(data stored in ACNUC9543 zone)

EMBL: CP000309

ID   CP000309; SV 1; circular; genomic DNA; STD; PRO; 96471 BP.
XX
AC   CP000309;
XX
PR   Project:PRJNA16645;
XX
DT   10-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Yersinia pestis Antiqua plasmid pMT, complete sequence.
XX
KW   .
XX
OS   Yersinia pestis Antiqua
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
OG   Plasmid pMT
XX
RN   [1]
RP   1-96471
RX   DOI; 10.1128/JB.00124-06.
RX   PUBMED; 16740952.
RA   Chain P.S., Hu P., Malfatti S.A., Radnedge L., Larimer F., Vergez L.M.,
RA   Worsham P., Chu M.C., Andersen G.L.;
RT   "Complete genome sequence of Yersinia pestis strains Antiqua and Nepal516:
RT   evidence of gene reduction in an emerging pathogen";
RL   J. Bacteriol. 188(12):4453-4463(2006).
XX
RN   [2]
RP   1-96471
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   "Complete sequence of Plasmid pMT of Yersinia pestis Antiqua";
RL   Unpublished.
XX
RN   [3]
RP   1-96471
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c985992f974ea1d025f9ad796019d367.
DR   BioSample; SAMN02598369.
DR   EnsemblGenomes-Gn; EBG00001242686.
DR   EnsemblGenomes-Tr; EBT00001588070.
DR   EuropePMC; PMC1482938; 16740952.
DR   RFAM; RF01405; STnc490k.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773254
CC   Source DNA and bacteria available from Gary Andersen
CC   (glandersen@lbl.gov)
CC   Contacts: Gary Andersen (glandersen@lbl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..96471
FT                   /organism="Yersinia pestis Antiqua"
FT                   /plasmid="pMT"
FT                   /strain="Antiqua"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:360102"
FT   gene            89..1111
FT                   /locus_tag="YPA_MT0001"
FT   CDS_pept        89..1111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0001"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16137"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG16137.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            1111..1890
FT                   /locus_tag="YPA_MT0002"
FT   CDS_pept        1111..1890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0002"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16138"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG16138.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(2024..2632)
FT                   /locus_tag="YPA_MT0003"
FT   CDS_pept        complement(2024..2632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16139"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQK2"
FT                   /protein_id="ABG16139.1"
FT                   /translation="MTFKMTDKARTLKVYNLLEGTNEYIGVGDAYIPPFTGLPANCTEI
FT                   EPPTTTEGFAAVFDFTKQEWSLEEDHRGKTLYSTETGEPVFIAELGPLPENVTYISPNG
FT                   EYQKWDGSAWVKDEEAEKTALVGEAEQNKSVLMKNVSQQISLLQDAIDLDMATDEEKET
FT                   LVALKKYRVLLNRVDTSLAPDIDWPILGNEEEDSANLIK"
FT   gene            complement(2934..5822)
FT                   /locus_tag="YPA_MT0004"
FT   CDS_pept        complement(2934..5822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0004"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16140"
FT                   /db_xref="GOA:A0A0E1NL48"
FT                   /db_xref="InterPro:IPR005003"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL48"
FT                   /protein_id="ABG16140.1"
FT                   /translation="MWYREGTITFTQGSDALSGTGTYWNVTANGVLPGMIVIGPDNKLY
FT                   EIKRVISDTSLILAEPYTGETQKEVPCRIITTYEGDLTQFSARFTALMTRMSADSKTMR
FT                   SWLTAVDEVTLEREDGTEVTVKSLTQIVDEHNANQKWYTDNADAINAAGEKAREAAERA
FT                   LAAAQSSSEARAKADEAAQSSASASEYKTAAELSAAASKASEHGAAESAASSKASASAA
FT                   KTSEDNSAASETNAAESKAAAALSASSSANSASEALQYAESAKTSKEAAAASEAAAANS
FT                   ENEARTSKDTAVAAAAEASANATSADASRHDVDTNKAEVSRMKDEVFAARDSTIQYSEE
FT                   AKTAADTAAREAATKTSDQLLSAVKSEAEKANSASASAQGFADDAKRFRDEAQEIAEGS
FT                   KVNDATTSQQGVVQLSSATDSESETLASTPKAVKTVMDAVALKAPIDSPALSGAPTAPT
FT                   PAITAAGREIATAAFVASKVAQLVGSAPEALDTLNELAAALGNDPNFATTITNMLARKQ
FT                   PLDGTLTALSGRSPQGVIDYLGLLNTVNLAAGSIQKSQNGADIPDKRLFVKNIGAVSSA
FT                   RISFVKESGWYKLATVTMPQGASTALITLIGGAGYNAGLYDQAAISEIVLRSGNWNPVG
FT                   ITATLWQRSPAGAQGVAWINTSGDVYDIYVNVGQYSIDVIALSDCTNNASIVLFGTPEY
FT                   VATKPASSTNGANYILYSSVLPPPESYPVGAPIPWPNDVAPSGFAIMQGQTFDKSVYPK
FT                   LAAAYPSGVLPDMRGWMIKGKPTSRAVLSLEQDGIKSHAHNAAASSTDLGTKPTTTFDY
FT                   GTKTSSGFDYGTKSSNSTGAHAHSLSGSTSSSGAHAHTVTAHTQYPRSTDSRNQNAVGK
FT                   QYNTQQTTANAFNVWTSSAGDHAHSISGTAVSAGAHAHTVGIGAHAHSLSIGSHSHSVA
FT                   IGAHSHTITIAACGNAENTVKNIAYNYIVRLA"
FT   gene            complement(5903..6520)
FT                   /locus_tag="YPA_MT0005"
FT   CDS_pept        complement(5903..6520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16141"
FT                   /db_xref="InterPro:IPR025484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NML5"
FT                   /protein_id="ABG16141.1"
FT                   /translation="MDETPVISAVRNAVRSLSGGISCEIQFDGLVMDDGVTPLFLPYTL
FT                   SESDTSPLAKKILEALESESSGGIAPYPEQGEYIERLKVEKLAVINDWRLRQECRTVYF
FT                   EWNGHRWDANDISKERLDISLKAAESGLPDNFFWTDADNNDVPVTQEQLKELGMRMTQT
FT                   LFDRKFGAHERQRVMKKDILEMCDPELIKNYQVGWGDGSARR"
FT   gene            complement(6538..11169)
FT                   /locus_tag="YPA_MT0006"
FT   CDS_pept        complement(6538..11169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0006"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16142"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR021034"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL10"
FT                   /protein_id="ABG16142.1"
FT                   /translation="MEQFKKKRLPLLIAGAGGKKSSGSSRTPVEADDTVNSRAMASILD
FT                   LLGEGVIGGLVDGAKSIFVDDLPILNEDGSSNFSGITWDFRDGSQDQTPMAGFDFVETP
FT                   KSVNIQLKRMHDVTIAIDNDEADRVRVILKFPSLRSIDKKTGDTNGTTVKYKFQIANGD
FT                   NAFKDAIAEGESASEIALTAKKTGVYYRSYELKLPKPGRAYKVRVLRLTDDSNTQYIFN
FT                   DTWVDSIGEIVDTPMNYPNSALVGLKVNSEQFGSSMPSRSYLVRGLKIRVPSNYDEHTN
FT                   TYIGVWDGTFKLLSSSNPAWILFDLLTNARYGLGQYVSESMIDLGQIYQIGRYCDEEID
FT                   NGFGGKEKRFAINTQITSRQDAYRLIQDIAGAFRGMVFWAGGMVNVMQDSPSDPVMMFT
FT                   NANVKDGMFSYKGSARKDRPSVALVTYNNKEDGYKQNIEYVEDQEAMRRYGERKTEVVA
FT                   FGCTSRGQAHRVGLWLLYTARMESDVISFTAGLDASFLMPGETVLIQNKYRAGKRNSGR
FT                   IVAFTKNSITLDAPVTLNKAGSYIRILNQEGEIVERDILETGEDITKVTFSKALNSGDM
FT                   PVMNGVWTITEPDLEPMRVRVINVAQGEAQGTFNVTVVQNNASKYEAIDNGATLIPENN
FT                   TVLDPTYSKPTNLQVTEGTYISSPGNLSIKLVATWEGKSAEYWISWRRSDENNVSNWQS
FT                   ARVTEEQFEILNIAENGQYDIQLYAVSFSGKKTDIISTVYQVKGTMTPPGSPTSLTAVG
FT                   DYRNVILNWVNPDSIDLDHINVYASQTNDLETAKLVAEAASTTFTHAGLGDSETWYYWV
FT                   RAVNKRGMLSPPNSNLGTEAMTRDVLSFLTGKITSSELGQELLEEIDAKASQDAVDAIN
FT                   KQMEESLKELDQSVADLDSKLEDTSGRLEQVQNDLKNEVSGTLDKVNDALQQVEDSNAA
FT                   LVELQETVSEQGKAIAGAVEAAHAALDNASALIAEEREARVEGDKANAKQIEAMKSSVD
FT                   DSVAAVEEMKKTVAEVERASAEASTNIEALAKTNIDLALRQDEDQHKQMVNNAKIATTQ
FT                   KTFADDMSAMASKVEEIRAEIGEDIRASILEETTARVEADKTIATHISKLEAQLNDDIS
FT                   AAIVSEQEARATADETLSRQITTLQAKVEGDISAALTEEQIARATADEALSKQITQLKA
FT                   QNGEDIKAAVAEETQARTDADGALASQISSLKAQTAEDIKAAVDTETKARTDADSALAG
FT                   QITNLQAQTGKDINAAITSEATARANADGALGKRIDTVKAEVDGNSALIQQQAKAIADT
FT                   DKKVSAAWTLKMETSTSGGQKYVAGIALGIDSTGLSQFLVQADRFGLVNSVNGKITTPF
FT                   VIENSVAYMNGAYIKDGTITNAKIGNVIQSNDYAAGSRGWIIPKDGSPEFNNGTFRGNI
FT                   AANSGTLNNVTIAQNCQILGKLHANQIDGDIVKAYMVNGSSIYIAPQTFARIIYVVNGY
FT                   YYNKPSEDINTYSWSRITEYTVNGVKQQIYGMREGSKNQSGLFGYYNLPAGQSATVDVY
FT                   TWHRQRKYDHRVNEPYLILVFKA"
FT   gene            complement(11191..11778)
FT                   /locus_tag="YPA_MT0007"
FT   CDS_pept        complement(11191..11778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0007"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMS9"
FT                   /protein_id="ABG16143.1"
FT                   /translation="MSELVHVQLGGPMARHFGRHWHLKVRNTKQALDLVEANRPGLKAW
FT                   MKRNMKTYDKYHIQITNKQGHKWSVDESEFQMMGQSDNIAKIRITPVPRGSGGKAFGWF
FT                   QTVVGALVMVASFWFPALAPLGLSLMMGGISQLISPQATNDSVRQADNSNSFYFDGPQN
FT                   TTNQGNPVQLIYGEEILVGSQVVSSSITIDQL"
FT   gene            complement(11766..12524)
FT                   /locus_tag="YPA_MT0008"
FT   CDS_pept        complement(11766..12524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0008"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16144"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCI0"
FT                   /protein_id="ABG16144.1"
FT                   /translation="MQEIYLTAIKRYPNEACGFLVRTTGEKYRFMEARNVSENPENTFV
FT                   MHADDIIAAEDAGDVVAIWHSHTDESADASDADRAGCEATEVPWLILAVRKNVEGDAPF
FT                   HFSEMNVITPDGFEMPYLGRPYVFGVFDCWMLCRDYLKREFNVELNPNPHLHIPSWYTG
FT                   DTDILDQNYRNEGLVRLAPGTEPQRGDVFFIQYGKMPDHCAVYIGDGMILHHQIDRLSC
FT                   RAYYGGMYQKHTTHHLRHRDLLKGDETCLS"
FT   gene            complement(12556..13254)
FT                   /locus_tag="YPA_MT0009"
FT   CDS_pept        complement(12556..13254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0009"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16145"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMS4"
FT                   /protein_id="ABG16145.1"
FT                   /translation="MGIKADIQSLSPSALIELFELDMSNTTSGGKLFFHAGTNELMEPV
FT                   VWQGVSYEPWPIKASGFDKTGQGTLPRPKIQVSNFAGTVSAEVQANDYLVGCRIIRKMT
FT                   LARFLDAANFKDGNPTADPNQHFPDEMWFVEQKTLETHEVVEFELSSVFDLMGVQLPYR
FT                   QIIKNTCPWKYRGPECGYTGPYFDKNNQQTTMSGADYCTKRYDSCNARRNYFANGVIHF
FT                   GGFIGATRYG"
FT   gene            complement(13344..13679)
FT                   /locus_tag="YPA_MT0010"
FT   CDS_pept        complement(13344..13679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0010"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16146"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKV3"
FT                   /protein_id="ABG16146.1"
FT                   /translation="MERLTFNWYPDYESEKTVKPNVTVLNFGDDYEQRQAKGLNRIKEE
FT                   WSLTFTRSYDVINAVDDFLTARAAVESFYWTNHRGKKMVVVCDSHTVKRYQGYLVLTAT
FT                   FRQIYEG"
FT   gene            complement(13721..15244)
FT                   /locus_tag="YPA_MT0011"
FT   CDS_pept        complement(13721..15244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0011"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16147"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL01"
FT                   /protein_id="ABG16147.1"
FT                   /translation="MSFDQSLRDTTKSLTELANAVPNEFITQEMIDKAKSRLADLANAS
FT                   DDYREMFNRRNVEQMISTWAPESDSIISAGYKPSREEKVADFNDTYNRNLKALMDLRDQ
FT                   ASDPKIVALYTKQINQLVAAGNTALIKETGTATQKLALEYENLAEQLENSWSNLFSNMT
FT                   DTLTDFVMKGKLDFSSLAESILRDITNMVVKTQITLPLMNMLGMGTTAAGSSQSGNLLS
FT                   GVASAVANQGVRMNAVNGDKSVGEATKETSSSVSGLGQTTQQTTSAIGSATNAIGNWVN
FT                   GLFTSTEAKDAETKAVKTSIFSMQNLSSVTGALSAAFAMLGANMSGSGNKWLSFGATIA
FT                   SGLVSAWAGGGFDNIGSGSSGSNSGFNNLTGSASDGTGGIPAIPKFAKGGIFGKDGVVP
FT                   LRAYQKGGIADSPQLALFGEGDMNEAYVPLPDGRSIPVTLNAEGVKGGGVFSPVSIEIN
FT                   VNSDGSVSENSNSEGAWSQAAQRMKAIALETIAQEKRPGGSLNPNSQRN"
FT   gene            complement(15254..18298)
FT                   /locus_tag="YPA_MT0012"
FT   CDS_pept        complement(15254..18298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0012"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16148"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQN2"
FT                   /protein_id="ABG16148.1"
FT                   /translation="MSQNVEFILSLEDKQFTASIDRAGKLLTRFGEQATKPAQKINNLE
FT                   RSLGSVSRIIGVLESKLDVTAEKLQDVAAGFELVSDVSRKTRGSITSLNSGLKTLIERV
FT                   DTTTSSVNKLTTSLRKVQSELNEFSDWATFAGKSASRFGTEVKEASASVSGMNTRLNTT
FT                   TKRLSNWGVTTSQAAEGLKKVRDQMDAVIGRQQLISKPVRVRTSSYGDGGGNGGGGRHS
FT                   GSYGHGGRSAESGVFSGLRGNIFLLGEIGDAARTVTDILFGWQKPIIEAASEMERMRVM
FT                   LRGLNKDKANPGKAAAEDMQYIVDMAQNAPFAMQALTDSFVKFRSAGLDPTDGSLKALV
FT                   DSVARFGGDSELLKRAAVAVQQMSGKGVVSMEELRQQLGEAVPNAMKAMADAAGITMGE
FT                   LTKAVSTGTVEAKQALSLMFVGLRAENENAAKDMMQTYTGALAQLQTSFTLFADRVGQA
FT                   GYLDSLTKGMKELASIMNSAEGISFANSLGSGLSTAIDGLRELAQWLAKNQELVISLGK
FT                   VVAAMVAFKLMRAGIAGVIGTAGQMVNTFTKMSTVLQAPFNLGATAVTRFNRAARMGLA
FT                   PIPSLIFAIRGAITGLQGAFAGLTAFIAANPIGAAFTVATVAVAGLITYMTMLRSETSK
FT                   VVDEIRKIPEAMTAAKRAQMAARAAELEKQIQRDQQALKTGESVNYYSTAAGPVAVKES
FT                   KEVVEARLKKNQEEYERTTGTMALGDGAVAKRLAKEAAESQIEKIRADNQVFSATFVKA
FT                   RQEALDKIQKINDDKSLSDDEKNKLLAPLREKVNKSYLEPAQKLVYDLSSRKNATEKQI
FT                   AHFSDMLEKAKKEGNTEQVQKLQGSIRGYQEHLEAVAQELTQAEFERDSAAKTGKGVMS
FT                   NQGTVLGLGTTDKAAQKALAQYMRNQMDSATYQRTLPDGTAMLDFEGKPIIGPKQLKTQ
FT                   LNLQKASSASSLEKMSDEERAAAIAALTKAREQDAAAAEKAGQRTANASQRAARKEENA
FT                   QRKLAAGYQKALDKADQLMGQMGES"
FT   gene            complement(18306..18539)
FT                   /locus_tag="YPA_MT0013"
FT   CDS_pept        complement(18306..18539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQM1"
FT                   /protein_id="ABG16149.1"
FT                   /translation="MFWMLSRNIDRLRAEEDVRNLQVARAAQADGEGVKAFMEGLQLRI
FT                   GRPVVTDKVYDPRKDKADPDAKEQLMQIFGRG"
FT   gene            complement(18656..18973)
FT                   /locus_tag="YPA_MT0014"
FT   CDS_pept        complement(18656..18973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKZ5"
FT                   /protein_id="ABG16150.1"
FT                   /translation="MTKLLDLDSILPPKKSIKFGGQEYPIVEMTVGLFVSIKQMEGKDL
FT                   QNMSPVEQVTAYADLVRKVIPSVPDAVLEKLTVPQLQQIFTFAMEVIDEENEKAAGEGA
FT                   K"
FT   gene            complement(19033..19779)
FT                   /locus_tag="YPA_MT0015"
FT   CDS_pept        complement(19033..19779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16151"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKR9"
FT                   /protein_id="ABG16151.1"
FT                   /translation="MSNTHVKNIKLGACKVSFGGVDLGYTKGGVQVEVATETLKVTVDQ
FT                   LGQTTISELVQGRNITITAPLAESVLQNMVDLMPGSTLSEEENSVTITSAQGVNLIDVA
FT                   KELVLTPQDTTDYVLTIPKAATAGNFTMTYQSDDVRVFSVQFTAYPDDDGVLGKMSGPK
FT                   PVKTVSISPESPEVKAGETVQLTAQITPADAGDKTGVWESDNQEKATVDQTGLVRGVAE
FT                   GSANISFTSNSGGKKATKAVTVNSAQ"
FT   gene            complement(19854..20237)
FT                   /locus_tag="YPA_MT0016"
FT   CDS_pept        complement(19854..20237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMR6"
FT                   /protein_id="ABG16152.1"
FT                   /translation="MFIEAFASLMQKAKIGTVGTDIFCHYMPANVKSGVLLVTPNTGIT
FT                   IDHELKGFYHDSFTVIVRNATITKTVAKANKIMDMFPVEETVSDGVYFRLVRPMSMPIT
FT                   YPKNEGSLIEAGIPIEFAGYLLN"
FT   gene            complement(20239..20712)
FT                   /locus_tag="YPA_MT0017"
FT   CDS_pept        complement(20239..20712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQG1"
FT                   /protein_id="ABG16153.1"
FT                   /translation="MGLKYDAHHFKRAGDRLNNSQKAFKRYLIRDMEKLARLVERLARA
FT                   MAPLETGSLESAIFARVVKEGYTGLRIELSVSGAKPREGHPGVEVGDYAEYMELGKYRL
FT                   GYLSRMKSVTNPPVAGVKPRVGPLFLERAVQISEKQFTQTIAEAARKAGFTRG"
FT   gene            complement(20703..21047)
FT                   /locus_tag="YPA_MT0018"
FT   CDS_pept        complement(20703..21047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL31"
FT                   /protein_id="ABG16154.1"
FT                   /translation="MNISWQAEIAIYRLGSKNVYGEAQLQFVRKTNVGVVKFEQSNEKS
FT                   SVRADSSGSRGKANLELFDAVLVIPLEAAVQLDDVLILEGQKLKVSSVHRRWGLRGRPG
FT                   HLEVGANIWV"
FT   gene            complement(21145..21978)
FT                   /locus_tag="YPA_MT0019"
FT   CDS_pept        complement(21145..21978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQH2"
FT                   /protein_id="ABG16155.1"
FT                   /translation="MAQIDTYRSGEAVSLSFAFNVLDIESATYTVRDGAGAIIVDNEPL
FT                   DITEGQMSIPVVVSAEHNLLSDKERDLRHVIVKAVASGLTHEERKMYVLLNSFELSIPG
FT                   QSFATVADAQMQAIDMLNGDTLLADGEGLMRKRLIEATRRVKTLPFSIRKVLRIDFDRY
FT                   DRPQNMLNVYDIPWGADGAYRHDLIDWEQMTPEKFDEFPDYFKQALMLAVVNEACEIAN
FT                   GNDVAAAREDGILSESIGETTNMYRTGKAANVQVARSTWRLLVSYINNRMIVRRA"
FT   gene            complement(21978..22412)
FT                   /locus_tag="YPA_MT0020"
