOA:A0A0E1P2D1"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2D1"
FT                   /protein_id="ABG12425.1"
FT                   /translation="MFHSQRAFTLLELLLAMIIISGLYYSVLITLPKGSGVVKSEAENL
FT                   VQGLRYINQKIRHEGGVFGLKLSETHWRFYKFCCDDCHGIKDNFKINTKINCIWQDSGN
FT                   DKILSREYPDKLTSKLNVYGEDSIIDNVIGDNIKPQLVFSPEEEYSDFSLVLRNEENSE
FT                   CVEIKNNITGVSLFIHK"
FT   gene            530854..531198
FT                   /locus_tag="YPA_0458"
FT   CDS_pept        530854..531198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0458"
FT                   /product="general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12426"
FT                   /db_xref="GOA:A0A0H2Y388"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y388"
FT                   /protein_id="ABG12426.1"
FT                   /translation="MLEVIIALTIFCIAGLSIMKIISERLRWINILEQRMISSWVAENV
FT                   LTEIKILKIEQTNEWLMGQESMAGQLWYWQSRSIKLQDDRMEIIAVEVRNNKESEHPDF
FT                   SLEGYKTTND"
FT   gene            531170..531787
FT                   /locus_tag="YPA_0459"
FT   CDS_pept        531170..531787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0459"
FT                   /product="general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12427"
FT                   /db_xref="GOA:A0A0H2Y4H2"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4H2"
FT                   /protein_id="ABG12427.1"
FT                   /translation="MKAIKQPMIKRPDCGFTLLEMLLAVVIFSMISFIIYSSLRVTIKS
FT                   NNIMGNKVQELIRLHRVISLLERDISHSVMYIGSQNDYFSNEGRIIGIGVLDSDSFGIY
FT                   MLRNNKINTEIFIHYQHERLGYRLKKNCLERLSYLILKNTNKIETKFSCLIEGINDFRV
FT                   RIFHQGKWLNEWSRIDLSPQGIEIILDVKGVGVIRRFILLLH"
FT   gene            531796..532752
FT                   /locus_tag="YPA_0460"
FT   CDS_pept        531796..532752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0460"
FT                   /product="general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12428"
FT                   /db_xref="GOA:A0A0E1NSB3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSB3"
FT                   /protein_id="ABG12428.1"
FT                   /translation="MNQNGIALLMVLCALFLMSTMVMASYNYWFDIYYLAKNSQQRQKE
FT                   KWILLGAEEKFVSKLIKNTSEDRFNDNEFRRLLSGGRVTVGTWNVNFKSIDNTNCFNIN
FT                   ALKTKISNPEEIIETYSWQVFKYLLLISGVGVKETQDTLERVVELYRSNLVIEQSINGL
FT                   STLKEIPYEADEINISSKMNRADFLKIAPVLCIRGDRKLLVNINMLDAGNSQYLQAALL
FT                   NKVSARDIYDVISAKPNNGWDNIFIFYDLLSSHSPMSARNVNKNILDKLTVDEYFINYI
FT                   FRIDHEDSYYQLITFIHAVGKSIAILNRRYSFSEQHH"
FT   sig_peptide     531796..531870
FT                   /locus_tag="YPA_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            532736..533926
FT                   /locus_tag="YPA_0461"
FT   CDS_pept        532736..533926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0461"
FT                   /product="general secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12429"
FT                   /db_xref="GOA:A0A0E1NYM4"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYM4"
FT                   /protein_id="ABG12429.1"
FT                   /translation="MSNIIDDVKLTFTLLIRLGETEFEPIYWYVESQGKKLVRHGKING
FT                   VAELKNITLYANNVVKILVPANKIIFRSLSIKKNEVMNNIKSIAFSIEQSISSDIDNFH
FT                   IVILDQDKDFCHVAAIEHELMNRWLFWLNINGISACCIMPDAFALPFFNSEWSVIKIES
FT                   NWLVRNNEMSGFLVNSSVLENILMLAEPTIKVNTFSPTDIKWGNWQSLDYSDPVLIMAK
FT                   TVSGNHVNLLSGKYKYAERIIVNNSVFLRVASWFFLLFLVMSLNGWYQGYKIVRDTGAL
FT                   SKVAQDFYADFLPPAYHGGDVNTSFNKYISDLDLKKNNVSFIKLLNAVSYYTADENVDV
FT                   RSFNFNYSDGEISFDIEGDDDLINEMLNDKTNLFNARVEVIRSGEDKYNIKLSSQP"
FT   gene            533923..534384
FT                   /locus_tag="YPA_0462"
FT   CDS_pept        533923..534384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0462"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12430"
FT                   /db_xref="GOA:A0A0H2Y5G1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5G1"
FT                   /protein_id="ABG12430.1"
FT                   /translation="MSYVMFLQHLFSAKRRVLLLYLLVISIPIVYYITSRVIEVRNNKL
FT                   LIKYSELSYHLQQHSIMAKKSNIKSHKKSDPIDIEINKSFKNKNIIFTVSLLDGGKCFV
FT                   EINSAKFSNLLDAIIDVSNKYDINVSSADIYLHQDDDDGYVAGKIIFFK"
FT   gene            534410..535252
FT                   /locus_tag="YPA_0463"
FT   CDS_pept        534410..535252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0463"
FT                   /product="type 4 prepilin peptidase 1. Aspartic peptidase.
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12431"
FT                   /db_xref="GOA:A0A0H2Y392"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y392"
FT                   /protein_id="ABG12431.1"
FT                   /translation="MMDIQVFFVSYLIFGAMVGSFLNVLIYRLPIMLANLSSRSESHGE
FT                   EIKMRSHLRNINLFQPGSFCHHCNESIPIKYNIPILGWIFLRGASRCCNKKISTRYLFI
FT                   EVLAVIQTLLVLMIFKEDLLICTSLVLIWSLTALAFIDFDTYLLPDCMTIPLLWLGLLI
FT                   NIDTVFAPLTSAVLGAVSGYLFLWLSYWLFKIVRGVDGMGYGDFKLMAALGAWFGVSAV
FT                   PFLILFSSFFGLVAYAIFYFFDKKDNGKEINYIAFGPYISLAGVLYLFLGSHVTNLFS"
FT   gene            complement(535304..535609)
FT                   /locus_tag="YPA_0464"
FT   CDS_pept        complement(535304..535609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0464"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12432"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSV8"
FT                   /protein_id="ABG12432.1"
FT                   /translation="MPNSNIKLMVFFAPILFGCQINSEEKKPNEEIINQLTALTAGLRF
FT                   LKEDCNLKKIPNEQEIINSAIKIANLKGEIMTSKHNNKIIKKSESLYQDIKISNQI"
FT   gene            535893..536642
FT                   /locus_tag="YPA_0465"
FT   CDS_pept        535893..536642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0465"
FT                   /product="putative regulatory membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12433"
FT                   /db_xref="GOA:A0A0H2Y585"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y585"
FT                   /protein_id="ABG12433.1"
FT                   /translation="MNTIVINDVFFTPQKRTIDRNGKVTKIRNKESELLSLLCEYYPEP
FT                   ISREDIEKRLWEGSYVTDNTLTQTISNLRHALDDKKHELVVTIPKKGYRIGIKPEIFIE
FT                   GEVQCQPYEKLGIIGSSVDKMAMSFLKGKMSFYRVCLFVLGVIFFFIFFNVALYRYQVK
FT                   LVDVNSLPILINLDKEQDKTFLSVYQQHPYVLLKKKKMAAMLFVNARETSWYAKKIIYS
FT                   ILFSILLGGGGGNYWYDLCLYTSDEKS"
FT   gene            536605..537006
FT                   /locus_tag="YPA_0466"
FT   CDS_pept        536605..537006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSW4"
FT                   /protein_id="ABG12434.1"
FT                   /translation="MIYAYIHPMKNLEGYWEGNYLLRTDSGNYHIFSRVNIINRSIQSS
FT                   MDVYDDRDQVKARCNTLFNIRSANNVFCVKMLSISFVDNEEKMLSDFLNTPYDVSYPIF
FT                   YRLDANTILIEQSQGHPVNSTRLLVRANI"
FT   gene            537161..538852
FT                   /locus_tag="YPA_0467"
FT   CDS_pept        537161..538852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0467"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12435"
FT                   /db_xref="GOA:A0A0H2Y5G5"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5G5"
FT                   /protein_id="ABG12435.1"
FT                   /translation="MFSRMNYVVKKYFGYIMSKLSLSESRLGILFGFTLVISLFSLLQI
FT                   FSIGYLSHILKSTKANVEITHRNHQQEALMDRARMELLIASDKLNRAGIYYMEDKETGS
FT                   EGSWQSLLNEALQSLQQSQDSYLQLQAVSAQDSRQELNELKESYHQLYQGLAEIAQGLA
FT                   QKHNIDTFFDVPIQGFQSDFTEKYYRYLQESEKGSTAMDEQLLSSLSSAKQIIIGALAI
FT                   LLVLAFSAWLGVTRWMIAPLNHLISRINKIAAGDLSHRIEDTSFACREIRQLTYSVRHM
FT                   QEGLVALVSQVRGGAEVILTGVNQITADNHRLSEQTHSQTQSLAVTAQSMQQLTVRVKQ
FT                   NSMSAEQANHLVNEARDTASQGGEMMSNVVSSMADISTGSREISEIITLIESVAFQTNI
FT                   LALNAAIEAAHAGEHGRGFSVVAREVGTLSHQSGHSAQNIKRLIQHSANSVSTGASLVN
FT                   RSGENLQAIIDVVKKVTDLMAEITTASHYQSKGIEEMAAQVEMINGATKQNAALVEQSA
FT                   HASEVLQQQTLQLNQSVARFHLPVEKYSPLRLAKESTIAAIDSRVS"
FT   gene            complement(538838..539473)
FT                   /locus_tag="YPA_0468"
FT   CDS_pept        complement(538838..539473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12436"
FT                   /db_xref="GOA:A0A0E1NYE8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYE8"
FT                   /protein_id="ABG12436.1"
FT                   /translation="MPGTTLHYIFDPLCGWCYGAAPLVQTAQNIPGLTLVLHGGGMMSG
FT                   ANRRQIDTQWRSYVMPHDKRIAELTGQTFGDNYFNQLLNDTSAIMDSTPPIAAILAAEA
FT                   LAGDGAKMLHRIQLAHYVEGRRIADTPVLTVLAADIGLNTEAFINAFNIAQKHAAQHIA
FT                   ESRTMLAKVQGHGFPTFILQDAAGKMTVVPAGDYFGNQPGWINRLTNA"
FT   gene            complement(539586..540473)
FT                   /locus_tag="YPA_0469"
FT   CDS_pept        complement(539586..540473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12437"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQW0"
FT                   /protein_id="ABG12437.1"
FT                   /translation="MLNKMLLQITFASLVTASAIATAATTEPLKMEVYNPGEKSIFPVS
FT                   SEIISGKNEVVLIDAQFQRNDAEALVKKIQQSGKKLTTIYISQADPDFYFGLDVIAKAF
FT                   PQAKVIATPQTIEEIKATKDGKMAYWGPILKENAPTAVIIPQPLQGKSFTVDGQQIEVE
FT                   GLDGPSPEKTFVWIPSLKAVVGGVAVSGNIHLWVADTQTPESRENWLTTLEKIKALKPA
FT                   IVVPGHFLDNAPQTLESVTFTQNYLTTLNAEIPKAKDSAELIAVMKKHYPELKDESSLE
FT                   LSAKVLKNEMKWPQ"
FT   sig_peptide     complement(540402..540473)
FT                   /locus_tag="YPA_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 24"
FT   gene            540580..541488
FT                   /locus_tag="YPA_0470"
FT   CDS_pept        540580..541488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0470"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12438"
FT                   /db_xref="GOA:A0A0E1NY39"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY39"
FT                   /protein_id="ABG12438.1"
FT                   /translation="MDRITAAEVFVAIVDRGSMIAAAESLEMSRAMATRYLAQMEQWAG
FT                   ARLLHRTTRKLSLTHAGEATLERCRRMLEFAQDMDLAEGQESEELRGLLRISCSQSLGQ
FT                   SALAIAVADYLRRYPQVAVDLQMNNRAINLVEERIDLALRITNELDPNLIARPLSTCYS
FT                   VVCASPAYLSVSGIPESPQDLTVHNCLTYSYFGESLWHFDQSGVKSSVAVSGNLSANES
FT                   VVLLSGALEGAGITLQPIYSVAPYIARGELIKLLPDYQPQAMGIYGVYASRRQMPTTLR
FT                   TMLDFLVEWFATHPQWLSTMK"
FT   gene            541857..543017
FT                   /locus_tag="YPA_0471"
FT   CDS_pept        541857..543017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0471"
FT                   /product="putative sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12439"
FT                   /db_xref="GOA:A0A0E1P1W0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P1W0"
FT                   /protein_id="ABG12439.1"
FT                   /translation="MPVALLALALCAFAIGTTEFVIMGLLPQVAGDLHISIPTAGWLIS
FT                   GYALGVAIGAPIMAVLTAKLPRKKTLLLLMVIFIIGNLMCALAYSYDFLMFARVITALC
FT                   HGAFFGIGAVVAANLVAPNRRASAVALMFTGLTLANVLGVPLGTALGQAFGWRSTFWVV
FT                   SVIGLFSLAALYSKLPSSSEEAPTELRKEIAALRGGGIWLSLLMTVFFAAAMFALFTYI
FT                   APILTEVTQVSEHGVSWTLLLMGVGLTLGNIVGGRLADWRLSVSLTMTFLLIAVFSALF
FT                   SWTSYSLLAAEVTLFLWSAAAFSAVPALQINVVAYGKKAPNLVSTLNIAAFNVGNALGA
FT                   WVGGVVIAKGLGLTAVPLAAAALAVMGLLLCLFTFSRARTIGNKMA"
FT   sig_peptide     541857..541949
FT                   /locus_tag="YPA_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.349 at
FT                   residue 31"
FT   gene            complement(543014..543955)
FT                   /locus_tag="YPA_0472"
FT   CDS_pept        complement(543014..543955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0472"
FT                   /product="transcriptional activator protein LysR"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12440"
FT                   /db_xref="GOA:A0A0E1P2W3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2W3"
FT                   /protein_id="ABG12440.1"
FT                   /translation="MPAISLRQIEIFHGVMTTGNLTEAALLLQTSQPTVSRELARFEQL
FT                   VQLTLFERVRGRLYPTVQGLRLFEEVQRSYYGLDRIKQAAEGIRQFQHAQLSIACLPVF
FT                   SQSLLPAVCKPFIDRYPEVSLNVIPQESPLLEEWLSAQRHDLGLTENIQTPAGTQRHTL
FT                   MTVNEVCVLPADHPLREKSVLTPQDFNGENFVSLSVTDSYRQLLDNLFAEEKVTRRLVM
FT                   ETHSAASVCAMVREGVGVSIVNPLTALDYLSKGRGSGVCVRPFSVDIPFTVSLIQPLHR
FT                   PSSTLVDTFVGHLKQQTTLFQQRLATVIAPAC"
FT   gene            544170..545432
FT                   /locus_tag="YPA_0473"
FT   CDS_pept        544170..545432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0473"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12441"
FT                   /db_xref="GOA:A0A0E1NT70"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT70"
FT                   /protein_id="ABG12441.1"
FT                   /translation="MPRALNDRSSALTAQNLIALPERFGCPVWAYDGDIIAERINQLRH
FT                   FDVIRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALHAGYQPGQEPAEIVFTADLL
FT                   DQATLLRVTELNIPVNAGSIDMLDQLGQQAPGHPVWLRVNPGFGHGHSQKTNTGGENSK
FT                   HGIWHEELPRALKKIEHYGLTLVGIHMHIGSGVDYQHLEQVCDAMVQQVITLGHDISAI
FT                   SAGGGLSIPYQFGDDVIDTEHYYGLWNSARERIAAHLGHPVSLEIEPGRFLVAESGVLI
FT                   AQVRAVKDMGRRHYVLVDAGFNDLMRPAMYGSYHHISLLPADGRDLTSAPLIDTVVAGP
FT                   LCESGDVFTQQEGGGVETLALPAAVIGDYLVFHDTGAYGASMSSNYNSRPLLPEVLFEK
FT                   GQPRLIRRRQTIEELIDLERV"
FT   gene            complement(545429..546451)
FT                   /locus_tag="YPA_0474"
FT   CDS_pept        complement(545429..546451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0474"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12442"
FT                   /db_xref="GOA:A0A0E1NXL0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXL0"
FT                   /protein_id="ABG12442.1"
FT                   /translation="MATIKDVAKLAGVSVATVSRVINHSPKASEASRVAVCKAMEQLQY
FT                   HPNANARALAQQSTETVGMIVSDVSDPFFGAMVKAVEQVAYATGNFLLIGNGYHDAEKE
FT                   RQAIEQLIRHRCAALVVHAKKLPDDELTSLMEQIPGMVLINRTLPGFEPRCIALDDRYG
FT                   AWLATRHLIQQGHKRVAFICSNHQISDALDRMQGYLDALKEFDIPVDERLITYGTPDEL
FT                   GGEQAMTDLLGRGKHFTAVSCYNDSMAAGALSVLSDNSIDVPQEISLIGFDDVLISRYL
FT                   RPRLTTIRYPVVAMSTQAAELALALANNTPLPEITNMFSPTLVRRHSVASPPSLRDDTD
FT                   "
FT   gene            546761..549022
FT                   /locus_tag="YPA_0475"
FT   CDS_pept        546761..549022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0475"
FT                   /product="putative biotin sulfoxide reductas2"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12443"
FT                   /db_xref="GOA:A0A0E1NVV1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVV1"
FT                   /protein_id="ABG12443.1"
FT                   /translation="MSIIRYPQLAHWGAYTAVVEDGKLIRCEPFADDPDPSPLLNSIVP
FT                   MVYSDKRIRKPAIRRSWLKRREKSDRTLRGQEDFVEVDWDVALDLVAEENRRVRDQYGP
FT                   AGLFTGSYGWSSAGRLHHARSLVRRFYFSGGGGVDQLGNYSWGAAQFFLPYVIGTFSPL
FT                   TGRVTSWPSVVEHCELFIAFGGLALKNAQVSSGGSAEHSLKLWLEKLAQKGTPVINISP
FT                   MRDDCPAFVNAEWIPIRPNTDVALMLALAYEIQRLDGHDEAFLATHCVGYGQLADYIRG
FT                   ANDGIAKTPDWASSITGIPAARIAQLAQQLIGVRSFMTCSYSVQRAHRGEQPYWMVIAL
FT                   SAMLGQVGLPGGGFSFGHGSMNGVGNPRIDTPGPAMPVGKNPAGLAIPVARICDMLLQP
FT                   GQPYQFQGETHTYPDIHLVHWAGGNPFHHHQQLNRLVEGWQKPDTVIVQDIWWTPVAKM
FT                   ADIVLPVTSSLERNDIGGSSRDRYVLAMHQAIAPQHQARHDFDIFADLADRLGYRETFT
FT                   EGRDEMAWIRHIYQECGAAQRSHDVEWPDFETFWQQGYVGLPAPSKAFVFFDSFREDPQ
FT                   ANPLQTPSGKIELFSEKIASYQYNDFAPHAEWKPPVEWLGAPLAEQWPLHLISIQPGDR
FT                   LHSQLDPAPLAQSNKTAGRETLYMHPLDAASRDITEGSQVQVSNLRGHCLAGVSITDGV
FT                   TRGVVLMATGAWFDPGFGGTQHKIEQSGNPNVLTLDIGTSRLTQGPNAMSCLVEVALYE
FT                   "
FT   gene            549471..551627
FT                   /locus_tag="YPA_0476"
FT   CDS_pept        549471..551627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0476"
FT                   /product="Aas bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12444"
FT                   /db_xref="GOA:Q1CAS8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023775"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS8"
FT                   /protein_id="ABG12444.1"
FT                   /translation="MAYRLLRALFRGLFRVTIDGVTDQFKHEKLIITPNHVSFLDGALL
FT                   ALFLPIKPVFAVYTSITDTWYMRWLKPYVDFVALDPTNPMAIKHLVRMVEQGRPVVIFP
FT                   EGRITVTGSLMKIYDGAAFVAAKSGAAVVPIRLDGPEFTHFGRLQGVLKTRWFPKISIH
FT                   VLPATTIPMPQAPRSRERRVLAGEHLHTIMMAARMATVPRETLFEALLSAQTRYGRFKP
FT                   CIEDVSFKEDSYQTLLKKTLGVSRILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRI
FT                   PALLNYTSGAKGLQSAIIAASLKTIVTSRQFLEKGKLTHLPEQVNEVNWVYLEDLKDTV
FT                   TLTDKLWILFHLCFPRRAMLPQQADGSALILFTSGSEGNPKGVVHSHASLLANVEQIRT
FT                   IADFTPRDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTV
FT                   LFGTSTFLGNYARFAHPYDFARVRYVVAGAEKLAESTKQIWQDKFGIRILEGYGVTECA
FT                   PVVAINVPMAAKVNTVGRILPGMEARLINVPGIAQGGRLQLRGPNIMRGYLRVENPGVL
FT                   EQPSAENAQGELDANWYDTGDIVTLDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAIS
FT                   LSPEGQHAAAAKTDSAKGEALVLFTTDSEITRERLIKVARENGVPELAVPRDIRVVKAL
FT                   PLLGSGKPDFVTLGKMAQDPEMSV"
FT   gene            551624..552844
FT                   /locus_tag="YPA_0477"
FT   CDS_pept        551624..552844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0477"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12445"
FT                   /db_xref="GOA:Q1CAS7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR023727"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS7"
FT                   /protein_id="ABG12445.1"
FT                   /translation="MSQDVLADKPLLSRSMVAVLCAQFFSAFGDNALLFATLALIKQQL
FT                   YPDWSQPILQMAFVATYIVLAPFVGQIADGFAKGRVMMVANGLKLAGALVICFGLNPFL
FT                   GYSLVGVGAAAYSPAKYGILGEITSGEQLVKANGMMEASTIAAILLGSVAGGILADWHL
FT                   MAALGVCALVYAIAVIANLFIPRLAAARSGASWRPRAMTGSFFTACRLLWQDSETRFSL
FT                   AGTSLFWGAGVTLRFLLVLWVPVALGIADNATPTLLNAMVAIGIVVGAGAAARFVTLKT
FT                   VKRCLPAGVLIGVMVTIFSLQNSMPMAYLLLIIIGILGGFFVVPLNALLQERGKHSVGA
FT                   GNAIAVQNLGENTAMLFMLGLYSLVVKLGAPVVAVGVGFGVVFALAIALLWGWQWRQQR
FT                   QKTRQPE"
FT   gene            complement(552873..553106)
FT                   /locus_tag="YPA_0478"
FT   CDS_pept        complement(552873..553106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y450"
FT                   /protein_id="ABG12446.1"
FT                   /translation="MKCIKQTLGHYYIPVQKLIKGDGMPVFKFHKQTFLIFNQQKQAAL
FT                   SKEYKSQVKQLIEVNIIDISKGDICQQSEGSP"
FT   gene            complement(553813..554853)
FT                   /locus_tag="YPA_0479"
FT   CDS_pept        complement(553813..554853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0479"
FT                   /product="putative aldo/keto reductase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12447"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY87"
FT                   /protein_id="ABG12447.1"
FT                   /translation="MQYHRIPHSSLEVSLLGLGTMTFGEQNSEADAHAQLDYAVAAGIN
FT                   LIDTAEMYPVPPRPETQGLTEQYIGRWIKARGCREKIILASKVSGPSRGDDQPIRPNMA