FT   CDS_pept        complement(21978..22412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16156"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKT0"
FT                   /protein_id="ABG16156.1"
FT                   /translation="MKPAKIRLLEPQFLGYTGILCGIQFVDGISVAELRFIDQQRICAS
FT                   MRATTVEGKNVSPSAAYSSRNDLTADDIVETAAPDIVPMKRGTAEVEAKPVQRFTREEL
FT                   ESIADCEGIAGLRQIGNQIGVKAKGIVEMIEGILKAQGGE"
FT   gene            complement(22456..23118)
FT                   /locus_tag="YPA_MT0021"
FT   CDS_pept        complement(22456..23118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16157"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMP2"
FT                   /protein_id="ABG16157.1"
FT                   /translation="MPEQKMKITEEAFSDFTGHMCRAGFTNSISNEPLSERQQNHLAAC
FT                   FRAIPFTQSVTITPTAPSVLVGKTVQLSAGITMSKSADSFTWTSDNDRVATVSGTGLVT
FT                   GVTPGKVKITATDKQTQLSASVEVIVKPVSVESVTVTPDSTSVEKGKSVKLRVDVQPSN
FT                   ATNKKVTWTSKNSDKATVDQNGNVAGVAVGTATIEVVSQDGSHKATATVEVTAAPAA"
FT   gene            complement(23193..24068)
FT                   /locus_tag="YPA_MT0022"
FT   CDS_pept        complement(23193..24068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMP7"
FT                   /protein_id="ABG16158.1"
FT                   /translation="MPLLRDEAEKLSNNELEQGVIETIIDRDDLFAVLPFMKINSKAYL
FT                   YNREATLSEATFIDVNDTITEGAATFTEHVAKLRILAGDVDVDKFLATTMSDTNNQLAI
FT                   QVRQKVKGLARAFRRNLILGDSTTNTKAFDGIPKLMHDDQKIDIEGASMTFSMFDELVD
FT                   AVKDLGADCIMMRSEHLRAYRALLRTVSLGPSEIMMENFGRPMLCHNGVPFIVNDFIPT
FT                   DAGKASIYCLHLSEENGVTGLYGGENAGIVVENIGTVQNKDATRTRVKWYCSLANKHDK
FT                   AIAALTNVKI"
FT   gene            complement(24095..24928)
FT                   /locus_tag="YPA_MT0023"
FT   CDS_pept        complement(24095..24928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16159"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL61"
FT                   /protein_id="ABG16159.1"
FT                   /translation="MNLWQMLMARRGLMDAAEAHERGGAGGGAPAGDNEQGNQDPGKQG
FT                   EQKEQPKGDDDEYAGMTQEELLAELRKSKKAGADLLKENMKRKEKERTLADQLAQYGDI
FT                   DPARARQLLEAEQAAETARREAEQAELERRGEFDAVKKQMIEAHQAQLVEMTVGASFSG
FT                   SAFLRDKVLMTPAKARVIYGSHFEVGEDGSVVGFDKPAGQKERAVLVDGEGKPLPFESA
FT                   IERILRADPEADALLRSEAKQGAGSNSKPTHKVNQPKSKSTMDKLTSGLGKIGLK"
FT   gene            complement(24951..26525)
FT                   /locus_tag="YPA_MT0024"
FT   CDS_pept        complement(24951..26525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16160"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NML9"
FT                   /protein_id="ABG16160.1"
FT                   /translation="MELTDKQIKDLVARRHPEYEKKKEHWDFLASTYAGGRAWFNDNIF
FT                   RYFKEGDQEFKERLERAYRFNHTREVVNLINKYLFKEVIHRNTDEAPEQIRNFWKRATR
FT                   QNASIDAFMAAIDLQSSIYGRIWVVVDSTMNVDVESVADEKKNDARAYAYWISPQQLLD
FT                   VAWDEDGNMLWALIVEIARDDEDPFTSTGQEYQRYRLWTQNEWYLFREEVKKGSGNSGR
FT                   RQAKVVLEDSGEHNLGVVPVFPVDCIGESESPYFSPSLIDDIAYLDRAVANYLSNLDAI
FT                   IQDQTFSQLAIPVQSLLPGDENHTKVLEMGTKRVFTFDSESGNQPFYLSPDPKQAQMII
FT                   TTIKTVINEIYHSVGVAGERTKQDNAQGIDNSSGAAKMYDFQRVNSLLVTKAERLERAE
FT                   RQMMQLAAKWMGVELDEDHSLIAYPESFDIRGLTDEFAVAEKLSLLQAPDSVRRHQMEM
FT                   LIEKVFPNISEAMQKEFQKDLLKFPPKNDLNTLENKSVLTYDRDISQESGQDQPRGNGD
FT                   SSTQETE"
FT   gene            complement(26559..27815)
FT                   /locus_tag="YPA_MT0025"
FT   CDS_pept        complement(26559..27815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16161"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQJ8"
FT                   /protein_id="ABG16161.1"
FT                   /translation="MAIPSSLSLVQLHSGQMQVFQSPHRFKVVCAGRRWGKSRLSISTI
FT                   IRAAAKEKKQRVWYVAPTYQMARQILWDDLQEVLPRKWVRKKNDTTMTIVLKNGSEIAL
FT                   KGADKPDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSSTRGGALIIGTPKGFSEFHK
FT                   LWTIGQNKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDMDPKSFAQEYLASFENMSG
FT                   RVYYPFDRNVHVKPLQFNPKLPIWVGQDFNIDPMSSVILQPQPNGELWAVDEVVLFSSN
FT                   TAEVCDELERRFWRWKSQVTIFPDPAGAYRQHARGESDVDIFKEKGFLRVDYPKKHPPI
FT                   ADRVNAVNRMLMSASGETRLYIDPKCKHLIDSLEKVIYKPGSRDMDKTGGIEHSADALG
FT                   YPVHRRYPVKNRVILGGSR"
FT   gene            complement(27818..28459)
FT                   /locus_tag="YPA_MT0026"
FT   CDS_pept        complement(27818..28459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMU2"
FT                   /protein_id="ABG16162.1"
FT                   /translation="MTVEKDESKTRLTPAEWAEAEAKWTSGEYTLSKLEEEYGIRRETL
FT                   SRHFKKRGLEKGADSVGKMVRESLKSDAELRAKARAEKIEERRTRYDDWAFALGRMVMH
FT                   EVATAKKDGKPLATIEDDLKSLQRASGTLAKCFEVSSKALGMDRAENEDDEIPNLVFGE
FT                   LTPSQVAQLRKEDDEPDLIDDDLLESLEEEALSEAEGDSDASGDESDGSV"
FT   gene            complement(28655..28921)
FT                   /locus_tag="YPA_MT0027"
FT   CDS_pept        complement(28655..28921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKQ8"
FT                   /protein_id="ABG16163.1"
FT                   /translation="MTLTDKQKDIIKTINLGHERGHLLDLDELLEVLPYKTTKQSMQFS
FT                   IRALVKKGLVEKGMCRQRGDSGYHRRTLGLTTLGRARAKLLVM"
FT   gene            complement(28931..29821)
FT                   /locus_tag="YPA_MT0028"
FT   CDS_pept        complement(28931..29821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16164"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQF2"
FT                   /protein_id="ABG16164.1"
FT                   /translation="MTDIIIKRYRPEEFPRHLDFLERMTVTKGTVEDWHALKSLHYKTD
FT                   GKPFAPTYYRCELDDRLVGVVVMAYPKLLLAPRHRMFPKLKPTTNTTVANQYWGRYVNN
FT                   NFAVISRSVVDTQYRGVGVSYRMINLVSRMHDRPIIEIQSSMSKYNPFAMKAGFQFIRP
FT                   ERPKSYESALRVFQRHFRSDPGDNEAIVKELFAMSESRRRRALRDLVADYHKNSSLAKA
FT                   GRNRGTTIQDIADSLVDEASIVKLLKDIHNLSFTSPLYGVYRNPDFGRQLPDTLPLLAF
FT                   DKQPLNKPLEIALPA"
FT   gene            complement(29827..30081)
FT                   /locus_tag="YPA_MT0029"
FT   CDS_pept        complement(29827..30081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQH7"
FT                   /protein_id="ABG16165.1"
FT                   /translation="MPDLKIVELKPSKEADNNNVEVIRLLEEALQHAREGKSQSLALLM
FT                   INNDGSVLDCWHNGGRPYVMVGAMESLRLDFINANIERR"
FT   gene            complement(30074..30712)
FT                   /locus_tag="YPA_MT0030"
FT   CDS_pept        complement(30074..30712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0030"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16166"
FT                   /db_xref="GOA:A0A0E1NL60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL60"
FT                   /protein_id="ABG16166.1"
FT                   /translation="MSKYTINVSFQTRVNKTMRTLEIAESFGLGLDEKEWTLYDNLELE
FT                   VKQGDVVYITGQSGSGKSVVLRELQRQMKDEGLSVASIDDFTFNNEVNVIDQLGKTTSD
FT                   ALGLLSMAGLNDAYLFVRKPSEMSDGQKYRLKIAKLIESGAKVWAADEFGAVLDRVTAQ
FT                   VVASNLQRAARKVGATVMVATTHEDLKNALRPDMQITKHYKERVKVEYA"
FT   gene            complement(30709..31377)
FT                   /locus_tag="YPA_MT0031"
FT   CDS_pept        complement(30709..31377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16167"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL43"
FT                   /protein_id="ABG16167.1"
FT                   /translation="MTKNFEIVYRNPAELIPYEMNAKKHDEQQIRDLAAAIKKRGFDQP
FT                   ITVDKHDVIITGHGRREAALLAGLERVPVIVRDDLSEEEVKAKRLEDNRLASIDYDAIK
FT                   LQQELESLVLGDVEVFGFEERELNVLVGSMTEEMETGALVLDLGEETERQKEEHTEISR
FT                   EVAAEEVRVIDVLGFKTLPAGSAIVVGDLLAHMEEITGECGVDAFVAYAEKVSSGELAA
FT                   "
FT   gene            complement(31377..32075)
FT                   /locus_tag="YPA_MT0032"
FT   CDS_pept        complement(31377..32075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0032"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16168"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEE8"
FT                   /protein_id="ABG16168.1"
FT                   /translation="MDCIRIMDVKITILQVEVANLRPNPWNTNSVGAQNFEKLKGSIEK
FT                   LGFFKPILARELDGGIFEILGGEHRWRAAMEQGISTVPVISVGKINDLVAKQMSLVDNE
FT                   RYGEDDQVALQRLIEEIQSEIDYRLSDIAPYDDEMAATLAKASVIDLEALEALSRGDDE
FT                   PIEEDKREKTERVGAEHQTMRFKVTFDASDRVADTIKTIIKEQGINTGNEMENAGEALV
FT                   WLVDYYKERM"
FT   gene            32140..33699
FT                   /locus_tag="YPA_MT0033"
FT   CDS_pept        32140..33699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16169"
FT                   /db_xref="GOA:A0A0E1NKV8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKV8"
FT                   /protein_id="ABG16169.1"
FT                   /translation="MTVRIVSNAVNALISGADDNVKRLVQEMLSYEVEAGDWKGTSTMF
FT                   NWSKNAFPAGFAKPVAANLLKAGIKCVHVRKEKAPALGKPNPVVNPFPYNPDYAYQDQT
FT                   VETLVREGMMIAQIATGGGKSNVACKAAARIGRMTLFLTTRSVLMFQMAENFQKSIDYR
FT                   AENGEPWLKGQKVGVIGSGEFQVSRHINVATVQTLASFLEEPPRDASPEKKRYHLKRRE
FT                   LVKRFLSSVSLLILEEAHESSGSNFYDIARLCINADYRLALTATPFMKDSTEANMRLMA
FT                   VAGRIEIKVTEKYLIDRGILAKPYFLYHKIAYTPDEVRIRAELASKHLNFRVGMSTAYQ
FT                   KAYQLGIVYNLGRNEAIVREALMYKSHGLNCMTLVRLKRHGQILMEMMKESGLKVDFIY
FT                   GESNQTTRQAKLSSLAAGRIDVLIGSTILDVGVDVPSVGAVILGGGGKAEVEMRQRVGR
FT                   GLRAKKNQANVCFITDFIDVSNKYLMSHSYERKHIIDTTPGFAEGVLPVGSTFDFTVLN
FT                   RE"
FT   gene            33702..33980
FT                   /locus_tag="YPA_MT0034"
FT   CDS_pept        33702..33980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKX7"
FT                   /protein_id="ABG16170.1"
FT                   /translation="MSEKRAIHCQVQLTEKANDKLETFQNRLRERNIKLSKADVINLVL
FT                   SNMTMADFDKAATSLEASAKAREKVMKIYESSGMTKEDLADILKRLD"
FT   gene            34040..34462
FT                   /locus_tag="YPA_MT0035"
FT   CDS_pept        34040..34462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0035"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKY6"
FT                   /protein_id="ABG16171.1"
FT                   /translation="MKHVLLPLITIPVLLLSACSSRPVSVANAKPAPQARVFKYQTSAP
FT                   TTLVVMRDKGMIGAGCDASIFINGETVAKLETGEKATFHLDAGQWIVGASLEGAGLCAL
FT                   NPARQERETITKAGETKVFRVFTSNAGDIDILPTTL"
FT   sig_peptide     34040..34129
FT                   /locus_tag="YPA_MT0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.572 at
FT                   residue 30"
FT   gene            34467..34994
FT                   /locus_tag="YPA_MT0036"
FT   CDS_pept        34467..34994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0036"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16172"
FT                   /db_xref="GOA:A0A0E1NKZ1"
FT                   /db_xref="InterPro:IPR003223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKZ1"
FT                   /protein_id="ABG16172.1"
FT                   /translation="MTNKTDITYGIPAEVWPRDYSNVEKALMFWRKSLIPVRVTMEDGQ
FT                   VFCMYVQGLMSSRNKVDLCPAPFDKENRIRLPLERISTIESGVTEGIAHDFTGRTTVHP
FT                   DYVDNRPSRRDFFKICRQAHEMQKSIRVYMADGREIEGGSSGVDACQATLNMGDGRKTV
FT                   VMFDWVERILPF"
FT   gene            35317..35967
FT                   /locus_tag="YPA_MT0037"
FT   CDS_pept        35317..35967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKX5"
FT                   /protein_id="ABG16173.1"
FT                   /translation="MSNVAISKKSIIDAAVVIANELQVAANNATQTYNNHYQNGTHTKA
FT                   DKANMLAATTKLAYFTNNVLNAVNDEKLAGVFYYAIKASKQAPEAFFREAMTNSYSLEK
FT                   LVYLVKSIKSGKCVYSVADMSGSRVFALIEMINDELETFTNGAVFDLMNEAKKANEIKL
FT                   DAGYTQANQLINLCERLGLVEKIKGMGAAKNGSQQYRFIKNDFYNYLADAFKA"
FT   gene            complement(36389..36847)
FT                   /locus_tag="YPA_MT0038"
FT   CDS_pept        complement(36389..36847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0038"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16174"
FT                   /db_xref="GOA:Q1C048"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C048"
FT                   /protein_id="ABG16174.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(37056..37625)
FT                   /locus_tag="YPA_MT0039"
FT   CDS_pept        complement(37056..37625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16175"
FT                   /db_xref="GOA:A0A0E1NL68"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL68"
FT                   /protein_id="ABG16175.1"
FT                   /translation="MSKTIRVVGVDPSMSNFGLAIGTLDLETDKLDIHGLTLVETKAGG
FT                   NKKTVRVNSDDLRRANEIWRTAKPIIEQAHMVFCELPVGSQSSRAQTSYGICIGVLACV
FT                   DKPLIQVTPNEIKHYVGNKLTTSKEEIIQWATQKQPNAPWLRRKQSGKEVLVNKNEHLA
FT                   DAVASIYTGMQTDQFRQVRDVLAGIL"
FT   gene            complement(37638..38384)
FT                   /locus_tag="YPA_MT0091"
FT   CDS_pept        complement(37638..38384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMR0"
FT                   /protein_id="ABG16227.1"
FT                   /translation="MSFNLSRTQFLQMFAVMQSIKLINHHTAKAAAPALLWKNENINDD
FT                   QFSVLTSLLSSTPLMPSLAMLPSGSTAPILVNPFTEGGYLPHSGPGFVAIPETGTLNIQ
FT                   ENALFNAMETHISTAFTNLIRHANARADHVAMPGAAFASVSVDYDRHAPISKRAKLCFY
FT                   EEGCEVAVIEVLLPHVFSANEKVAHHLIDIMRHFIGQSMIDADIAAGVLTNDSIHVVSD
FT                   IPKPPTREPEKTLEQKLMECPTWATW"
FT   gene            complement(38374..40290)
FT                   /locus_tag="YPA_MT0040"
FT   CDS_pept        complement(38374..40290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0040"
FT                   /product="exonuclease subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16176"
FT                   /db_xref="GOA:A0A0E1NQF6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQF6"
FT                   /protein_id="ABG16176.1"
FT                   /translation="MKFLKLQVENFMALASAEVELDQRGLVLIQGVNSGDSSAASNGAG
FT                   KSTLMNSLMWCLYGETAHGVKGDDVLSTGHEKNCRVMVTVEDEGKRYAIIRHRKHKEFK
FT                   NRLIVRGEDGDMTKGKDTLTQEFVERLIGASKEVFMASIYASQEAMPDLPGMSDKNLKT
FT                   IVEEAAGVDRLTRAYAIARERANAAAARMDVTKSKMDACLTLIETAQSEIEAAKASSDS
FT                   WERDRGERLDKARVDLAGAEVTLSEVVMEIRSLPEQIRDTENAIAGERCKLASKEEHDA
FT                   KLLKVRGAITEIRSSIRTSEAAQNESMNRARSFKTKAEEVSTKVGAPCVTCGKPYCEED
FT                   LSTVKESFIEQARNEIGQAQASASAVAQHKARLEKALGIESALVAATPDVSEIIAKIER
FT                   LTNELSALRHREREVVAVEAMVARARTDVNRIMAEVNPFLAVIKRHEDNLAANKSNHAV
FT                   LKNELKSIQEQALLLEKARQVYSPAGVRSHILTSVTPFLNIRTAEYLNTLSDGNIVAEW
FT                   STMETTKKGEYRDKFNISVTKTGSSKSFQTLSGGEKRKVRIACSLALQDLVASRASKNI
FT                   ELFIGDEIDDALDTAGLERLMGILEAKARERGTVMIISHKEMKSWFRETITVEVKEGRS
FT                   YVV"
FT   gene            complement(40520..41605)
FT                   /locus_tag="YPA_MT0041"
FT   CDS_pept        complement(40520..41605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0041"
FT                   /product="exonuclease subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16177"
FT                   /db_xref="GOA:A0A0E1NKX1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKX1"
FT                   /protein_id="ABG16177.1"
FT                   /translation="MTLPYGVISDPHYHRWDAFATTNADGLNSRLEIQLDATKEAAKAM
FT                   KAAGCKHMLVAGDTFHVRGAISPSVLHFVTETYEWIIKELGLEVVMLAGNHDLETNDSV
FT                   YSANAAASLRSIGVEIVCGKRPHSIKIGDVTVHLISWRNNHAELISDLKTLRSGLDGDN
FT                   HDVVVHTSINKAIPTMPDVGIDAQELKDIGFRLLLSGHYHNHKEVLPGVVSIGALTHQN
FT                   WGDVGSLAGFMIVNPDGTFTHHETSAPKFVNLEDDVEDDQIRGNYVRFRAVVENDEEGI
FT                   KLQNVLKTMGAKGVVCNFIRKASMMEGSASTAETSKIDSLGESVAAYCKIVHDTDGGFD
FT                   LSKLDMLCQEILTEAESAEAV"
FT   gene            42212..43042
FT                   /locus_tag="YPA_MT0042"
FT   CDS_pept        42212..43042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0042"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16178"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQG6"
FT                   /protein_id="ABG16178.1"
FT                   /translation="MDYTPNSGQLVRNLLNGKYNIAVAGIDNVIAYQEGQVKEPVVNPD
FT                   MFAFYGVDNGLLSLVANPQIKNISDLKGKQVSVDALTTGYAFVIRNYLEKNGLTQNDVH
FT                   YTSVGSTNDRFNALLAGKTDATLLRTPLNLQAKENGFKILASGSELGDYQGTTGITTRS
FT                   WAAQNGDILVSYIRSYIDGLNWIYDPRNQKEAEEILVKKAPGMTAELAGPALQELLNNG
FT                   LQRDAAINAEGVKNVLLLRSRLAKPEKNLTDTHKYYDTSYYQKAVGLNKQETGK"
FT   gene            complement(43402..44046)
FT                   /locus_tag="YPA_MT0043"
FT   CDS_pept        complement(43402..44046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMV1"
FT                   /protein_id="ABG16179.1"
FT                   /translation="MDLKRTRWVRRLEDGSYTIESNTILNKQKLLCDLCGIASKCPINE
FT                   TRLKLYDAGAHFHLNSCIRYVPLLAFRKPIIGLDAPYFNTLRSGVTWRDRVEPGKLVCL
FT                   VEADTGNIIRFGRVDKVYSGPVDEMLRKHSRFNHLCMGGEKIDKVGEVIRKSYGHFLND
FT                   DSLLTAIYIRHVDREFDTEYHSAEELNLVDPRPKAGVIDISVARQKPSETF"
FT   gene            44791..45855
FT                   /locus_tag="YPA_MT0044"
FT   CDS_pept        44791..45855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0044"
FT                   /product="replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16180"
FT                   /db_xref="GOA:A0A0E1NL37"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL37"
FT                   /protein_id="ABG16180.1"
FT                   /translation="MSENGNKNIAIVEAFSETDKKTGEVVTLVPNTNNTVQPVALMRLG
FT                   LFVPTLKSTSRGRKGQMVSMDASAELKQLSLAKAEGYEDIRISGVRLDMDNDFKTWVGI
FT                   IHAFAKHKVVGDTVTLPFVEFVRLCGIPTARSSAKLRKRLDSSLTRIATNTISFRSKGS
FT                   DEYYVTHLVQTAKYSTKNDTVSLQADPKIFELYQFDKKVLLQLRAINELSRKESAQALY
FT                   TFIESLPPDPAPISLARLRARLNLTSRTITQNATVRKAMEQLREIGYLDYTEVKRGSSV
FT                   YFIIHYRRPKLRPALPPTKAAPEEPEEQEDNLPGDGQEDIIDVVPEEKDGEMVMLSKEE
FT                   LAILEELRKAKARK"
FT   gene            complement(46424..46636)
FT                   /locus_tag="YPA_MT0045"
FT   CDS_pept        complement(46424..46636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL18"
FT                   /protein_id="ABG16181.1"
FT                   /translation="MAVTMAGLEIEKTSGYWRAKGFKQPGVLERLEREDGVIIHQRREW
FT                   RMYDPETGKLTTKAGTLWGLLKKIH"
FT   gene            complement(46636..46971)
FT                   /locus_tag="YPA_MT0046"
FT   CDS_pept        complement(46636..46971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL57"
FT                   /protein_id="ABG16182.1"
FT                   /translation="MKKTALALALFTLPVYANTHVYECEMSVAEVKNDEICNVVKANYG
FT                   AMIVDSGEQFYVVRDDRVLSSPYLTRRNGKLSGVGEDKFVYDKSGDVYGVHAKNASYLF
FT                   DDCKEVG"
FT   sig_peptide     complement(46918..46971)
FT                   /locus_tag="YPA_MT0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.524 at
FT                   residue 18"
FT   gene            complement(46968..47147)
FT                   /locus_tag="YPA_MT0092"
FT   CDS_pept        complement(46968..47147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16228"
FT                   /db_xref="GOA:A0A0H2YDG2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDG2"
FT                   /protein_id="ABG16228.1"
FT                   /translation="MKTVLDTLLLIISIAFVLDCIFTGVIHKALAPVNSAMINALAVVL
FT                   LFDSAFGVIQGVVA"
FT   gene            complement(47188..47463)
FT                   /locus_tag="YPA_MT0047"
FT   CDS_pept        complement(47188..47463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL52"
FT                   /protein_id="ABG16183.1"
FT                   /translation="MKILVRISSSTDYDVYPLFMVKCDGLNDEEIQAAIERNLVEYTGM
FT                   DADSVHVDDDGVCWSNGSCWYVDDTTPVSDEDAAHLERILGISTFE"
FT   gene            complement(47531..47935)
FT                   /locus_tag="YPA_MT0048"
FT   CDS_pept        complement(47531..47935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL28"
FT                   /protein_id="ABG16184.1"
FT                   /translation="MHRSLHNAALDVVDTEIAQGFPEPEWATQLREAIAEMNAPEPSED
FT                   EADWQRFIRMYAEEIGPTPTAEQAMLLKYFKEAGENLPVDDTPHWFHAAWRKFDVIYTR
FT                   DLGSKDMVVWHLMHIDKAVDRTLEKFFPPA"
FT   gene            48005..49027
FT                   /locus_tag="YPA_MT0049"
FT   CDS_pept        48005..49027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0049"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16185"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG16185.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            49138..49800
FT                   /locus_tag="YPA_MT0050"
FT   CDS_pept        49138..49800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0050"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16186"
FT                   /db_xref="GOA:A0A0E1NVQ3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVQ3"
FT                   /protein_id="ABG16186.1"
FT                   /translation="MDFLEHLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATG
FT                   APQKQLQSLRSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLL
FT                   QLSTAQRQGRYKTTLQRGVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILT
FT                   SNLPFGQWDQTFAGDAALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            49816..50136
FT                   /locus_tag="YPA_MT0093"
FT   CDS_pept        49816..50136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEL4"
FT                   /protein_id="ABG16229.1"
FT                   /translation="MGRWWRYKWITFHPSLTRWPRHTVFSRFFSCIKRNTIIAALKGLG
FT                   FWIRCCGVELSTSLWAALHSPACLAGMMPILFLEMMSQASTGLLHQSKEPAPFGPIAIT
FT                   FV"
FT   gene            complement(50403..51233)
FT                   /locus_tag="YPA_MT0051"
FT   CDS_pept        complement(50403..51233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0051"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16187"
FT                   /db_xref="GOA:A0A0E1NKY5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKY5"
FT                   /protein_id="ABG16187.1"
FT                   /translation="MKKGLLAVTLAAICTMGLTGCDRVEPGYVGIKVNKLGEDKGIGEV
FT                   VGVGRQWTGLNTELYTFPTFKQMKTYDEPFTFQMSDGTAIGHKIGVAYLVNRNKVTTVF
FT                   QTYRKGVDDITDTDLRQKIADSLNRLASRMTTDTFIDGGKASLLDNALKDIQAEMSPVG
FT                   IEVISLSWVGKPDYPDTVIESINAKVTANQKTLQRQQEVEQRKAEANMLREQAEGEADA
FT                   IRKRAQAEADAIKLRGEALRQNPNVMELEAINKWNGQLPQYMTEGANTPFIALK"
FT   sig_peptide     complement(51171..51233)
FT                   /locus_tag="YPA_MT0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.881 at
FT                   residue 21"
FT   gene            complement(51237..51437)
FT                   /locus_tag="YPA_MT0094"
FT   CDS_pept        complement(51237..51437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL06"
FT                   /protein_id="ABG16230.1"
FT                   /translation="MIKGYLMAVSAVVSVCFIYGLLVPSLISAKSDLAFFIGLAIAVVF
FT                   PVALLKAGRRYINSLNKTKEK"
FT   gene            complement(51528..52604)
FT                   /locus_tag="YPA_MT0052"
FT   CDS_pept        complement(51528..52604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0052"
FT                   /product="recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16188"
FT                   /db_xref="GOA:A0A0E1NMN2"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMN2"
FT                   /protein_id="ABG16188.1"
FT                   /translation="MAKGKSALALALKKKIGSNDEIQKVSHWIDSGFPPLNKAISGRYD
FT                   GGFPCGRIVEVFGPPSAGKTFLATAAMVSAQKQDGLAVFLDHENSFDVGLAVANGLNAD
FT                   EDDGQWVYKQPDTFEDSVELIGTILKLVRDEELIPETAPICIVADSLASMVPNSKAEKF
FT                   DKMAEGTAKDKDQLNMNDNTALARATSANFPTLALWARKYNACIIFLNQVRTKIGVMFG
FT                   DPTTSPGGDSPKFYASVRIRLGASVMKDGKEKIGQDVGAECIKNKVAPPFGKCSWKFYF
FT                   DPTRGLDVIESLVEYMLEEGYLPKNASGRVEIGDKRYTKSQIVEMYREKPLPEIIAALQ
FT                   AIDERRAKESSPAETEEA"
FT   gene            complement(52607..52873)
FT                   /locus_tag="YPA_MT0053"
FT   CDS_pept        complement(52607..52873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL36"
FT                   /protein_id="ABG16189.1"
FT                   /translation="MLKSIINGGATTPTMLAKEIVFCHGEHAVVALPNILGAAGISATE
FT                   REFALVSEQVVKIIARVAKHLNHDAIKFDEAAASKRINESKGA"
FT   gene            complement(52873..53817)
FT                   /locus_tag="YPA_MT0054"
FT   CDS_pept        complement(52873..53817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0054"
FT                   /product="exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16190"
FT                   /db_xref="GOA:A0A0E1NKZ2"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKZ2"
FT                   /protein_id="ABG16190.1"
FT                   /translation="MNYLFVDGNSLGYYHQQSDKLHNGEMEVQAAFGFVKNVRRYASIL
FT                   HARPMILWDGFSDKRRDFYPEYKANRDDDPDMKKMKEGFAIQKPYILKMMTALGVNQLI
FT                   AKDAEADDLAGMLVSRLAPQPTVDHIYLLTGDGDWLQLVRENVSWVSLREDAKHKQVNF
FT                   EQFAELTGLPTPRAFLEAKALQGDTSDNIKGVGGIGDGGAKELLHEWGSVAAMVRGIND
FT                   GSIVINKGRYKTAFNKLAKNAFNEKTGCRMLEAFKRNMMLMNLIDTKFPPSEIESIKGA
FT                   RDMNAFEQMCCELNFRSFLEDLEVFVLPFERYC"
FT   gene            complement(53878..54906)
FT                   /locus_tag="YPA_MT0055"
FT   CDS_pept        complement(53878..54906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16191"
FT                   /db_xref="GOA:A0A0E1NKU2"
FT                   /db_xref="InterPro:IPR012339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKU2"
FT                   /protein_id="ABG16191.1"
FT                   /translation="MSKSLLDLLNKTRGDIASKRGNNVDLTRLKDGNNYLRIFPNKDDP
FT                   NGVFFQTFGMHYVKHQNEEGKDVTTAYICEQHTHGHACQLCEMVMEGRARFKGNKAMEE
FT                   RINSMRATPRYLVNGVLSAREDFADAEKCQLIELPSTVFDDICKVMSEDIADDIGNPLS
FT                   KEEGYAFLIKRTGSGRDTKYDVSPKRKVYKGDIPEKLWTTQHDLIAYANQADETRLLST
FT                   ARTMGRLIGIAAPAATMSSPAISSAAKSAAAELPGFGSITGHTEGAAAVATAHTPAPES
FT                   TSLVDEEILRAAEAEFKPETKPEKVKAPEAAAAASASASAAAASVPADEGLDDLLAELD
FT                   AL"
FT   gene            complement(55026..55499)
FT                   /locus_tag="YPA_MT0056"
FT   CDS_pept        complement(55026..55499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDB8"
FT                   /protein_id="ABG16192.1"
FT                   /translation="MVKLIYRNKLEPIKMSADIYEKIMSDLEFDRDNLEEVWRQQPRLL
FT                   MEYGSKLARAEREVADAKLSLDAIEAKIYDNERKNLSMNGIKFNESVLEAKVRTNPQYL
FT                   AKRQKLDDARHIADLYKHAVTAFSHRRDMIVQASKMAIVEIERLGAERFHSPR"
FT   gene            56002..56565
FT                   /locus_tag="YPA_MT0057"
FT   CDS_pept        56002..56565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMM3"
FT                   /protein_id="ABG16193.1"
FT                   /translation="MALYNFTLTLSGVTYETEGLEDALYESGCGDAIVCAYGNSVYVEF
FT                   DREAKSLDAAIASAVDNIESAGIGAIVESVDSALVGLSDVAEMTGMSRQAITMLKDGLR
FT                   GGGDFPCPIQRIQGQSPLWDWADVANWLEANGRLKENAELAHNARVLSKWNLALRNSVS
FT                   KDFVEIEHIASSLIARRRHHAECA"
FT   gene            complement(56595..57038)
FT                   /locus_tag="YPA_MT0058"
FT   CDS_pept        complement(56595..57038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL65"
FT                   /protein_id="ABG16194.1"
FT                   /translation="MNKENTMNEAQKIAQALAAIPADFQDKAVAATMRSQFWEIIDCPV
FT                   TLDLALAFAGLDGADKVSRLRKCARALALKTQDPKACQYLLEIYESDNPEEQLEAFKVF
FT                   RNRLVLKVAKEFMEVNKIGDVRQYRLKRQTRVTLSNIFGKKVA"
FT   gene            complement(57035..60559)
FT                   /locus_tag="YPA_MT0059"
FT   CDS_pept        complement(57035..60559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0059"
FT                   /product="DNA polymerase III"
FT                   /EC_number="2.7.7.7"
FT                   /note="putative pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16195"
FT                   /db_xref="GOA:A0A0E1NKQ0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKQ0"
FT                   /protein_id="ABG16195.1"
FT                   /translation="MKALMVRTDFSLGESALKAENAVKIARDAGYTAVISADSMNIASV
FT                   IPLQRAAGDDMAVICGVKLNVVDDPTYEHRARLAKESERCMESLVRDRSYCFTALIKNE
FT                   QGYRDVCELMTLANKREQFYFVPRLALDQLAAAYAKGNIILLTSDIGSVFQRRDFAKII
FT                   GTLVTAGGRDNFYSVVYPHPTPFYDQINVRAMKVASALKIEPVAFYPAYYEAVDDADIK
FT                   DIAHMVTNNIKIDQPHRLRIPHQRDNAVNGRRHLLEALKAFSVRMDVPVTAAMASTTQD
FT                   TIIEACTWRWHELPPALPKMADDEPATLMKLAVAGLRKRLTTKEFGYTPPASEHRVYVD
FT                   RLKYEMDTLTRLGFCGYFLMVRDLMNHSRETGIPVGPGRGSSAGSLVAWCIGITNVDPI
FT                   RHGLLFERFINPERLDLPDADLDFSQARRHEVIEYLNERYGEDYVAGIPNFTYLGAASA
FT                   LRDTARIYGVDAADMAVSKEFKNLEDDSLSLEELREQLASLDKYATKYPEAFKAACKLQ
FT                   SLMRGFGRHAAGMIVAGVPLVERTPVELRGNARCIAFDKRYCEAMGLIKLDVLGLATLD
FT                   LLDSAKRYIKESTGEDINLDAIPLDDRKVLDGFAAGYTQGVFQLESGPMRKLLKDLGGG
FT                   IEPMSFKTVVATTALFRPGPIQSGMLDDYVSVAKGFMAPQSLHPVLDELTAETNGVILY
FT                   QEQTMNATRLLAGFTMAEADGVRKAIGKKDMEKMKSMGEKFVVQAQAGWIDVEMEDGTT
FT                   QRIHRAEHFKCEDGALRTVEEALEAGVKLPMAAVRVTGSQPGLSETKAKEIWDAFEKNG
FT                   AYQFNKSHPVAYSLISYQSMWLKTHYPAEFFAAALTILGEDKHQGLVKDALTYGIHVLP
FT                   PDVNVSSNRIEIRTLEDGSQVLYAPFSAVKGCSENGCQAIMRAREKVGGKFESLEQFEE
FT                   AVEKRACACNSRVRESLQKVGAFASIEPGSLPATDPERLRDQAELMGNLVIDAVKASRP
FT                   FEMNPKRSAEVNVLMTRMAAEMGLGDDLIRPSIGIKPKIMVILDNANGNDGRTGYFMEN
FT                   GYDDFKAKLLTAGDLRMGDLYVTGVCKKVKDKEKDYTKDEIGQFTDFMREEINLVRPTY
FT                   VLTCGSRATSLFNNKSKPSDLVGRKEYLPELDVTVFYGFNPNILYFRPEEGEKLEAILA
FT                   EVAETISK"
FT   gene            complement(60740..61975)
FT                   /locus_tag="YPA_MT0060"
FT   CDS_pept        complement(60740..61975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0060"
FT                   /product="porphyrin biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16196"
FT                   /db_xref="GOA:A0A0E1NL22"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL22"
FT                   /protein_id="ABG16196.1"
FT                   /translation="MTATALQQEEHLPEAIVCKWCGKSFHYLKSHISMGRCENIPESAK
FT                   GLDVDEVVKMYTSAFPDEPTISRTALVKLNEKRAERHSGEGKVAEISAHPGYAGTVEYK
FT                   TELVAAHELLGVTIKELGTPRGKPLQVTVNVNTPYPEFVPEAKKNYVYGDFDLIKDIFM
FT                   MLEIGIPGYLWGHAGTGKSSLPTQLCALLNRPLIRAQHTASMEEAHVTGQILARDGSTY
FT                   FEPGLLALAMKNGWVYLADEYDFAFPQILGVYQPVLEGEPLIIKEATPDWRRITPHKRF
FT                   AFIGTGNTNGSGDETGLYQGTNIQNAANFSRFGIVSNVKYMSTKAEVNMLAEAGVIREY
FT                   AEKMVKFANLVREGYEQHLISQPIGPRELLLSAKIGMMRGDFSAGIEKSFINKLPSTSA
FT                   QAAREVVQKIFG"
FT   gene            complement(62072..63958)
FT                   /locus_tag="YPA_MT0061"
FT   CDS_pept        complement(62072..63958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0061"
FT                   /product="porphyrin biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16197"
FT                   /db_xref="GOA:A0A0E1NKR4"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKR4"
FT                   /protein_id="ABG16197.1"
FT                   /translation="MDHFSSVVDTWDGQSPFIDFMEEHWHLIDKPVALLKEHGIDVAVR
FT                   NMSNTEDCVKVAAAIAQIMQDMKDKPEGKLPELKSSAKKPSKSKDESEETPESGDDPSH
FT                   SESAPKRTKGEDDDKEEQEDDASEEEDSGDSDLPDSLDKDLPIHDKEISDTESKYTEAG
FT                   EDESGDTPESDDAGMESGDSDDEGGSDGTGAPTPGDGIREDADDSDGYGSGAAGDGDSD
FT                   NGEDSDAGREESEGEDEGEEDVADHTDGEGKENEDAAEAPEDSESGFVPAPDEMTLEDA
FT                   LKALDEMEEGTDEMTEDALSATISKELMSASLSEYRPYDRSYDFIGLIDEAEEHVKRTR
FT                   KTFGAIPMHSPVDRYRMVPEGRKLFELKIEKHLSAGVSSTLAKDLERAIASRNRVQFIP
FT                   GQRRGRIHGANLYRLAMNDDRVFRKKEDHRAVNACVQQVIDLSGSMGGRKIQLALASAY
FT                   TIADALDRINVPNIITGFTTFGSPDYETMSKRGFTRFEALMLPIIKNWNEKANSPEIRA
FT                   RMGCVCETFPLLNNVDGESVAQLATLFAGRMEDKKIMLVMSDGAPCAAGDGFHEHLRTV
FT                   TKEIETLSDIDLMAIGVLTDAPRRYYKNYALVNSVEELGPSVVTELSRIILG"
FT   gene            complement(63997..64776)
FT                   /locus_tag="YPA_MT0062"
FT   CDS_pept        complement(63997..64776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0062"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16198"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG16198.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(64776..65798)
FT                   /locus_tag="YPA_MT0063"
FT   CDS_pept        complement(64776..65798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0063"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16199"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG16199.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(65825..66397)
FT                   /locus_tag="YPA_MT0064"
FT   CDS_pept        complement(65825..66397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0064"
FT                   /product="porphyrin biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16200"
FT                   /db_xref="GOA:A0A0E1NMT2"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMT2"
FT                   /protein_id="ABG16200.1"
FT                   /translation="MSKAMTRAVLKEVQDFRDCVKRVVAMLSGKQIPVAERGNEAYVRY
FT                   NRRGEPVLVNIPSIPDDASPTLMNAVRGFLDHEVAHILFTDPKVAMKMRERGKAPSTGL
FT                   WNALEDVFIERRMGQVFNGTRRNLLATQNLVIDKYFKGKVSEAVSICHGNQRELFLKFF
FT                   LCPVVRAWCNERCNSDPHPTPEIRSRG"
FT   gene            complement(66507..66719)
FT                   /locus_tag="YPA_MT0065"