FT                   LDRKNIRIALEESLKRLNTDYLDIYQLHWPQRETNCFGKLNYRYSEQTAVVTLLETLEA
FT                   LNEQVRAGKIRYIGVSNETPWGVMRYLQLAEKHDLPRIVSIQNPYSLLNRSFEVGLAEI
FT                   SQHEGVELLAYSSLAFGTLSGKYLNGAKPAGARNTLFSRFTRYSGPQTQLAVAEYVSLA
FT                   KHHGLDPAQMALAFVRQQPFVASTLLGATSLEQLKSNIDSQNIVLSQEVLDALEAIHTR
FT                   YTFPAP"
FT   gene            complement(554972..555151)
FT                   /locus_tag="YPA_0480"
FT   CDS_pept        complement(554972..555151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12448"
FT                   /db_xref="GOA:A0A0H2Y3A6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3A6"
FT                   /protein_id="ABG12448.1"
FT                   /translation="MFSIPQVLYISLILYISLILYISLMLYISLILYIPLFSPLLLCAL
FT                   PPAPVLRYSRIRQV"
FT   gene            complement(555242..555928)
FT                   /locus_tag="YPA_0481"
FT   CDS_pept        complement(555242..555928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0481"
FT                   /product="DNA mismatch repair protein MutH"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12449"
FT                   /db_xref="GOA:Q1CAS3"
FT                   /db_xref="InterPro:IPR004230"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS3"
FT                   /protein_id="ABG12449.1"
FT                   /translation="MSVYSLPPAPPSDEHQLFQRAQALSGFTLGELATRAQWVIPADLK
FT                   RVKGWVGMLLEFYLGASAGSKPEQDFADIGIELKTIPISAQGKPLETTFVCVAPLTGNS
FT                   GVTWESSHVRHKLARVLWVPVEGERHIPLAERRVGAPLLWSPNVEEEELLRRDWEELMD
FT                   LIVLGKVESITARHGQVLQLRPKAANSRALTEAIGEFGQPIMTLPRGFYLKKTLTAPML
FT                   ARHFLL"
FT   gene            556626..557153
FT                   /locus_tag="YPA_0482"
FT   CDS_pept        556626..557153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12450"
FT                   /db_xref="GOA:Q1CAS2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS2"
FT                   /protein_id="ABG12450.1"
FT                   /translation="MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGET
FT                   PEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQL
FT                   MCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAP
FT                   PRVPPAYRRKRG"
FT   gene            557166..559412
FT                   /locus_tag="YPA_0483"
FT   CDS_pept        557166..559412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0483"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12451"
FT                   /db_xref="GOA:A0A0H2Y4I8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4I8"
FT                   /protein_id="ABG12451.1"
FT                   /translation="MLMRLREVVEKVAMATGLTEALELLVNETCLAMDTEVCSIYLADN
FT                   DRRCYYLMATRGLKKPRGRTITLAFDEGIVGLVGRLAEPINLADAQSHPSFKYVPQVKE
FT                   ERYRAFLGVPIIYRRQLLGVLVVQQREHRQFDESEESFMVTLATQLAGILSQSQLNAIF
FT                   GQYRQTRIRALAAAPGVAVAEGWQDISQPSLDLVYEASTLDSTLERERLTQALEEAAAE
FT                   FRRFSKRFAASSQKESAAIFDLYSHLLNDARLKRELFAQIDAGAVAEWAVKQVVEAFAA
FT                   QFASLQDTYMRERASDLRALGQRLLFHLDDSTSGASQWPERFILVADELTATLLAEVPQ
FT                   DRLAGVVVRDGAANSHAAILVRAMGIPTVMGADIQPALLSQRLLIVDGYRGEVLVDPEP
FT                   VLVKEYQRLVTEEIELSKLAEDDVEQPAALKSGERIQVMLNAGLSPEHEQLLGGRVDGV
FT                   GLYRTEIPFMLQSGFPSEEEQVAQYQGMLQLYPQKPVTLRTLDIGADKQLPYMPISEEN
FT                   PCLGWRGIRITLDQPEIFLIQVRAMLRANAGTGNLGILLPMITSIEEVDEAKRLIDRAG
FT                   REVEEMLGYVLPQPRLGVMIEVPSMIFMLPYLTSRVDFISVGTNDLTQYLLAVDRNNTR
FT                   VASLYDSLHPAMLQVLRQILMQATESGLQVSLCGEMAGDPMGALLLVGLGYRNLSMNGR
FT                   SVARIKYLLRNIELADAQVLAARVLTAQMTTDVRHLTAAFMERRGLGGLIRGGK"
FT   gene            559663..560535
FT                   /locus_tag="YPA_0484"
FT   CDS_pept        559663..560535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0484"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12452"
FT                   /db_xref="GOA:Q1CAS0"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS0"
FT                   /protein_id="ABG12452.1"
FT                   /translation="MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRA
FT                   NKPGSGWTKEEVENLLYAGFLGVFIGGRVGYVLFYNLPMFLDNPLYLFKVWDGGMSFHG
FT                   GLIGVICVMLWFARRTKRNFFQVADFIAPLIPFGLGAGRLGNFINAELWGRVTTDTPWA
FT                   MLFPTSRNTDIAIVAADPAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNVFIRKP
FT                   RPMGSVSGLFLIGYGTFRIIVECFRQPDEQLGLFEGMISMGQILSVPMILAGIIMMIWA
FT                   YRRPTQKLS"
FT   gene            560542..561336
FT                   /locus_tag="YPA_0485"
FT   CDS_pept        560542..561336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0485"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12453"
FT                   /db_xref="GOA:Q1CAR9"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAR9"
FT                   /protein_id="ABG12453.1"
FT                   /translation="MKQYLDLMKKVLEEGTPKADRTGTGTLSIFGHQMRFNLQDGFPLV
FT                   TTKRCHLRSIIHELLWFLNGDTNIAYLKENNVSIWDEWADENGDLGPIYGKQWRAWGAA
FT                   DGRKIDQLSNVVNQLKQDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQL
FT                   YQRSCDVFLGLPFNIASYALLVHMMAQQCDLAVGDFVWTGGDTHLYSNHIDQAHLQLSR
FT                   EPRVLPKLVIKRKPDSLFDYHFDDFDIEGYDPHPGIKAPIAI"
FT   gene            561572..562141
FT                   /locus_tag="YPA_0486"
FT   CDS_pept        561572..562141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12454"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM71"
FT                   /protein_id="ABG12454.1"
FT                   /translation="MKIYSIKTGKLLPKAPLLRKQKVFIKQRSLIKQRGISLIELLVVI
FT                   TLVSVMTLWGGQSWHHYRQRAKLADSARQLLAFLTHLQAEANRNNRTAILWAQPDGQGC
FT                   LGSGHKPTPPCTGLAGSLFIPPYRDIAITLPLQKEMGFYGVRNTAQAGNIILSSPAGRI
FT                   RLVISSRGRIRLCSEQQSMAGIHLCL"
FT   sig_peptide     561572..561739
FT                   /locus_tag="YPA_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.622 at
FT                   residue 56"
FT   gene            562132..562740
FT                   /locus_tag="YPA_0487"
FT   CDS_pept        562132..562740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0487"
FT                   /product="putative prepilin peptidase dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12455"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVI2"
FT                   /protein_id="ABG12455.1"
FT                   /translation="MPLVVNVLSTPLNAQPTRTAGFTLPEMMLALSFGSLIALSTAQVL
FT                   PKLSQQISVLQQHYRLELVMNQAMGAMEKDLRRAGFCHGKCQGEAITIEHYLGETAHSC
FT                   LIVAYDLNCNGRWEGAKHQESEYFGYRLRNKALESQRGELNCHGRGWEKLFDPRDVTVT
FT                   HFSVTPLSGQLFKLRLVGHKTGNPAIHHQVTYLIRGNNV"
FT   gene            562737..563207
FT                   /locus_tag="YPA_0488"
FT   CDS_pept        562737..563207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0488"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12456"
FT                   /db_xref="InterPro:IPR019652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTD0"
FT                   /protein_id="ABG12456.1"
FT                   /translation="MTQVFQRGSSTLAAVMTLFSLGLFWLSAIHRQLDNIQQITGEEQR
FT                   YLRAYNQAESSLNWGVSQRWALRIPWRVGSAWHCMAHQELGLKACVKRSSLAGFFILKG
FT                   ESLPLGSLPPLMLYQRVKLKAVTGSSGNYQLIDTPHGWLDFCPDKDAQFCLD"
FT   gene            563195..563605
FT                   /locus_tag="YPA_0489"
FT   CDS_pept        563195..563605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0489"
FT                   /product="putative prepilin peptidase dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12457"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYY3"
FT                   /protein_id="ABG12457.1"
FT                   /translation="MPRLITKHAYGQTISVETGGFNLRHLRGFSLLEVLIAALFFSISL
FT                   LGLLQYHQALLQGFASSWQQRQAWSWLHQYMESQSGTDPEERWAPEVKPGWHYRQFIDR
FT                   IEGDCREFSVKLITRQDSPVELSRWFCSTEMI"
FT   gene            563740..567111
FT                   /locus_tag="YPA_0490"
FT   CDS_pept        563740..567111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0490"
FT                   /product="DNA helicase/exodeoxyribonuclease V, gamma
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12458"
FT                   /db_xref="GOA:A0A0E1NY90"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY90"
FT                   /protein_id="ABG12458.1"
FT                   /translation="MFTVYHSNQLDLLKALTTALIEREPLDNPFQQEVVLVQSPGMAQW
FT                   LQMQLAQQFSIAANIVFPLPATFIWDMFTRVLPDIPKESAFSKEAMTWKLMWLLPDLLE
FT                   NPLFSPMKRYLSDDGDRRKIHQLAARVADLFDQYLVYRPEWLESWERGQLIEGLDDAQQ
FT                   WQALLWVELTRYTRQLEQPEWHRANLYQRFIHQLLKSDVCPQGLPKRVFICGISALPPI
FT                   YLQALQALGKHIDIHLMFTNPCRYFWGDIQDYTFLAKLQSRKRRHYRESIELSLFRHPQ
FT                   QAEQLFNTDGEQNLSNPLLASWGRLGRDHMYLLSQIDEIQEVHAFVDIEPDNLLHGIQH
FT                   DMLELEDHAVIGTTPETLARSDQKRRLDLDDRSLSFHVCHSPQREVEVLQDHLLGLLAA
FT                   DPELTPRDIIVMVVDIDSYTPYIQAAFGNAPSERYLPFAISDRKASQAHPALHAFITLL
FT                   DLPQSRFTAEQVLALLEVPALATKFGITEDGLRRLRQWVGESGIRWGLDDDNVRELSLP
FT                   ATGQHTWRFGLTRMLLGYAMDSTAGDWQGILPYDESSGLAAELAGQLADMLMHLSQWRQ
FT                   QLGQPRELSEWLPICRQLLDTFFDQDNDTEAALVLIEQQWQKVIGYGIAAQYPDVVPLN
FT                   LLRDELAARLDNERISQRFLAGPINFCTLMPMRSIPFKVVCLLGMNDGVYPRTLPPQGF
FT                   DLMAKKVRRGDRSRRDDDRYLFLEALLSAQQQLYISYIGRSIQDNSKRYLSVLVSELIE
FT                   YVAQSYHLPGDEKLSADDSAQRVTQHLLCWHARMPFSAENFIKNSELQSYAAEWLPSAE
FT                   SKGHAHPNFNQPLQAEPLAEITLDELVRFYRHPVRAFFQLRLGVNFVIEETELPDEEPF
FT                   TLDNLSRYQFNTQLLNALINEDDINSVFARARAAGVLPYGSFGELYWESQQDEMVPLAE
FT                   QIRSERKENHSIELNIEFADITVTGWIHQVQDDGLVRWRPSILTAVDGLLLWLEHLVYC
FT                   SAGGEGESRIYGRKGTAWRYAPMAADEARPYLQQLIKGYQQGLCEPLMLLSKSGWAWLS
FT                   QCFDRESGQILWDEETQGKARMKLLQVWQGDQRVTGEGEDHYIQRVCRRMDNQHLDIIL
FT                   HETERYLLPIARHNKA"
FT   gene            567193..570081
FT                   /locus_tag="YPA_0491"
FT   CDS_pept        567193..570081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0491"
FT                   /product="pitrilysin. Metallo peptidase. MEROPS family
FT                   M16A"
FT                   /EC_number="3.4.24.55"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12459"
FT                   /db_xref="GOA:A0A0E1NW05"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR032632"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW05"
FT                   /protein_id="ABG12459.1"
FT                   /translation="MHKQLARIVGIVFFLGLLAPSSWAAIPAWQPLAETIYKSEHDLRK
FT                   YQAIKLSNGMTVLLVSDTQAPKSLAALALPVGSLEDPDNQLGLAHYLEHMVLMGSKHFP
FT                   EPGSFSEFLKKHGGSHNASTASYRTAFYLEIENDALAPAVERLADAIAEPLLDPINADR
FT                   ERNAVNAELTMARSRDGMRMAQVNAETLNPAHPSARFSGGNLETLRDKPDGKLHDELVS
FT                   FYHRYYSANLMVGVLYSNQSLEQLAQLAADTFGRIPNRDAKVPTITVPVVTPDQTGIII
FT                   HYVPAQPRKQIKVDFRIANNSADFRSKTDTYISYLISNRSKNTLSDWLQKQGLADAINA
FT                   GADPMLDRNGGVFSITVSLTDKGLAQRDVVVAAIFDYINMLHKEGIKKSYFDEIAHVLN
FT                   LDFRYPSITRDMDYIEWLVDMMLRVPVAHTLDAPYLADQYDPKAIASRLAEMTPENARI
FT                   WFVSPEEPHNKVAYFVDAPYQVDKIGVQRMKEWQQLGQKIALSLPALNPYIPDNFTLIK
FT                   ADKNITRPQNVADQPGLRVFYMPSQYFADEPKADITVAFRNPHALNSARHQVLFALTDY
FT                   LAGLSLDQLSYQASIGGISFSTAPNNGLYVNAGGFTQRMPQLLTSLVSGYASFTPTEEQ
FT                   LVQAKSWYREQLDVAEKGKAYELAIQPAKLLSNVPYSERSERRKLLDSISVQDVLTYRD
FT                   DLLKQSAIEVLAVGNMTAEQVTELTESLKKQLNLIGTTWWVGEDVIIEKTQLANMERVG
FT                   SSSDAALAAVYVPTGYTEIAGMARSALLGQIIQPWFYDQLRTEEQLGYAVFSFPMSVGH
FT                   QWGIGFLLQSNSKEPNYLYQRYLAFYPQAEKRLREMKPDDFEQYKQGLVNQLLQRPQTL
FT                   DEEAERYRKDFNLNNFAFDSREKMIAQVKQLTANELADFFQQAVIKPQGLALLSQVKGQ
FT                   GQAGGFAVPEGWTTYPTTSALQATLPQKVLAP"
FT   sig_peptide     567193..567267
FT                   /locus_tag="YPA_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            570078..573740
FT                   /locus_tag="YPA_0492"
FT   CDS_pept        570078..573740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0492"
FT                   /product="DNA helicase/exodeoxyribonuclease V, beta
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12460"
FT                   /db_xref="GOA:A0A0E1NV09"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV09"
FT                   /protein_id="ABG12460.1"
FT                   /translation="MTPTTPQRLEPLALPLYGERLIEASAGTGKTFTIGVLYLRLLLGL
FT                   GGDAAFRRPLMVEEILVVTFTEAATEELRGRIRDNIHGLRIACVRGVSDDPMYQALLAE
FT                   ITDWAVAAAQLLAAERQMDEAAIYTIHGFCQRMLANNAFESGILFEQTLVQDELPLWRQ
FT                   ACADFWRRHCYPLPLVIARAVSQEWSGPEALLSDLSAYLQGETPKFRQAPGDDETILSR
FT                   HQHVVTQIDALKAEWRLAAPELEALISRSGVDKRSYSSKHLPNWLEKVGLWAEQETEDY
FT                   QLPKELEKFRQSVLLEKTKKGAAPQHTLFSAIDSIFEQPLTLRDLILARAISEIRFSVQ
FT                   QEKRQRAELGFDDLLSKLDAALQQSGGELLAQSIRTRYPVAMIDEFQDTDPQQYRIFHT
FT                   VYGGQEACALLLIGDPKQAIYAFRGADIFTYIRARSEVSAHYTLETNWRSSFPMVQSVN
FT                   RLFSLVNTPFLFEQIPFINVAAAKKNHDLSFEIKGEKQPALHFWLQPGDGVGVSEYQQV
FT                   MARQCAAQIRDWLTAGQQGQAELLTTKGPKPVQASDITILVRSRAEAALIRDALSALAI
FT                   PSVYLSNRDSVFETTEAKDLLWLLQAVLAPEQERALRSAMATGILGLDARMLDALNHDE
FT                   RAWDALVDEFDHYRQHWQRRGVLPMLREMMARRHLAENLLATPGGERRLTDLLHLGELL
FT                   QEAASQLDSEHALIRWLAQQIAQPNPQSDSQQLRLESDRHLVRVVTIHKSKGLEYPLVW
FT                   LPFIGNFRQQQNVLYHDRHSFEALLDLNADEESQALAEEERLAEDLRLLYVALTRSVYH
FT                   CSVGIAPLIKGGRKKQGESDMHRSALGYLVQHGQPGDAHVLSEKLTELARSSNGDICVS
FT                   PVEPPDDKPWQPQPEALPELTARHFTRKMQDYWRVTSYSGLQQSGSTKKLYGSATGDVS
FT                   QALGAPLQVLLPRLDIDAVGEQAVVTEDDHLTPHTFPRGAAPGTFLHDLLEPLDFSQPI
FT                   ELAWLSERLQQQGFSEQWAPVLHQWLNDIVQTPLTDTGATLAGLSPERKQAELQFYLPI
FT                   DSLLRAEVLDRLIKQYDPLSRQCPVLDFQQVRGMLKGFIDLVFCWQGQYYLLDYKSNWL
FT                   GEDSRAYTVEAMTQAMAEHRYDLQYQLYTLALHRYLRHRLADYDYQRHFGGVIYLFLRG
FT                   VDQQHSGHGIFNCRPEQKLIEEMDRLFSGTIGSNATASDKSGSNVIHSGERASR"
FT   gene            573737..575695
FT                   /locus_tag="YPA_0493"
FT   CDS_pept        573737..575695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0493"
FT                   /product="DNA helicase/exodeoxyribonuclease V, alpha
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12461"
FT                   /db_xref="GOA:A0A0E1NVB7"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVB7"
FT                   /protein_id="ABG12461.1"
FT                   /translation="MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVG
FT                   AGHVCLPLRYLQPELLFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPL
FT                   VLQQERLYLQRMWQYEGDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALF
FT                   GCAGSEVDWQKVAAAVAATRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIKLAA
FT                   PTGKAAARLTESLGKAIRQFFLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLN
FT                   LDVLVVDEASMVDLPMMARLIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGY
FT                   SEQRAQQLTQLTGYLLTNNALTSNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYR
FT                   FDEKSGIGQLALAVNAGEYRQALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYL
FT                   ERVAALAPAAEVLAAFGRYQLLCALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRW
FT                   YVGRPVMIELNDSALGLFNGDIGIALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAY
FT                   AMTVHKSQGSEFEHTALVLPNTFMPVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTP
FT                   TLRLSGLVDRLNTLNRQ"
FT   gene            complement(575850..577175)
FT                   /locus_tag="YPA_0494"
FT   CDS_pept        complement(575850..577175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0494"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12462"
FT                   /db_xref="GOA:Q1CAR0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAR0"
FT                   /protein_id="ABG12462.1"
FT                   /translation="MKERSTELVQGFRHSVPYINAHRGKTFVVMLGGEAIEHENFSSIV
FT                   NDIGLLHSLGIRLVVVYGARPQIDSNLADHNYEPIYHKHTRVTDARTLEMVKQAAGLLQ
FT                   LDITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEEAIHRQ
FT                   LDNGAIVLLGPVAVSVTGESFNLTSEEVATQLAIKLKAEKMIGFCSSQGVTDSEGNIIS
FT                   ELFPNDAQKRIEDLEQDGDYNSGTVRFLRGAVKACRSGVRRSHLLSYQEDGALIQELFS
FT                   RDGIGTQIVMESAEQVRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIE
FT                   RDNLTIACAALYPFPDEHIGEMACVAVHPDYRSSSRGEMLLNRITNQARQMGLKKLFVL
FT                   TTRSIHWFQERGFTPAEVDVLPIQKQELYNYQRRSKILLADL"
FT   gene            577411..578661
FT                   /locus_tag="YPA_0495"
FT   CDS_pept        577411..578661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0495"
FT                   /product="N-acetylmuramoyl-L-alanine amidase AmiC
FT                   precursor"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12463"
FT                   /db_xref="GOA:A0A0E1NUB8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUB8"
FT                   /protein_id="ABG12463.1"
FT                   /translation="MADSNHNSGRRRLLQGAAAAWMLSISRVGFAASSHIVAVRVWPSS
FT                   TYTRVTLESNTPLKYRQFALTHPDRIVVDIEGVQLNSVLKEISRQVQSADPYLKQARVG
FT                   QFDKNTVRLVLELKQSISPQLFTLKPFAEFRNRLVVDLYPAEGGTSAEDDPLLALLEDY
FT                   NKGNVDRTLPPETPKAGKAGRDRPIIIMLDPGHGGEDPGAIGKNKTKEKDIVLQIARRL
FT                   RALIQKEANMRVFMTRNEDVFIPLKVRVAKARKLRADLFISIHADAFTNRAASGSSVFA
FT                   LSTKGATSTAARFLAQTQNEADQIGGVSKSGDPYLDHTIIDLLQTATINDSLKFGKEVL
FT                   SRMSKINKLHKNRVDQAGFAVLKAPDIPSILVETAFISNLEEERKLRTSRFQQQIAESI
FT                   FAGIKAYFANGGAMARL"
FT   sig_peptide     577411..577506
FT                   /locus_tag="YPA_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.964 at
FT                   residue 32"
FT   gene            complement(578891..578967)
FT                   /locus_tag="YPA_r022"
FT                   /note="tRNA-Met5"
FT   tRNA            complement(578891..578967)
FT                   /locus_tag="YPA_r022"
FT                   /product="tRNA-Met"
FT   gene            complement(579091..579167)
FT                   /locus_tag="YPA_r023"
FT                   /note="tRNA-Met4"
FT   tRNA            complement(579091..579167)
FT                   /locus_tag="YPA_r023"
FT                   /product="tRNA-Met"
FT   gene            579383..580555
FT                   /locus_tag="YPA_0496"
FT   CDS_pept        579383..580555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0496"
FT                   /product="membrane-bound lytic murein transglycosylase A
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12464"
FT                   /db_xref="GOA:A0A0H2Y4J7"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4J7"
FT                   /protein_id="ABG12464.1"
FT                   /translation="MTSRWGKYLLSGIMIAVLAGCQSRPTDRGQQYKDGRLEQSLELVN
FT                   EPNAAGKPVNAKDYSDQVKVINQSSPGLYNRNSDTFNAVQNWMLAGADTSKLSLFGLNA
FT                   YQMEGVDNFGNVQFTGYYTPVLQARYTPQGEFRHPLYRMPAKGKRRLPDRAAIYAGALD
FT                   NRNLIIAYTNSLVDNFMMEVQGSGYVDYGDGRPLTFFGYAGKNGHAYRSIGKVLIDRGE
FT                   VARADMSMQAIRQWAENHSEAEVRELLEQNPSFVFFKPVMYAPVKGASAVPLIAKASVA
FT                   SDKSLIPPGTTLLAEVPLLDDQGKFTGKYQMRLMVALDVGGAIKGQHFDIYQGIGHEAG
FT                   QAAGFYNHYGRVWVLKNAQSSGPLFTAYKGGTQSEPTSNDSSLLVNNQDR"
FT   gene            580698..581525
FT                   /locus_tag="YPA_0497"
FT   CDS_pept        580698..581525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12465"
FT                   /db_xref="GOA:A0A0E1NMY7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMY7"
FT                   /protein_id="ABG12465.1"
FT                   /translation="MSTAYSEAYQQRFGGIARLYGQQALALFSQAHVCVIGIGGVGSWA
FT                   AEALARTGIGAITLIDMDDVCVTNTNRQIHALRHNIGQAKTEVMAERILAINPECHVTC
FT                   IDDFITADNVAELLNKNFSYVIDAIDSVRPKAALLSYCRRYKIPVVTTGGAGGQIDPTR
FT                   IAVVDLAKTIQDPLAAKLRERLKSDFNVVKNSKGKLGIDCVFSSEPLVYPQADGSVCAS
FT                   RSTAEGPKKMDCTSGFGSATMVTATFGFVAVSHVLKKMMAKAARQHESAATAS"
FT   gene            complement(581561..582004)
FT                   /locus_tag="YPA_0498"
FT   CDS_pept        complement(581561..582004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12466"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="InterPro:IPR017763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y463"
FT                   /protein_id="ABG12466.1"
FT                   /translation="MMIAPHPFGHDITATDLIEKFSAHKQWEDRYRQLILLAKQLPPLQ
FT                   EAWKKNELELTGCENRVWLGHQHLPDGTLHFYGDSEGRIVRGLLAVILTAVEGKTPQQV
FT                   LAADPLALFEQLGLRQQLSTSRANGLQALAQGVQTIAAKYAER"
FT   gene            complement(582139..583443)
FT                   /locus_tag="YPA_0499"
FT   CDS_pept        complement(582139..583443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0499"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12467"
FT                   /db_xref="GOA:A0A0H2Y5I8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5I8"
FT                   /protein_id="ABG12467.1"
FT                   /translation="MCITSICITSLLKHATMIKAKKFRGHSQDANNSMKVFNPMDFRRE
FT                   FPALSDKLTYLDSAATALKPRAMIDATQQFYQQDSATVHRSQHQSALSLTVRFENTRQQ
FT                   VADFINSSTAENIIWTRGTTEAINLIAQSYARPRLQPEDEIIVSEAEHHANLIPWLMVA
FT                   EQTGAKIVKLPLGLDHLPDLQQLPQLLNEKTRILALGQMSNVTGGSPDLAQAIRLAHQY
FT                   DCVVVVDGAQGIVHYPADVQALDIDFYAFSSHKLYGPTGIGVLYGKTELLEEMPAWQGG
FT                   GKMLTHASFGGFTPHEVPYRFEAGTPNIAGVIGLSAVLKWLEHIDLEEAEVYSQGLATM
FT                   AENKLAQLPGFHSYRCQQSSLLAFTFDGVHHSDLVALLAEQGIALRAGQHCAQPLMAAL
FT                   GVNGSLRASFAPYNTPQDVEMLCSALGKALELLRD"
FT   gene            584004..584921
FT                   /locus_tag="YPA_0500"
FT   CDS_pept        584004..584921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0500"
FT                   /product="glycine cleavage system transcriptional
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12468"
FT                   /db_xref="GOA:A0A0E1NQX9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQX9"
FT                   /protein_id="ABG12468.1"
FT                   /translation="MSKRLPPLNALRAFDAAARHLSFTKAAEELFVTQAAVSHQIKSLE
FT                   DFLGLKLFRRRNRSLLLTEEGQSYYLDIKEIFTSINEATRKLQARSAKGALTVSLPPSF
FT                   AIQWLVPRLSGFNAAYPGIDVRIQAVDREEDKLADDVDVAIFYGRGNWSGLRTERLYAE
FT                   FLLPVCAPSLLTGENGLKVPSDLANHTLLHDTSRRDWLAYTRQLGVPQINVQQGPIFSH
FT                   SAMVVQAAVHGQGIALVNNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKI
FT                   AAFRQWILARAASEQEKLRFRYEN"
FT   gene            585087..585482
FT                   /locus_tag="YPA_0501"
FT   CDS_pept        585087..585482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12469"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLK3"
FT                   /protein_id="ABG12469.1"
FT                   /translation="MNSRLMLIFSALSGFFYVAFGAFGAHVLSTSLGLNEMAWIRTGLE
FT                   YQGFHTLVILILAVAMQRQVSLWFYWSGALLALGTLLFSGSLYCLALSHLRLWIYITPV
FT                   GGVCFLAGWILMLIGALRLRKRAERHE"
FT   sig_peptide     585087..585161
FT                   /locus_tag="YPA_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.765 at
FT                   residue 25"
FT   gene            585475..586581
FT                   /locus_tag="YPA_0502"
FT   CDS_pept        585475..586581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12470"
FT                   /db_xref="GOA:Q1CAQ2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR011224"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAQ2"
FT                   /protein_id="ABG12470.1"
FT                   /translation="MNNKIALYCRSGFEKECAAEITEKAAQLEIFGFARVKENSGYVLF
FT                   ECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGMLVGVIEKAGEL
FT                   RVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRPVVHVFFIAPGCCYVGY
FT                   SYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPADEWEERLASGMHAVDLGAC
FT                   PGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGFKYEPTRSNIYWLVCDMVE
FT                   KPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLAMMDEQLKENGINADIHAK
FT                   QLYHDREEVTVHVRRIWSGAPGRRDERY"
FT   gene            complement(586832..586987)
FT                   /locus_tag="YPA_0503"
FT   CDS_pept        complement(586832..586987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5B0"
FT                   /protein_id="ABG12471.1"
FT                   /translation="MWITIAPFVTPEKWRKKLQQHQQMAFTCKQIATLKTDLLLSGNLQ
FT                   QLRLKK"
FT   gene            587044..588066
FT                   /locus_tag="YPA_0504"
FT   CDS_pept        587044..588066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0504"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12472"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12472.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            588066..588845
FT                   /locus_tag="YPA_0505"
FT   CDS_pept        588066..588845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0505"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12473"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12473.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(588855..589547)
FT                   /locus_tag="YPA_0506"
FT   CDS_pept        complement(588855..589547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0506"
FT                   /product="exodeoxyribonuclease IX"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12474"
FT                   /db_xref="GOA:Q1CAP8"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAP8"
FT                   /protein_id="ABG12474.1"
FT                   /translation="MQIHLLIVDALNLIRRIHAVQGSPCVKACQHALQQLIQHSQPSHA
FT                   VAVFDEDDRSDSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEAD
FT                   DLAATLVVKVAGAGHQVTIVSTDKGYCQLLAPNIQIRDYFQKRWLDMPFVKQEFGVLPR
FT                   QLPDYWGLAGISSSKIPGVAGVGAKTATLLLQQADTLEVLYQNLESIPECQRRMKSDPL
FT                   ISPPTAQY"
FT   gene            complement(589807..591171)
FT                   /locus_tag="YPA_0507"
FT   CDS_pept        complement(589807..591171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12475"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVU3"
FT                   /protein_id="ABG12475.1"
FT                   /translation="MITHVSPLGSMDLLSQLEVDMLKRTASSDLYRLFRNCSLAVLNSG
FT                   SLTDNSKELLSRNETFDINVLRRERGVKLELVNPPEHAFVDGKIIRSLQANLFAVLRDI
FT                   LFVNGQIVSASNFQHLNMESSSHLTNLVFSILRNARALHIDEEPNMVVCWGGHSINETE
FT                   YLYARKVGSQLGLRELNICTGCGPGAMEAPMKGAAVGHAQQHYKKGRFIGMTEPSIIAA
FT                   EPPNPLVNELVIMPDIEKRLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPENSEQV
FT                   LPLILTGPKESADYFKVVDEFIMNTLGDGARKYYQIIIDDPDEVARQMKKAMPLVKEYR
FT                   RNTGDAYSFNWSIRIEPDLQHPFEPNHENMANLDLSHNQPPEKLAAALRRAFSGIVAGN
FT                   VKEVGIQAIEAHGPFKLHGDPQLMKQMDRLLQDFIAQHRMKLPGSVYTPCYEICS"
FT   gene            complement(591324..592169)
FT                   /locus_tag="YPA_0508"
FT   CDS_pept        complement(591324..592169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12476"
FT                   /db_xref="GOA:Q1CAP6"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAP6"
FT                   /protein_id="ABG12476.1"
FT                   /translation="MSSYQNHKALAELTLGKPTAYCDYYDATLLQAVPRSMNREPLGLY
FT                   PDNLPFHGADIWTLYELSWLNSNGLPQVAVGEISLNADSINLIESKSFKLYLNSFNQTI
FT                   FADKESVRMTLQRDLAACAQGNVSVALYDLDEITGQPISNFNGECLDKQDIRIDSYEFN
FT                   ADYLQGAAGKDHVEESLVSHLLKSNCLITHQPDWGSVQIHYRGPQIDHEALLRYLVSFR
FT                   HHNEFHEQCVERIFNDIMRFCQPETLTVYARYTRRGGLDINPWRSNTDFVPLTGRLARQ
FT                   "
FT   gene            592301..592852
FT                   /locus_tag="YPA_0509"
FT   CDS_pept        592301..592852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0509"
FT                   /product="Syd protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12477"
FT                   /db_xref="GOA:Q1CAP5"
FT                   /db_xref="InterPro:IPR009948"
FT                   /db_xref="InterPro:IPR038228"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAP5"
FT                   /protein_id="ABG12477.1"
FT                   /translation="MDLNISTALRSFTQRYIDLWQQQTGHLPASKELYGVPSPCIVETG
FT                   EDQVFWQPQAFLPEATLTNIERALEIQLHPDIHDFYTQQYAGDMMADLGNHRFTLLQVW
FT                   SEDDFIRLQENLIGHLVTQKRLKLSPTLFLATTSSEMTMASLCNVSGNVVLEQFGSDKR
FT                   TLLASTLSHFLDALRPVLPE"
FT   gene            593115..593396
FT                   /locus_tag="YPA_r024"
FT   misc_RNA        593115..593396
FT                   /locus_tag="YPA_r024"
FT                   /product="regulatory RNA csrB"
FT   gene            593542..594000
FT                   /locus_tag="YPA_0510"
FT   CDS_pept        593542..594000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0510"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12478"
FT                   /db_xref="GOA:Q1C048"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C048"
FT                   /protein_id="ABG12478.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            594254..594586
FT                   /locus_tag="YPA_0511"
FT   CDS_pept        594254..594586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12479"
FT                   /db_xref="InterPro:IPR007384"
FT                   /db_xref="InterPro:IPR023376"
FT                   /db_xref="InterPro:IPR036814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTR7"
FT                   /protein_id="ABG12479.1"
FT                   /translation="MSTENKVRQSLQDIEFAMRETDLWQTVPPEAEAFESNEPFSIDTM
FT                   AAEQWLQWVFLPRMYALLELNGPFPTRFAITPYFEEALSGDGRPDYSALLAQLRCLDDL
FT                   LNKESE"
FT   gene            594586..595359
FT                   /locus_tag="YPA_0512"
FT   CDS_pept        594586..595359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0512"
FT                   /product="tRNA pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12480"
FT                   /db_xref="GOA:A0A0E1NQY7"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQY7"
FT                   /protein_id="ABG12480.1"
FT                   /translation="MLEIIYQDEHIVAVNKPAGWLVHRSWLDRNETVFVMQTVRDQIGQ
FT                   HVYTVHRLDRPTSGVLLMALSSDVARMLSLQFEQHQIQKTYHAVVRGYVLEGGTVDYAM
FT                   AEELDKIADKFAKSDKAPQPSVSHYEALAQVEVPLAIGRYETARYSLVALKPETGRKHQ
FT                   LRRHMAHIRHPIIGDSTHGDLRQNRGVAQHFGCSRLMLHASHLHLNHPVTGEALTLTAR
FT                   WDEPWQGLMSQFGWSGIAPHLERVEFPLTASQDNE"
FT   gene            595387..595836
FT                   /locus_tag="YPA_0513"
FT   CDS_pept        595387..595836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12481"
FT                   /db_xref="GOA:A0A0E1NT02"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT02"
FT                   /protein_id="ABG12481.1"
FT                   /translation="MAQVGIFVGTVYGNALLVAEEAENILKDQGHEVKLFDEGTLEDWQ
FT                   HYRQHYVLVITSTTGQGDFPDSIASLFVAVRDQVGFQPELRYGVIALGDSSYDNFCGAG
FT                   RTFDELLQEQGATRIGERLEIDAIEHSEPEAISAPWVEQWGRLLQ"
FT   gene            complement(595926..596315)
FT                   /locus_tag="YPA_0514"
FT   CDS_pept        complement(595926..596315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12482"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAP0"
FT                   /protein_id="ABG12482.1"
FT                   /translation="MYDNLKSLGITQPEDVDRYSLRQEANNDILKIYFRKDKGEFFAKS
FT                   VKFKYPRQRKTVVSDNASHGYKEINEINPNLRYVIDELDQLCKRDQIEVDLKRKILDDL
FT                   RHLESVVTNKIAEIEADLEKLTNGR"
FT   gene            complement(596439..597263)
FT                   /locus_tag="YPA_0515"
FT   CDS_pept        complement(596439..597263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0515"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12483"
FT                   /db_xref="GOA:Q1CAN9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN9"
FT                   /protein_id="ABG12483.1"
FT                   /translation="MQQLQNVIETAFERRADITPANVDTVTREAITHVIDLLDTGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVMEGAETRYYDKVPMKFAGYDEARFQREGFR
FT                   VVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGSYSLYCAVIVKKVDAKTRSKVGINELLRTID"
FT   gene            complement(597438..600119)
FT                   /locus_tag="YPA_0516"
FT   CDS_pept        complement(597438..600119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0516"
FT                   /product="(protein-PII) uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12484"
FT                   /db_xref="GOA:Q1CAN8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN8"
FT                   /protein_id="ABG12484.1"
FT                   /translation="MSDNHTEHSLSLTLTPTISEQPALPSTYLDSDIHCPILKQRLDAF
FT                   QRWQAEAFNSGTSAEVLIAARSDYIDHLLQRLWTFYGFDKVPETALVAVGGYGRGELHP
FT                   LSDIDVLVLSKQRLNDEQAQRVGQLITLLWDLKLEVGHSVRTLEECLLEGLADLTIATN
FT                   MIESRLICGDVALFLQMQKHIFSDSFWPSPQFFHAKVVEQQERHKRYHGTSYNLEPDIK
FT                   SSPGGLRDIHTLLWVARRHFGATSLSEMVDFGFLTNAERNELNESQSFLWRIRFALHLV
FT                   LTRYDNRLLFDRQLSVAQLLRYEGEGNEPVEHMMKDFYRMTRRVSELNNMLLQLFDEAI
FT                   LALDANEKPRPLDEEFQLRGDLIDLRDENLFVRQPEAIMRMFYLMVRNQDIKGIYSTTV
FT                   RRLRHARRHLKAPLCHIPEARKLFMAILRHPGAVSRALLPMHRHSVLWAYMPQWGSIVG
FT                   QMQFDLFHAYTVDEHTIRVLLKIESFADEDTRPRHPLCVELYPRLPQPELLLLAALFHD
FT                   IAKGRGGDHSILGAHDAVEFAEQHGLNSRESQLVAWLVRCHLLMSVTAQRRDIQDPAVI
FT                   QQFSAEVQSETRLRYLVSLTVADICATNENLWNSWKQSLLRELYFATEKQLRRGMQNSP
FT                   DLRERVRHHRLQALALLRMDNIDEEALHRIWSRCRADYFLRHSPNQLAWHARHLLEHDS
FT                   TKPLVLVSRQATRGGTEIFIWSPDRPSLFAAVVGELDRRNLSVHDAQIFTNRDGMAMDT
FT                   FIVLEPDGSPLAQDRHPIISHALQQAINRSDYQHPPRVRRLSPKLRHFSVPTEANFLPT
FT                   HNERRTYLELIALDQPGLLARVGKIFADLGLSLHSARITTIGERVEDLFVLADKDRRAL
FT                   SLETRRELAQRLADTLNPNDKL"
FT   gene            complement(600179..600970)
FT                   /locus_tag="YPA_0517"
FT   CDS_pept        complement(600179..600970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0517"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12485"
FT                   /db_xref="GOA:A0A0E1NSK1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSK1"
FT                   /protein_id="ABG12485.1"
FT                   /translation="MAISIKTPEDIQKMRVAGRLAAEVLEIIEPYVKPGVTTGELDRIC
FT                   HDHITNHQQAISACLGYHGFPKSVCISVNEVICHGIPSDEKVLKEGDIVNIDVTVIKDG
FT                   FHGDTSKMFIVGKPTILGERLCRVTQESLYLAIKMVKPGIRLRTLGKAIQKFVEAENFS
FT                   VVREYCGHGIGEGFHEEPQVLHYDADDGGVVLQAGMAFTIEPMVNAGDYRIRTMKDGWT
FT                   VKTKDRNLSAQYEHTIVVTDNGCEIMTLRKDDTIPNIITHE"
FT   gene            601405..602130
FT                   /locus_tag="YPA_0518"
FT   CDS_pept        601405..602130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0518"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12486"
FT                   /db_xref="GOA:Q1CAN6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN6"
FT                   /protein_id="ABG12486.1"
FT                   /translation="MATVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELTKISSRKGKILFVGTKRAASEAVKEAANNCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLEIQSQDGTFDKLTKKEALMRTRELNKLENSLGGIKDMGGLPDALFV
FT                   VDADHEHIAIKEANNLGIPVFSIVDTNSDPDGVDFIIPGNDDAIRAVKLYLGAVATAVR
FT                   EGRSQDLAVQAEESFVEAE"
FT   gene            complement(602057..603136)
FT                   /locus_tag="YPA_0519"
FT   CDS_pept        complement(602057..603136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4K8"
FT                   /protein_id="ABG12487.1"
FT                   /translation="MAAPFGALRLFAHCCNFSSKVSFNFLNAFAHFKADEVHDISVVFF
FT                   QQIANSFAWVHNEVLTSQRDFASELTHTAFNHLLSNLTWLAGFDSNVQLDLVLASNNFS
FT                   RNIVWLNIFRLACSDVHSNVLNQFFISTRGRNHNTDTCAMQVSTQNVAFQYSDTANVDV
FT                   LTDFSDQVCTLFFELSFQNIDISDFFSQSCVDNFFAECFEASIFSNEVSFAVQFQNHTV
FT                   LTISGNFSQDDTFSSNTACFLGSFSLTRLTHVVDGQLNVTISFNQRLFTFHHACGCTLT
FT                   QFFYQSSGNSNHLNFLGSLVKTKSHIRYAKGAYKAPLTNIFQYLVNKGSQRAGLIIQLL
FT                   RSFLPPERPDLENDLHGRR"
FT   gene            602258..603115
FT                   /locus_tag="YPA_0520"
FT   CDS_pept        602258..603115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0520"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12488"
FT                   /db_xref="GOA:Q1CAN4"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN4"
FT                   /protein_id="ABG12488.1"
FT                   /translation="MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRIAAEGIILAKVSADGKYGVILELNCETDFVAKDAGFKAFGEEVINAALA
FT                   EKIADIDVLKAKFEEQRANLVAKIGENINIRRVAVLEGDILGTYLHGARIGVMVAATGA
FT                   DEELVKHIAMHIAASKPEYVKPDDVPAEVVAREHQIQLDIAIESGKPREIAEKMVEGRM
FT                   RKFTGEVSLTGQNFVMDPSKTVGDLLKENNADVVNFIRFEVGEGIEKVETDFAAEVAAM
FT                   SKQS"
FT   gene            603299..603757
FT                   /locus_tag="YPA_0521"
FT   CDS_pept        603299..603757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0521"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12489"
FT                   /db_xref="GOA:Q1C0I9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C0I9"
FT                   /protein_id="ABG12489.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            604034..604759
FT                   /locus_tag="YPA_0522"
FT   CDS_pept        604034..604759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0522"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12490"
FT                   /db_xref="GOA:Q1CAN2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN2"
FT                   /protein_id="ABG12490.1"
FT                   /translation="MATNAKPVYQRILLKLSGEALQGAEGFGIDASVLDRMAQEVKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAQAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRHNRVVIFAAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVYSADPVKNPDATLYEQLTYQDVLEQELKVMDLAAFTLARDHNLPIRVFNMNK
FT                   PGALRRVVMGENEGTLIAK"
FT   gene            604895..605452
FT                   /locus_tag="YPA_0523"
FT   CDS_pept        604895..605452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0523"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12491"
FT                   /db_xref="GOA:Q1CAN1"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN1"
FT                   /protein_id="ABG12491.1"
FT                   /translation="MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYY
FT                   GTATPLRQLANIVVEDSRTLALTVFDRSLSAAVEKAIMTSDLGLNPSSAGTVIRVPLPA
FT                   LTEERRKDLIKVVRAEAEQGRVSIRNVRRDANDKVKALLKDKEISEDEDRRSQDDVQKL