FT   CDS_pept        complement(66507..66719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCD2"
FT                   /protein_id="ABG16201.1"
FT                   /translation="MKNITSNLNALEVGHAYALGMDGVATILTELNTEELPIDMSDTTV
FT                   FTFELSNKHFTLINTGCGSLAVRTH"
FT   gene            66987..67373
FT                   /locus_tag="YPA_MT0067"
FT   CDS_pept        66987..67373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16203"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL64"
FT                   /protein_id="ABG16203.1"
FT                   /translation="MATNETDSKQGRYAAYIDSLITISPKSQATIAKEVGYKNANNLSL
FT                   IKSGKIPLPVDKVRALAVALDADPVRLMLMVLEERHPELLEFFREEGTAPLSADEKRVL
FT                   EAFRNRFGDQRGASDQVVEAIKKL"
FT   gene            complement(67368..67712)
FT                   /locus_tag="YPA_MT0066"
FT   CDS_pept        complement(67368..67712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0066"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16202"
FT                   /db_xref="GOA:A0A0H2YDD2"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDD2"
FT                   /protein_id="ABG16202.1"
FT                   /translation="MSKVAIAQALRRILERPELMDLEPFTPRDLRRTARSYFPALGINQ
FT                   EVARKIMNHSLEGIDRVYDRHDYMDEMRDALDRFSAYIASIVEQQDLDEIDHKFKGDRL
FT                   ATELIRVNFS"
FT   gene            complement(67735..68472)
FT                   /locus_tag="YPA_MT0068"
FT   CDS_pept        complement(67735..68472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0068"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16204"
FT                   /db_xref="GOA:A0A0H2YCP9"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCP9"
FT                   /protein_id="ABG16204.1"
FT                   /translation="MKNTFDKARAAENTSREAIEYLERASGLSAVSTANFDGDMSFSSA
FT                   FMLFTRLSLLITRRRPEIAVHCVLIHVMPHISEVKVSDISRVLVNQLVNPLILEGKIVQ
FT                   GRRVFSLMKQFLSWCAFQGLIDTSPLNDMSLNKVAGGAKPVPRERKLTDAEVWVFWNIW
FT                   DYFNVCEGTKWAARLCLVAARRPDEVLRARKDEFNLQRDVWNQGTRNKSARQHALPLSP
FT                   LMRKCVEELFEYGKGQPVACSVK"
FT   gene            complement(69232..69744)
FT                   /locus_tag="YPA_MT0095"
FT   CDS_pept        complement(69232..69744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0095"
FT                   /product="F1 capsule antigen"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16231"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR015335"
FT                   /db_xref="InterPro:IPR038699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMN7"
FT                   /protein_id="ABG16231.1"
FT                   /translation="MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYK
FT                   EGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQ
FT                   FTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAV
FT                   TVTVSNQ"
FT   sig_peptide     complement(69679..69744)
FT                   /locus_tag="YPA_MT0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(69825..72326)
FT                   /locus_tag="YPA_MT0069"
FT   CDS_pept        complement(69825..72326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0069"
FT                   /product="F1 capsule anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16205"
FT                   /db_xref="GOA:A0A0E1NKY2"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKY2"
FT                   /protein_id="ABG16205.1"
FT                   /translation="MRYSKLFLCAGLTLATLPCWGRAYTFDSTMLDTNSGESIDVSLFN
FT                   QGLQLPGNYFVNVFVNGRKVDSGNIDFRLEKHNGKELLWPCLSSLQLTKYGIDIDKYPD
FT                   LIKSGTEQCVDLLAIPHSDVQFYFNQQKLSLIVPPQALLPRFDGIMPMQLWDDGIPALF
FT                   MNYNTNMQTRKFREGGKSLDSYYAQLQPGLNIGAWRFRSSTSWWKQQGWQRSYIYAERG
FT                   LNTIKSRLTLGETYSDSSIFDSIPIKGIKIASDESMVPYYQWNFAPVVRGIARTQARVE
FT                   VLRDGYTVSNELVPSGPFELANLPLGGGSGELKVIIHESDGTKQVFTVPYDTPAVALRK
FT                   GYFEYSMMGGEYRPANDLTQTSYVGALGMKYGLPRNLTLYGGLQGSQNYHAAALGIGAM
FT                   LGDFGAISTDVTQADSQKNKQKKESGQRWRVRYNKYLQSGTSLNIASEEYATEGFNKLA
FT                   DTLNTYCKPNTRNDCRFDYAKPKNKVQFNLSQSIPGSGTLNFSGYRKNYWRDSRSTTSF
FT                   SVGYNHFFRNGMSLTLNLSKTQNINKYGEKTSELLSNIWLSFPLSRWLGNNSINSNYQM
FT                   TSDSHGNTTHEVGVYGEAFDRQLYWDVRERFNEKGRKYTSNALNLNYRGTYGEISGNYS
FT                   YDQTQSQLGIGVNGNMVITQYGITAGQKTGDTIALVQAPDISGASVGYWPGMKTDFRGY
FT                   TNYGYLTPYRENKVEINPVTLPNDAEITNNIVSVIPTKGAVVLAKFNARIGGRLFLHLK
FT                   RSDNKPVPFGSIVTIEGQSSSSGIVGDNSGVYLTGLPKKSKILVKWGRDKNQSCSSNVV
FT                   LPEKTDISGAYRLSTTCILNN"
FT   sig_peptide     complement(72261..72326)
FT                   /locus_tag="YPA_MT0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.749 at
FT                   residue 22"
FT   gene            complement(72351..73127)
FT                   /locus_tag="YPA_MT0070"
FT   CDS_pept        complement(72351..73127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0070"
FT                   /product="F1 chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16206"
FT                   /db_xref="GOA:A0A0E1NKW4"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKW4"
FT                   /protein_id="ABG16206.1"
FT                   /translation="MILNRLSTLGIITFGMLSFAANSAQPDIKFASKEYGVTIGESRII
FT                   YPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPPLFRLDAKQQNSLRIA
FT                   QAGGVFPRDKESLKWLCVKGIPPKDEDIWVDDATNKQKFNPDKDVGVFVQFAINNCIKL
FT                   LVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKST
FT                   WAFDLPKGLAGARNVSWRIINDQGGLDRLYSKNVTL"
FT   sig_peptide     complement(73056..73127)
FT                   /locus_tag="YPA_MT0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 24"
FT   gene            73437..74360
FT                   /locus_tag="YPA_MT0096"
FT   CDS_pept        73437..74360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0096"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16232"
FT                   /db_xref="GOA:A0A0H2YCH2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCH2"
FT                   /protein_id="ABG16232.1"
FT                   /translation="MIWVIFMLKQMTVNSIIQYIEENLESKFINIDCLVLYSGFSRRYL
FT                   QISFKEYVGMPIGTYIRVRRASRAAALLRLTRLTIIEISAKLFYDSQQTFTREFKKIFG
FT                   YTPRQYRMIPFWSFKGLLGRREINCEYLQPRICYLKERNIIGQCFNFRDLVFYSGIDSK
FT                   CRLGKLYDSLKKNTAITVSNRIPFHDKTNDIIARTVVWDRNKHFSDSEIKVDKGLYAYF
FT                   FFNDTYDQYVHHMYNIYYNSLPIYNLNKRDGYDVEVIKRRNDNTIDCHYFLPIYCDDME
FT                   FYNEMQVYHNNIVKPEMSVTLGLPKS"
FT   gene            74709..75917
FT                   /locus_tag="YPA_MT0071"
FT   CDS_pept        74709..75917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0071"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16207"
FT                   /db_xref="GOA:A0A0E1NL56"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL56"
FT                   /protein_id="ABG16207.1"
FT                   /translation="MDEKKLKALAAELAKGLKNEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            76386..77408
FT                   /locus_tag="YPA_MT0072"
FT   CDS_pept        76386..77408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0072"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16208"
FT                   /db_xref="GOA:A0A0E1NMQ4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMQ4"
FT                   /protein_id="ABG16208.1"
FT                   /translation="MTITTVGIDLAKNVFAVHCVDQNGKTVLVKPKVSRAALPELIAGL
FT                   PPCVIGMEACSGAHYWARLFREYGHEPRLMAAKFVSPYHMAGKSGKNDAADAQAICEAV
FT                   RRPHMRFVPVKDESQQAMQCLHRTRQGFIEEKTATYNRLRGLISEFGVIAPQSTDALRR
FT                   MVSEQKNSLPFQVQQCIDDLLEHVDRIEANIADYDRILSRMAKTDHRSQRLMELKGVGP
FT                   TTACALVASIGNAHDFKNGRQLAAWLGLTPSQYSSGGKSKLGRITKAGDSYLRTLLVQG
FT                   ARSVLIGADKRTDSFSRWVCTLVERRGYWRAVVAIAAKNARLCWASLHYGDDFRLYSAS
FT                   "
FT   gene            complement(77607..77924)
FT                   /locus_tag="YPA_MT0073"
FT   CDS_pept        complement(77607..77924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16209"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCQ4"
FT                   /protein_id="ABG16209.1"
FT                   /translation="MADYLSSPQVMALIHYLLQAGESADSEAFVRELAQRVPQHGDALM
FT                   TIAQQLEQKGIEKGIEKGIQLGEQKGKLEVGVSLDIENYCTIRASPACQRRYSRFLSAL
FT                   Q"
FT   gene            77977..78177
FT                   /locus_tag="YPA_MT0097"
FT   CDS_pept        77977..78177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0097"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16233"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDG8"
FT                   /protein_id="ABG16233.1"
FT                   /translation="MLCRQRQAYRVTTKARQSAEVSPNLLNQNFNPLGINQVWVSDITY
FT                   RVPGVQGEHGRSNEPRVCLEY"
FT   gene            78784..79239
FT                   /locus_tag="YPA_MT0074"
FT   CDS_pept        78784..79239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16210"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YE88"
FT                   /protein_id="ABG16210.1"
FT                   /translation="MQRKLATWAATDPPRRVERLLRLITQPEWLAEAARITLASKGAHT
FT                   PGVDGVNKTTLQARLAAELQILRDELLSGCYQPLPARRVYIPKSNGKQRPLGIPTLRDR
FT                   IVQRAMLMAMEPIWESDFHTLSYGFRPERSVHHAISSPIVGKHEGAG"
FT   gene            complement(79484..81247)
FT                   /locus_tag="YPA_MT0075"
FT   CDS_pept        complement(79484..81247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0075"
FT                   /product="murine toxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16211"
FT                   /db_xref="GOA:A0A0E1NL46"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL46"
FT                   /protein_id="ABG16211.1"
FT                   /translation="MLQIDNVINNIGNYFHHLSNINYIRLLDTPHAWGAPFGKEIMQQS
FT                   YLRQEEFAGAMTEVLRNSRYRCDISSLNSPDAEWRKVIFKAIDESLSKKMGRTQPTQYR
FT                   FLFGQSPTVFMNGLSAATNGSPDFVAFKSELIQLIKERGQYWEKMPEIWLGRFFRIEEG
FT                   LATSFMRNVYPDFPPINDTRMTWNHTKIMASDGTEALVGGHNMNMDLFRNYPPVHDVSI
FT                   ITHGSSAYGSQLYLNELWSCNSDLLKKEYFDYESMMWAVGTKFYDKPEDPLKSSVAMNY
FT                   MKQRQEDLLNLHENFNQKVATRISEYENMEEYKKADRVLSVGKYWTGPNMEHDYQRGSE
FT                   IMKEQLIKNAKRIIRISQQDLVSAWKKKWKDHFTCNWIIEALLENKDLHIHVVVSALDA
FT                   AAGAAGDQYSFGSGAERTYELFKYYLTHDIDTDEVLDDPDGSRADALKRILIAPFFFTD
FT                   KVPDENTIEGETYKWPDLEQSAYTATLKQKPLSEKPPHQGIIGSALMSAIKGSGLFYPK
FT                   VPVAPGNHAKLMIIDDELYVVGSDNLYPGYLSEFDYLVEGKDAVNELMKSYWEPLWKYS
FT                   SPHAFPKLSPN"
FT   gene            complement(81325..81813)
FT                   /locus_tag="YPA_MT0076"
FT   CDS_pept        complement(81325..81813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16212"
FT                   /db_xref="GOA:A0A0E1NMT6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMT6"
FT                   /protein_id="ABG16212.1"
FT                   /translation="MRFKLSVIIFVLVSASALATPSFNVGFSPSHTALENVLSVVNNAQ
FT                   SSLDVEAYTFTSKQISTAIVSAQKRGVNVRVVADAKANRLNYSAIHYLAQQHVPVRLNN
FT                   NYSIHHNKVMIADGDTIQTGSMNYTTNGDTHNAENVLVIRGAPEIAGKYQVEFNRLWA"
FT   sig_peptide     complement(81754..81813)
FT                   /locus_tag="YPA_MT0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 20"
FT   gene            82553..82828
FT                   /locus_tag="YPA_MT0077"
FT   CDS_pept        82553..82828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKW9"
FT                   /protein_id="ABG16213.1"
FT                   /translation="MSRRGLRLSQLPPVRSEKPKPAKTSAQLMAEDTLRELIAARFAVG
FT                   KPVIHIHANWNDALLLRVLKEAIHQAKGPPFVVVPPHLNEHEKEND"
FT   gene            complement(82851..83792)
FT                   /locus_tag="YPA_MT0078"
FT   CDS_pept        complement(82851..83792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16214"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQI2"
FT                   /protein_id="ABG16214.1"
FT                   /translation="MKKKNSTPTPHDATFRQFLTQPEIARDFMELHLPAELRAICDLST
FT                   LKLESGSFVEDDLRQYFSDVLYSLDTVEGEGYVHVLIEHQSSPDKHMAFRLIRYAIAAM
FT                   QRHLEAGHAKLPLVIPVLFYVGKRSPYPYSTRWLDEFDDPELAHKLYSGAFPLVDVTVI
FT                   PDDDIMEHRSMAALTLLQKHIHQRDIATLTDRLATLLMADYLSSPQVMALIHYLLQAGE
FT                   SADSEAFVRELAQRVPQHGDALMTIAQQLEQKGIEKGRMEGRTEGIQLGEQRGIEKGKL
FT                   EVARSLLKMGMPIESVQEATGLSEDDLAQIRH"
FT   gene            complement(83858..84478)
FT                   /locus_tag="YPA_MT0079"
FT   CDS_pept        complement(83858..84478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0079"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16215"
FT                   /db_xref="GOA:A0A0E1NMU7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMU7"
FT                   /protein_id="ABG16215.1"
FT                   /translation="MLIFGYLRASTSEQDATRAKNALKNFARLHGHRIAGWYVDNISGA
FT                   TMTRPKLVQLLEEAEPGDIILIEQVDRLSRLDDVGWEALRKQITDKQLSIVSLDLPTSH
FT                   LALNNAVSDEFTRSMLKAVNGMMLDMLAAISRKDYEDRRRRQAEGISKAKAEGKYRGRV
FT                   ADAQKHELIRTLRLLHGKSLRETARLAGVSKMTVIRVCQQAEG"
FT   gene            complement(85004..85231)
FT                   /locus_tag="YPA_MT0080"
FT   CDS_pept        complement(85004..85231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16216"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKY0"
FT                   /protein_id="ABG16216.1"
FT                   /translation="MKIETISYVKKNAASLDLEEPILVTQNGVPAYVIESYDAQQERQN
FT                   AIALLKLLTLSEQDKADGNIFSKEQLLAGL"
FT   gene            85533..86738
FT                   /locus_tag="YPA_MT0081"
FT   CDS_pept        85533..86738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0081"
FT                   /product="partitioning protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16217"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQP8"
FT                   /protein_id="ABG16217.1"
FT                   /translation="MKRDYGSVGTIALRASALLQAMSRDIEEQRKEFNLTEYHQTYTRN
FT                   AVAKLPKLSRRIVELAVKEMEESGYEFNKKQVGNVEQYALTIQNVIDIYAHRQIPKYRD
FT                   IHKAPYVIFVVNLKGGVSKTVSTVTLAHALRVHQDLLRHDLRILVIDLDPQASSTMFLD
FT                   HTHSIGTVLETAAQAMLNDLDAETLREAVIRPTIIPGVDVIPASIDDGFVASQWESLVA
FT                   EHLPGLKPSEVLRKTIIDRIAGDYDFVFIDTGPHLDPFLLNGLAASDLLLTPTPPAQVD
FT                   FHSTLKYLTRLPEMLERLEEEGVEPRLSASIGFMSKMTSKRDHETSHSLAREVYASNIL
FT                   DSSLPRLDGFERCGESFDTIISANPVSYPGSAEALKKARTEAERFTKAVFDRIEYIRGA
FT                   SK"
FT   gene            86735..87706
FT                   /locus_tag="YPA_MT0082"
FT   CDS_pept        86735..87706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0082"
FT                   /product="partitioning protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16218"
FT                   /db_xref="GOA:A0A0E1NL23"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL23"
FT                   /protein_id="ABG16218.1"
FT                   /translation="MKQVIARGRVLGNSNSEFARMLEGDGDVKTFTLKSGVQARFVKTV
FT                   VLSGEVESKTFVDASVNGRDQTMLTRESVSDISRTIKLQQFFPAIGREVNGLIEILDGT
FT                   RRRAACIFNNVKFEILVTKDDISLADARQLAKDIQTAREHSLRELGKRLEVTYGTSMTK
FT                   EDIALKENLSPAKVTRAFQAAAVPDEMVAVFPVINDISLSDYQFLLKLAEEANNKQTSV
FT                   TELMEKVQHRLKTMPDYPAIDKSKILAVIRSESKLLTALPTRTVQTEKLREFSDRNQFA
FT                   RKKTDPKKRLVVYEFSRISAEAQSEIDKAIKRILERLPESGE"
FT   gene            complement(87843..87989)
FT                   /locus_tag="YPA_MT0098"
FT   CDS_pept        complement(87843..87989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16234"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEM2"
FT                   /protein_id="ABG16234.1"
FT                   /translation="MEQMRYMDIHVWEKCGLLEGVASEWHIKREMLSPAYTTRWSELPI
FT                   AKL"
FT   gene            88091..89482
FT                   /locus_tag="YPA_MT0083"
FT   CDS_pept        88091..89482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0083"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16219"
FT                   /db_xref="GOA:A0A0E1NQJ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQJ4"
FT                   /protein_id="ABG16219.1"
FT                   /translation="MAIAGCDLPTFATRLNEVLTLSVPVRTPEKLFGRDKQLETIQLAL
FT                   HSPGRHVFIYGDRGVGKTSLAHTAASLIQSSDNRPITVSCDHDSTLETVIESVISQGMM
FT                   RMPVDRYKTSATFGLNIPVLKAEARVEERETSRVRSVVNMASAVEALNYLTERYSDNTV
FT                   IVIDEFDLIRSEEQRARFGVLLKQLSDGDVPVRIIFTGIGQSVSDLIGGHLSSQRQIEQ
FT                   VDLERLHWTGRQRIVESAFRYFDINIPDDIADRICALSDGFPYYVHLMCSKLLHECYMA
FT                   DEVVSTVTRDLFLASLDAAVLSAEETLRSCYEAATCRDEHMHHILWAMAEGADLNRMKD
FT                   HIITSYIQVMKYLDIEPLTQKNFDSRFARLRKENHGSILCHALVGKDGVRPGWFRFREN