FT                   TDAYIKKVDAALAVKEAELMDF"
FT   gene            605666..606862
FT                   /locus_tag="YPA_0524"
FT   CDS_pept        605666..606862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0524"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12492"
FT                   /db_xref="GOA:Q1CAN0"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN0"
FT                   /protein_id="ABG12492.1"
FT                   /translation="MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQ
FT                   CLEFSPRYAAMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGI
FT                   AGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPER
FT                   IQRQLGYSSLNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIA
FT                   HAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANE
FT                   ISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAKLNN"
FT   gene            607086..607844
FT                   /locus_tag="YPA_0525"
FT   CDS_pept        607086..607844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0525"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12493"
FT                   /db_xref="GOA:A0A0E1NV49"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV49"
FT                   /protein_id="ABG12493.1"
FT                   /translation="MSPVKEDRANLSPRSPRHVAIIMDGNGRWAKNKGKLRVFGHKAGV
FT                   KSVRRAVSFAAKHNLDALTLYAFSSENWNRPDQEVTALMELFVRALDSEVKSLHKHNVR
FT                   LSIIGDISRFSGRLQERIRRSEKLTANNDGLKLNIAANYGGRWDIIQGVRHLAEQVQKG
FT                   ELQPTDISEESLNSYICLHEQSQVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDF
FT                   DENVFEGALNAFAQRERRFGGTTPIDATAS"
FT   gene            607854..608702
FT                   /locus_tag="YPA_0526"
FT   CDS_pept        607854..608702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0526"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12494"
FT                   /db_xref="GOA:A0A0E1NUT1"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUT1"
FT                   /protein_id="ABG12494.1"
FT                   /translation="MLKYRLITALILIPVVIGALFLLPPVGFAIVTLVVCMLAAWEWGQ
FT                   LAGFASRTQRIWLAILCGFLLVAMLLSLPEYQHSPHHLLVSTPLWLSMGWWVAALMLVL
FT                   TYPRSAVSWRNSRLLRIIFGILTIIPFFWGMFALRQYGYEQNHNTGAWWLLYVMLLVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWEGLIGGLLTSALISLLFGRYAPLDIVPEKLLI
FT                   CSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLMLLV
FT                   F"
FT   sig_peptide     607854..607943
FT                   /locus_tag="YPA_0526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.765 at
FT                   residue 30"
FT   gene            608731..610086
FT                   /locus_tag="YPA_0527"
FT   CDS_pept        608731..610086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0527"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12495"
FT                   /db_xref="GOA:A0A0E1NUC5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUC5"
FT                   /protein_id="ABG12495.1"
FT                   /translation="MMSILWSLAAFIVALGILITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRQGTEYVIALIPLGGYVKMLDERVEAVAPELRHQSFNNKTVLQRAAIVSAG
FT                   PIANFLFAIVAYWLVFIIGVPSVRPVIGDISPQSIAAQANISSGMELKSVDGIETPDWD
FT                   SVRLALISRIGDKQMQVGVAPFGSDNVVEKTLDLRQWQFEPDKQDPVVALGIIPRGPQI
FT                   ESVLAEVQPGSAAQKAGLQAGDRIVKVNGQLLDRWQTFVLQVRDNPGQPLVLDIEREST
FT                   PLSLTLIPDTKSVGENRSEGFAGVVPKVIPLPDEYKTIRQYGPFTAVYQAGDKTWQLMR
FT                   LTVSMLGKLITGDVKLNNLSGPISIAQGAGLSAEYGLVYYLMFLALISVNLGIINLFPL
FT                   PVLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            610123..612510
FT                   /locus_tag="YPA_0528"
FT   CDS_pept        610123..612510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0528"
FT                   /product="putative surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12496"
FT                   /db_xref="GOA:Q1CAM6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAM6"
FT                   /protein_id="ABG12496.1"
FT                   /translation="MAMKKLLIASLLFGSATVYGADGFVVNDIHFEGLQRVAVGAALLN
FT                   MPVRVGDTVSDDDIGKTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKA
FT                   VKEDMLKQNLEASGVRVGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFTEGVSAKIQQINIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSFYLDRGYARFNIDSTQVSLTPDKKGIYVTINITEGPQFKLNSVIVSGNLAGHQ
FT                   SEAEKLTKIEPGELFNGSKVTRMEDDIKKMLGRYGYAYPRVVTQPEINDDDKTVKLHIN
FT                   VDAGNRFYVRHIRFEGNDTSKDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVD
FT                   VETQRVPGAADLVDVTYKVKERNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGI
FT                   NGTKNDYQTYAEFTLMDPYFTVDGVSLGGRIFYNDFKADNADLSGYTNSSYGADGTLGF
FT                   PINENNSLRVGVGYVHNDLSDMLPQVAMWRYLESVGERPGYDGREGFTTDDFTLNLGWT
FT                   YNNLDRGFFPTSGVKSSVNTKITVPGSDNEFYKVTFDTSAYQPLNEDRSWVLLGRGRLG
FT                   YGDGIGSKEMPFYENFYAGGSSTVRGFRSNNIGPKAAYYANGGATVTNSTDAVGGNAMA
FT                   VASIELITPTPFISEKYSNSVRTSIFIDSGTVWDTNWENTAKTRAAGIPDYGKASNIRV
FT                   SAGVALQWMSPLGPLVFSYAKPVKDYEGDKSEQFQFNIGKTW"
FT   sig_peptide     610123..610185
FT                   /locus_tag="YPA_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 21"
FT   gene            612617..613165
FT                   /locus_tag="YPA_0529"
FT   CDS_pept        612617..613165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0529"
FT                   /product="cationic 19 kDa outer membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12497"
FT                   /db_xref="GOA:A0A0H2Y4L3"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4L3"
FT                   /protein_id="ABG12497.1"
FT                   /translation="MQFKVSLTQTGNGKEFIVKKWLCAASLGLALAASASVQAADKIAI
FT                   VNVSSIFQQLPAREAVAKQLENEFKGRATELQGMERDLQTKMQKLQRDGSTMKASDRTK
FT                   LENEVMKQRETFSTKAQAFEQDNRRRQAEERNKILSRIQDAVKSVATKGGYDVVIDANA
FT                   VAYADSSKDITADVLKQVK"
FT   sig_peptide     612617..612736
FT                   /locus_tag="YPA_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 40"
FT   gene            613169..614191
FT                   /locus_tag="YPA_0530"
FT   CDS_pept        613169..614191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0530"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12498"
FT                   /db_xref="GOA:Q1CAM4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAM4"
FT                   /protein_id="ABG12498.1"
FT                   /translation="MPSIRLADLAQQLDAQVHGDGDLVITGIASMHSAQPEQITFLSNS
FT                   RYREQLASCNAGAVVLTEADLPFCKVAALVVENPYFTYARMAQIMDTTPQPAQDIAPSA
FT                   VISPQATLGEGVSVGANAVIESGVVLGDNVVIGAGCFIGKNTHIGAGSRLWANVSIYHE
FT                   VVIGQNCLIQSGTVIGADGFGYANDRGNWVKIPQLGSVHIGDRVEIGACTTIDRGALDN
FT                   TIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKVGRYCMIGGASVINGHMEICD
FT                   KVTITGMGMVMRPITEPGLYSSGIPLQPNKMWRKTAALVMNIDGINKRLKAVERKIDKE
FT                   "
FT   gene            614349..614879
FT                   /locus_tag="YPA_0531"
FT   CDS_pept        614349..614879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0531"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12499"
FT                   /db_xref="GOA:Q1CAM3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="PDB:5BUX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAM3"
FT                   /protein_id="ABG12499.1"
FT                   /translation="MTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVS
FT                   FNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVEFVKERRGLTRFTGVAKVDGEIVCTATMMCARSKPAAPAESVVVKPDV
FT                   VKPDVVNPVVKES"
FT   gene            614883..615671
FT                   /locus_tag="YPA_0532"
FT   CDS_pept        614883..615671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0532"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12500"
FT                   /db_xref="GOA:Q1CAM2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAM2"
FT                   /protein_id="ABG12500.1"
FT                   /translation="MIDKTAFIHPSSIVEEGAIIGAGVYIGPFCIVGSQVEIGAGTELK
FT                   SHVVVNGITKIGCDNQIYQFASIGEANQDLKYAGEPTRVEVGDRNRIRESVTIHRGTTQ
FT                   GGGVTKVGCDNLLMVNTHVAHDCVIGNRCILANNAALGGHVEIDDYAIIGGMTAIHQFC
FT                   VIGAHVMVGGCSGITQDVPPFVIAQGNHATPFGINIEGLKRRGFDKESLHAIRSAYKLL
FT                   YRSGRTLDEVKPEIAELAEQYPVVKAFNDFFARSTRGIIR"
FT   gene            615675..616859
FT                   /locus_tag="YPA_0533"
FT   CDS_pept        615675..616859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0533"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12501"
FT                   /db_xref="GOA:A0A0E1NX07"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX07"
FT                   /protein_id="ABG12501.1"
FT                   /translation="MQNSPLTADCSLNAGRPLTIGLVAGETSGDILGAGLIRALKVQVP
FT                   NARFVGVAGPLMQAEGCEAWYEMEELAVMGVVEVLERLPRLLKIRKDLTQRFSELSPDV
FT                   FVGIDAPDFNITLEGRLKQRGIRTIHYVSPSVWAWRQKRVFKIGKATDMVLAFLPFEKA
FT                   FYDRFNVPCRFIGHTMADAMPLVPDQQAARAELGIAPNATCLALLPGSRHSEVEMLSAD
FT                   FLRTAVILRDKLPNLEVVVPLVNSKRREQFERIKAEIAPDLSVHLLDGKARVAMIASDA
FT                   ALLASGTAALECMLAKCPMVVGYRMKPFTFWLAERLVKTPYVSLPNLLAGEELVTELLQ
FT                   QECQPQKLAGALLPLLQGGSEIAALKERFLVLHQSIRCGADEQAAQAVLELADR"
FT   gene            616856..617452
FT                   /locus_tag="YPA_0534"
FT   CDS_pept        616856..617452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0534"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12502"
FT                   /db_xref="GOA:Q1CAM0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAM0"
FT                   /protein_id="ABG12502.1"
FT                   /translation="MSETFIYPQANLIAGVDEVGRGPLVGAVVTAAVILDPNRPIVGLA
FT                   DSKKLSEKRRLSLYDEITEKALSWSLGRAEPEEIDQLNILHATMLAMQRAVSGLHIVPD
FT                   YVLIDGNRCPKLQMPSLAVVKGDSRVAEISAASILAKVTRDREMTELDLLFPEYGFAQH
FT                   KGYPTAFHLEKLAALGATVHHRRSFGPVKRVLGLV"
FT   gene            617582..621097
FT                   /locus_tag="YPA_0535"
FT   CDS_pept        617582..621097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0535"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12503"
FT                   /db_xref="GOA:A0A0H2Y481"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y481"
FT                   /protein_id="ABG12503.1"
FT                   /translation="MIQSTHFWYLDMAEPRFVHLRVHSDYSMIDGLAKIGPLVKRAAAL
FT                   GMPALAITDFTNLCGLVKFYGSAHGAGIKPIIGADFYVQSEILGDELAHLTVLARNNEG
FT                   YQNLTLLISEAYQRGYGAAGPIIDRDWLIKHKEGLILLSGGRMGDVGKFLLRGNQVQVD
FT                   QCLAFYQEHFPDCYYLELIRTGRPDEENYLHAAVALATERGLPVVATNDVRFIDESDFD
FT                   AHEIRVAIHDGFTLVDPKRPKNYSPQQFMRDEEQMCELFADIPEALINSVEIAKRCNVT
FT                   IRLGEYFLPQFPTGEMSTEDFLVEKAKQGLEERLEFLFPDPEVRLQKRPEYDERLDIEL
FT                   KVINQMGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDIDPLEFDLLF
FT                   ERFLNPERVSMPDFDVDFCMEKRDLVIEHVAEMYGRDAVSQIITFGTMAAKAVIRDVGR
FT                   VLGHPYGFVDRISKLIPLDPGMTLEKAFAAEPQLAEIYEADEEVRALIDMARKLEGVTR
FT                   NAGKHAGGVVIAPTKITDFAPLYCDAEGNNPVTQFDKNDVEYAGLVKFDFLGLRTLTII
FT                   NWALEMINARRAKTGLEPIDIASIPLEDKKSFDMLQRSETTAVFQLESRGMKDLIKRLK
FT                   PDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREAISYPDIEWQHESLKPVLEPTYGI
FT                   ILYQEQVMQIAQVLSGYSLGGADMLRRAMGKKNPAEMAKQRSVFEDGAKNQGIDGELAI
FT                   KIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTDKVVGLV
FT                   DECWRMGLKILPPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAILEARKEGGYFK
FT                   ELFDLCARVDTKKLNKRILEKLIMSGAFDRLGPHRAALMSSLGDALKAADQHAKAEAIG
FT                   QVDMFGVLADAPEQVEQSYANVPPWQEQVVLDGERETLGLYLTGHPITQYLKEIERYAG
FT                   GMRLKDMHPTDRGKMTTAVGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALEK
FT                   YQHLLEKDRILIATGQVSFDDFSGGLKMTARELMDISEAREKYASGLAISLTDRQIDDQ
FT                   LLNRLRQSLEPHRAGTIPVHLYYQREDARARLRFGATWRVTPTDRLLIDLRTLVGNEQV
FT                   ELEFD"
FT   gene            621110..622069
FT                   /locus_tag="YPA_0536"
FT   CDS_pept        621110..622069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0536"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12504"
FT                   /db_xref="GOA:Q1CAL8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAL8"
FT                   /protein_id="ABG12504.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINLDEEVQRLRE
FT                   KSVELTRKIFSDLGAWQIAQLARHPRRPYTLDYIANIFTDFEELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKLPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPIVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGITAHRLKELKMIDSVIPEPLGGAHRDYAA
FT                   IAISLKAQLLADLNDLDVLNDEELLNRRYQRLMNYGYC"
FT   gene            622253..622651
FT                   /locus_tag="YPA_0537"
FT   CDS_pept        622253..622651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12505"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVW4"
FT                   /protein_id="ABG12505.1"
FT                   /translation="MLAINKIHHIAIICSDYQASKRFYCEVLGFNLISEVYREERDSWK
FT                   ADLALHDQYTIELFSFPSPVPRPSRPEACGLRHLAFQVDDIDLALKELVVAGVVCEAVR
FT                   IDPYTQSRFTFFNDPDGLPLELYELKAE"
FT   gene            622653..624035
FT                   /locus_tag="YPA_0538"
FT   CDS_pept        622653..624035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12506"
FT                   /db_xref="GOA:A0A0E1NQS5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQS5"
FT                   /protein_id="ABG12506.1"
FT                   /translation="MNLVTSKPNVLLNPLFAQLGENRHVLVGFSGGLDSTVLLHLLVCL
FT                   RQQLIPELNIRAIHIHHGLNPQADSWVKHCMQQCDQWKIELKVVRVNIDPRQNGIEAAA
FT                   RTARYQAFSANLAAKEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAAKMPFAHSQLL
FT                   RPLLAFSREILENYAQAQQLQWIEDDSNQDDRFDRNFLRLNVLPILNQRWPHFAQATAR
FT                   SAGLCAEQEQLLDELLAENLQQLQGPDRSLSIDGLLQASMAKRAAILRRWLASLGAPMP
FT                   SQSQLQRLWLEVAMARQDAEPQLMIGTRQVRRFRQHLYLLMPLAEITTNYLPWATVKAA
FT                   PNSSIIPLLPEPLWLPADLGVLRFVSAGGQAVRPAAVGEEISVRFGLQGDIKIVGRHHS
FT                   RQSKKVWQELGIPPWQRERIPLLYFGEQLIAAAGVFVTQAGQANENEPCWHLDWDKPLR
FT                   LG"
FT   gene            624272..624589
FT                   /locus_tag="YPA_0539"
FT   CDS_pept        624272..624589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0539"
FT                   /product="putative cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12507"
FT                   /db_xref="GOA:A0A0E1NTD1"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTD1"
FT                   /protein_id="ABG12507.1"
FT                   /translation="MMKLVVSMAVLLSLCSFQVWAKNDIEAGRAKSSSCVACHGMNGKV
FT                   SVPMYPNLAGQNALYLQQSLEAYKKGSRSGGQAEVMRAYVSGLSDEDFSDLAAYYASLK
FT                   P"
FT   sig_peptide     624272..624337
FT                   /locus_tag="YPA_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(624854..625114)
FT                   /locus_tag="YPA_0540"
FT   CDS_pept        complement(624854..625114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12508"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSG3"
FT                   /protein_id="ABG12508.1"
FT                   /translation="MSMSEEYQPINCDDYDNLELACQHHLILTLKLRGGEIVEGKASDL
FT                   LLRKKVEYLIVEQEGTMRELRLDHIASFSHPEIGTVVVSAS"
FT   gene            complement(625101..625301)
FT                   /locus_tag="YPA_0541"
FT   CDS_pept        complement(625101..625301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12509"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAL3"
FT                   /protein_id="ABG12509.1"
FT                   /translation="MQQYCELVRRFYAEIGSGDLGYVPDALRCVLKALDEVAANDALPS
FT                   SVREQAAYAAANLLVSDYVDE"
FT   gene            625543..626091
FT                   /locus_tag="YPA_0542"
FT   CDS_pept        625543..626091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12510"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQZ8"
FT                   /protein_id="ABG12510.1"
FT                   /translation="MALKATIHKAAINIADMDRNFFQDINLTIAQHPSETDQRMMLRLL
FT                   AWICHADERLLFTKGLSADDEPEVWRHNDHNGIELWIELGLPEEKRLRKACNQSKQVVL
FT                   YAYSERAAKVWWPQVQEKLAGHRNLRVRFLDDEQMAKLAALSNRNMSLQATLQEGTIWL
FT                   SDVQNNLEISFAEWQNYGQ"
FT   gene            626070..626510
FT                   /locus_tag="YPA_0543"
FT   CDS_pept        626070..626510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12511"
FT                   /db_xref="GOA:A0A0H2Y5K7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5K7"
FT                   /protein_id="ABG12511.1"
FT                   /translation="MAKLRAISVLIISNSVTLASGEIELTAIRAQGAGGQHVNKTSTAI
FT                   HLRFDIKASSLPEYYKERLLLLNSHLVTAEGVVIIKAQEYRSQDMNREAALARLVALIR
FT                   QAMVVEKARRATKPTKGSKIRRVEGKVRKGATKALRGKIHQE"
FT   sig_peptide     626070..626129
FT                   /locus_tag="YPA_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.563 at
FT                   residue 20"
FT   gene            626595..627278
FT                   /locus_tag="YPA_0544"
FT   CDS_pept        626595..627278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0544"
FT                   /product="putative copper homeostasis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12512"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN90"
FT                   /protein_id="ABG12512.1"
FT                   /translation="MSKLTITLLLAVGALSLLGCNNRSQPAEQVLQPMQQSYQGVLPCA
FT                   DCSGLDTSLFLDSDGTFILKEVYLGTKDGDQTFAEYGKWARTADKLVLTNGQGEKRYFH
FT                   PVDKSLVMLDQQGLPIKSTLNYQLEPSDQPLSKTPMPLSGMYKYFADAAIFTDCVTGKA
FT                   FPVENNIELETGYLNARRNPGEPVFLTLNGYFDSRPSMEEGRTNKTLIPEGDIQFNANK
FT                   SCEKK"
FT   sig_peptide     626595..626654
FT                   /locus_tag="YPA_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.581 at
FT                   residue 20"
FT   gene            complement(627412..629130)
FT                   /locus_tag="YPA_0545"
FT   CDS_pept        complement(627412..629130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0545"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12513"
FT                   /db_xref="GOA:Q1CAK9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAK9"
FT                   /protein_id="ABG12513.1"
FT                   /translation="MRTSQYLLSTQKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLIRGEINSYKQLPLNFFQIQTKFRDEVRPRFGVMRAREFLMKDAYSF
FT                   HTTQESLQETYDAMYTAYSKIFSRMDLNFRAVLADTGSIGGSASHEFQVLAESGEDDIV
FT                   FSTGSDYAANIEFAEALAPTEPRAPATEELRIVDTPNAKTIAELVEQFKLPIEKTVKTL
FT                   LVHAHEESGHKLVALLVRGDHDLNEIKAEKLPQVAKPLTFASEEEIRAAIGAGPGSLGP
FT                   VNLSLPVIADHSVAVMSDFGAGANIDGKHYFGINWERDLALPLVADLRNVVEGDISPDG
FT                   KGTLQIKRGIEVGHIFQLGTKYSEVMKATVQGEDGRNQVMTMGCYGIGVSRVVAAAIEQ
FT                   NHDDRGIIWPDAIAPFQVAILPMNMHKSFRVKELAEELYTTLRSHGIDVILDDRKERPG
FT                   VMFADMELIGVPHNIVIGDRNLDSEEVEYKNRRVGEKQMIKTSEIVEFLLSQIKR"
FT   gene            complement(629234..629941)
FT                   /locus_tag="YPA_0546"
FT   CDS_pept        complement(629234..629941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12514"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUK8"
FT                   /protein_id="ABG12514.1"
FT                   /translation="MSTFSFNQIGVIRSPYKEKFAVPRQPGLVEDGGGELQLLAPYNQP
FT                   ESVRGLSDFSHLWVIFVFHQTMEGSWRPTVRPPRLGGNTRMGVFATRSTFRPNPIGMSL
FT                   IELKGVRCQNGEVILALGSLDLVDGTPVIDIKPYLPFAESQPQARAGFAQSAPDTEMQV
FT                   CFSPAAEQQLAHHQQRYPHLRRFISQVLAQDPRPAYRKDDNESREYAVLLLEFNVRWRV
FT                   IGQQTEVLSLDPR"
FT   gene            complement(629938..630345)
FT                   /locus_tag="YPA_0547"
FT   CDS_pept        complement(629938..630345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0547"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12515"
FT                   /db_xref="GOA:A0A0E1NP61"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NP61"
FT                   /protein_id="ABG12515.1"
FT                   /translation="MRALPLCLLALSLTGCTLLPSKPSTTDNPIKQPPPVIERSPTAAP
FT                   RPAPVKLYKSAEELVGKPFRDLGEVSGESCQSTVQDSPPSISTARKRMQIRASYMKANA
FT                   VLLHECEIQSGVPGCYQQAVCQGSALNVSSK"
FT   sig_peptide     complement(630265..630345)
FT                   /locus_tag="YPA_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.631 at
FT                   residue 27"
FT   gene            complement(630463..631278)
FT                   /locus_tag="YPA_0548"
FT   CDS_pept        complement(630463..631278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0548"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12516"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSP1"
FT                   /protein_id="ABG12516.1"
FT                   /translation="MSLKFKSIAAISALIGTLTLVGCGPTEKAPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDLNAFQHKPYLDQQIKDRGYKLV
FT                   SVGNSFVYPIAGYSKKIKSLDELQPGSQVALPNDPTNLGRSLLLLQSVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKLVELEAPQLPRSLDDQQIALAIINTTYASQIGLTPAKDGLFVED
FT                   KESPYVNLIVAREDNKDAENVKKFVQAYQSDEVYDAANKAFNGGAVKGW"
FT   sig_peptide     complement(631210..631278)
FT                   /locus_tag="YPA_0548"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.647 at
FT                   residue 23"
FT   gene            complement(631342..631995)
FT                   /locus_tag="YPA_0549"
FT   CDS_pept        complement(631342..631995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0549"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12517"
FT                   /db_xref="GOA:A0A0E1NUL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUL5"
FT                   /protein_id="ABG12517.1"
FT                   /translation="MSEAMMWLMARGVWETLMMTFVSGFFGFVLGLPVGVLLYVTRPGQ
FT                   IIANNKIYRTLSGVVNIFRSIPFIILLVWMIPFTRMIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPSGLVEAARAMGATPMQIIKKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQLSGDRIVKAVTHK"
FT   gene            complement(631988..633019)
FT                   /locus_tag="YPA_0550"
FT   CDS_pept        complement(631988..633019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0550"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12518"
FT                   /db_xref="GOA:Q1CAK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAK4"
FT                   /protein_id="ABG12518.1"
FT                   /translation="MIKLTHISKVFQQGSRTITALSDVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCANMLERPTSGQVLVDDQDLTTLSEGQLTRARRQIGMIFQHFNLLSSRTVYGNIA
FT                   LPLELDNTSRADIKKRVNELLDLVGLTDKQDAYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDQVAVISEGKLIEK
FT                   DSVSEVFSHPKTPLAQQFIQSTLHLDIPEDYAKRMSPEPTVDHVPLLKLEFTGKSVDAP
FT                   LISQAVRRFNIDIGILSSQMDYAGGVKFGVMLAELHGDVQDGLAAIKFLQDHHVKVEVL
FT                   GYV"
FT   gene            633206..633772
FT                   /locus_tag="YPA_0551"
FT   CDS_pept        633206..633772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0551"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12519"
FT                   /db_xref="GOA:A0A0E1NR66"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR66"
FT                   /protein_id="ABG12519.1"
FT                   /translation="MTQSVPAIFLDRDGTVNVDHGYVHEIDNFQFIDGVIDACRELKEM
FT                   GFALVLVTNQSGIARGMFTEEQFLSLTEWMDWSLADRGVDLDGIYFCPHHPDGSVAEFS
FT                   ETCECRKPLPGMLLQAQNELNIDMAASYMVGDKIEDMQAALAANIGTKVLVRTGKPVTA
FT                   EGEAAADWVLNSLADLPKAIKARYK"
FT   gene            complement(634023..634208)
FT                   /locus_tag="YPA_0552"
FT   CDS_pept        complement(634023..634208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4M3"
FT                   /protein_id="ABG12520.1"
FT                   /translation="MFDLLTFTCVKAAVLKDYFLQIGILTGVKMFTALVTLQDLILFLP
FT                   AETGVDIVLRVPTQIV"
FT   gene            634241..635756
FT                   /locus_tag="YPA_r025"
FT   rRNA            634241..635756
FT                   /locus_tag="YPA_r025"
FT                   /product="16S RNA"
FT   gene            635893..635968
FT                   /locus_tag="YPA_r026"
FT                   /note="tRNA-Glu3"
FT   tRNA            635893..635968
FT                   /locus_tag="YPA_r026"
FT                   /product="tRNA-Glu"
FT   gene            636221..639126
FT                   /locus_tag="YPA_r027"
FT   rRNA            636221..639126
FT                   /locus_tag="YPA_r027"
FT                   /product="23S RNA"
FT   gene            639126..639357
FT                   /locus_tag="YPA_r028"
FT   rRNA            639126..639357
FT                   /locus_tag="YPA_r028"
FT                   /product="5S ribosomal RNA"
FT   gene            639477..639553
FT                   /locus_tag="YPA_r029"
FT                   /note="tRNA-Asp2"
FT   tRNA            639477..639553
FT                   /locus_tag="YPA_r029"
FT                   /product="tRNA-Asp"
FT   gene            639912..640715
FT                   /locus_tag="YPA_0553"
FT   CDS_pept        639912..640715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0553"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12521"
FT                   /db_xref="GOA:A0A0E1NR23"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR23"
FT                   /protein_id="ABG12521.1"
FT                   /translation="MSIPVFGLGTFRLQDQIVIDSVSQALTLGYRAIDTAQIYENEAPV
FT                   GQAIQESGINRDELFITTKIWIANLSKDKLIPSLRESIQKLKTDYVDLTLIHWPSPNDE
FT                   VSVAEFMSELLKAKGLGLTRQIGISNFTIDLMKQAIAAVGAEEIATNQIELSPLLQNRN
FT                   VVDFAKQNGIAVTSYMTLAYGKALAEPVIKTIAEQHGATPAQVILSWAMQLGYGVIPSS
FT                   TKAANLASNLLAQKLCLNAADMALIATLDRNERLVSPDGLAPKWD"
FT   gene            640750..641214
FT                   /locus_tag="YPA_0554"
FT   CDS_pept        640750..641214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y497"
FT                   /protein_id="ABG12522.1"
FT                   /translation="MRWFFILVHPDGAETGSVKSVRMDMELPPSMCAVIVGTNLMRAYQ
FT                   RVGEQRVDNSIVKKHGNEAMDLQLSGLRPDNGSQVESAGQGNCEASIGTERMDTLLPFN
FT                   RGGRGDWNSWIGGDKENCVACYGGSGKGRIYEQRCLLEEVFYRKGLIYQQ"
FT   gene            641596..642357
FT                   /locus_tag="YPA_0555"
FT   CDS_pept        641596..642357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12523"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMX6"
FT                   /protein_id="ABG12523.1"
FT                   /translation="MRYVAGQPVEQIFPGAAKQLDKGLPLGEPLPTAELLRVVVWNIFK
FT                   QQRAGWLPVLKELGRDTQLMLLQEAQTTPELVRFATASYQAADQVPAFSLPQHPSGVMT
FT                   LAAAHPVYCCPLREREPLLRLSKSALVTVYPIHDGRLLMVVNIHAVNFSLGVDVYSKQL
FT                   DPIGDQIASHRGPVILAGDFNAWSRQRINALQHFAQDAGLQEVEFRVDHRSRAFGRPLD
FT                   FIFYRGLTVIDASVLVTRASDHNPLIVEFQP"
FT   gene            complement(642399..643826)
FT                   /locus_tag="YPA_0556"
FT   CDS_pept        complement(642399..643826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0556"
FT                   /product="membrane-bound lytic murein transglycosylase D
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12524"
FT                   /db_xref="GOA:A0A0H2Y3F2"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3F2"
FT                   /protein_id="ABG12524.1"
FT                   /translation="MIARLLSNHIDTHMKTKAILLASVLLVGCQTSKQDAQAPEQHAQS
FT                   LSSAGQASEAGEYTNSTREGSARWLESESSYAQQDLWNFIKDELKMKVPENSRIREQKQ
FT                   KYLKNKSYLHDVTLRAEPYMYLIVEQIKKRKMPMELVLLPIVESAFDPHATSSANAAGL
FT                   WQIVPSTGRNYGLKQNQWYDGRRDVVASTKAALDILERLNKMFNGDWLLTVAAYNSGEG
FT                   RVMQAIKANKAKGKPTDFWALSLPRETSIYVPKMLALGDLLKNSKKYGITLPETDKDRA
FT                   LARVDVDQQIELTQAAEMAGMSLTKLKSFNSGYKRNVTAPDGHGPRYIMLPKAHAEQLK
FT                   DSLADTDITAVQPTKLATNSTKSASSSQYKVRPGDTLSTIAKRLNIKTSDLQSWNNLRA
FT                   KSTLKVGQTLQLASNTTSKSITYQVRKGDSFASIAKRHGVNTDDVMRWNSVVSKANNLQ
FT                   PGLKLTLFVNDKSTPEA"
FT   sig_peptide     complement(643716..643826)
FT                   /locus_tag="YPA_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.493 at
FT                   residue 37"
FT   gene            complement(643859..644614)
FT                   /locus_tag="YPA_0557"
FT   CDS_pept        complement(643859..644614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0557"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12525"
FT                   /db_xref="GOA:Q1CAJ7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAJ7"
FT                   /protein_id="ABG12525.1"
FT                   /translation="MNLISIPAFQDNYIWLLANRQKHCVIVDPGESAPVLATLAQGQYV
FT                   PQAILLTHHHNDHVGGVADLRHHFPDIPVYGPQETAKKGATVIVNDGDSLTIAGQNYTI
FT                   IAVPGHTLGHIAYYSSPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICC
FT                   AHEYTLSNLKFAHAILPADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDI
FT                   DLQRKIGTTSPPDSLVSVFCELRSRKDSF"
FT   gene            644659..645378
FT                   /locus_tag="YPA_0558"
FT   CDS_pept        644659..645378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12526"
FT                   /db_xref="GOA:A0A0E1NPY2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPY2"
FT                   /protein_id="ABG12526.1"
FT                   /translation="MKPAQIRQNIETPASWAELPWGEYYRAALEQQLQPWWPKFFGFHL
FT                   LKVGHLSAEIASDKCAIAHQVNVGEWGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAA
FT                   NPHRILREVDRVLIDDGWLVISGFNPFSLLGLGKLVPVLRQRQPYISRMFTQMRLLDWL
FT                   SLLNYEVVHLSCFHVLPFNKNGGHFISTHLPALGCVNLIIARKRTVPLTFNPMKFGVRK
FT                   PWFSRAVGATKSYRDQP"
FT   gene            complement(645433..645897)
FT                   /locus_tag="YPA_0559"
FT   CDS_pept        complement(645433..645897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0559"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12527"
FT                   /db_xref="GOA:Q1CAJ5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAJ5"
FT                   /protein_id="ABG12527.1"
FT                   /translation="MTKQVEIFTDGSCLGNPGPGGYGAILRYKQHEKTFSAGYYLTTNN
FT                   RMELMAAIVALEALTSPCEVTLSTDSQYVRQGITQWIHNWKKRGWKTADRKPVRNVDLW
FT                   QRLDLAIQSHTIQWEWVKGHAGHPENERCDELARQGANSPTLDDTGYNPD"
FT   gene            645967..646731
FT                   /locus_tag="YPA_0560"
FT   CDS_pept        645967..646731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0560"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12528"
FT                   /db_xref="GOA:A0A0E1NX72"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX72"
FT                   /protein_id="ABG12528.1"
FT                   /translation="MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTG
FT                   RNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFADITPEFLDFIRGAELVIHNAAFDI
FT                   GFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRTLHG
FT                   ALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASEDIQRITRPASALKIIYATEDEL
FT                   ANHESRLDFVMKKGGSCLWRMPLEAEEETKAE"
FT   gene            646844..646920
FT                   /locus_tag="YPA_r030"
FT                   /note="tRNA-Asp3"
FT   tRNA            646844..646920
FT                   /locus_tag="YPA_r030"
FT                   /product="tRNA-Asp"
FT   gene            complement(646977..648461)
FT                   /locus_tag="YPA_0561"
FT   CDS_pept        complement(646977..648461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0561"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12529"
FT                   /db_xref="GOA:A0A0E1NWS9"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWS9"
FT                   /protein_id="ABG12529.1"
FT                   /translation="MPNNEKISASSINPHYSPKLTNEDLAPTRKQNWGWYNIFSFWMTD
FT                   VHSMGGYVVAASFFALGLSSWQVLLSLLVGICIVQICANLVAKPSQIAGVPYAVICRQS
FT                   FGVFGANIPAVIRGLIAVAWYGIQTYLAGNAFMLVMLKFFPSLIPLAQSQWLGLSTLGW
FT                   ICFSIMWVLQAMVFWHGMNAIKRFIDFAGPAVYVVMLSLALWIVYQTGWSNISFTLASK
FT                   ILSPSEQVWQMLTATALVVSYFAGPLLNFGDFSRYGKSMQEIRRGNRWGLPFNFLLFSL
FT                   VTVVIVSGSQSLFGEMITDPIETVTRVGNGVAIALGLLTMIIATIGINIVANFVSPAFD
FT                   FSNCSPQRINFRTGGMIAAVGSVLLTPWNLFQSPIIIHYTLDVLGAFMGPLFGILIADF
FT                   YLIKRGQLYVDDLFNASSSGRYWYRGGFNPKAIMALLPAVAIGLMIIFIPNLQQISSFS
FT                   WFIGAFLGGSIYRFIARNDPLPNNAALFIRPEIGKD"
FT   gene            648794..649033
FT                   /locus_tag="YPA_0562"
FT   CDS_pept        648794..649033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12530"
FT                   /db_xref="GOA:A0A0H2Y5M4"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5M4"
FT                   /protein_id="ABG12530.1"
FT                   /translation="MPMHETELNHDYPRDLAGYGGQPPVANWPGQARIAVQFVLNIEEG
FT                   AENNVLHGDAGSEQFLSDIIGADSYPDRHIVNDG"
FT   gene            complement(649084..649863)
FT                   /locus_tag="YPA_0563"
FT   CDS_pept        complement(649084..649863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0563"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12531"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12531.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(649863..650885)
FT                   /locus_tag="YPA_0564"
FT   CDS_pept        complement(649863..650885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0564"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12532"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12532.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(650899..651075)
FT                   /locus_tag="YPA_0565"
FT   CDS_pept        complement(650899..651075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12533"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVE2"
FT                   /protein_id="ABG12533.1"
FT                   /translation="MARTTRPLTHTEVQKAKTTDKDLTLHDGDGLFLLVVTNGAIVIHT
FT                   QRLKSDPGGNLLS"
FT   gene            651490..651807
FT                   /locus_tag="YPA_0566"
FT   CDS_pept        651490..651807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0566"
FT                   /product="putative prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12534"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT35"
FT                   /protein_id="ABG12534.1"
FT                   /translation="MKTIKHYLTPEGRDLYMEYLKSLRDSIAKAKISSRVNRIASGNFG
FT                   DHKPCREGVWELRIDQGPGYRVYYSLVDGEVVLLLLGGDKRSQNADIDQAIVCLKDYLT
FT                   R"
FT   gene            651813..652127
FT                   /locus_tag="YPA_0567"
FT   CDS_pept        651813..652127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0567"
FT                   /product="putative DNA-binding prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12535"
FT                   /db_xref="GOA:A0A0E1NUC2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUC2"
FT                   /protein_id="ABG12535.1"
FT                   /translation="MAKARLHDDAMVQLLMEDPEFAQVYLHQALLDIDEEGGQEAFLMA
FT                   LRHVVEARGGMASVAKKAGVSRETLYRTLSPSGNPTLKTLLSVVSATGFQFSHLASITA
FT                   "
FT   gene            complement(652476..653564)
FT                   /locus_tag="YPA_0568"
FT   CDS_pept        complement(652476..653564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0568"
FT                   /product="plasmid and phage replicative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12536"
FT                   /db_xref="GOA:A0A0E1NMN3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMN3"
FT                   /protein_id="ABG12536.1"
FT                   /translation="MKTPLILLEREPVSLTTNLPLRKGSDGYNTPQDYNIKGHLPSNTL
FT                   ASIYGPSGSYKSFLAVSWACHIATGKPWASRRVTQGSVVYIVGEGGIGVPRRIRAWGME
FT                   FNGGTPIESLYRIDCPVFPASPESAIQVIKAAQDVTEQTGSPVRLIVLDTLARCFGGSD
FT                   ENAAKDMGAFIQGCDYIKAETGATVLVIHHSGKDLDKGARGSSAFRAALDVEFNVRREG
FT                   DGGALVLSCTKMKDSEEPTTRAYDLSPLNLYIDNDGEEVNSLVLCDKGREVSDEGSPYE
FT                   AELASIQRLTANHIALWQSIRSRTASGEACTKSLVRDDMRGMGFDVAKKFTRWLDKLET
FT                   DGLIHIDGENICPNSLSNTARN"
FT   gene            complement(653561..654520)
FT                   /locus_tag="YPA_0569"
FT   CDS_pept        complement(653561..654520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0569"
FT                   /product="plasmid and phage DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12537"
FT                   /db_xref="GOA:A0A0E1NQZ7"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQZ7"
FT                   /protein_id="ABG12537.1"
FT                   /translation="MSRFVSDIIRASQHHWSNILSSLAIPIPHLNKHGPCPVCGGKDRF
FT                   RFDDKKGRGTWFCNYCGHGDGLDLVTLVRQCDVIQAAREISRLTDLAPTAPAKERTEQP
FT                   LHSDMTQKVTALLAACSQGTSDYLLHKGLNHPVFLMPANSAKNIGGVHFNVGSMVLPLV
FT                   DLSGNTTGALLINRRGEKRLLPGSRIKSSFIPITHHTLSQTIIITEGFATGLVISRFVT
FT                   ATVVAAISATNLTQVAVALRERYPDAQIIIAADNDVTNSDNNPGKQQAEYAALAVNGLV
FT                   TLPPTCGKADWDDYRQQVGTDAARIEFFRQLYNPREWI"
FT   gene            complement(654513..655055)
FT                   /locus_tag="YPA_0570"
FT   CDS_pept        complement(654513..655055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0570"
FT                   /product="putative prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12538"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMK3"
FT                   /protein_id="ABG12538.1"
FT                   /translation="MIFYFFLAGALQYNPFAAAKSVAGISVPKIFLIPSLVIQTWSFIG
FT                   MACAHPSMVAQAGAPKGAPVSKKSGNANSVWATTQGISVSGGSHYNYFLEAAQWLLPFT
FT                   VCTRNTFVPIRGCAMHNSSPLTIEEIVDHCHALVLAMLEITDPTAKELLLFILAERLDL
FT                   LQLMLDEVPDAEEANHE"
FT   gene            complement(655055..655255)
FT                   /locus_tag="YPA_0571"
FT   CDS_pept        complement(655055..655255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0571"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12539"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWY5"
FT                   /protein_id="ABG12539.1"
FT                   /translation="MSDINLIRLPEVIEKIRLKKSSIYHLISLNQFPRPIKLGPRSVAW
FT                   VESEVDEWVIIRINQREEGRN"
FT   gene            complement(655248..656135)
FT                   /locus_tag="YPA_0572"
FT   CDS_pept        complement(655248..656135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0572"
FT                   /product="putative DNA-binding prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12540"
FT                   /db_xref="GOA:A0A0E1NXD8"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXD8"