FT                   MIRGFVRMQAEKCGIVLDFDRQYSAHTASTRTAAVRGVYNPLSTVERSVARLRRDDEKE
FT                   AEENE"
FT   gene            complement(89644..89952)
FT                   /locus_tag="YPA_MT0099"
FT   CDS_pept        complement(89644..89952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCT2"
FT                   /protein_id="ABG16235.1"
FT                   /translation="MTARLTKRSSFNHTTQTSLFLVWYVDAECTQPERRKMDREMLAEW
FT                   LRDIARHIEEESPLIRDVSVDDALSEEGLARKIITITFNAPGRAPQPEEDVSSIPRH"
FT   gene            90345..91022
FT                   /locus_tag="YPA_MT0084"
FT   CDS_pept        90345..91022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0084"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16220"
FT                   /db_xref="GOA:A0A0E1NKZ0"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKZ0"
FT                   /protein_id="ABG16220.1"
FT                   /translation="MSRFIQGNCVHIMSGFPDNAVDFILTDPPYLVGFRDRQGRTIAGD
FT                   KTDEWLQPACHEMYRVLKKDALMVSFYGWNRVDRFMAAWKNAGFSVVGHLVFTKTYTSK
FT                   AAYVGYRHECAYILAKGRPPLPQNPLNDVIAWKYSGNRHHPTEKPVTSLQPLIESFTHP
FT                   GAIVLDPFAGSGSTCVAALQAGRRYIGIELLEQYHRAGQQRLAAVRRAMQYPAANDEFP
FT                   EAA"
FT   gene            91022..91243
FT                   /locus_tag="YPA_MT0085"
FT   CDS_pept        91022..91243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQK6"
FT                   /protein_id="ABG16221.1"
FT                   /translation="MNYAGHEKLRAEVAEVANSMCDLRATLNGMEHRYRFDSDVLVERL
FT                   TRQTLFRINALFMAAYNEMLELDACFKD"
FT   gene            91254..91673
FT                   /locus_tag="YPA_MT0086"
FT   CDS_pept        91254..91673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16222"
FT                   /db_xref="InterPro:IPR009811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKT6"
FT                   /protein_id="ABG16222.1"
FT                   /translation="MYGTCETLCRLLREQYPAETPLNLIVWSPADIEALADGMEYAVSE
FT                   QDTRAVLARMDAIPEEQQLESGVSAGAVMDLIEQVKEAVPAVMVPADLLETLLTTAEQA
FT                   LWHREWTARDSNHPVPESVTRRLADAAKVRALLKK"
FT   gene            91727..92506
FT                   /locus_tag="YPA_MT0087"
FT   CDS_pept        91727..92506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL13"
FT                   /protein_id="ABG16223.1"
FT                   /translation="MQETTTLNALVMRRARDLIADYGWPDHTDVDQRDPVNKPGWISIY
FT                   VRLDAANIVHLLPLLCSGDIPAELQNAMTKIAGTSAQIILSGSRYADAPQLPEDGTQIA
FT                   FPWAGEWLTEPEIQAVTDCLSRAVRDVSRQVWEDARRIKAALTTRGETLFYRQTRNFRL
FT                   VVKENDMPCWLDDDDNLPVVLDAILNKGARYSSVEFFVISDKVDQILACGQMCDVLRIP
FT                   GEPPRRWMDLTLLHEVMAEARAEISLVRNALSAIRPV"
FT   gene            92905..93411
FT                   /locus_tag="YPA_MT0088"
FT   CDS_pept        92905..93411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0088"
FT                   /product="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16224"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="InterPro:IPR041893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKP5"
FT                   /protein_id="ABG16224.1"
FT                   /translation="MRTTTTTPAVYVGTYHKYNCGSIFGKWFELTEFDGREDFYEACQA
FT                   LHADEWDAEFMFQDQEGIPSQFVSESAIDWDFIAAYKRAEEEGREAAFIAWAEYTGECD
FT                   YDAFDDAYRGEAESEEDYAQEMVDDNGLLNEVPEPLRSYFDFEAYARDLFSSGYVFHDG
FT                   YVFGN"
FT   gene            94124..94354
FT                   /locus_tag="YPA_MT0089"
FT   CDS_pept        94124..94354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16225"
FT                   /db_xref="InterPro:IPR009253"
FT                   /db_xref="InterPro:IPR038612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BZY8"
FT                   /protein_id="ABG16225.1"
FT                   /translation="MSEALAVLPDDTFTREQAEVVAAQYTNVAIEDDQGAHFRLVVRQN
FT                   GEMVWRTWNFEPGGTYWLNRYIADYGIRKPQ"
FT   gene            94427..96436
FT                   /locus_tag="YPA_MT0090"
FT   CDS_pept        94427..96436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_MT0090"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_MT0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16226"
FT                   /db_xref="GOA:A0A0E1NL41"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL41"
FT                   /protein_id="ABG16226.1"
FT                   /translation="MSVTDVKAKAPKKASSKKITKAQEEALKAALEAAVIEYVPLSSLA
FT                   KSPLNVRTIPYSVDSVRGLADSIEALGLLQNLIVHTLADGQSGVAAGGRRLTALNLLAQ
FT                   EDRLAADHTVMVKRVSDDIAALASVAENEQRAAMHPAEQIAGFRTLAEQGKTPAQIGDA
FT                   LGFGSRHVQRMLKLANLAPSLMEKLAQDELTVEQCQALCLEDDPARQVEVFENVKASWS
FT                   NAPAHLIKRAITETEMRTDNAKFRFIGRDAYEAAGGYVREDLFSQDEGDGTADSVLVER
FT                   LVQEKLERIAQDIQQREGWAWSRGRAARIWYHGEDGKEFVQPVEPDPVYTPEQQQRLDA
FT                   LREQYDTYDSVCDESDAIEADILAIQEAAEASAWTDDMKSGAGVMVSLYEGQVYVQRGV
FT                   RLKADMPEETVTSSVTVPFTSRQPDAAEGISVPLLTKMTSERTLAVQAALMQQPEKAVA
FT                   LMVWRMCTCVFSGCLTTTHPFRISLTVSHGSLTENAPSGKDGAAFEMLMTERARLKALL
FT                   PEGWEKDFTTFFALDGGVLMSLMAFCTACSVDGVQTRDMGHTSRSPLDTVEAAIGFHLR
FT                   DWWQPTKDNYFGSLKHPQIVASLKEAGLTGAAGDAEKMKKGDAAAHAEHFMQHTRWVPA
FT                   WLKGPEPAAESGADDAVSDTDSTDNDTTNTAHAA"
XX
SQ   Sequence 96471 BP; 22972 A; 24813 C; 23654 G; 25032 T; 0 other;
     attgtaacga acggtgcaat agtgatccac acccaacgcc tgaaatcaga tccagggggt        60
     aatctgctct cctgattcag gagagtttat ggtcactttt gagacagtta tggaaattaa       120
     aatcctgcac aagcagggaa tgagtagccg ggcgattgcc agagaactgg ggatctcccg       180
     caataccgtt aaacgttatt tgcaggcaaa atctgagccg ccaaaatata cgccgcgacc       240
     tgctgttgct tcactcctgg atgaataccg ggattatatt cgtcaacgca tcgccgatgc       300
     tcatccttac aaaatcccgg caacggtaat cgctcgcgag atcagagacc agggatatcg       360
     tggcggaatg accattctca gggcattcat tcgttctctc tcggttcctc aggagcagga       420
     gcctgccgtt cggttcgaaa ctgaacccgg acgacagatg caggttgact ggggcactat       480
     gcgtaatggt cgctcaccgc ttcacgtgtt cgttgctgtt ctcggataca gccgaatgct       540
     gtacatcgaa ttcactgaca atatgcgtta tgacacgctg gagacctgcc atcgtaatgc       600
     gttccgcttc tttggtggtg tgccgcgcga agtgttgtat gacaatatga aaactgtggt       660
     tctgcaacgt gacgcatatc agaccggtca gcaccggttc catccttcgc tgtggcagtt       720
     cggcaaggag atgggcttct ctccccgact gtgtcgcccc ttcagggcac agactaaagg       780
     taaggtggaa cggatggtgc agtacacccg taacagtttt tacatcccac taatgactcg       840
     cctgcgcccg atggggatca ctgtcgatgt tgaaacagcc aaccgccacg gtctgcgctg       900
     gctgcacgat gtcgctaacc aacgaaagca tgaaacaatc caggcccgtc cctgcgatcg       960
     ctggctcgaa gagcagcagt ccatgctggc actgcctccg gagaaaaaag agtatgacgt      1020
     gcatcttgat gaaaatctgg tgaacttcga caaacacccc ctgcatcatc cactctccat      1080
     ctacgactca ttctgcagag gagtggcgtg atgatggaac tgcaacatca acgactgatg      1140
     gcgctcgccg ggcagttgca actggaaagc cttataagcg cagcgcctgc gctgtcacaa      1200
     caggcagtag accaggaatg gagttatatg gacttcctgg agcatctgct tcatgaagaa      1260
     aaactggcac gtcatcaacg taaacaggcg atgtataccc gaatggcagc cttcccggcg      1320
     gtgaaaacgt tcgaagagta tgacttcaca ttcgccaccg gagcaccgca gaagcaactc      1380
     cagtcgttac gctcactcag cttcatagaa cgtaatgaaa atatcgtatt actggggcca      1440
     tcaggtgtgg ggaaaaccca tctggcaata gcgatgggct atgaagcagt ccgtgcaggt      1500
     atcaaagttc gcttcacaac agcagcagat ctgttacttc agttatctac ggcacaacgt      1560
     cagggccgtt ataaaacgac gcttcagcgt ggagtaatgg ccccccgcct gctcatcatt      1620
     gatgaaatag gctatctgcc gttcagtcag gaagaagcaa agctgttctt ccaggtcatc      1680
     gctaaacgtt acgaaaagag cgcaatgatc ctgacatcca atctgccgtt cgggcagtgg      1740
     gatcaaacgt tcgccggtga tgcagcactg acctcagcga tgctggaccg tatcttacac      1800
     cactcacatg tcgttcaaat caaaggagaa agctatcgac tcagacagaa acgaaaggcc      1860
     ggggttatag cagaagctaa tcctgagtaa aacggtggat caatattggg ccgttggtgg      1920
     agatataagt ggatcacttt tcatccgtcg ttgacaccct gatgaatagt caaatcggga      1980
     tggcatattt atatcacatt atataaataa ctacctacct actttattta atcaaatttg      2040
     ccgaatcttc ttcctcgttt cccaatatcg gccagtcaat atctggagcc aacgaagtat      2100
     caactcggtt aagcaagaca cggtactttt tcaacgcaac cagtgtttcc ttttcttcat      2160
     cagttgccat atccagatca atcgcatctt gaagcaagga aatttgttgg ctgacgttct      2220
     tcatcagcac cgatttattc tgctcggctt caccgacaag ggcagtcttc tctgcttctt      2280
     cgtctttaac ccaagcagaa ccatcccatt tctggtattc cccgtttgga gagatgtagg      2340
     ttacattttc gggcaacggg ccaagttcag cgatgaacac cggttcaccg gtttctgtgc      2400
     tgtaaagcgt tttgccacga tgatcttctt caaggctcca ctcttgcttt gtgaagtcaa      2460
     aaactgcggc aaacccttcc gtagtcgtcg gtggttcaat ctcagtgcag ttggccggta      2520
     acccagtaaa cggtgggata taggcatctc caactccgat atattcattt gtcccctcca      2580
     gcagattgta cactttgaga gttctcgctt tatcagtcat tttgaaagtc atttcgtcaa      2640
     ctcctttaac gatacagatt taaaagaatg cgcattagaa ttgtcccctg atgtctcgga      2700
     cgtgatgcac gccaaccaaa agcctcacaa actattggta aaaaccttgc ccgatatatt      2760
     cagcattcgc gctcccatcc acctgaccaa actgttcgta gcactgacaa tgcagtcaaa      2820
     ctcagcgctc gcttcgagcg acctgtaaat tatctcgaca ttttcgctat atccaaattc      2880
     acatgtacaa gcatcagcca tttctgcaac aggtgccgaa aaaactaata taatcatgcg      2940
     agtctcacta tgtagttata tgcaatgttt ttcacggtgt tctccgcatt accacaagcg      3000
     gcaatagtga tagtgtgtga gtgcgcccca attgccactg aatgcgagtg tgatccaata      3060
     ctcaatgagt gagcatgtgc gccaatacca acggtatggg catgagcacc ggcactgaca      3120
     gcagtaccgg agattgagtg ggcatgatca cctgcactac ttgtccagac attgaaagca      3180
     ttggctgtag tctgctgtgt gttgtattgc ttaccgacag cattctggtt cctcgaatct      3240
     gtagatcttg gatactgagt atgagcagtt accgtatgcg catgggcacc tgaactcgat      3300
     gtagagccag acagcgagtg tgcatgagca ccagtgctgt tagacgattt cgttccataa      3360
     tcgaagccac tggacgtttt tgtcccgtaa tcaaatgttg tggttggttt tgtaccaaga      3420
     tctgtactgg aagcggctgc attgtgcgca tgtgacttaa ttccatcttg ctccagtgac      3480
     aacactgcac gagaagttgg tttaccctta atcatccatc cacgcatgtc aggtaacaca      3540
     cctgatgggt atgcggccgc cagcttcgga tacacactct tgtcaaacgt ctgcccttgc      3600
     atgatggcga aaccagacgg ggccacatcg ttcggccacg gaataggggc acctactgga      3660
     tatgactcag gcggtggtag aacactactg tacaatatat aatttgcgcc gttcgtggaa      3720
     cttgcaggtt tggtcgccac atactctggt gtgccgaaca acactatgct tgcattattt      3780
     gtacaatcgc tcagagcaat aacatcaata gagtactgtc caacgtttac ataaatatcg      3840
     taaacatctc ctgatgtatt tatccacgcc accccttgag cacctgctgg tgagcgttgc      3900
     cataatgttg ctgtgatgcc aacaggattc cagttccctg atcgcaacac tatttcgctt      3960
     atcgctgcct ggtcataaag ccccgcgttg tatccagcac ctccaataag agtaattaaa      4020
     gcggttgaag ctccttgagg cattgttact gtcgctaact tataccaccc ggattcctta      4080
     acaaacgaaa ttctggcgga gctaactgca cctatatttt tcacaaataa tcttttgtca      4140
     ggaatatctg ccccattctg ggatttctga attgagccag ccgccaggtt aaccgtattc      4200
     aacaagccaa gataatcaat taccccttga ggtgaacgac cagaaagcgc agttagtgtt      4260
     ccatccaaag gctgctttct agccaacatg ttcgtaatag tcgtagcaaa gtttggatca      4320
     ttgcctaacg cagcagccag ctcatttaac gtatccagtg cttcaggcgc tgagccaaca      4380
     agttgtgcta cttttgaagc cacaaacgcg gctgtcgcga tctcacgtcc agcagcagta      4440
     attgccggag ttggagctgt tggtgcgcca gatagcgcgg ggctatctat aggagccttt      4500
     agagcaacgg catccatgac tgttttcaca gcttttggtg tagaggcaag agtttcactc      4560
     tcgctatcag ttgcactact caactgaaca accccctgct gtgaggttgt tgcatcgttt      4620
     accttgctgc cttcagctat ttcctgagct tcgtctctaa atcgcttggc gtcatcggca      4680
     aaaccttgag cacttgcgct agcactgttt gccttttccg cctctgattt aaccgccgac      4740
     aggagctgat cagatgtttt cgtggctgct tctcttgccg ctgtatcagc cgctgtttta      4800
     gcctcttcgc tatactgaat cgttgagtcc ctagcagcga aaacttcatc tttcattctc      4860
     gatacttcgg ctttattggt atcgacatca tgtctggagg catcagctga tgtggcatta      4920
     gctgatgcct ctgccgcagc cgctacagcg gtatcttttg aggttctggc ttcattttca      4980
     ctattggctg ccgctgcttc tgaagcagca gcagcctctt tagaggtctt ggctgactcc      5040
     gcgtattgca atgcttctga ggcgctattt gccgaagaag acgcacttaa tgccgcagca      5100
     gccttgcttt cagccgcatt ggtctctgac gcggcagaat tatcttcaga tgttttagcc      5160
     gcagaggcac ttgccttcga tgaagctgcg ctttctgccg cgccgtgctc cgatgctttt      5220
     gatgcagcgg cacttagctc tgccgcagtt ttatactcag atgctgaagc tgaactttga      5280
     gcggcttcat ctgcttttgc tcttgcttct gaagagcttt gcgccgcagc taatgcgcgc      5340
     tcagcggcct cacgagcctt ctcgcctgcc gcattaatag cgtctgcatt atccgtatac      5400
     catttctggt ttgcgttgtg ctcatcgacg atctgcgtca gcgacttcac ggtcacttcc      5460
     gtaccgtctt cacgctcaag cgttacctca tcaactgccg tcaaccagct gcgcatcgtc      5520
     ttcgagtcgg ctgacatacg ggtcataagc gcggtaaaac gtgcgctgaa ctgcgttaag      5580
     tcgccctcat aggttgtgat gatgcggcac ggaacttcct tctgggtctc ccctgtgtac      5640
     ggctctgcga gaatcagact tgtgtcgcta attacgcgct taatttcgta caacttgttg      5700
     tcagggccga tgacgatcat gcccggcaga acgccgttgg cggtcacatt ccagtacgtg      5760
     ccagtgccag aaagtgcgtc acttccctgt gtaaatgtga tagtaccttc cctgtaccac      5820
     atattcgctc cttgtaaagg cgggcatccc tgctcgccat aggtaatcac ttacttattt      5880
     ttaccgatat aaagaaagat gtctaccgcc gagcagagcc atccccccac ccgacctgat      5940
     aatttttgat tagctcagga tcacacatct ccagaatgtc ttttttcatc accctctgtc      6000
     gttcgtgggc gccgaacttg cggtcgaaca acgtctgggt cattctcatc cctaattcct      6060
     tcagttgctc ctgcgttacc ggaacatcgt tattatccgc atcggtccag aagaaattgt      6120
     cagggagacc gctttccgct gctttaagcg agatatccaa acgttctttg gaaatgtcat      6180
     tcgcgtccca gcggtggccg ttccattcga aataaacggt gcgacactcc tgacgaagac      6240
     gccagtcatt aattactgcc agtttctcaa ctttcaatct ttcgatgtac tcgccttgtt      6300
     cggggtacgg agcgatacca ccactggatt ccgactccag agcctccagt attttcttgg      6360
     ccaaaggtga tgtgtcactt tccgacaacg tgtatggcaa aaacaaaggg gttacaccat      6420
     cgtccataac aaggccatca aattgaatct cacaagagat accgccacta agactgcgca      6480
     ctgcgttcct tacagcagag atgacagggg tttcgtccat aatatccttc tccattttta      6540
     agccttaaac accagaatga gataaggttc attcacgcgg tgatcgtatt tacgctgtct      6600
     atgccaggta taaacatcaa cagtcgcaga ctgacctgcc ggcaaattgt aataaccaaa      6660
     caagccagat tgatttttag agccttctct cattccatat atctgctgct tcactccatt      6720
     taccgtatac tcggtaattc ttgaccatga gtaggtgtta atatcctccg atggcttgtt      6780
     atagtagtaa ccatttacca catagataat tctggcgaat gtttgaggtg caatataaat      6840
     actgctgcca ttaaccatgt aggctttaac aatatcgcca tcaatctggt tcgcgtgcag      6900
     tttccccaga atctggcagt tctgcgcgat ggtgacgtta ttcagcgtgc cggagtttgc      6960
     agcaatattt cccctgaacg taccgttgtt gaactcaggg ctaccatctt tggggataat      7020
     ccagcctcta ctgcctgcgg cgtaatcgtt cgactgaatg acattaccaa ttttggcgtt      7080
     cgtaattgtg ccgtctttga tataagcgcc gttcatatac gccacgctgt tttcgatgac      7140
     aaatggcgta gtgatcttcc cgtttacgga gttgaccagg ccaaaacggt ctgcctgcac      7200
     caaaaattgt gataaaccgg tactgtcgat acccagcgcg atacctgcaa cgtacttctg      7260
     cccgccgctg gtagatgttt ccatcttcag cgtccaggca gcagaaacct tcttatcggt      7320
     atcggcaatc gccttcgctt gctgctgaat gagagccgag ttgccatcaa cttcagcctt      7380
     aaccgtatca attctcttac cgagagcacc gtcagcgttt gcacgcgcgg tggcttcgga      7440
     tgtgatagca gcgttgatat ctttgccggt ctgagcctgg agattggtga tctgcccggc      7500
     cagagcagag tcggcatcgg tacgcgcttt cgtctctgtg tcgacagcgg ccttgatgtc      7560
     ctctgccgtc tgagccttca gcgagctgat ctgcgaagcc agagcaccat ctgcatcggt      7620
     tcgagcctgg gtctcttctg caacggcggc tttgatatcc tcaccattct gtgccttcag      7680
     ttgggtaatt tgcttcgata gcgcctcatc cgctgtggct cgggcaatct gctcttcagt      7740
     aagtgcagcg ctgatatcac cttcaacttt cgcctgcaac gtggtgatct gacgagaaag      7800
     cgtttcatcc gcagtcgcac gcgcctcttg ctcggaaacg attgccgctg aaatatcgtc      7860
     gttgagctgg gcttccagct tggagatatg cgtcgcaatt gtcttgtcag cctctacgcg      7920
     agccgttgtc tcttccagaa tcgacgcccg gatgtcctca ccaatttctg cgcggatttc      7980
     ttccactttt gaggccattg cagacatatc gtcggcaaac gtcttctgag tggttgcgat      8040
     cttcgcatta ttgaccatct gcttgtgctg gtcttcatcc tgacgcagag cgaggtcaat      8100
     attggttttg gccagagcct cgatattggt cgacgcttcc gcgctggcgc gttcgacttc      8160
     ggcaacggtc tttttcatct cttcgacggc ggcaacactg tcatcgacgg aggatttcat      8220
     tgcctcaatc tgtttggcat ttgccttatc accttcgaca cgggcttcac gctcttcagc      8280
     aatcagcgcg gaggcgttgt cgagcgcagc gtgcgccgct tccacagcgc cagctatggc      8340
     tttgccctgc tcggaaacgg tttcctgcaa ctcgaccaga gccgcattag agtcctcaac      8400
     ttgttgcagc gcgtcgttga ccttgtccag cgtgccagag acttcatttt tgaggtcgtt      8460
     ctgcacctgc tcaagccgac cgctggtgtc ttccagtttg ctgtccagat cggcaacgga      8520
     ctgatcaagc tctttcagac tctcttccat ctgtttgttg atggcgtcga ccgcatcctg      8580