FT                   /protein_id="ABG12540.1"
FT                   /translation="MSRLSREMKMLAKQAGGSHKTVHDRIRIMDRFSRHLLALNIQVRD
FT                   VKHLKAKHIESYITDRFSQGIAIRSLHNEMAALRTVFRFAGRDKIVLSERLTNKALGLG
FT                   GASRAGSKFAIPEEVYQAALRTAQQQDKGLACALQLARLLGLRSQEAVQCANSLKTWQK
FT                   ELEQNRSKLTVVFGTKGGRSRETRILDPEAVKRAVKEAQQIAETRGGKLIDKPDLKTAM
FT                   NFWRSHTTRLGLTGHYSPHSLRYAWAQDAINYYLAAGFSRIEARALTSMDLGHGDGRGR
FT                   YVERVYTRKEANYV"
FT   gene            complement(656157..656480)
FT                   /locus_tag="YPA_0573"
FT   CDS_pept        complement(656157..656480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3G6"
FT                   /protein_id="ABG12541.1"
FT                   /translation="MLLVASLLRVKVTPQHKPASAFEISDFTQHVMHLTPLQYVRLTAF
FT                   YKIFEPIPRQANSLGDDLQKQEAAPSASPIPRNTSTAARSGAQVSFKADNLPFPMRQRN
FT                   AAS"
FT   gene            656943..657170
FT                   /locus_tag="YPA_0574"
FT   CDS_pept        656943..657170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4N9"
FT                   /protein_id="ABG12542.1"
FT                   /translation="MQVIRIILILETLGAVIDSEFTWGKLRQKLNSGKLLEAVIRKSNE
FT                   RGATSLSNLCHLRIFPLASLPKRALHAYSA"
FT   gene            complement(657332..659002)
FT                   /locus_tag="YPA_0575"
FT   CDS_pept        complement(657332..659002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNQ3"
FT                   /protein_id="ABG12543.1"
FT                   /translation="MKKLILKKIMILSDSGKSARQFEFGEHLTLITADDDNSVGKSTLA
FT                   KMIFWTFGCEPIFSEVWRTLDCTSIIEFEINNAPYIIHRYKNEIKIRHSNGKLHSFPKI
FT                   TGDYSKYFSELVNFNVLLPKKGQLTLETPPPAYYFIPFYIDQKRTWAKPWDSFENLQQY
FT                   SSWAKPVISYHSGLFIKAHFEVEKDIYVIKRELEEVEKGVTELNNAVIILRQNLIDTDN
FT                   VLPSTEFIFSVIQESEKNKKNLLEERTNLRVEKIRLESQIKLAKGIISELDKDYIFSVE
FT                   NMEDGDIECPTCGTIHENSIAHRTSILIDMELAKNQLESLESEVNGIINLLVIKDEEIT
FT                   EQSNKSERSYNNVIESDSNSLISFTNDKFEKRAHEINSKKNITIEIKKSEEKTAKKSQS
FT                   DILSKEQKSEIKQSFADRLSKYITKLKVNVDISKIKSPLDYKKIYEVGGAAEDARAVLG
FT                   YYLAIYEQVADSCEEALPPLVIDTPNQQEQASGNYTNIIKSISDGINNDRQYVICAMEH
FT                   KALEQIKTNAQVIKLDARKILLQDQYEKISKLRNEVIFD"
FT   gene            complement(659053..660141)
FT                   /locus_tag="YPA_0576"
FT   CDS_pept        complement(659053..660141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12544"
FT                   /db_xref="InterPro:IPR025382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPS3"
FT                   /protein_id="ABG12544.1"
FT                   /translation="MDSEDTSDNPLSEPQRESAGAQSYDRFEYQYHWALCKAFSSYKES
FT                   NDFAIFMEYHEDVVYANSIDKNKVKFTFNQIKANAKKTYTAKVLTKRENGTKPSLLGKL
FT                   CSSVSDKKYFEKVEKLDFITTSGFNLTKNNKLNLASYKLSSLSSDEASEIIKCLSDELA
FT                   NFGKFPQEIIHFTTSDIPLESYYEHTISRITDSVEEVYPQHLLRTKDIYRILMDSLRIR
FT                   GKNVFDYENWNDALTKKALTYKDIHTVVTKIVSKGNSDLNFEAIKYILDDLNLKGTIKA
FT                   KIIQKINSYSLTLLSPTLAIIKAQKEIQELLKKNSKKIEIEMSYELLERLIIDLSKDTI
FT                   GLFEDNISISSAIIYEMVEATN"
FT   gene            complement(660220..661419)
FT                   /locus_tag="YPA_0577"
FT   CDS_pept        complement(660220..661419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0577"
FT                   /product="putative prophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12545"
FT                   /db_xref="GOA:A0A0E1NT80"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT80"
FT                   /protein_id="ABG12545.1"
FT                   /translation="MARTTRPLTHTEVQKAKATDKDLTLHDGDGLFLLVKTTGKKIWRF
FT                   RYQLPNSSKRTMISLGAYPALSLADAREIRAEKLAMLVRGTDPQTRAGEEAEKLQIAEE
FT                   SIFVNVARKWFELKESHVSAAHAKDIWRSIEKDILPSIENIPIQELKARTLIQVLEPIK
FT                   ARGALETVRRLVQRINEIMIYAVNVGLIDANPASGIGNAFERPKKQHMPTIRPEELPKL
FT                   MRTIAMSNLSLPTRCLLEWQLLTLIRPAEASATAWIEIDLENKQWCIPAERMKAKRDHI
FT                   VPLSEQALELLEIMRPISGNRQHVFPSRNDPRNHMNSQTANAALKRIGYGGKLVAHGLR
FT                   SIASTAMNEAGFNADVIEAALAHSDKNEVRKAYNRSTYLIQRQELMNWWGLEIYTKRSI
FT                   "
FT   gene            complement(661643..662101)
FT                   /locus_tag="YPA_0578"
FT   CDS_pept        complement(661643..662101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0578"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12546"
FT                   /db_xref="GOA:Q1C0I9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C0I9"
FT                   /protein_id="ABG12546.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(662324..662687)
FT                   /gene="ssrA"
FT                   /locus_tag="YPA_r031"
FT   tmRNA           complement(662324..662687)
FT                   /gene="ssrA"
FT                   /locus_tag="YPA_r031"
FT   gene            complement(662736..663230)
FT                   /locus_tag="YPA_0579"
FT   CDS_pept        complement(662736..663230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0579"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12547"
FT                   /db_xref="GOA:Q1CAH5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAH5"
FT                   /protein_id="ABG12547.1"
FT                   /translation="MTDTMTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEV
FT                   KSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSL
FT                   FGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHAN
FT                   R"
FT   gene            663379..663813
FT                   /locus_tag="YPA_0580"
FT   CDS_pept        663379..663813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12548"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTW7"
FT                   /protein_id="ABG12548.1"
FT                   /translation="MPQISRSALVPFSVKQMYQLVNDVRSYPEFLPGCTGSRVLDATEN
FT                   EMIAAVDVAKAGISKTFTTRNTLTDNQSINMQLVDGPFRKLMGGWHFTPLSADACKVEL
FT                   HLDFEFTNKLIELAFGKIFKELAGNMVQAFTQRAKEVYSA"
FT   gene            663806..664090
FT                   /locus_tag="YPA_0581"
FT   CDS_pept        663806..664090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12549"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAH3"
FT                   /protein_id="ABG12549.1"
FT                   /translation="MPDIRVEVVYALSERQYLRTVSLVVGSTVEDAIKASGLLELRPDI
FT                   DLEKNKVGIYSRPVKLGDKLNDGDRVEIYRPLIADPKELRRQRAEQAKK"
FT   gene            complement(664240..664581)
FT                   /locus_tag="YPA_0582"
FT   CDS_pept        complement(664240..664581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12550"
FT                   /db_xref="GOA:A0A0E1NXF8"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXF8"
FT                   /protein_id="ABG12550.1"
FT                   /translation="MRCKMLTAAAVMLAMLTAGCSTLEKVVYRPDINQGNYLSPIDASK
FT                   IHKGMTQQQVAYTLGTPMLQDPFGTQTWFYVFRQQPGHEKITQQTLTLTFDSSGVLTDI
FT                   KNEPALTGS"
FT   sig_peptide     complement(664513..664581)
FT                   /locus_tag="YPA_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.343 at
FT                   residue 23"
FT   gene            complement(664695..666356)
FT                   /locus_tag="YPA_0583"
FT   CDS_pept        complement(664695..666356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0583"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12551"
FT                   /db_xref="GOA:A0A0E1NS81"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS81"
FT                   /protein_id="ABG12551.1"
FT                   /translation="MLVQLTISNFAIVRELEIDFQPGMTAITGETGAGKSIAVDALGLC
FT                   LGNRSDGSMVRLGATRADICARFSLADTPSARQWLENNHLDDNNECLLRRAIGADGRSR
FT                   GFINGTPVPVSQLRELGQHLIQIHGQHAHQLLLKPDHQKQLLDAYANQSSLLAEMKAAY
FT                   QIWHQSCRDLALHQQQSLERTARQELLQYQLKELNSFSPQAGEYEQIDIEYKRLANSGQ
FT                   LLSLSQQTLQLLSDDEQNNILSQLYAAKHQLTELASMDEQFNNLLNMLEEASIQISEAS
FT                   DELRHYAEQLDMDPNRLYELEKRLSRQLNLARKHHVAPEELPQFHQQLLDEQELLSQQE
FT                   NDHEQLSNAVNTHYQQALAIAKRLHQERQYYANELAALITESMHELSMPHGKFAIETIF
FT                   EPEHLSAEGATRIEFCVTTNPGQPLQALVKVASGGELSRIALAIQVITARKMDTPALIF
FT                   DEVDVGISGPTAAIVGRLLRQLGESTQVMCVTHLPQVAGCGHQHFFVSKQTDGTETETH
FT                   MHRLDKKARLQELARLLGGSEVTKNTLANAKELLAA"
FT   gene            complement(666443..667324)
FT                   /locus_tag="YPA_0584"
FT   CDS_pept        complement(666443..667324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12552"
FT                   /db_xref="GOA:A0A0H2Y5P1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5P1"
FT                   /protein_id="ABG12552.1"
FT                   /translation="MNNRRFDCIGIVGHPRHPAALATHEILYHWLKARGYAVMVEQQIA
FT                   HDLNLTDAITGSLADIGQKADLAVVVGGDGNMLGAARVLARYDIKVIGVNRGNLGFLTD
FT                   LDPDNALQQLSDVLEGEYLSEQRFLLETHVRRTNQQSRISTAINEVVLHPGKVAHMIEF
FT                   EVYIDDRFAFSQRSDGLIIATPTGSTAYSLSAGGPILTPTLDAIVLVPMFPHTLTARPL
FT                   VISSSSTIRLKFSHITSDLEISCDSQIALPIQEGEEVLIRRSDFHLNLIHPKDYSYFNT
FT                   LSTKLGWSKKLF"
FT   gene            667448..668026
FT                   /locus_tag="YPA_0585"
FT   CDS_pept        667448..668026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0585"
FT                   /product="heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12553"
FT                   /db_xref="GOA:Q1CAG9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAG9"
FT                   /protein_id="ABG12553.1"
FT                   /translation="MSSKEQKTPNEQVSEEMENTAEQQVEATQETGECVDPRVAELEVQ
FT                   LSDALQRERESLLRAKAEVENIRRRTELDVEKAHKFALERFSSELLPVIDNLERALDTA
FT                   DKTNTELISMIEGVELTLKSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEPN
FT                   HVMMVMQKGYTLNGRLLRPAMVAVSKAKS"
FT   gene            complement(668134..669414)
FT                   /locus_tag="YPA_0586"
FT   CDS_pept        complement(668134..669414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0586"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12554"
FT                   /db_xref="GOA:A0A0E1NNJ6"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNJ6"
FT                   /protein_id="ABG12554.1"
FT                   /translation="MADKKATLNLGEAAIELGVLSPTLGTDVIDVRTLGSKGYFTFDPG
FT                   FTSTASCESKITYIDGDQGILLHRGFPIAQLAKDSTYLEVCYILLYGETPTPEEYKTFK
FT                   TTVTRHTMIHEQITRLFHGFRRDSHPMAVLCGVTGALAAFYHDALDVNNERHREITAFR
FT                   LLSKMPTVAAMCYKYSLGQPFVYPRNDLSYAGNFLHMMFSTPCEKYEVNPVLERAMDRI
FT                   LILHADHEQNASTSTVRTAGSSGANPFACIAAGIASLWGPAHGGANEACLKMLEEIKTV
FT                   EHIPEFIRRAKDKNDSFRLMGFGHRVYKNYDPRATVMRETCHEVLEELKLNNSLLEVAM
FT                   ELENIALNDPYFIEKKLYPNVDFYSGIILKAMGIPSSMFTVIFAIARTIGWIAHWNEMH
FT                   NDGIKIARPRQLYTGYTERDFQSQLKK"
FT   gene            670124..670513
FT                   /locus_tag="YPA_0587"
FT   CDS_pept        670124..670513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0587"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12555"
FT                   /db_xref="GOA:A0A0H2Y4P9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4P9"
FT                   /protein_id="ABG12555.1"
FT                   /translation="MGKTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL
FT                   WLLGLSVSSQEGFMQAATIMNSFFVKFIFWGILTALAYHICGGIRHLLMDFGYLEENLA
FT                   VGTRSAQVAMGLTLVLSVLAGVLVW"
FT   gene            670507..670854
FT                   /locus_tag="YPA_0588"
FT   CDS_pept        670507..670854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0588"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12556"
FT                   /db_xref="GOA:A0A0E1NUR8"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUR8"
FT                   /protein_id="ABG12556.1"
FT                   /translation="MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITY
FT                   EIWRGFFASHITKVFTLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVY
FT                   LLYGTIVVWGA"
FT   gene            670855..672621
FT                   /locus_tag="YPA_0589"
FT   CDS_pept        670855..672621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0589"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12557"
FT                   /db_xref="GOA:A0A0E1NT12"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT12"
FT                   /protein_id="ABG12557.1"
FT                   /translation="MNLPIREFDAVVVGAGGAGMRAALQISQMGLSCALISKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGL
FT                   PFSRLEDGSIYQRPFGGQSLNFGGGQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAFVGCTAINIETGEVVYFKARATILATGGAGRIYQSTTNAHINTGDG
FT                   VGMALRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHV
FT                   DPIKEPIPVIPTCHYMMGGIPTKVTGQAITVNEKGEDVVIPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGMHLQESLMEQGASRDASESDIEASLARMNRWNNTRSGEDPVE
FT                   IRKALQACMQNNFSVFREGDAMAKGLEELKTIRERLQNARLDDTSSEFNTQRIECLELD
FT                   NLMETAFSTAVSANFRTESRGAHSRFDFPDRDDVNWLCHSLYLPGTESMTRREVNMQPK
FT                   LREAFPPKVRSY"
FT   gene            672671..673387
FT                   /locus_tag="YPA_0590"
FT   CDS_pept        672671..673387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0590"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12558"
FT                   /db_xref="GOA:A0A0E1NND6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NND6"
FT                   /protein_id="ABG12558.1"
FT                   /translation="MKLEFSIYRYNPDVDNAPHMQDYTLDAEEGRDMMLLDALIQLKEK
FT                   DPTLSFRRSCREGVCGSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLV
FT                   VDMGQFYTQYEKIKPYLLNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFVGPAGLLAAYRFLIDSRDTETASRLDDLDDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TKAIGHIKSMLLQRSA"
FT   gene            673743..676550
FT                   /locus_tag="YPA_0591"
FT   CDS_pept        673743..676550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0591"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12559"
FT                   /db_xref="GOA:A0A0E1NXH1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXH1"
FT                   /protein_id="ABG12559.1"
FT                   /translation="MQNGAMKAWLDSSYLAGANQSYIEQLYEDFLTDPGSVDDSWRSIF
FT                   QQLPTTGVKPDQLHSQTREYFRRLAKDSTRYNSSINDPDIDAKQVKVLQLINAFRFRGH
FT                   QHANLDPLGLWKQESVPDLDPSYHNLTEADFQNTFNVGSFAIGKETMKLADLYAALKQT
FT                   YCGSVGAEYMHITNTEEKRWIQQRIESVVGKPTFSDAEKRRFLSELTAAEGLERYLGAK
FT                   FPGAKRFSLEGGDSLVTMLKEMIRHAGKNGTREVVLGMAHRGRLNVLINVLGKKPEDLF
FT                   DEFAGKHKEHLGTGDVKYHQGFSSDVETEGGLVHLALAFNPSHLEIVSPVVIGSVRARR
FT                   DRLDEARSNMVLPITIHGDAAITGQGVVQETLNMSQARGYEVGGTVRIVINNQIGFTTS
FT                   NPLDARSTQYCTDIAKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVMIDLVCYR
FT                   RHGHNEADEPSATQPVMYQKIKKHPTPRKIYADKLIEQNIASLEDATEMVNLYRDALDH
FT                   GDCVVEEWRPMNLQSFTWSPYLNHEWDEAYPSKVEMKRLQELARRISSAPEAIEMQSRV
FT                   AKIYSDRALMASGEKPFDWGGAETLAYATLVDEGIPIRLSGEDAGRGTFFHRHAVIHNQ
FT                   KNGSVYVPLSNIHSGQGDFQVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANG
FT                   AQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCIP
FT                   STPAQVYHMIRRQALRGMRRPLIVMSPKSLLRHPLATSSLDELANGSFLPAIGEIDELD
FT                   PKGIKRVVMCSGKVYYDLLEQRRKNGQTDVAIVRIEQLYPFPHQAVQSVLEQYAHVHDF
FT                   VWCQEEPLNQGAWYCSQHNFREVIPFGASLRYAGRPASASPAVGYLSVHQKQQQALVND
FT                   ALNVE"
FT   gene            676580..677803
FT                   /locus_tag="YPA_0592"
FT   CDS_pept        676580..677803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0592"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12560"
FT                   /db_xref="GOA:A0A0E1NPP5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPP5"
FT                   /protein_id="ABG12560.1"
FT                   /translation="MSSVDINVPDLPESVADGSVATWHKKPGDSVKRDEVLVEIETDKV
FT                   ILEVPASQDGILDAILEDEGATVTSRQVLGRIRPSDSSGKPTEEKSQSTESTPAQRQTA
FT                   SLEEESNETLSPAIRRLIAEHDLDATAIKGSGVGGRITREDVDSHLASRKSASAVVADA
FT                   KAVAAAAPVLAGRSEKRVPMSRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQY
FT                   GEAFEKRHGVRLGFMSFYIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGL
FT                   VTPVLRDVDTLSMADIEKKIKELAVKGRDGKLKVEELTGGNFTITNGGVFGSLMSTPII
FT                   NPPQSAILGMHAIKDRPMAVNGQVVILPMMYLALSYDHRLIDGRESVGYLVTVKEMLED
FT                   PARLLLDV"
FT   gene            677916..679082
FT                   /locus_tag="YPA_0593"
FT   CDS_pept        677916..679082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0593"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12561"
FT                   /db_xref="GOA:Q1CAG1"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAG1"
FT                   /protein_id="ABG12561.1"
FT                   /translation="MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDI
FT                   DKELYLGAVIDRSSRRVVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGREL
FT                   AFKLGLTGKQVGQFTKIFMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNA
FT                   LFRQPELREMRDPSQEDAREAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAATSLTDAAQQVVAAVGAK"
FT   gene            679082..679954
FT                   /locus_tag="YPA_0594"
FT   CDS_pept        679082..679954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0594"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12562"
FT                   /db_xref="GOA:A0A0E1NVT3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVT3"
FT                   /protein_id="ABG12562.1"
FT                   /translation="MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   TQHLGLPVFNTVREAVETTGATASVIYVPAPFCKDSILEAIDAGIKLIICITEGIPTLD
FT                   MLVVKVRLEQSDARMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVK
FT                   QTTDIGFGQSSCVGIGGDPIPGSNFIDILKLFQEDPQTEVIVMIGEIGGNAEEEAAAYI
FT                   KEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLAEIG
FT                   NAVKAVLPQ"
FT   gene            680721..682289
FT                   /locus_tag="YPA_0595"
FT   CDS_pept        680721..682289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0595"
FT                   /product="cytochrome D ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12563"
FT                   /db_xref="GOA:A0A0E1NLF7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF7"
FT                   /protein_id="ABG12563.1"
FT                   /translation="MFDIVELSRLQFALTAMYHFLFVPLTLGLAFLLAIMESVYVLSGK
FT                   QIYKDMTKFWGKLFAINFALGVATGLTMEFQFGTNWSYFSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFVGLFFFGWDRLTKHQHLAVTWLVALGSNFSALWILVANGWMQNPIASDFNFET
FT                   MRMEMLSFSELVLNPVAQVKFVHTVAAGYVTGAMFILGISSYYLLKGRDIPFAKRSFAI
FT                   AASFGLASVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPPPAAFTLFAIPNQETME
FT                   NRFAIQIPYALGLIATRSLDTPVIGLRDLMSQHEVRIRNGIQAYSLLEQLRGGNTDPAV
FT                   RDAFNKAKQDLGYGMLLKRYTENVADATEEQIQLAAQDSIPRVLPLYFAFRIMVACGFL
FT                   MLLIIGLAFYNVVRGRIGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLP
FT                   TAVANSSVTAGEILFSMALICGLYTLFLIAEMYLMFKFARLGPSSLKTGRYHFEQPTAP
FT                   VQEAR"
FT   gene            682304..683443
FT                   /locus_tag="YPA_0596"
FT   CDS_pept        682304..683443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0596"
FT                   /product="cytochrome D ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12564"
FT                   /db_xref="GOA:A0A0E1NPX6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPX6"
FT                   /protein_id="ABG12564.1"
FT                   /translation="MFDYEVLRFIWWLLIGVLLIGFAVTDGFDMGVGILLRIIGKNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYIAMILVLAALFFRPVGF
FT                   DYRSKLEDSRWRNMWDWGIFIGSFVPAVVFGVAFGNLLQGVPFHMNEYMRLFYTGNFFQ
FT                   LLNPFGLLAGIVSLTMLVTQGATYLQMRTRGELHLRSRKAAQISALVMSVAFLLAGIWL
FT                   VKGIDGFVITSVLDTAAESNPMRKEVAHQAGAWLINFNKYPILWALPALGVILPLFTIL
FT                   LSRFEKGAWAFLFSSLTIACVILTAGVTMFPFVMPSSTMPNVSLTMWDATSSLLTLKVM
FT                   TIVAIIFVPIILLYTSWCYYKMFGRIDKEFIENNKHSLY"
FT   gene            683535..683867
FT                   /locus_tag="YPA_0597"
FT   CDS_pept        683535..683867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12565"
FT                   /db_xref="GOA:A0A0H2Y3I4"
FT                   /db_xref="InterPro:IPR011846"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3I4"
FT                   /protein_id="ABG12565.1"
FT                   /translation="MKPTQQLKPLTMATTMLSDKLYELMDKGPLRALSLVLAFALAFCV
FT                   FWDPTRFAAATSSLEVWQEVFIVWAVCTGVIHGVGFRPKQVWLRAFFAPLPAIVILATG
FT                   LFYFFA"
FT   gene            683999..684400
FT                   /locus_tag="YPA_0598"
FT   CDS_pept        683999..684400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12566"
FT                   /db_xref="GOA:A0A0H2Y4Q9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4Q9"
FT                   /protein_id="ABG12566.1"
FT                   /translation="MSNTLFRWPVRVYFEDTDAGGMVYHARYVAFYERARTEMLRQRNF
FT                   HQQQLLSEHVAFAVRSMTVEYLAPARLDDMLEVQSEVTAMRGASLTFAQRILDSHGNLL
FT                   SSAEVLIACIDPHQMKPRALPKSIVAEFK"
FT   gene            684400..685086
FT                   /locus_tag="YPA_0599"
FT   CDS_pept        684400..685086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0599"
FT                   /product="TolQ colicin import protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12567"
FT                   /db_xref="GOA:A0A0E1NSY5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSY5"
FT                   /protein_id="ABG12567.1"
FT                   /translation="MADMNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRILNAA
FT                   TRDAEAFEDKFWSGIELSRLYQESQARRDTLSGSEQIFHSGFKEFARLHRANSHAPEAV
FT                   IDGASRAMRISMNRELEALETHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQAT
FT                   LQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQHVNKLEQNYDNFMEEFIAILHRQAF
FT                   ASTESK"
FT   gene            685099..685527
FT                   /locus_tag="YPA_0600"
FT   CDS_pept        685099..685527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0600"
FT                   /product="TolR colicin import membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12568"
FT                   /db_xref="GOA:A0A0E1P1P9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P1P9"
FT                   /protein_id="ABG12568.1"
FT                   /translation="MARVRGRKRRELKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   NLPDATDSKTVSSDDNPPVIVEVSGVGQYTVVVDHQRMELLPSEQVVAEAQARLKTNPK
FT                   TVFLIGGAKEVPYDEIIKALNMLHQAGVTSVGLMTQPI"
FT   gene            685624..686805
FT                   /locus_tag="YPA_0601"
FT   CDS_pept        685624..686805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0601"
FT                   /product="TolA colicin import membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12569"
FT                   /db_xref="GOA:A0A0H2Y5R0"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5R0"
FT                   /protein_id="ABG12569.1"
FT                   /translation="MWKSSVGKATEQNDKLNRAVIVSVVLHIILIALLIWGSLTQTTEM
FT                   GGGGAGGEVIDAVMVDPGAVTEQYNRQQQQQTDAKRAEQQRQKKAEQQAEELQQKQAAE
FT                   QQRLKELEKERLQAQEDAKLAAEEQKKQVAEQQKQIAEQQKQAAEQQKIAAAAVAKAKE
FT                   EQKQAETAAAQAKAEADKIVKAQAEAQKKAEAEAKKEAAVAAAAKKQADADAKKAVEVA
FT                   EKAAADAAEKKAAADAEKKAAAAKKVAAAAEAKKKAAAEAAASTDVDDLFGGLANAKNA
FT                   PKSGSGAGAAAAGKGGGKKSGASGADISGYLGQITGAIQSKFYDADLYKGRTCDLRIKL
FT                   APDGLLIDVKAEGGDPALCQAAIAAAKQAKIPKPPSTDVYEQFKNAPLVFKPQ"
FT   gene            686925..688217
FT                   /locus_tag="YPA_0602"
FT   CDS_pept        686925..688217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0602"
FT                   /product="TolB colicin import protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12570"
FT                   /db_xref="GOA:Q1CAF2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAF2"
FT                   /protein_id="ABG12570.1"
FT                   /translation="MKQAFRVALGFLVLWASVLHAEVRIEITQGVDSARPIGVVPFKWM
FT                   GPGTPPEEIGAIVGADLRNSGKFNPIDAARMPQQPSTAAEVTPAAWTALGIDAVVVGQV
FT                   QPSADGSYVVSYQLVDTSGSAGSILAQNQYKVTKQWLRYSAHTVSDEVFEKLTGIKGAF
FT                   RTRIAYVVKTNGGKFPHELRVSDYDGYNQFVVHRSPEPLMSPAWSPDGSKIAYVTFESG
FT                   KSALVIQTLANGAIRQVASFPRHNGAPAFSPDGTKLAFALSKSGSLNLYVMDLASGQIS
FT                   QVTDGRSNNTEPSWFPDSQNLAYTSDQGGRPQVYKVNINGGVPQRITWEGSQNQNADVS
FT                   PDGKFLVLVSSNGGAQHIAKQDLETGAVQVLTDTLLDETPSIAPNGTMVIYSSTQGLGS
FT                   VLQLVSTDGRFKARLPATDGQVKFPAWSPYL"
FT   sig_peptide     686925..686990
FT                   /locus_tag="YPA_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            688268..688774
FT                   /locus_tag="YPA_0603"
FT   CDS_pept        688268..688774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0603"
FT                   /product="peptidoglycan-associated lipoprotein Pal"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12571"
FT                   /db_xref="GOA:A0A0E1NS26"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS26"
FT                   /protein_id="ABG12571.1"
FT                   /translation="MQLNKVLKGLMLALPVLAVAACSSNKSANNDQSGMGAGTGTENGS
FT                   NLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHA
FT                   DERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRR
FT                   AVLVY"
FT   sig_peptide     688268..688351
FT                   /locus_tag="YPA_0603"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.283 at
FT                   residue 28"
FT   gene            688784..689593
FT                   /locus_tag="YPA_0604"
FT   CDS_pept        688784..689593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12572"
FT                   /db_xref="GOA:A0A0E1NMD9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMD9"
FT                   /protein_id="ABG12572.1"
FT                   /translation="MNSNFRRHLVGLSLLVGVAVPWAATAQAPISNVGSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDSQRDVDSLRGQIQESQYQLNQVVERQKQIYQQMESLSGG
FT                   QGAQNSASAASGATADNTAAGSSGNADAGAAASTAAPAASTGDENSDYNVAVSLALEKK
FT                   QYDQAITAFQSFVKQYPKSTYQPNANYWLGQLYYNKGKKDDAAYYYAVVVKNYPKSPKS
FT                   SEAMFKVGVIMQDKGQSDKAKAVYQQVIKQYPNTDAAKQAQKRLSAL"
FT   sig_peptide     688784..688864
FT                   /locus_tag="YPA_0604"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.753 at
FT                   residue 27"
FT   gene            689784..689859
FT                   /locus_tag="YPA_r032"
FT                   /note="tRNA-Lys1"
FT   tRNA            689784..689859
FT                   /locus_tag="YPA_r032"
FT                   /product="tRNA-Lys"
FT   gene            689887..689962
FT                   /locus_tag="YPA_r033"
FT                   /note="tRNA-Lys2"
FT   tRNA            689887..689962
FT                   /locus_tag="YPA_r033"
FT                   /product="tRNA-Lys"
FT   gene            689991..690060
FT                   /pseudo
FT                   /locus_tag="YPA_r034"
FT                   /note="tRNA-Pseudo1"
FT   tRNA            689991..690060
FT                   /pseudo
FT                   /locus_tag="YPA_r034"
FT                   /product="tRNA-OTHER"
FT   gene            690429..691490
FT                   /locus_tag="YPA_0605"
FT   CDS_pept        690429..691490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0605"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12573"
FT                   /db_xref="GOA:Q1CAE9"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023513"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAE9"
FT                   /protein_id="ABG12573.1"
FT                   /translation="MSEIFDVNAAIYPFPARPVPLDTNEKAFYREKIKTLLKQRDAVLV
FT                   AHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKKV
FT                   LMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELI
FT                   EHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAA
FT                   VLVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFE
FT                   APTAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGGVMHEIHVDEELRQQALIPLNRMLD
FT                   FANQLKLQVKGNA"
FT   gene            691612..692337
FT                   /locus_tag="YPA_0606"
FT   CDS_pept        691612..692337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0606"
FT                   /product="intergral membrane NMN transport protein PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12574"
FT                   /db_xref="GOA:A0A0E1NPW0"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPW0"
FT                   /protein_id="ABG12574.1"
FT                   /translation="MDFLSTGNILVHIPLGAGGYDLSWIEAIGTLFGLLCIWFASKEKI
FT                   INYLFGLINVTLFAVIFFQIQLYASLLLQLFFFGANIYGWYAWSKQTPDNQAELKIRWL
FT                   SLPKALAWAAVCIAGIVLMTLHIDTVFAWLTRVAVTVMQSLGANVQMPELQPDAFPFWD
FT                   STMMVLSIAAMILMTRKYVENWLIWVVIDVISVAIFAYQGVYAMALEYAFLTLIALNGS
FT                   WLWIKSAARNHSRPLSTQG"
FT   gene            complement(692452..693390)
FT                   /locus_tag="YPA_0607"
FT   CDS_pept        complement(692452..693390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0607"
FT                   /product="putative cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12575"
FT                   /db_xref="GOA:A0A0E1NT53"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023500"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT53"
FT                   /protein_id="ABG12575.1"
FT                   /translation="MAVSTIFSQDSNSKRLLIAFAITTLFMVTEAIGGWLSGSLALLAD
FT                   AGHMLTDSAALFIALMAVHFSQRKPDPRHTFGYLRLTTLAAFVNAAALLLIVILIVWEA
FT                   VHRFFSPHEVMGTPMLIIAIAGLLANIFCFWILHKGEEEKNINVRAAALHVLSDLLGSV
FT                   GAMIAAIVILTTGWTPIDPILSVLVSVLILRSAWRLLKESFHELLEGAPQEIDINKLRK
FT                   DLCTNIYEVRNIHHVHLWQVGEQRLMTLHAQVIPPLDHDALLQRIQDYLLHHYRISHAT
FT                   VQMEYQHCGTPDCGINQAAPADGHHRHHHHE"
FT   gene            693839..694855
FT                   /locus_tag="YPA_0608"
FT   CDS_pept        693839..694855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0608"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12576"
FT                   /db_xref="GOA:A0A0E1NXX2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXX2"
FT                   /protein_id="ABG12576.1"
FT                   /translation="MNYQNDDLRIKEIKELLPPVALLEKFPSTVNAAETVAKTRNAIHN
FT                   ILRAQDDRLLVVIGPCSIHDTQAAKEYAARLLALREELQGELEVVMRVYFEKPRTTVGW
FT                   KGLINDPHMDNSYDINEGLRLARELLVEINDSGLPAAGEFLDMITPQYLADLMSWGAIG
FT                   ARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAASAPHCFLSVTKWGHSAIVN
FT                   TAGNGDCHIILRGGKEPNYSSKHVNAVKEGLIKAGLEPQIMIDFSHANSCKQFQKQMEV
FT                   GTDVCQQIAQGEKSIIGVMIESHLVEGSQNLESGEPLTYCQRRMKSDPLISPPTAQY"
FT   gene            complement(694865..695644)
FT                   /locus_tag="YPA_0609"
FT   CDS_pept        complement(694865..695644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0609"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12577"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12577.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(695644..696666)
FT                   /locus_tag="YPA_0610"
FT   CDS_pept        complement(695644..696666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0610"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12578"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12578.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            696736..697287
FT                   /locus_tag="YPA_0611"
FT   CDS_pept        696736..697287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0611"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12579"
FT                   /db_xref="GOA:A0A0E1NN65"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN65"
FT                   /protein_id="ABG12579.1"
FT                   /translation="MHRSLQLWNSSLNVDGMKTGYTNGAGYNLVASATDGPMRLISVVL
FT                   GAPSDKVRFSESEKLLTWGFRFYETVVPIKSTKPFVTEKVWLGDNSQVELGVAEDAAIT
FT                   IPKGQMKNLKASYTLNQTELRAPLAKHQVVGTIDFQLNGKTIEQRPLVVLNEVKEGGIF
FT                   SRFWDYVMMKLNQWFGGIFG"
FT   gene            complement(697727..699028)
FT                   /locus_tag="YPA_0612"
FT   CDS_pept        complement(697727..699028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0612"
FT                   /product="serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12580"
FT                   /db_xref="GOA:A0A0E1NYF6"
FT                   /db_xref="InterPro:IPR004694"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYF6"
FT                   /protein_id="ABG12580.1"
FT                   /translation="MDTTQTSTLASARKISSSTWRKSDTMWMLGLYGTAIGAGVLFLPI
FT                   NAGIGGLLPLIVMAIIAFPMTYYAHRGLCRFVLSGKNPGEDITEVVEEHFGVGAGKLIT
FT                   LLYFFAIYPILLVYSVAITNTVDSFITHQIHLPSPPRAILSLILIVGLMAIVRFGEQTI
FT                   VKAMSILVFPFVAVLMMLAIYLIPNWSGAIFENVSMDGNGTGSGLWMTMWLIIPVMVFS
FT                   FNHSPIISAFAVAKREEYGVDAEKKCSRILSFAHIMMVITVMFFVFSCVLSLSPADLMD
FT                   AKNQNISILSYLANHFNTPVIAYMAPVIAFIAITKSFLGHYLGAREGFNGMVIKSLRSR
FT                   GKTIEQNKLNRITALFMLVTTWAVATLNPSILGMIETLGGPIIAMLLFLMPMYAIHKVP
FT                   AMRKYSGQISNVFVVLMGLIAISGILFNLSNLFN"
FT   gene            complement(700128..700892)
FT                   /locus_tag="YPA_0613"
FT   CDS_pept        complement(700128..700892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0613"
FT                   /product="deoxyribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12581"
FT                   /db_xref="GOA:A0A0E1NRF2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRF2"
FT                   /protein_id="ABG12581.1"
FT                   /translation="METRRAERINKLIQALKRSDKIHLKDAANLLRVSEMTIRRDLSAE
FT                   PTSVILLGGYVVMDPKSNNANNYFVSDQQAKQVEEKRRIGQLAAQLIIENDTVFFDCGT
FT                   TIPWIIDEIDEELAFTAICYSLNTFLALQDKPNCKVILCGGEFKPNNCIFTPLSQQSEL
FT                   DNICPNKAFISAAGVSIEYGATCFNFDEILLKHRAMAKSQYKILVADHSKFGKIKPASI
FT                   GTLAQFDALVTDRPPVAEFYLFFSQHSVKIYC"
FT   gene            complement(701122..701793)
FT                   /locus_tag="YPA_0614"
FT   CDS_pept        complement(701122..701793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0614"
FT                   /product="putative deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12582"
FT                   /db_xref="GOA:Q1CAE0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAE0"
FT                   /protein_id="ABG12582.1"
FT                   /translation="MTTNYAHYIDHTLLAMDATEAQIIKLCEEAKQHHFYAVCVNSGYV
FT                   PVAAQQLAGSSVKVCSVIGFPLGAGLTAAKAFEAQAAINAGAQEIDMVINVGWLKSGKI
FT                   ADVKADIKAVRDNCAATPLKVILETCLLSDEQIVQVCEMCRELDVAFVKTSTGFSTGGA
FT                   KEEHVKLMRATVGPVMGVKASGAVRDRATAETMIQAGATRIGTSSGVAIVSGQQAAASG
FT                   Y"
FT   gene            complement(702051..702626)
FT                   /locus_tag="YPA_0615"
FT   CDS_pept        complement(702051..702626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0615"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12583"
FT                   /db_xref="GOA:A0A0H2Y3K1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3K1"
FT                   /protein_id="ABG12583.1"
FT                   /translation="MINATPASSPWMISFATFIARDLIMLIPILLIGLWLWGPKDTMDM
FT                   QRTVVTKAAIALAFSMLSATCIGMLIPHDRPFVDGFGYAFMSHAPDSSFPSDHGTAIFT
FT                   FALAFLFWHHLWSGVSLMFIAIAIAWSRIYLGVHWPFDMLGAFLLGIVGCLFAQLVWNL
FT                   FGEIIASTTKRFYHMSFALPISKGWVRG"
FT   gene            complement(702656..703471)
FT                   /locus_tag="YPA_0616"
FT   CDS_pept        complement(702656..703471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0616"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12584"
FT                   /db_xref="GOA:A0A0H2Y4S4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4S4"
FT                   /protein_id="ABG12584.1"
FT                   /translation="MITVPLFATSASGHTVKISKTTRQASTGPSTLNNRSTVPTIKTIS
FT                   LYSLPLSFYFWQVFGLLLVGLLFLALSRSEQLDWLISNYWFDPVGQNFPWEHNKWLDLL
FT                   NHRLLKMALIATAIAALLWGIYRRNGRLVTTALLFGLGPLVIGILKATSAHSCPWDLVE
FT                   YGGKALNYVLMDTAPPGAGPGHCFPGGHASSGFAVMALFFLFYPERPRLAMLCWFAGIG
FT                   LGMLMGFGQIMRGAHFLTHNLWAGWWVWLSQLAAFWIISGYYQRIKGTE"
FT   gene            complement(703804..705492)
FT                   /locus_tag="YPA_0617"
FT   CDS_pept        complement(703804..705492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0617"
FT                   /product="TrkA, Potassium channel-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12585"
FT                   /db_xref="GOA:Q1CAD7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023017"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAD7"
FT                   /protein_id="ABG12585.1"
FT                   /translation="MNINVANLLNGNYILLLFVVLALGLCLGKLRLGSIQLGNAIGVLV
FT                   VSLLLGQQHFAINTEALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSAM
FT                   ILALGLGKLFGWDIGLTAGMLAGSMTSTPVLVGAGDTLRHTMANGSSLQQAQDNLSLGY
FT                   ALTYLIGLVSLILGARYLPKLQHQDLPTSAQQIARERGLDTDSQRKVYLPVIRAYRVGP
FT                   ELVAWADGKNLRELGIYRQTGCYIERIRRNGILANPDGDAVLQVGDEISLVGYPDAHSR
FT                   LDPSFRNGKEVFDRDLLDMRIVTEEIVVKNSNAVGKRLSHLKLTDHGCFLNRVIRSQIE
FT                   MPIDDNVVLNKGDVLQVSGDARRVKSVAEKIGFISIHSQVTDLLAFCSFFILGLMIGLI
FT                   TFQFSNFSFGIGNAAGLLLAGIMLGFLRANHPTFGYIPQGALNMVKEFGLMVFMAGVGL
FT                   SAGGGINSSLGAVGGQMLISGLIVSLVPVVICFVFGAYVLRMNRALLFGAIMGARTCAP
FT                   AMDIISDTARSNIPALGYAGTYAIANVLLTLAGSLIVILWPGILG"
FT   gene            complement(705902..706165)
FT                   /locus_tag="YPA_0618"
FT   CDS_pept        complement(705902..706165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0618"
FT                   /product="glutaredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12586"
FT                   /db_xref="GOA:A0A0E1NRN3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011902"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRN3"
FT                   /protein_id="ABG12586.1"
FT                   /translation="MFAVIFGRPECPYCVRAKELAEKLASERDDFKFRYVDIHAEGISK
FT                   ADLEKTVGKPVETVPQIFIDEKHIGGCTDFEAYAKEHLSLYK"
FT   gene            706628..706942
FT                   /locus_tag="YPA_0619"