     agaggcttta gcgtcgattt cctccagcag ctcctgcccc agctcggaag aggtgatctt      8640
     cccggtaagg aacgagagga cgtctcgcgt catcgcttcc gtacccagat tggagttcgg      8700
     cggacttaac atgccacgct tgttcaccgc gcgaacccaa tagtaccagg tctcactatc      8760
     tcccagaccg gcatgagtga acgtggtgct ggcggcctct gcaaccaact tcgccgtttc      8820
     cagatcgttg gtctgggagg catacacgtt gatgtgatca aggtcgattg agtccgggtt      8880
     gacccaattc agaatcacgt tgcggtagtc accaacggcc gtcagagagg taggagagcc      8940
     tggcggcgtc atcgtacctt tcacctgata aacggtgctg atgatgtccg ttttcttgcc      9000
     gctgaacgaa accgcataga gctgaatgtc gtattgacca ttctcagcaa tattgaggat      9060
     ctcgaactgc tcttcggtaa cgcgtgcgga ctgccagtta gaaacgttgt tttcatcgga      9120
     acgacgccag ctgatccaat attccgcaga cttaccctcc caggtggcta cgagcttgat      9180
     tgagaggtta cccggactgg agatatacgt cccttccgtc acctgcaggt tagtcggctt      9240
     cgaataagtc gggtcgagaa ctgtgttgtt ctcggggatc agcgtcgcac cgttgtcgat      9300
     ggcttcgtac ttcgatgcat tattctggac aaccgtaacg ttaaacgtcc cctgagcctc      9360
     gccctgggca acgttgataa cacgcacgcg cattggctcc agatctggct cggtaatcgt      9420
     ccagacgcca ttcatcaccg gcatatcacc ggaattgagc gctttggaga aggtcacttt      9480
     ggtaatgtct tccccggtct caagaatatc gcgctcaacg atttcgcctt cctgattcaa      9540
     gatccggatg tagctaccgg ctttattcag cgtaaccggt gcgtcgagag tgatgctgtt      9600
     ctttgtgaac gccacaatgc ggccagagtt gcgtttacca gcacggtatt tgttctgaat      9660
     cagcaccgtt tcacccggca taaggaagga agcatcaagc cctgccgtaa agctgataac      9720
     gtccgactcc atgcgtgcgg tatacagcag ccacagaccg acacgatgcg cctggccacg      9780
     gcttgtacag ccgaacgcaa ccacttcggt tttacgctcg ccataacgac gcatcgcctc      9840
     ctggtcttcg acgtactcga tgttctgctt gtagccgtct tccttgttgt tgtaggtcac      9900
     aagagctact gacggacggt ctttacgcgc agatcccttg tagctgaaca tgccgtcttt      9960
     gacgttcgcg ttggtgaaca tcatgaccgg atctgacgga ctatcctgca tgacgttaac     10020
     catgccacca gcccagaaga ccataccgcg gaaggcgcca gcgatatcct gaatcagtcg     10080
     gtacgcgtcc tgacggctag tgatctgggt gttgatagcg aagcgcttct ctttgccccc     10140
     gaatccattg tcaatttctt cgtcacagta gcgaccaatc tggtagatct gcccgaggtc     10200
     aatcatggac tcagaaacgt actgccccag gccataacga gcgttggtaa gcaggtcgaa     10260
     gagaatccag gcagggttgg aagatgacaa cagcttgaat gtgccatccc atacgccgat     10320
     ataggtgttt gtgtgttcat cgtagttgga cggtacgcgg atcttcaggc cacgcaccag     10380
     atacgaacga gacggcatcg agctgccgaa ctgctctgag ttgaccttga ggccaaccag     10440
     cgcggagttc ggatagttca tcggcgtatc gacgatctca ccgatagagt ccacccacgt     10500
     atcgttaaag atgtactgag tattgctgtc atcggtcaga cgcagcacgc gaaccttgta     10560
     ggcacgacct ggcttgggca gttttagctc atagctgcgg tagtagacgc ctgtcttttt     10620
     tgccgtcagc gcaatttcgg aagcactctc cccttctgcg atggcgtcct tgaaggcatt     10680
     atcgccattg gcaatctgga atttgtactt cacggtcgta ccgttggtat caccggtctt     10740
     tttgtcgatg ctacgcagag acgggaactt cagaatgacg cggacacggt ctgcctcatc     10800
     gttatcgatg gcaatcgtaa cgtcgtgcat tcttttcaac tggatgttga ctgacttcgg     10860
     cgtttcaacg aaatcgaacc cagccatcgg cgtctggtct tgtgaaccat cgcggaagtc     10920
     ccaggtgata ccgctaaagt ttgaagaccc gtcttcgtta aggattggca gatcatcaac     10980
     gaagatcgac tttgcaccat ccaccagccc gccaatgaca ccttccccga gcaggtcgag     11040
     gatggacgcc atagcacgcg agtttacggt atcgtcggct tcaaccggtg tgcggctgga     11100
     gccactgctt ttcttaccgc cagcacctgc aatcaggaga ggcagtctct tcttcttgaa     11160
     ctgttccatg ttcaaaaatt tcccttctta ctaaagctgg tcgatggtga tcgaagaact     11220
     tactacctgt gagccgacca gaatttcctc accataaatg agctgaaccg ggttgccctg     11280
     gttagtggtg ttttgtggtc cgtcgaaata aaacgagttc gagttatctg cctgccttac     11340
     actgtcattg gtcgcctggg gcgaaattaa ctgcgaaata ccccccatca ttagcgacaa     11400
     gccgagcggg gccagcgcgg gaaaccagaa tgaggcaacc atgacgagtg cccctacgac     11460
     tgtctgaaac caaccaaaag ccttaccgcc gctaccgcga ggaaccggcg tgatgcggat     11520
     cttcgcgatg ttgtcggact gccccatcat ttgaaactcg ctctcatcaa ccgaccactt     11580
     atgcccctgc ttattggtga tctggatgtg atacttgtcg taggtcttca tgttgcgctt     11640
     catccaggct tttaagcccg gacgattggc ttcgaccaga tccaacgcct gtttggtgtt     11700
     gcgcactttt aaatgccagt ggcggccgaa atgtctggcc atcgggccac caagttgcac     11760
     atgaactaac tcagacacgt ctcatctccc ttgagtaagt ctctgtgacg caggtggtgc     11820
     gtcgtgtgtt tctggtacat gccaccgtaa taagcgcgac agctcagacg gtcgatctgg     11880
     tggtgcagga tcattccgtc tccgatgtac accgcgcagt ggtcaggcat ctttccgtac     11940
     tgaatgaaga agacgtcacc acgctggggt tccgtccccg gcgccagacg aacaagccct     12000
     tcattgcggt agttctgatc gagaatgtcg gtatcgcccg tgtaccacga tggaatatgc     12060
     aggtgcgggt tcggattcag ctcgacgttg aactcacgct tcaggtagtc gcggcacagc     12120
     atccagcagt cgaagacacc gaacacatag ggtcgaccca gataaggcat ctcaaagccg     12180
     tctggggtga tcacattcat ctcactgaag tgaaatggcg catcgccctc gacgttcttc     12240
     cgaacagcca gaatcagcca cggaacttcc gttgcctcgc atccggcgcg gtcggcatct     12300
     gacgcatcag ctgattcgtc agtgtgggag tgccagatgg caaccacgtc tcccgcatct     12360
     tccgctgcga taatgtcgtc agcgtgcatc acaaacgtgt tttccgggtt ctccgacacg     12420
     ttccgggctt ccatgaagcg atatttctcg ccagtagtac gcaccagaaa gccacacgct     12480
     tcgttcgggt agcgtttgat ggctgtcaga tagatttcct gcataatgtc cgacccaagc     12540
     tcagggaaag ctctattacc cataacgtgt tgctccaatg aatccgccaa agtggattac     12600
     gccattggca aagtagttac ggcgtgcgtt gcatgagtcg tagcgtttcg tgcagtaatc     12660
     cgcgcctgac atggtggttt gctggttgtt tttgtcgaaa taggggccgg tatagccgca     12720
     ctctgggccg cggtatttcc acgggcaggt gtttttgatg atctggcggt acggcagttg     12780
     cacgcccatc agatcgaaca cgctcgacag ctcaaactcg acaacctcat gggtttcaag     12840
     agtcttctgc tcgacgaacc acatctcatc gggaaaatgc tgattcggat ctgcggtcgg     12900
     atttccgtct ttgaagttgg ccgcgtcgag aaaacgcgcc agcgtcatct tgcggatgat     12960
     gcgacaaccc accagatagt catttgcctg gacttcagcg gagacggttc cggcaaagtt     13020
     ggagacctgg atttttggac gcggcaaagt accctgacca gtcttatcaa agcctgacgc     13080
     cttgattggc cacggttcgt aggacacacc ttgccaaacg actggctcca tcagttcgtt     13140
     tgtaccggcg tggaaaaaca gcttgccccc agaggtggtg ttcgacatat caagttcgaa     13200
     cagctcaatg agcgcggagg gcgacaagct ctgaatatca gctttaatac ccatcgtttc     13260
     ttccttgaaa taaagaggcg ccaacatcct gtcagcgcct atagataata gtaaataagc     13320
     acctacttat ctagtgggtt aaattatcct tcataaattt gtcggaaggt cgcagtgaga     13380
     acgagatagc cctgataacg cttcacagta tggctgtcgc acaccacaac catctttttg     13440
     cctcgatggt tcgtccagta gaacgactca acggccgcgc gtgccgtcag aaagtcatcg     13500
     acggcattga tgacgtcata agaacgcgta aaagtaaggc tccactcttc tttaatgcga     13560
     ttaagccctt ttgcctgacg ctgttcgtaa tcgtcaccga aattcagcac cgtcacgtta     13620
     ggcttcacgg tcttttccga ctcgtagtcg ggataccagt taaaagtcag tctttccatc     13680
     tcacatcctt gtgagaccgc cccttccggg gcagccgtgg ttagttacgt tgagagttag     13740
     ggttgagcga accgcctggc cgcttctcct gagcgatggt ttcaagcgcg atcgccttca     13800
     tgcgctgcgc agcctgactc catgcgcctt cggaattgct gttctccgag acactgccgt     13860
     cgctgttgac gttgatttca atgctgacag gtgagaaaac gccgccgcct ttaacaccct     13920
     ctgcgttgag cgtgaccggg atggaacgcc catccggaag aggaacgtag gcttcgttca     13980
     tatccccttc gccaaataac gccagctgtg gagagtcagc gatgccacct ttctggtaag     14040
     cacgcagcgg aaccacgccg tctttcccga aaatgccgcc tttggcgaac ttcgggattg     14100
     ccggaatgcc gccagtacca tcagatgccg atccggtgag attgttgaat ccggagttag     14160
     agccggagga accagatccg atgttatcga agccaccacc agcccaggca gacaccagcc     14220
     cggaggcaat ggtagcgccg aaactcaacc acttattgcc agagccggac atgtttgcgc     14280
     ccagcatagc aaacgcggca gaaagcgccc ccgtgacaga gctaaggttc tgcatggaga     14340
     agatggacgt cttcaccgct ttggtttccg cgtctttggc ttcagtactg gtgaacagtc     14400
     catttaccca gttgccgatc gcgttggttg cagaaccaat cgcgctggtc gtctgctgag     14460
     tggtctgccc cagaccggag accgagctgg aggtctcttt cgtcgcctca cccacgctct     14520
     tatcgccgtt gaccgcattc atccggacgc cctggttggc aaccgcagac gcgacaccag     14580
     aaagcagatt gccactctga gagctgcccg ctgccgtcgt ccccatcccc agcatgttca     14640
     tgagaggtag agtgatctgc gtcttcacaa ccatgttggt gatgtcgcgg agaatggact     14700
     ctgccaggct ggagaagtcc agtttcccct tcatgacgaa gtcggtcagc gtatccgtca     14760
     tgttgctgaa caggttgctc cagctgtttt ccagctgttc ggccagattc tcgtactcaa     14820
     gcgccagctt ctgtgtcgcc gtacccgtct ctttgatgag cgcggtgttg cctgccgcca     14880
     ccagctggtt aatctgcttg gtgtagagcg ccacgatttt cggatcagaa gcctggtcac     14940
     gcaaatccat caacgctttc agattacggt tgtaggtgtc gttgaaatcg gccaccttct     15000
     cttcacgaga cggcttgtaa cccgcgctga tgatggaatc ggattccggc gcccaggtgg     15060
     agatcatctg ctcgacgttg cggcggttga acatctcgcg atagtcgtcg ctcgcgttcg     15120
     ccaggtcagc gaggcgtgac ttggctttgt cgatcatctc ctgagtgatg aactcattcg     15180
     gtacggcgtt ggccagttcg gtcagcgatt tggtggtatc gcggagagac tggtcaaacg     15240
     acacggtcgc ttttcagctt tcccccatct gccccataag ctgatcggct ttatccaggg     15300
     ctttctggta gccggccgcc agcttacgct gcgcattttc ttccttcctc gcggcacgct     15360
     gagaagcatt ggcagtacgc tgcccggctt tttccgctgc tgctgcgtcc tgctcacgcg     15420
     ctttggtcag tgcggcgatc gcggcagcac gttcctcgtc gctcattttc tccagagagc     15480
     tggcgctgga ggctttctgc aggttcagct gggttttgag ctgtttcggc ccgatgatcg     15540
     gcttgccttc gaagtccagc atcgccgtac cgtctggcag tgtgcgctgg taggtcgcgg     15600
     agtccatctg gttccgcata tactgcgcca gtgctttctg agccgcctta tcggtcgtcc     15660
     ccaaccccag aacggtgccc tggttggaca ttacgccctt accggttttc gccgcgctat     15720
     cacgctcgaa ctccgcctga gtcagctcct gagctacagc ttcaagatgc tcctgatacc     15780
     cgcggatgct gccctgcagc ttctgaacct gctcggtgtt cccctctttc ttcgctttct     15840
     ccagcatgtc gctgaagtgg gcaatttgct tctcggtggc gtttttacga gaagacaggt     15900
     cgtagaccag cttctgtgcc ggttccagat aggacttgtt caccttctcg cgaagcggtg     15960
     caagcagctt gttcttctcg tcgtccgaaa gcgatttgtc gtcgttgatt ttctggatct     16020
     tatccagagc ctcctgacgg gctttcacaa acgtcgcaga gaagacctgg ttatctgccc     16080
     ggattttctc aatctgggat tcggcagctt cttttgccag gcgtttggcc actgcgccat     16140
     cacccagcgc catcgtgccg gttgttcttt cgtactcttc ctgatttttc ttcaggcgag     16200
     cctcaacaac ctctttggac tccttcacgg cgacagggcc agccgctgtg gagtagtagt     16260
     tcacgctttc gccagtttta agcgcctgct ggtctcgctg gatctgcttt tcaagctcgg     16320
     ctgcacgcgc tgccatctgc gcacgcttgg ccgccgtcat cgcctccggg attttgcgga     16380
     tctcgtccac gactttggac gtttcgctgc ggagcatggt catatacgtg ataagaccgg     16440
     ccacagccac ggtagctacg gtgaacgctg caccaattgg gtttgctgca atgaacgcag     16500
     ttagcccagc aaacgcgccc tgaagccccg taatcgcgcc acggatagcg aagatcagcg     16560
     atgggattgg ggccagcccc atacgagccg cacgattaaa gcgggtgaca gctgtcgcgc     16620
     ccagattgaa cggagcctgg agaacggtcg acatcttggt aaatgtgtta accatttgcc     16680
     cggcagtgcc aatcacgcct gcaatcccgg cacgcatcag cttgaacgcc accattgcgg     16740
     caacgacttt gcccaggctg ataaccagct cctggttttt agccagccac tgcgccagct     16800
     cgcgtaagcc gtcgatcgcc gtggagagtc cggaacccag cgagttagcg aacgaaatgc     16860
     cttcagcgct gttcatgatg gaagcaagct ctttcatccc ctttgtgaga gaatccagat     16920
     agcccgcctg accgacacga tcggcaaaca gcgtaaagga ggtttgcagt tgcgccagcg     16980
     caccggtgta ggtttgcatc atgtctttgg cggcgttttc gttctccgca cgcagaccaa     17040
     cgaacatcag cgatagcgcc tgtttcgctt ccacagtacc ggtggagact gctttggtca     17100
     gttcccccat agtgataccg gcagcgtctg ccatcgcctt catcgcgtta ggaacggctt     17160
     cacctaattg ctgacgcagt tcttccatcg acacgacgcc cttaccggac atctgctgga     17220
     cagccacggc agcacgttta agcagttcgc tatcgccgcc gaagcgtgca acggagtcca     17280
     ccagtgcttt cagcgatccg tcagtaggat cgagacctgc cgagcgaaat ttaacgaagg     17340
     aatcggtcag cgcctgcatc gcaaacgggg cgttttgcgc catatccacg atgtactgca     17400
     tatcctctgc ggcggctttt ccagggttgg ccttatcctt gttcagcccg cgcaacatga     17460
     cacgcatacg ctccatttcg gaggcggctt cgatgattgg cttctgccag ccgaacagga     17520
     tgtcagttac cgttcttgcc gcatcaccaa tctcgccaag caagaaaatg ttgccgcgca     17580
     gaccagagaa cacaccactt tcagcactac gcccgccgtg gccataggaa ccgctgtgtc     17640
     gacctccacc gccattacca ccgccatcac cgtagctact ggtgcgtaca cgtaccggct     17700
     tgctgatcag ttgctggcgg ccaatcaccg catccatctg atcgcggact ttcttcagcc     17760
     cctcagcagc ctggctcgtt gtgacacccc aattactgag acgctttgtc gtggtgttaa     17820
     gacgcgtatt catgccgctc acggatgcag aggcttcttt tacctccgta ccgaagcggc     17880
     tggcgctctt gccagcgaac gttgcccaat cggaaaactc attgagttca gactgaacct     17940
     tgcgcagcga tgtggtgagc ttattaacgg atgaggtggt tgtgtcgacg cgctcaatca     18000
     gggttttgag acctgagttg aggctggtaa tgctgcctcg cgtcttgcgc gaaacatcag     18060
     acacaagctc gaagccggca gctacatcct gtagtttttc tgccgtgaca tcgagcttgg     18120
     actccagaac gccgatgatg cgggagaccg aacccaacga gcgttccaga ttgttaattt     18180
     tctgagctgg ctttgtggcc tgctccccga atctggtaag tagcttaccc gcccggtcga     18240
     ttgacgctgt aaactgcttg tcttccagcg acaggataaa ctctacgttt tgtgacattc     18300
     ccttgtcatc ctctgccaaa aatttgcatc agttgctctt tggcgtcagg gtctgcctta     18360
     tccttgcgtg gatcgtagac tttatcggtt acgactggtc ttccaatcct gagttgcaaa     18420
     ccctccatga acgcctttac gccctcgcca tctgcctggg cagcgcgagc gacttgcagg     18480
     ttgcggacat cctcttccgc acgcagacgg tcgatgttgc gactgagcat ccagaacatc     18540
     gttagaggga cgcccagcag ctctaatggc gacacggcgt agtgagcaac tacacgactg     18600
     aaatagaatc cgagatctat cgatacggtc tttaccccgg attcatcgcg ggaaattact     18660
     ttgccccttc accagccgct ttttcgttct cttcatcaat cacttccata gcgaaggtga     18720
     agatctgctg gagctgcgga acagtcagtt tttccagtac agcgtccggc acggatggga     18780
     tgaccttgcg aaccaggtcg gcgtaagcag taacctgctc aacaggcgac atattctgga     18840
     ggtctttgcc ttccatctgc ttgatagaga cgaacaggcc aacagtcatt tcaacgatgg     18900
     gatattcctg accgccgaac ttgatgcttt tcttcggagg cagaatggag tcgagatcga     18960
     gtaatttggt cattggttaa agtcctttta aaagagaggc tcttcctgag cctctgctta     19020
     attacgtcgc gattattggg cagaattaac cgttactgct ttggtcgctt tcttgccgcc     19080
     gctattgctg gtaaaggaga tatttgccga accttcagct actccgcgaa ccagaccagt     19140
     ctggtcaacg gttgctttct cctgattgtc ggattcccac acaccggttt tgtcgccggc     19200
     atctgcaggg gtgatctggg cagtcagttg cacggtctca ccggctttaa cttccggaga     19260
     ttccggagag atagagacgg ttttaaccgg ctttgggccg ctcattttcc ccagcacgcc     19320
     gtcgtcatcc gggtaagcgg tgaactgaac ggagaacacg cgaacatcat cagactggta     19380
     ggtcatggtg aagttacctg cggttgcagc tttcgggatg gtcaggacat agtcggtggt     19440
     atcttgcggg gtcagaacca gctctttggc tacgtcgatc aggttgacgc cctgtgcgga     19500
     agtgatggtc acagagttct cttcttcgct cagggtagaa cccggcatca gatcgaccat     19560
     attctgcaac acagactcgg ccagcggcgc agtgatagtg atgttacgac cctgtaccag     19620
     ctcggagatg gtggtctgcc ccagctggtc tacggtgact ttcagagttt cggtcgcaac     19680
     ttcaacctga acaccgcctt tggtgtaacc cagatcaacg ccaccaaacg acactttgca     19740
     ggcgccaagt ttgatgtttt ttacatgggt attggacatt tttggaaaac tcctttttcc     19800
     gttaaatcag caccttcatg gtgttaatga taagtatata cttacctatt ttattaattc     19860
     aacaaatagc ccgcaaattc aatcgggata cccgcttcaa tcaacgaacc ttcatttttg     19920
     ggataagtaa tcggcatcga cattggtcga accaaccgga agtaaacgcc atctgacacg     19980
     gtttcttcga ccgggaacat gtccatgatc ttattggctt tcgccaccgt ctttgtaatc     20040
     gtcgcattac gcacgatgac ggtgaaagag tcgtgataga agccttttaa ctcatggtca     20100
     atggtgatcc ccgtattggg agtaaccaac agaacaccgg acttcacatt ggctggcatg     20160
     tagtgacaga aaatgtcagt gccgactgta ccgatcttcg ccttctgcat caggctcgca     20220
     aatgcttcaa taaacacatc aacctctcgt aaaacctgct ttccttgccg cttctgctat     20280
     cgtctgagtg aactgtttct cactgatctg cacggctctc tcaaggaaca aaggcccaac     20340
     tcgtggcttc actccagcaa ctggcgggtt ggtgacgctc ttcatgcggg atagatagcc     20400
     gagacgatac ttgcccaact ccatgtactc cgcataatcg ccaacctcaa cgcccggatg     20460
     accttcgcgt ggtttggctc cagataccga taactcaata cgcagcccgg tatagccttc     20520
     tttgacaact ctcgcgaaga tcgcgctttc gagtgagcca gtctccagcg gggccattgc     20580
     ccgcgccaga cgctcaacca gacgcgccag cttctccatg tcacggatga gataacgctt     20640
     aaaggctttc tggctgttat tgagcctgtc gccagcacgc ttaaaatgat gcgcgtcgta     20700
     cttcagaccc atatgtttgc ccctacttcc agatgcccag ggcgcccacg cagtccccag     20760
     cgacgatgca cgctggatac cttcagcttt tgcccctcca gaatgagaac gtcatcaagc     20820
     tgtactgcgg cctcaagtgg gatcaccaga acagcatcga acaattccag attcgcttta     20880
     ccgcgactgc cggagctgtc agcacgtacc gatgacttct cgttactttg ctcaaactta     20940
     acgacgccga cgttcgtctt tctgacgaac tgcaattgcg cttcaccgta gacgttcttc     21000
     gaacccagac ggtaaatcgc tatctctgct tgccatgaaa tgttcatgca ctctccctgt     21060
     ggttggcagc cgcactcatt accaggcgaa ggcgcgattg ctcgtcttga gcctttcgac     21120
     cagaagtaaa taatgcgact ggcgttacgc acggcgaaca atcatgcggt tattgatgta     21180
     actgaccagc agtcgccagg tactgcgagc cacctgcacg tttgccgctt tgccggtacg     21240
     gtacatattg gtcgtttcgc caatggactc agacagaatg ccgtcctcgc gggctgccgc     21300
     tacgtcatta ccgttagcga tttcgcaggc ttcattaacc acggccagca ttaatgcctg     21360
     tttgaagtag tccgggaact cgtcgaattt ctccggcgtc atctgctccc aatcgatcag     21420
     atcgtgacga tatgccccgt cagcgcccca cggaatgtca tagacgttca gcatgttttg     21480
     cgggcgatcg taccggtcga agtcgatacg caggactttg cggattgaga acggcagcgt     21540
     tttgacgcgt ctggtggcct caatgagacg tttgcgcatc agcccttcgc catcagctaa     21600
     cagggtgtcg ccgttcagca tatcgatagc ttgcatctgg gcgtctgcga ccgttgcgaa     21660
     tgactggcct ggaattgaca gctcgaagct attcagcaaa acgtacatct tgcgctcttc     21720
     atgcgtcagc ccggatgcca ccgctttgac aatgacgtgt cgcagatcgc gctctttatc     21780
     tgaaagcagg ttgtgttcgg ccgacacgac aaccggaatg gacatctgcc cctcagtaat     21840
     atcgagaggt tcgttatcga cgatgatcgc gccagcgcca tctctgacgg tatacgtggc     21900
     cgactcaata tccagaacgt taaatgcaaa cgacagggaa acagcttccc cgctacggta     21960
     cgtgtcgatc tgcgccatta ctcaccgccc tgtgctttca ggatgccttc gatcatttca     22020
     acgatgcctt tggctttcac gccaatctgg ttgccgatct gacgcagacc cgcaatacct     22080
     tcacagtccg caatcgactc cagttcttca cgagtaaagc gctgtaccgg tttggcttcc     22140
     acttcagctg taccacgttt cattggcaca atatccgggg ccgccgtctc gacaatgtcg     22200
     tccgcagtca aatcattgcg gctgctgtac gcggcagaag gagatacatt tttgccttca     22260
     acggtagtgg cacgcatgga ggcacaaatc cgctgctgat cgatgaatcg cagttcggca     22320
     accgagatgc cgtcgacaaa ctggataccg cagagaatgc ccgtgtaccc caaaaattga     22380
     ggctccaata aacgaatttt tgctggtttc attcttcttc tcacttaatg ggcggctatg     22440
     ccgcccatgt attggttacg cagccggtgc tgcagtcact tccacagtcg cagtagcttt     22500
     gtggctgcca tcctgcgaaa ccacttcaat agttgccgta ccaacggcta cgccagctac     22560
     gttaccgttc tggtcaacag tcgctttgtc gctatttttg gaagtccagg tgactttttt     22620
     attggttgca tttgacggtt gtacatcaac acgcaacttg accgatttcc ccttctcaac     22680
     ggaggtagag tcaggcgtta cggttacgga ctccacgctg acaggcttaa cgatcacttc     22740
     gactgaggca gaaagctgag tctgcttatc ggtggcggtg atcttcactt tgcccggagt     22800
     cacgccagta accagacccg taccgctgac tgtggcgacc cggtcattgt ctgacgtcca     22860
     ggtgaatgaa tctgcacttt tgctcatggt gatacctgca ctaagttgaa cggttttgcc     22920
     caccaatacg gacggcgcag tcggtgtaat ggtgacagac tgagtgaacg gaattgcccg     22980
     gaagcaagcc gcaagatgat tctgctggcg ctcgctcaga ggctcgttgg agatggaatt     23040
     ggtgaatccg gcacggcaca tatgccccgt gaaatccgaa aacgcctctt ccgtgatctt     23100
     catcttttgt tctggcattt ctcgctccta caaaaagggt gggcgtatag cccaccctta     23160
     aatggtagat aattacttac ctacgatact gatcaaattt ttacgttggt cagcgcggcg     23220
     atagccttat cgtgcttgtt cgccagagag cagtaccact taacgcgggt acgggttgcg     23280
     tctttgttct gaacagtacc gatgttctca acaacgatac cggcgttttc gccgccatac     23340
     agaccggtca caccgttctc ttcggacagg tgcaggcagt agatgcttgc tttgccagca     23400
     tcagtcggga tgaagtcgtt cacgatgaac ggtacaccgt tgtggcacag catcgggcgg     23460
     ccgaagtttt ccatcatgat ttctgacggg ccgaggctaa cggtacgcag cagagcgcga     23520
     taagcacgca ggtgctcgga acgcatcatg atgcagtctg cgcccagatc tttcaccgcg     23580
     tcgaccagct cgtcgaacat ggagaaggtc atggaagcgc cttcgatgtc gatcttctga     23640
     tcgtcgtgca tcagcttcgg aataccgtcg aaagctttgg tgttggtggt ggagtcgccc     23700
     agaatcaggt tgcggcggaa tgcgcgggcc agacctttca ccttctgacg aacctggatt     23760
     gccagctggt tgttggtgtc ggacatagtg gtcgccagga atttgtcgac gtctacgtcg     23820
     cctgccagga tacgcagctt cgcaacgtgt tcggtgaagg ttgcagcgcc ttcggtgatg     23880
     gtgtcgttca catcaatgaa ggttgcttcg ctcagggtag cttcgcggtt gtagaggtat     23940
     gccttagagt taatcttcat gaaaggcaga acagcgaaca ggtcatcgcg atcgatgatg     24000
     gtctcgatca caccctgctc aagttcgttg ttagatagct tttcagcttc atcacgcagt     24060
     aatggcatct ttcatttccc tatgatttaa gatgttactt gagtccgatt ttccccagac     24120
     cggaggtcaa cttatccata gtcgacttgc tcttcggctg gtttactttg tgggtcggtt     24180
     tgctattgga accagcaccc tgcttggctt cgctgcgcaa cagtgcgtca gcttccggat     24240
     ctgcacgcag aatgcgttca atcgcggatt cgaacggtaa cggtttgcct tcaccgtcaa     24300
     ccagaactgc acgctctttc tgaccggctg gcttatcaaa gcccacaaca ctaccgtctt     24360
     cacccacttc gaaatgagag ccgtagataa cgcgagcctt agccggagtc atcagaactt     24420
     tgtcacgcag gaaggcagag ccgctgaagg aagcgccaac agtcatttcg accagttgag     24480
     cctggtgcgc ttcgatcatc tgctttttca cagcatcgaa ctcaccacgg cgttccagtt     24540
     cagcctgctc cgcctcccgg cgtgcggttt ctgcggcttg ttcagcttcg agaagctggc     24600
     gagcacgcgc cgggtcaata tcaccgtact gagccagctg atcggccaat gtgcgctctt     24660
     tctccttgcg cttcatgttc tctttcagca ggtcagcacc agctttcttg gacttacgca     24720
     gttctgccag caactcttcc tgagtcatac cggcatactc gtcgtcgtca cccttcggtt     24780
     gctctttttg ctcgccctgt ttacctgggt cttgattgcc ctgctcgttg tctccagcag     24840
     gagcaccgcc accagcgcct ccgcgctcat gcgcttcagc tgcatccatc aggccacgac     24900
     gggccataag catttgccac agattcatag aaattccttt tcgttactta tcactcggtc     24960
     tcttgagtag atgagtcccc attccctcgg ggttgatctt gcccgctttc ttgggatata     25020
     tctcgatcat aagtaagtac tgacttattt tcaagggtgt taagatcatt ttttggagga     25080
     aatttcaaga gatctttttg aaattccttt tgcatcgcct cagaaatgtt cgggaagacc     25140
     ttctcgatga gcatttccat ctgatgacga cgaacagaat caggcgcctg gagcagcgac     25200
     agtttctcag caacggcaaa ctcgtcagtc agaccgcgaa tgtcaaaact ttccgggtac     25260
     gcgatcagag agtggtcttc atccagttcg acacccatcc atttcgctgc cagttgcatc     25320
     atctggcgct ctgccctttc gaggcgttct gcttttgtca ccagcagact gttaacgcgc     25380
     tggaagtcgt acatcttcgc tgcgcccgaa gagttatcga tgccctgtgc gttatcctgc     25440
     ttggttcgct cacctgccac accaacggag tggtagatct cgttaatcac cgtcttaatc     25500
     gtggtgatga tcatctgggc ctgtttcggg tctggagaca gatagaatgg ctgattaccg     25560
     ctctcagagt cgaaggtgaa gacgcgtttt gtccccattt cgagcacttt ggtgtggttt     25620
     tcatcgcccg gcagcaatga ctgaaccggg atcgccaact ggctgaatgt ctgatcctga     25680
     ataatcgcat caaggttcga caggtagttg gccacggcgc ggtcaagata ggcgatatca     25740
     tcaatcaacg acgggctgaa atacggagac tcgctttcac caatgcaatc caccgggaac     25800
     accggcacca cgcccagatt atgctcgccg ctatcctcca gaacgacttt ggcctgacga     25860
     cgaccgctat ttccggaacc tttcttcact tcttcacgga acagatacca ctcgttttgc     25920
     gtccacagac ggtaacgctg gtattcctgc ccggttgacg tgaacggatc ttcgtcgtcg     25980
     cgcgcgattt caacaatcag cgcccacaac atattgccgt cttcgtccca ggcaacatca     26040
     agcagctgct gcggcgaaat ccagtaagcg taggcgcgcg catcattttt cttctcgtct     26100
     gcaacagact caacatcgac gttcatggtg ctgtccacaa caacccagat gcgaccatag     26160
     atggatgatt gcagatcgat agccgccata aacgcatcga tggaggcgtt ctggcgcgtg     26220
     gctcgcttcc agaaattgcg gatctgctcc ggtgcttcat ccgtgttgcg atgaatgacc     26280
     tctttgaaga ggtatttgtt gatgaggttt accacttcac gagtgtggtt gaagcgatag     26340
     gcacgttcca gacgctcttt gaactcctga tcgccctctt tgaagtaacg aaagatattg     26400
     tcgttgaacc aggcacgccc gccagcgtag gtgctggcga ggaaatccca atgttctttt     26460
     ttcttctcat attccgggtg gcgtcgtgcc acaaggtcct tgatttgctt atcagtcaat     26520
     tccatttgtt tcctttccat atttaggtag gcacttactt atctagatcc accaagaata     26580
     acacgatttt tcaccggata cctacgatga accggataac ccaacgcatc cgcactgtgt     26640
     tcgatgccgc cagtcttatc catatcgcgt gagcctggct tgtagatcac cttctccagc     26700
     gagtcgatga gatgtttgca cttcggatcg atgtacaacc gggtttcgcc cgaggcactc     26760
     atcaacatcc ggttcacggc gttcacacgg tctgcgatag gcgggtgctt cttcggataa     26820
     tcgactcgga ggaaaccttt ttccttgaat atatcgacgt cagattcgcc gcgtgcgtgc     26880
     tggcgatacg caccagccgg gtcagggaag atagtgacct gagacttcca gcgccagaaa     26940
     cggcgctcca gctcatcaca cacttcagcc gtgttggaag agaacagcac aacctcgtcc     27000
     acggcccaca actcaccatt tggctgcggc tgcaggatga ccgatgacat agggtcgatg     27060
     ttgaagtcct gaccaaccca gatcggcagt ttcggattga actggagtgg cttcacatgc     27120
     acattgcggt cgaacgggta gtaaacgcgt ccggacatgt tttcgaagct ggccaggtat     27180
     tcctgtgcga acgatttagg gtccatatcg ttcttcgccg cttcgatttc cgcgctcggt     27240
     acgaacggag aatcggccgt aacgaactgc cagctcttcc actgcccttt gcgttgcaaa     27300
     tctttgttct gaccgatagt ccacagcttg tggaactcgg agaagccttt tggcgtaccg     27360
     atgatcagcg caccgccacg ggttgaggac agtgtcggac gaagtacctt gtaccaggta     27420
     tccggcttca tatcctgaaa ttcatcgagc accacaaagt gcagtgccac accacgaagc     27480
     gtatcgggct tatccgcacc tttcagcgcg atttcagagc cgttcttcag cacgatggtc     27540
     atcgtggtgt cgtttttctt acgaacccat ttacgcggca gaacttcctg caggtcatcc     27600
     cacaagatct ggcgagccat ctggtacgtc ggtgcgacgt accagacacg ttgcttcttc     27660
     tctttggctg ccgcgcgaat gatggtggaa atcgacaacc gggatttacc ccagcgtcga     27720
     cccgcacaca ctactttgaa acgatgtggc gactggaaga cttgcatctg cccagaatgc     27780
     agctgtacga gactcagaga cgacgggatg gccatagtta gacgctccca tcactttcat     27840
     caccagacgc gtcagaatcg ccctcagctt cgctcagtgc ttcctcttcg agtgactcaa     27900
     gcagatcgtc atcaatcaga tccggctcat catcttcctt acgcagctgc gccacctggg     27960
     aaggcgtaag ttcgccaaat accagattcg ggatttcgtc gtcctcgttt tcggcgcgat     28020
     ccataccgag cgctttcgac gatacttcga agcacttagc gagtgtgccg ctggcacgct     28080
     ggagactctt caggtcatct tcgatggttg cgagtggctt gccgtccttc ttggctgtgg     28140
     ccacctcatg catcaccatc cgaccgagtg cgaacgccca atcgtcgtaa cgagtccggc     28200
     gctcttcgat tttctctgca cgcgccttcg cacgcagctc tgcgtcggat ttgagcgact     28260
     cgcgcaccat cttccccacg gagtccgcgc ctttctctaa tccacgcttt ttgaaatgtc     28320
     tggagagcgt ttcacgacga atgccgtact cttcctccag cttggagagt gtgtattcac     28380
     cggaagtcca cttcgcttcg gcttctgccc actcagctgg cgtcaggcga gttttgctct     28440
     cgtctttttc tacagtcata gatccctcta aaacactcag agcgcatcct tgcgctccta     28500
     aacaacttgt ttaattctat gcctaaccaa tttgttttct gggtgtttaa aaccgggctg     28560
     gggagtattc agaacctgct tccgtatata tttaataagt cacttagtat ttatatatac     28620
     ggaagcaggc tctcaaactg gctcccagac cgacttacat caccagtaat ttggctctgg     28680
     cacgacctaa cgtggtcagc cccagcgtgc gacggtggta gccagaatca ccgcgctggc     28740
     ggcacattcc tttctccacc agcccctttt tcaccagtgc gcggatagag aactgcatac     28800
     tctgtttggt cgttttgtac ggcagcactt caagcagctc gtccagatcg agcagatgcc     28860
     cacgctcatg gcctaaattg atggttttga tgatgtcttt ttgtttgtcg gtcaacgtca     28920
     tggcaaatcc ttatgccggt aatgcaattt caagaggttt gttcaaaggc tgtttgtcga     28980
     atgccagcag tggcagcgtg tcaggcaact gacggccaaa gtccgggttt cggtacacgc     29040
     catacagcgg agacgtgaag ctcaggttgt gaatatcctt gagcagcttc acaatgctgg     29100
     cctcgtccac caggctgtcg gcaatgtcct gaatcgtcgt gccacgatta cgcccggctt     29160
     tggccaggga actgttcttg tggtagtcag cgaccagatc acgcagcgca cgacgacggc     29220
     gagactcact catggcgaac agctctttga cgatcgcttc gttgtcgcca gggtcggaac     29280
     ggaaatgacg ctggaagacg cgcaacgcac tctcatagct cttcggacgc tccggacgga     29340
     tgaactggaa ccctgctttc atggcaaacg ggttgtattt gctcatcgac gactggatct     29400
     cgatgattgg ccggtcgtgc atcctgctaa ccaggttaat cattcgatag gagacgccga     29460
     cgccgcggta ctgagtgtcc acaacggaac ggctaatcac cgcaaagttg ttgttcacgt     29520
     accgccccca atactggttg gccacggtgg tattggtggt tggcttcagc ttaggaaaca     29580
     tgcgatggcg aggcgccagc agcagtttcg ggtaagccat aaccacgacg cccaccagcc     29640
     ggtcgtccag ttcgcagcga taatacgttg gcgcgaacgg cttaccatcc gtcttatagt     29700
     gcagcgactt cagcgcgtgc cagtcttcaa ccgtgccttt ggtaacggtc atacgctcca     29760
     gaaagtccag atgacgcggg aactcttccg ggcggtagcg tttgatgatg atgtctgtca     29820
     tgtcgatcac ctgcgctcga tattggcatt gatgaagtcc aggcgaagcg attccatcgc     29880
     cccaaccatg acgtatggac gcccaccgtt atgccagcaa tccagaacac tgccgtcgtt     29940
     gttgatcatc agcaacgcca gactctggct tttaccttct ctggcgtgct ggagtgcttc     30000
     ttccagcagg cggatgactt caacgttgtt gttgtcagcc tctttcgatg gcttcagctc     30060
     aacgatcttc aaatcaggca tattccacct tcacgcgttc tttgtagtgc ttggtgatct     30120
     gcatatccgg gcgcagcgcg ttcttcaggt cttcgtgggt cgtcgccacc attaccgtcg     30180
     caccaacctt gcgggcggca cgctggaggt tcgacgccac aacctgagct gttacacggt     30240
     cgagaacagc accaaattcg tcggcggccc agactttggc gccggactca atcagcttgg     30300
     cgatcttgag gcggtatttc tggccgtcgg acatttcgga tggtttgcgc acaaagagat     30360
     aagcgtcatt caatccggcc atagacagca gccccagcgc atcgctggtg gttttgccca     30420
     actggtcgat gacgttaacc tcattgttga aggtaaagtc atcgatggag gctacagaaa     30480
     gcccttcatc cttcatctgg cgttgcagct cgcgcagcac aacggatttg ccggaaccgg     30540
     actgaccggt gatgtacacc acatcgccct gcttcacttc cagctccaga ttgtcgtaaa     30600
     gcgtccactc tttttcgtcc aggccaagac cgaacgattc ggcaatctcc agcgtgcgca     30660
     tggttttatt cacgcgggtc tgaaacgata cgttgatggt gtatttgctc atgcagccag     30720
     ctccccagaa gaaactttct ccgcatacgc cacgaaagcg tctaccccgc actctcccgt     30780
     gatttcctcc atgtgggcaa gcaaatcccc aaccacaatg gcagagccag cagggagcgt     30840
     tttaaagccc aatacgtcga tgacgcggac ttcttcagcg gccacttcgc gactgatctc     30900
     ggtgtgctct tctttctggc gttccgtctc ttcgcccaga tcgagcacca gagcgccggt     30960
     ttccatctct tcggtcatgc tgccgacaag cacgttcagc tcgcgctctt caaaaccgaa     31020
     gacctcaacg tcgcccagca ccagggattc aagttcctgc tgcaatttga tggcgtcgta     31080
     gtcaatactg gccaggcggt tgtcttccag gcgttttgcc ttcacttctt cttcgctcag     31140
     gtcgtcgcga acgatgaccg gcacacgctc cagaccagcc agaagtgccg cctcgcgacg     31200
     accgtggcca gtaatgatga cgtcgtgctt gtcgaccgtg atcggctggt caaaaccgcg     31260
     ctttttgatg gcggcagcca ggtcgcggat ctgctgttcg tcatgttttt tggcgttcat     31320
     ctcatacggg atgagttctg ccgggtttcg atagacgatt tcaaagtttt tggtcattac     31380
     atacgctcct tgtagtagtc gaccagccac accagggctt ccccggcgtt ctccatttcg     31440
     ttaccggtat tgattccctg ctctttgatg atggttttga tggtgtcggc gacgcgatct     31500
     gatgcatcaa atgtcacctt gaagcgcatc gtctggtgtt cagcaccgac tcgctcggtt     31560
     ttctcgcgtt tgtcctcttc gatcggctcg tcatctccac gggagagcgc ttccagcgct     31620
     tcaagatcga taacggacgc tttggcgagt gttgccgcca tttcgtcgtc atacggggcg     31680
     atatcggaca accggtagtc gatttcagac tggatttctt cgattaagcg ctgcaaagca     31740
     acctgatcgt cttcgccgta gcgctcgtta tcgacgaggg acatctgttt ggccaccagg     31800
     tcgttaattt tgcccacgga gatgacggga accgttgaaa tgccctgctc catcgcggca     31860
     cgccagcggt gttcgccacc gaggatctca aaaatgcccc cgtccagctc ccgcgccaga     31920
     attggcttaa aaaagcccaa tttttcgata gagcctttca gtttttcgaa gttttgcgcc     31980
     ccaacggagt tggtattcca gggattcgga cgcaggttcg cgacttccac ctgcagaatc     32040
     gtaattttca catccataat tctgatacaa tccattatat aagtacttac ttactataat     32100
     agccaattac catacaaaag gcacgaagga aagaggttta tgacagttcg gattgtatcg     32160
     aatgcagtca atgcgctgat ttctggcgct gatgacaacg tgaagcggct cgttcaggag     32220
     atgttgagct atgaagtgga ggctggtgac tggaaaggga ccagcacgat gttcaactgg     32280
     agcaaaaacg cgttcccggc tgggtttgcg aagccagtag cggccaacct tctgaaagct     32340
     ggcatcaaat gcgtgcatgt gcgcaaggaa aaagcccccg cgctgggcaa gccgaacccg     32400
     gtagttaacc cattcccgta taacccggac tatgcgtatc aggatcagac tgtggaaaca     32460
     ctggtgcgcg aagggatgat gattgcccag attgcgacgg gtggcggtaa atcgaacgta     32520
     gcgtgtaagg cagctgctcg cattggtcgt atgacgctgt ttttaaccac gcgctcggtt     32580
     ctgatgttcc agatggcaga gaacttccag aaatcaatcg actaccgcgc ggagaatggc     32640
     gagccgtggc tgaaaggtca gaaagttggg gtgattggat ctggtgagtt ccaggtctcg     32700
     cgccatatca acgttgccac ggtgcagacc ctggccagtt ttctcgaaga gccgccgcgc     32760
     gatgcctcac cagagaaaaa acggtaccac ctgaagcgcc gggaactggt taagcgcttc     32820
     ctgtccagcg tttctctgct gattctggaa gaggcacacg aatcatctgg ttcaaacttc     32880
     tacgatatcg cccggttgtg cattaatgcc gactaccgtc tggcgctgac tgctacgccg     32940
     ttcatgaagg actcaaccga agcaaatatg cgtctcatgg ccgttgcagg tcgcattgag     33000
     ataaaggtga cggaaaaata tttgatcgac cgaggtattt tagcaaaacc ctactttcta     33060
     tatcataaaa tcgcgtacac tccagacgag gtgcgaatca gggccgaact tgcttcgaaa     33120
     caccttaact ttcgggttgg gatgagtacg gcttaccaga aagcctatca gttaggcatc     33180
     gtttacaatc tgggccgcaa cgaggccatt gtgcgcgaag cgttaatgta caaaagtcac     33240
     ggtctaaact gtatgacgct ggttcgtttg aagcgtcatg gtcagattct gatggaaatg     33300
     atgaaggaaa gcggcctgaa ggtcgatttc atctacggag aatcaaacca gactacccga     33360
     caagcaaagc tcagcagtct ggcggcaggc aggatagatg ttttgattgg ttcaaccatt     33420
     ctggatgttg gcgtcgacgt tccaagcgta ggtgcggtga ttctgggtgg cggtggcaaa     33480
     gccgaagttg agatgcgcca acgagttggt cgcggtcttc gagccaaaaa gaatcaggct     33540
     aacgtgtgct ttattaccga cttcatcgac gtgagcaata aatacctcat gtcgcattca     33600
     tatgagcgga agcacattat cgacacgacg ccagggtttg ccgaaggagt cttgccggtg     33660
     ggtagcacat tcgattttac tgttttgaat agagagtaag catgagcgag aaacgcgcta     33720