FT   CDS_pept        706628..706942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0619"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12587"
FT                   /db_xref="InterPro:IPR010815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXW2"
FT                   /protein_id="ABG12587.1"
FT                   /translation="MRSLGNMPRIVIISEVLGLLLLVVAYLSINNYLSLPGEMGTPTAA
FT                   IMMIFVGVGLMIPAAVCIVWRVASGFGPLLGSADRISTPQKASEEKLAAKSKKSGQDNH
FT                   "
FT   gene            707084..707569
FT                   /locus_tag="YPA_0620"
FT   CDS_pept        707084..707569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12588"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUU0"
FT                   /protein_id="ABG12588.1"
FT                   /translation="MDSLIVPDLALLRRWLDQLGISFFECDSCQALHLPHMQNFEGVFD
FT                   AKIDLVDNIILFSALAEVRPTALIPLVADLSQINASSLTVKAFIDIQDDNLPKLIVCQS
FT                   LVVEVGVTIEQFGYFMQQCEEQISMIIMEARANDLLFIGNNDEEEAPLTATSYPIIH"
FT   gene            708087..709196
FT                   /locus_tag="YPA_0621"
FT   CDS_pept        708087..709196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0621"
FT                   /product="putrescine-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12589"
FT                   /db_xref="GOA:A0A0E1NVU6"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVU6"
FT                   /protein_id="ABG12589.1"
FT                   /translation="MFTQRKKWLSGVAAGLLMAASVSASAEEKILHIYNWSDYIAPDTL
FT                   ANFQKETGIKVVYDVFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLSAGVFKPLDKSK
FT                   LPNEKNLDPELLALVSKHDPDNKYAIPYLWATTGIGYNVEKVKAVLGEDAPVNSWDLVL
FT                   KPENLEKLKSCGVSFLDAPSEIFATVLNYLGKDPNSTLTADYTGSATDLLLKLRPNIRY
FT                   FHSSQYINDLANGDICVAVGWAGDIMQASNRAKEAKNGVNVAYSIPKEGALAFFDVFAM
FT                   PTDAKNQDEAYQFLNYLMRPDVIANISNHVFYANANQAATPLVNAEVRDNPGIYPPADV
FT                   RAKMFTLKVQDPKIDRVITRAWTKVKSGK"
FT   sig_peptide     708087..708167
FT                   /locus_tag="YPA_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 27"
FT   gene            709367..710500
FT                   /locus_tag="YPA_0622"
FT   CDS_pept        709367..710500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0622"
FT                   /product="putrescine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12590"
FT                   /db_xref="GOA:A0A0E1NVW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVW8"
FT                   /protein_id="ABG12590.1"
FT                   /translation="MNDVIPRPQPKSQKVFTPLLEIRNLTKSFDGQAAVDDVNLTIYKG
FT                   EIFALLGASGCGKSTLLRMLAGFEQPTQGQIVLDGQDLSHVPPYRRPINMMFQSYALFP
FT                   HMTVEQNIAFGLKQDKLPSNEIKSRVAEMLTLVHMQEFAKRKPHQLSGGQRQRVALARS
FT                   LAKRPKLLLLDEPMGALDKKLRDRMQLEVLDILERVGATCVMVTHDQEEAMTMAGRIAI
FT                   MNRGKFVQIGEPEEIYEHPNSRFSAEFIGSVNVFEGVLKERLDDALVIDSPGLRHPLKV
FT                   DSDASVVDGVPVLVALRPEKVMLCDQVPKDGCNFAVGEVVHIAYLGDLSIYHVKLHSGQ
FT                   MLSAQLQNGHRYRKGMPTWGDEVQLCWDADSCVVLGS"
FT   gene            710525..711490
FT                   /locus_tag="YPA_0623"
FT   CDS_pept        710525..711490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0623"
FT                   /product="putrescine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12591"
FT                   /db_xref="GOA:A0A0E1NYC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYC6"
FT                   /protein_id="ABG12591.1"
FT                   /translation="MIPESTSGAAESPIRSVGPVRALIQRFQMAHGRKLVIAMPYLWLF
FT                   LLFMLPFLIVFKISLAEMVRAVPPYTDLTTWLDGKLDISLNLGNYLLLLDDPLYIDAYL
FT                   QSLQVAAVSTLCCLLIGYPLAWAIAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILK
FT                   NNGILNNFLIWTGIIDQPLVILHTNLAVYIGVVYSYLPFMVLPIYTALTRLDYSLVEAA
FT                   LDLGARPFKTFISVIIPLTKGGIVAGSMLVFIPAVGEFVIPELLGGPDSIMIGRILWQE
FT                   FFNNRDWPVASAVATVMLVLLIAPILWFHKHQNKDIGGAR"
FT   gene            711487..712332
FT                   /locus_tag="YPA_0624"
FT   CDS_pept        711487..712332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0624"
FT                   /product="putrescine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12592"
FT                   /db_xref="GOA:A0A0E1NPC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPC4"
FT                   /protein_id="ABG12592.1"
FT                   /translation="MNNLPEVRSVWRRVILTVGYTFLYAPMLMLVIYSFNSSKLVTVWA
FT                   GWSTRWYTQLFNDSAMISAVGLSLTIAAASATMAVVLGTIAAVVMVRFGRFRGSTGFAF
FT                   MLTAPLVMPDVITGLSLLLLFVAMGHAIGWPAERGMFTIWLAHVTFCTAYVTVVISSRL
FT                   RELDRSIEEAAMDLGATPLKVFFVITVPMIAPALISGWLLAFTLSLDDLVIASFVAGPG
FT                   ATTLPMLVFSSVRMGVNPEINALATLILLVVGVIGLFAWWIMSRAEKQRLRELRKAARS
FT                   "
FT   gene            712457..712921
FT                   /locus_tag="YPA_0625"
FT   CDS_pept        712457..712921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0625"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12593"
FT                   /db_xref="InterPro:IPR019703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX17"
FT                   /protein_id="ABG12593.1"
FT                   /translation="MRPSFSSSAATPVPVVIGGTAIIATRIIGVLLLVAELGFSGVSDF
FT                   ISDSLQRWDTGLIFFASIVLLLLDMMCGVAVCHRRNWARWYYLICQLIIMIYLLMASLN
FT                   WLEPDIFRIEGDSGAEILHSLLLQKIPDVVIIGLLFFPWHRYFPQSKMSV"
FT   gene            713005..714135
FT                   /locus_tag="YPA_0626"
FT   CDS_pept        713005..714135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0626"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumB"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12594"
FT                   /db_xref="GOA:Q1CAC8"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011825"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAC8"
FT                   /protein_id="ABG12594.1"
FT                   /translation="MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHAVTQWL
FT                   APVFGRESAFRNKAKMVVSGSVERPLLGMLHRDGTPVDLCACPLYPPSFEPVFTVLKTF
FT                   IARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLP
FT                   QLAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLY
FT                   ATARQWVQEHEVHSMWDLFCGVGGFGLHCAGPETQLTGIEINAEAIACARQSAEQLGLK
FT                   NVSFAALDSTRFATAEAQIPELVLVNPPRRGIGRELCDYLSQMAPKFILYSSCNAETMA
FT                   KDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTLRR"
FT   gene            complement(714262..714993)
FT                   /locus_tag="YPA_0627"
FT   CDS_pept        complement(714262..714993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12595"
FT                   /db_xref="GOA:A0A0E1P0W2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P0W2"
FT                   /protein_id="ABG12595.1"
FT                   /translation="MKKLLLATLLSGMAFSATAAETLRFAASATYPPFESMDANNEIVG
FT                   FDMDLAKALCKQMEANCTFTNQAFDSLIPALKFKRYDAVISGMDITPERSKQVAFTQPY
FT                   YANSAIVIAPKGKFSTFADLKGKKIGMENGTTHQKYLQDKHPEIQTVSYDSYQNAIIDL
FT                   KNGRIDGVFGDTAVVNEWLKTNPNLASVGEHVTDPQYFGTGLGIAVRPDNIALLTKLNK
FT                   AIDAVKADGTYQAINDKWFPQ"
FT   sig_peptide     complement(714934..714993)
FT                   /locus_tag="YPA_0627"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            715812..716738
FT                   /locus_tag="YPA_0628"
FT   CDS_pept        715812..716738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0628"
FT                   /product="putative SPFH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12596"
FT                   /db_xref="GOA:A0A0E1NVB6"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVB6"
FT                   /protein_id="ABG12596.1"
FT                   /translation="MTMKKEMSMRFVTVCGFLAILTLIAVICLMGSWYTINESDRGIIT
FT                   KWGKVVAVAEPGLGFKIPIITEVETISISNRSIKYDRLKAYSKDQQPAQMVVSIGFQVP
FT                   PTSVEDLFVKYGSIQNMAERLVSRHVPTQVENVFGQYTAVSAVQNREDFVRRVTEELRR
FT                   VLKDEPLIINSVNIENIDFTEGYEASIEERMKAEVNVEKTRKMLETEKINADIAIEQAR
FT                   GQSESQLSIAKIGAEKIKLMGAAEAENIRLMGAAEAEAIKLRADALKQNPLLVELITAE
FT                   KWNGELPQTMLPNSSVPFINARNKDGK"
FT   sig_peptide     715812..715907
FT                   /locus_tag="YPA_0628"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.717 at
FT                   residue 32"
FT   gene            717150..718241
FT                   /locus_tag="YPA_0629"
FT   CDS_pept        717150..718241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0629"
FT                   /product="putative periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12597"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW30"
FT                   /protein_id="ABG12597.1"
FT                   /translation="MLLRIFWSLCLWWGISSSALAEIHLKDVDGREVTLAAPAQRVYIG
FT                   FYYEDFLAINGPDSYQHVVAFSKSDWSLRTSQWPRYQAALRRLSQLVDVGSLYNQSFDF
FT                   ERLLATRPDLLILAKWQLEGFANYLPVLQQLSIPYVVVDFNQGEDAKLTSIRVMGQALG
FT                   HGERAERLAIAYQQGIADIRRRITQANLPSPKTYIELGDKGPGEYSSSYGSSIWGPLLQ
FT                   QAGANNIATGVVTTPSPLRAEYVLSQKPEVIFLAGGDWPKMPNAVSMGFGAKPETLQQS
FT                   MTQYAQRPGWSQFPAIKQTRFYALYHGGVRTLYDYIFVQFVAKALFPSAFEDVNPQHNL
FT                   ETFYEEYLPIKADGVFMQQWQGE"
FT   sig_peptide     717150..717215
FT                   /locus_tag="YPA_0629"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            718395..719297
FT                   /locus_tag="YPA_0630"
FT   CDS_pept        718395..719297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0630"
FT                   /product="FecCD transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12598"
FT                   /db_xref="GOA:A0A0H2Y4F6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4F6"
FT                   /protein_id="ABG12598.1"
FT                   /translation="MYCDCFWWILRSMMNYTRSFLVHSFADDVNRRGGGREFGFGWLVD
FT                   ANRTGESVSQSLYLGDFSRGRIWCRIIDHHWLQRGGSLVIRHPIIGFTDGITGLPAHLL
FT                   SGPTAGDDTANSGVERHCGAVLLPVVAITHVISASPEAMQQIVFWLFGSLLKANMQGVL
FT                   MTGSVLACSLVICLQQAWRLTALSAGEEQALGLGINVSALRKLAFLLATLLTAASVSFV
FT                   GTIGFIGLVAPHFARMLVGEDQRYLIGISALCGSLLLVLASIISKLILPNGVVPIGIII
FT                   ALIGVPVLFYFVTKQVKRA"
FT   gene            719294..720079
FT                   /locus_tag="YPA_0631"
FT   CDS_pept        719294..720079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0631"
FT                   /product="putative transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12599"
FT                   /db_xref="GOA:A0A0E1NM00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM00"
FT                   /protein_id="ABG12599.1"
FT                   /translation="MTQLTLKHVGVTLHKRPLLTDISLTWPAAQVSGIIGPNGAGKSTL
FT                   LKAINHMVPITGQIEYQQCPLNTRVTRIAYVSQLNRSDSALTVFEMVLLGKVRQLSWRV
FT                   SPAQIDAVEQVLAECGISSLANQVFNSLSGGQRQLVMLAQAFIAQPQIILLDEPTSALD
FT                   IHHQLRVLQKIVDYSKRHQCTTLMVIHDLGLALRFCQTLTLIHRGNVACHGAAHQVIAD
FT                   PMMSTVFGVGIESGTSPLGYRYLLPTQFLPTHGEKICIR"
FT   gene            720067..720864
FT                   /locus_tag="YPA_0632"
FT   CDS_pept        720067..720864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12600"
FT                   /db_xref="GOA:A0A0E1NNR8"
FT                   /db_xref="InterPro:IPR004298"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNR8"
FT                   /protein_id="ABG12600.1"
FT                   /translation="MYTLMKADVLAQLAGLQQEISQLHDNAQQNQSHFVLLERRFSRLQ
FT                   SFNDEPQLQDYRLQLEHDDAVVKQIAQLRQVANAALCDYEKHQVCALCSPSSKTDDYLT
FT                   SFNQSLQQEIKLAGMQMGEKVLLVGSGALPTTALVLVAKLGATVFCYDHDPAAQQLARQ
FT                   LVQSLGLEKQVQFIDNLKELTDRPVDHIIVASLVADKQALLAQLVPYVTRSSKLVMRYG
FT                   NGLKSIFNCPYCHEVNCSHWRTASKPVTTGLYDLIILEPNHHA"
FT   gene            720827..722227
FT                   /locus_tag="YPA_0633"
FT   CDS_pept        720827..722227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12601"
FT                   /db_xref="InterPro:IPR016935"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4T7"
FT                   /protein_id="ABG12601.1"
FT                   /translation="MTLSFWNLIIMHNTLPTLILGAGPAAIQLAVDISATGDARLGLYN
FT                   RPSTKGERLKQYLALTPTLYLQGTGKAQATQKESSVTIDCYIDQLAQAVGDWQRLILAV
FT                   PADHYYAVLQQIPWAALPQLKSVILLSSSMGSGLMVQNLLNAAGKRDVEVISLSSYYAD
FT                   TKYIRAETQDISANTQDINAGTQDIGAIQPYRAYTKAFKQRIYLANQWGNAGSAEMSWL
FT                   TAVLARHHIDTLPCSNLLAAERFSITNYVHPPLALADTTLQALFYPEQRSQYLYKTQPE
FT                   GPVCPAVIADLAGLADDYKRLLNRLGVEEINLLRFLNDDNYPVPASMVSRRWIDEFPQL
FT                   PPLEQQYALFVRYTALLVDPYSTPDEQGRFYDFSAVKVATVYQDANALWHLPRVPLEDV
FT                   HKLRTLLLLAGALDVVMPTAQRLLQRFQQALKAFIDRVGEEHCHPSLLGDDCDRQAAII
FT                   EQQWRSQT"
FT   sig_peptide     720827..720919
FT                   /locus_tag="YPA_0633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.717) with cleavage site probability 0.670 at
FT                   residue 31"
FT   gene            722224..723069
FT                   /locus_tag="YPA_0634"
FT   CDS_pept        722224..723069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0634"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12602"
FT                   /db_xref="GOA:A0A0E1NLX6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLX6"
FT                   /protein_id="ABG12602.1"
FT                   /translation="MNQGALLAILASLIFSVMNVLVKTIADEIPTGEIVFFRSSIGCLL
FT                   IGLLMYQRGIAFSREDRPLLVLRGTMGALYLICYFYSIAHLTLADASMLAYLSPFFSIV
FT                   LSLLVLRERVNATMAFWLVMVIIGAIILIRPWNFSTYTLASLVGVMSAVFAAIAYLSVN
FT                   KLTKRHHNYEIVFYFLFITTLISIPLMWHNFVWPSGYQFGILIAIALVSLLGQVVLTQA
FT                   FSSDNLIVVSVVRYIGIVFNITWGWLFWDEVPLMLSLMGGGLVVVSCIQLGLRSKKKAA
FT                   "
FT   sig_peptide     722224..722292
FT                   /locus_tag="YPA_0634"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.710 at
FT                   residue 23"
FT   gene            complement(723094..723243)
FT                   /locus_tag="YPA_0635"
FT   CDS_pept        complement(723094..723243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12603"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4G1"
FT                   /protein_id="ABG12603.1"
FT                   /translation="MRQRRIINQKLRDDPVSLTPRPCDLPYLTVMLQAAYALAAFLPLE
FT                   LFGV"
FT   gene            complement(723259..723927)
FT                   /locus_tag="YPA_0636"
FT   CDS_pept        complement(723259..723927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0636"
FT                   /product="arginine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12604"
FT                   /db_xref="GOA:A0A0E1NN66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN66"
FT                   /protein_id="ABG12604.1"
FT                   /translation="MLEYIPEILKGLHTSLTLTIVSLLVALVLSVVFTIVLTLKTPIAT
FT                   PLVKIYITLFTGTPLLVQIFLIYYGPGQFPAIREYPWLWSLLSQPWLCAMIALALNSAA
FT                   YTTQLFYGAVRAIPSGQWQSCEALGMSKRQSLRILLPFAFKRALSSYSNEVVLVFKGTS
FT                   LAYTITLMEVMGYSQLMYGRTYDVMVFGAAGVVYLCVNGLLTLLMRLVERKALAFERRN
FT                   "
FT   gene            complement(723927..724643)
FT                   /locus_tag="YPA_0637"
FT   CDS_pept        complement(723927..724643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0637"
FT                   /product="arginine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12605"
FT                   /db_xref="GOA:A0A0E1NSW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSW0"
FT                   /protein_id="ABG12605.1"
FT                   /translation="MNEFQPLASAAGMTVGLAVCALALGLVLAMLFAVGESSRLKVVSY
FT                   LTIGWVTLLRGLPEILVVLFIYFGSSQLLMMLSDGFTLNLYLFELPIKLNLDNFEVSPF
FT                   LCGVIALALLYSAYASQTLRGALKAVPIGQWESGQALGLSQTAIFFRLIMPQMWRHALP
FT                   GLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYVIAAAIYLVVTLLSQYV
FT                   LKWIELRTTRFERSAS"
FT   sig_peptide     complement(724542..724643)
FT                   /locus_tag="YPA_0637"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.356 at
FT                   residue 34"
FT   gene            complement(724655..725386)
FT                   /locus_tag="YPA_0638"
FT   CDS_pept        complement(724655..725386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0638"
FT                   /product="arginine-binding periplasmic protein 1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12606"
FT                   /db_xref="GOA:A0A0E1NUM0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUM0"
FT                   /protein_id="ABG12606.1"
FT                   /translation="MKKLIIATVLASISLSASAAETIRFAAEATYPPFEFIDANNKMQG
FT                   FDIDLANALCKEMQADCTFTNQAFDSLIPSLKFKRFDAVISGMDITPERQKQVAFTQPY
FT                   YDNSALFIAQKDKVADLAALKGKRVGMQNGSTHQKYLMEKHPEITAVPYDSYQNAILDL
FT                   KNGRLDAVFGDTAVVNEWLKQNDQLAAVGDKVTDADYFGTGLGIAVRQSNTELQGKLDA
FT                   ALTKVKADGTYQTIYKKWFQQ"
FT   sig_peptide     complement(725327..725386)
FT                   /locus_tag="YPA_0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(725407..726186)
FT                   /locus_tag="YPA_0639"
FT   CDS_pept        complement(725407..726186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0639"
FT                   /product="arginine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12607"
FT                   /db_xref="GOA:A0A0H2Y5K8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5K8"
FT                   /protein_id="ABG12607.1"
FT                   /translation="MPWKLPFPASLAIQIWRMSIQLNGINCYYGAHQALFDITLDCPAG
FT                   ETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLQIAGNHFDFSRVPGEKAIRELRTNVGMV
FT                   FQQYNLWPHLSVVHNLIEAPCRVLGLPKEEAMARAQKLLSRLRLTDFADRFPLHLSGGQ
FT                   QQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAGTGITQVIVTHEVEVAR
FT                   KTASRVVYMENGHVVEQGDASHFTQPTTEAFASYLSH"
FT   gene            complement(726430..726990)
FT                   /locus_tag="YPA_0640"
FT   CDS_pept        complement(726430..726990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0640"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12608"
FT                   /db_xref="GOA:A0A0E1NUD1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUD1"
FT                   /protein_id="ABG12608.1"
FT                   /translation="MQPTHTLTRLTVIGKLIIASSFFLSLAVQAQQCGQTAPLINERLS
FT                   YMKDVAGYKAENHLPIEDRIQEEKVINSAMAQAESLGLNGESIKPLMVAQINAAKAIQY
FT                   RYRADWLSQPEPGWQPKPLDDVRANIGELSTKILEQIAEELKTCKPAEMGDKAHFINTI
FT                   RQHNLTSADVEAIFSTFNQVKLK"
FT   sig_peptide     complement(726898..726990)
FT                   /locus_tag="YPA_0640"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.891 at
FT                   residue 31"
FT   gene            727023..727133
FT                   /locus_tag="YPA_0641"
FT   CDS_pept        727023..727133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5U2"
FT                   /protein_id="ABG12609.1"
FT                   /translation="MGLIGNGLGIISSYQRGQYVDHYGCLWEEVIADDVP"
FT   gene            complement(727160..727735)
FT                   /locus_tag="YPA_0642"
FT   CDS_pept        complement(727160..727735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0642"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12610"
FT                   /db_xref="InterPro:IPR024289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS56"
FT                   /protein_id