     tacactgcca ggttcagtta accgaaaaag ctaacgacaa gctggaaacc tttcagaatc     33780
     gactgcgtga gcgcaacata aagctgtcaa aagcagacgt catcaatctg gtactgtcca     33840
     acatgacgat ggccgatttt gataaggcgg ctacgtcatt agaggcttct gcaaaggctc     33900
     gtgaaaaggt catgaagatt tacgaatcct ctggcatgac caaagaagat ctggccgata     33960
     ttctcaaacg tctcgattaa gcattaaggg cgtcgcaaga cgccttgttc gttgaagtga     34020
     taaggattta gttcaagcca tgaaacacgt tctacttcca ctgattacca tccccgtttt     34080
     actcctgagt gcatgttcat cccgcccagt gtctgtagcc aatgcaaaac cggctccgca     34140
     ggcaagagtt ttcaaatacc agacgtctgc cccaaccacg ctggtggtta tgagggacaa     34200
     aggtatgata ggtgcgggct gcgacgcatc catcttcatt aatggagaga cagttgcgaa     34260
     actggagacc ggcgaaaaag cgacgttcca tcttgatgcc gggcagtgga ttgttggcgc     34320
     ctcacttgag ggcgccgggc tgtgcgcact gaaccctgct cgtcaggaac gcgagaccat     34380
     caccaaagct ggcgagacga aagtcttccg ggtattcacc agcaacgcag gtgacatcga     34440
     tatcctacca acgacactgt gacgatatga cgaataaaac tgacatcacc tacgggattc     34500
     ctgcagaagt ctggccgcgc gattactcca acgtggagaa agcgctgatg ttctggcgta     34560
     agtctctcat tcctgtaagg gtcacgatgg aagatggtca ggtgttctgc atgtacgttc     34620
     agggtctcat gtcgtcgcgc aacaaagtcg acctttgccc tgccccgttc gacaaagaaa     34680
     atcgtataag gctcccactt gagcgaatca gcacgattga atcaggtgtg acagaaggca     34740
     ttgcgcacga tttcacgggt cggacaacgg tacacccaga ctatgtggac aatcggccat     34800
     ctcgccgtga tttctttaaa atttgtcgcc aggctcatga gatgcagaag tctataaggg     34860
     tctacatggc ggatggccgt gaaattgagg gggggtcttc aggcgtagac gcttgccagg     34920
     ccacgctcaa catgggggac ggtcggaaga cagtcgtcat gttcgattgg gtcgaacgga     34980
     ttttaccgtt ttaaatctat aagggtaata accggctaag tccggttatt attttatgtg     35040
     tcacttcccg ttatatttac ctcccctaat cccggttccg ttttaaatat ataagggtga     35100
     ttgaccgaat agggaattta tttaggcaac accttcgaga aaacgcgttt tatttctaag     35160
     actttgattt ttattgaaga aaattttttt tattcccgcg caaaaaactc ttgattttaa     35220
     tttttgtata tcgataatta gtcacatcga aagcgaacac gctaacgata aataaataac     35280
     aaattaagtt atcaatatta cataaggatt aatatcatgt ctaacgttgc tatctctaaa     35340
     aaatctatca tcgacgctgc tgtagttatc gctaatgaat tgcaagttgc agccaacaat     35400
     gcgactcaga cttataacaa tcattatcag aatggtacgc acaccaaagc agataaagct     35460
     aacatgcttg cagcgactac caaacttgca tactttacca acaacgtttt aaacgctgtt     35520
     aatgatgaga aattagctgg tgtcttttac tacgcgatta aagcaagcaa acaagcacct     35580
     gaagcgtttt tccgtgaagc tatgaccaat agctattcac tcgaaaaact ggtttatctg     35640
     gttaaatcta tcaagtctgg taaatgcgtt tattccgtcg ctgatatgtc cggatctcgc     35700
     gtattcgcat taatcgaaat gattaatgat gaattggaaa cattcactaa tggcgctgtt     35760
     ttcgatttga tgaatgaagc gaaaaaagcc aacgaaatta aattggacgc tggctacact     35820
     caagccaacc aactaatcaa tctttgtgaa cgtctcggac tggtcgagaa gatcaaagga     35880
     atgggcgctg ctaaaaacgg atcgcagcaa tatcgcttta tcaaaaatga tttttataac     35940
     tatctggctg acgctttcaa agcgtaatta attgaatata gcgcccacta tgggcgctta     36000
     ttcaaaagat cttaagtctg tattcaattt tattttttaa ggagcgtttt tatggttatt     36060
     tttatcgctg gcgttaacat ccataatcat actcttgttt atgatatcgc tggtttagct     36120
     ggatacgctc tcagctctga agtagtcgac gaaaccacgt ttaaaataga tctgaatagc     36180
     gcggagcata ggaagcgcgc aggaatcaaa gaatccgatg ttcttttaat gattcaagaa     36240
     tttttaaacg ctggctttaa aattcactta gaaaaataaa aataaatatc ctccggcata     36300
     gccggaggtt tttcatatgc gcctataagg ctctgttacc agccgcgccc taacaggcgc     36360
     atcgcgatct gacatttgca tctatggatt acttacggcc cgtaaacggg ctaccgggat     36420
     acgggatcga gagttgctca cccattttat cctcttccaa ttggtgcttt atgtattctt     36480
     gtatcctggc cgtgtttttc cctaccgtat caacgtaata ccctcgacac caaaactccc     36540
     tgttacggta tttgaacttc aaatcgccaa actgctcata aagcatcaga ctgctctttc     36600
     ccttcaggta ccccataaat cccgagacac tcatcttggg cgggatctcc agaagcatat     36660
     ggatgtgatc cacacagcat tctgcttcca ggatattcac gtttttccat tcgcacagtt     36720
     ttcttaaaat actgccaatc gctctgcgtt tttccctgta gaacacctgc cttcggtact     36780
     tcggcgcaaa aactatatga tatttacagt tccatcgggt gtgcgctaag ctcttttcat     36840
     ccctcattgg gacccccttt tgatttcttg ttgaacattt gcagttgcca gaccgcaaac     36900
     tgttttaaca aatcaaaagg ggtttttata actgacccaa agctgaaagc tttactgaac     36960
     ccccagccta gctgggggtt ttctgggcac aaaaaaggcc actaaatata gtggccttat     37020
     gttaatagat aagcacctac ctatcaatta tcgacttata aaatccctgc aagcacatcg     37080
     cgaacctgac ggaattgatc agtttgcatt ccggtgtaaa tcgacgcgac agcgtccgca     37140
     aggtgctcgt ttttattcac cagcacttcc ttaccagatt gcttgcggcg caaccacggg     37200
     gcgtttggct gcttctgcgt agcccactga atgatctctt ccttcgacgt ggtcagctta     37260
     ttcccgacat agtgcttaat ctcgtttggc gtgacctgta tcagtggctt atccacgcac     37320
     gccagtacgc caatgcagat gccgtatgag gtttgtgcgc gactggactg gctaccaacc     37380
     ggcaactcgc aaaacaccat atgagcctgc tcgattatgg gcttggcggt gcgccagatt     37440
     tcgttagcgc ggcgtagatc gtcgctgttt acgcgaaccg tcttcttgtt gccaccagct     37500
     ttggtttcca ccaatgtcag gccatgaatg tccagcttat ccgtttccag atccagcgtg     37560
     ccaatcgcca ggccaaagtt gctcattgaa gggtcgacgc caaccacacg aatggtttta     37620
     ctcatttttt ggtctcctta ccacgtagcc caggttgggc attccattag tttctgttca     37680
     agtgtcttct ccggctcgcg agttggcggc ttcggaatgt cgctaacaac atgaatgcta     37740
     tcgttggtta gaacacctgc agcaatgtct gcatcaatca tgctctggcc gatgaaatgt     37800
     cgcatgatgt cgatcagatg gtgtgcaacc ttttcattcg cgctgaatac atgggggaga     37860
     agaacttcaa taaccgctac ttcacatccc tcctcgtaaa agcagagttt cgcccgcttt     37920
     gagattggcg cgtgccgatc atagtcaaca gagacgctgg cgaaagcagc accaggcatt     37980
     gcaacgtgat cagcgcgtgc gttagcgtgt cgaatcagat tggtgaatgc ggtgctgatg     38040
     tgcgtctcca ttgcattgaa gagcgcattt tcttggatat tcagcgttcc ggtttcaggt     38100
     atcgcaacga accccggccc agaatgtggg agatatccac cttccgtaaa tgggttaaca     38160
     aggatcggcg cagtgcttcc tgacggcaac atagccaagc tcggcatcaa cggagtcgat     38220
     gacaacagac tggttaatac cgagaactgg tcgtcattga tgttttcgtt tttccacaaa     38280
     agtgcaggcg cagctgcttt tgccgtatgg tggtttatca gctttataga ttgcatcacg     38340
     gcaaacatct gcaaaaactg cgtgcggctc aagttaaacg acatagctgc gaccctcttt     38400
     gacttcgaca gtgatggttt cccggaacca cgatttcatc tctttgtggg agatgatcat     38460
     cactgtgccg cgttcacgcg ctttggcttc cagaatcccc atgagacgct ccagaccggc     38520
     agtgtcgagc gcgtcgtcaa tttcatcgcc gataaacagc tcgatattct tactggcgcg     38580
     actggcaacc agatcctgca aggctagaga gcacgcaata cgtaccttac gcttctcacc     38640
     accagacaac gtctggaagg atttgctgga acctgttttg gtcacgctta tattgaattt     38700
     gtcgcgatac tcgcctttct tcgttgtctc cattgtcgac cattcggcaa cgatattgcc     38760
     gtccgatagc gtgttgagat actccgcagt cctgatgttc aggaaaggcg taacggaggt     38820
     caggatgtgt gaacgaacac ctgcagggga gtaaacctgg cgagccttct ccagcaacag     38880
     agcctgttct tgaatactct ttaactcatt tttaagtact gcatgattag atttattggc     38940
     agccaggttg tcctcatgac gcttaataac ggccagaaat gggtttacct ctgccataat     39000
     gcgattcaca tcggtacgcg cccgcgccac catcgcttcg acggccacaa cttcacgttc     39060
     gcgatgacgc agcgcactta gctcattggt caggcgttcg attttggcga tgatttctga     39120
     aacgtcgggt gtggctgcga ccagtgcaga ttcgatgccg agcgctttct caagacgagc     39180
     tttgtgttga gccactgccg aagctgatgc ttgcgcctgg ccgatctcat tacgcgcttg     39240
     ttcaatgaaa ctctccttca cggtggacaa atcttcttcg cagtagggct ttccgcaagt     39300
     aacacaaggt gctccgacct ttgtgctgac ctcttctgct ttggttttaa acgagcgagc     39360
     acggttcatc gactcgttct gtgccgcttc tgaagtgcgg atgcttgagc ggatctccgt     39420
     aatcgcaccg cgcaccttca gcagtttggc gtcatgctct tctttggagg ccagcttgca     39480
     gcgttcgcca gcaatcgcgt tttccgtatc ccggatctgt tccggcagcg agcgaatttc     39540
     catcacgact tcagacagcg ttacctccgc gccagccaaa tctacgcggg ccttgtccag     39600
     acgttcgccg cgatcgcgtt cccaactatc agaggacgct ttggccgcct caatctctga     39660
     ctgcgcggtc tcgataagcg tgagacaggc gtccattttg gatttggtaa catccatgcg     39720
     tgcggcagct gcattagcac gctcgcgagc aatggcatag gctcgcgtta accggtcgac     39780
     gccagcggct tcttcaacga tggttttgag gttcttgtcg gacatacccg gcagatctgg     39840
     cattgcttcc tgactggcgt agatggacgc catgaacacc tctttcgatg caccaatcag     39900
     gcgttcaacg aactcctgcg tcagtgtgtc tttgcctttg gtcatgtcac cgtcttcgcc     39960
     acggacgatc agccggttct tgaactcttt gtgtttgcgg tggcgaatga tggcgtaacg     40020
     ctttccttca tcctcaacag ttaccatcac acgacagttt ttttcgtgac ctgtagacag     40080
     cacgtcgtca cctttgacgc catgcgcagt ttcgccatac agacaccaca tcaggctgtt     40140
     catcaaagtc gatttgcccg cgccattgct ggcagcggaa gagtcgccac tgttaacacc     40200
     ctgaatgagc accagaccgc gttggtctaa ctcaacttcg gcgctggcta acgccatgaa     40260
     gttctcaacc tggagcttta gaaatttcat acaatgcctc aaactttttg attcaaatgc     40320
     tggccttttc gtagttgaaa ctccgtgtga gccgggaagg atttgcgttt tagtacgccc     40380
     tttttgctca atcttcccag gtaaaacgcc acagggtttc cattaggtgg gtagggcttg     40440
     tggaacatca ccgtctggcc tcgttcaagt cttctcattg tggagacgaa gtcccgaaag     40500
     ctcccagaat ggttcgtact cacactgcct ccgcactctc cgcttcggtc aggatttcct     40560
     gacacagcat gtccagcttg ctcaggtcga agccgccatc agtgtcgtga acgatcttgc     40620
     agtacgccgc gacggactcg cccaggctgt ctattttgct ggtctccgca gtactggcag     40680
     agccttccat catcgatgcc ttgcggatga agttgcagac gacacccttc gcgcccattg     40740
     ttttcaggac gttctggagt ttgatgcctt cttcatcgtt ctcaacaacg gcacgaaagc     40800
     gcacgtagtt accgcgaatt tgatcgtctt ccacatcgtc ctcaaggttc acgaacttgg     40860
     gtgcagaggt ttcgtggtgg gtgaatgtgc cgtcagggtt gacgatcatg aagccagcca     40920
     gcgagccaac atcaccccaa ttctggtgcg tcagcgcccc gatgctaacc accccaggca     40980
     gcacttcttt gtggttgtgg tagtgtccgg acaacaacaa acggaagccg atatctttca     41040
     gttcctgtgc gtcgatgccg acatcaggca tggtagggat cgctttgttg atcgaggtat     41100
     gcacaacgac atcgtgattg tcgccatcca gcccggaacg cagtgttttg aggtcgctga     41160
     taagctctgc gtggttattg cgccagctaa tcagatggac ggtaacgtcg ccaattttga     41220
     tggagtgagg acgtttgccg cagacgattt ccacaccgat tgagcgcaga gaggccgctg     41280
     cattggcgct gtatacggaa tcgttggttt cgaggtcgtg gttgccggcc agcataacca     41340
     cttcgaggcc caactctttg atgatccact cgtaagtttc ggtcacgaaa tgcaggacgg     41400
     aaggcgatat agcaccacga acatggaaag tatcaccagc caccagcatg tgcttgcagc     41460
     ccgcagcttt catggctttg gcagcttctt tcgtggcatc cagttggatc tccagtcgag     41520
     agttcagccc gtcagcgttt gttgtcgcaa aagcatccca acgatgataa tggggatctg     41580
     atatcacccc gtatggcaat gtcatgtgtc ttttcctttg tggttatttt gatacagata     41640
     ttaagcgtgc ttgagaggcg aacaacccag acaacacggc acagaagaaa atctacaggc     41700
     acatgattat gacaaaatac ataagtaagt gaatacctat tttcatggcg gtaatgattt     41760
     ctaaatgtaa cgagcaactc ttcgtcacgt cagaatttat aggcatgtct ctagaatccg     41820
     ctctcagcag tctgggcttt cgtcactggc aatggaccga gatctgcgca ttcgaggctg     41880
     ccttaccggc gcttatgctt atccatttgc tggtaaaaat gagccagtta ttcgccagat     41940
     agccagaatg ctttctactt tattatcatt acccattttt ttaaactctt acgaactgtt     42000
     cacagtaaga ggtaaatatt atgttcagat gcttggcttt aaccgtttca cttgcattta     42060
     tcctgcccgg cgccctacac gcggcggata cccgggaatc aagctcatct atcagggata     42120
     ttaacgtcat tacttttcag gggggtggaa cctgcctgtt tgggttgccc aggaaaaagg     42180
     ctttttcaga aaaaatggtc ttaatgtgaa aatggattac acacccaatt ccggtcaact     42240
     ggtcagaaac ctgctgaatg gcaagtataa tattgcagta gcaggtattg ataacgtcat     42300
     cgcgtatcaa gagggccagg tgaaagagcc ggtagtgaat ccggatatgt tcgcgtttta     42360
     tggagtggat aacgggcttc tttcattagt tgctaaccct caaattaaga acatcagtga     42420
     tcttaaagga aaacaagttt cagtcgacgc tttgaccact ggctatgcct ttgttatccg     42480
     gaattatctt gagaaaaacg ggctgacaca aaatgatgtc cactatacaa gtgttggcag     42540
     tacgaatgat cgctttaatg cacttctcgc cggtaagaca gatgcaacac ttctccgtac     42600
     tccattaaat ctgcaggcga aagaaaatgg gtttaagatc cttgcctccg gaagtgaact     42660
     tggcgactat cagggcacaa ctggcattac aacccgctcc tgggcggctc agaatggtga     42720
     tattctggta agttacatcc gtagctatat cgacggactg aactggattt atgacccccg     42780
     taaccaaaaa gaagcagaag aaattctggt caaaaaggca ccaggaatga cggcggagct     42840
     ggcaggacct gcattacagg aattacttaa caatgggctg caacgggatg ctgctattaa     42900
     tgcagaaggg gtaaaaaatg ttctactgtt gcgaagcagg cttgctaagc cagagaaaaa     42960
     tctgacagat acgcataaat attatgatac cagctattat cagaaagcag tgggcttaaa     43020
     caagcaagaa acaggcaaat agtctcatta caggcggttg tctactggac aatcgcctat     43080
     ttacctggag tgcattacta ttatttatgt gatgcgtacc agtaaacatg tacctgtttt     43140
     aacctagtac atatttttct tctgaccact actgagatcc taatctctct cgtactgttt     43200
     ttgtgacaga tattttactg tcactatgat taacgggggc tgcaaattaa aaaccggccc     43260
     tgctcgttcg tcttcattgc cagcttggtc tgccacagcc gccgcccttg aataaaattc     43320
     actcatgtat taatccctaa agctctcagt gtctttctaa gacaccatat tttatgcccc     43380
     ggtaaaacca tgagtttacg tttaaaacgt ctcagagggc ttctgacgcg ctacgctgat     43440
     gtcgattacc ccagcttttg ggcgagggtc gacaagattc aactcttcag cactgtgata     43500
     ctccgtatcg aactcccgat cgacatggcg aatgtagatg gccgtgagaa ggctgtcgtc     43560
     gttcaggaag tgtccgtagg atttgcggat cacttcgcca accttatcaa tcttctctcc     43620
     gcccatgcag agatggttaa accggctgtg tttccgcagc atctcatcca cggggccgga     43680
     gtagacttta tcgactctcc cgaaccggat gatatttcca gtatcagcct caaccagaca     43740
     aacgagcttg ccaggttcga cccggtctcg ccatgttaca ccagagcgga gcgtgttgaa     43800
     gtagggtgcg tccaatccga tgatcggttt acgaaatgcc agcagtggca cgtaacgtat     43860
     gcagctgttc aagtggaagt gcgcaccggc gtcgtagagt ttgagccgag tttcgttaat     43920
     cgggcacttc gacgctatgc cgcataggtc gcagagcaat ttctgtttgt tcaggatagt     43980
     gttcgattca atggtgtagg agccatcttc aagacggcga acccagcgcg tgcgtttgag     44040
     atccataatt cttattcaaa tagttttgtc cggggcaacg ataactgaca aggcgcaccg     44100
     atgtttgcaa atgcctgttt tacttatacc cattattcac aggaccgatc caataattag     44160
     atccccagag agatcctaca gaagatcaaa agagatcccc gatcgtctcc agccgttgcg     44220
     gttactggcc tgagaggggg ttactatcca ctatggggag caaagtaacc tctgtagaga     44280
     gcataataac cgctatgaag agcaaaacaa cctctctgga gagtggtcgg tatccactgt     44340
     agtgagtagg aggcattgtc ttgactggat aactctttgc ctgtttttct gtgttagata     44400
     gctgatattc atggatatat cgttaatctt gcgttcaggc gtgtttgttt ccaccacaca     44460
     ttatccccag aaagggagtg atggctggtt ttgcaattac ctgattttta tacacaggcc     44520
     cgatccagta attcagatcc caaatagaac caaagagacc cacaaagacc caaaaagatc     44580
     cccgcatccc gcaaaccgtt gtgccatctg gcctcagagg tgatcgatat ccactataga     44640
     gagaagatca gccactatga agagtaaacc aaccactgta gagagtagaa aaaccactat     44700
     aggcggtagg ataaccgctg tgatgagtgc taatatccac tgtaatcagc aaaggccacc     44760
     aaagccgtcg aataaaaaga gacacttgga atgagcgaaa acggcaataa aaacatagcg     44820
     atcgttgaag cattctcaga aacagacaaa aagacaggcg aagttgttac gttagttcct     44880
     aacaccaaca acactgttca gcccgttgct ctgatgcgtc ttggtctctt cgttccgacg     44940
     ctgaaatcga cgtccagggg caggaagggg caaatggtct ctatggacgc ctctgctgaa     45000
     ctcaaacagc tgtctctggc caaagccgaa gggtatgagg acataaggat ctccggcgtt     45060
     cgtctggata tggataacga ctttaaaacg tgggtaggca tcatccacgc gttcgccaag     45120
     cacaaggttg ttggcgacac tgtcacgtta ccgttcgtcg agttcgtcag gctctgtggc     45180
     ataccaacgg ccagatcgtc cgcgaagtta cgtaagcgcc tggacagttc tctaactcgt     45240
     atcgccacaa acactatctc attccgcagt aaaggctctg atgagtatta cgtaactcac     45300
     cttgtgcaga cagcaaagta cagcactaag aacgacacgg tctcgctgca ggctgatcct     45360
     aagattttcg aactctacca gttcgacaaa aaggttcttc tgcaactccg ggcaatcaac     45420
     gaactctcca gaaaagaatc cgcccaggca ctctacacat tcatcgaaag tttgccacct     45480
     gacccggcac caatctcgtt ggctcgctta cgcgccagac ttaacttaac cagccgcacc     45540
     attacccaga acgcgacagt caggaaggcg atggagcagc tgcgggagat cggctatctc     45600
     gattacaccg aagtgaagcg cggcagctcg gtctacttca tcatccacta taggcggccg     45660
     aagttacgcc cggcattgcc accaactaaa gctgcgccgg aagaaccaga agagcaggaa     45720
     gataacttgc ctggcgatgg tcaggaggac atcatcgatg ttgttcctga agaaaaagac     45780
     ggtgagatgg tcatgttgag caaggaagaa ctggcgattc tcgaagagct gcgcaaggca     45840
     aaggctcgca aatagcccaa tcactgtaga gagtagaaag gctcactatc cgctgtagtg     45900
     ggccttttgt ttatctgaag tccgctatcc actgtagtga gtaacaacaa ccgaatagta     45960
     accactgtag gcagtagcgc tcaaataacg aaatgaatgt tagtggttac aaacctagat     46020
     gaaacaaggg ctgcgaggtt agtggtcact gggtgacttg ttaaatccac tctctatagt     46080
     ggttatcgtt gctcccttcg ctattggcta tccactatgg agagcagaat cggttggctg     46140
     gatttactat ccactgtgga gagtagacat ccgctgaaaa cagtgaaggt ttactctcca     46200
     tagtggatac ccgctggagg tcgcattcca tcactctcca tagtggttgt ttgctgtgaa     46260
     tgaacgcctg tttactctct acagtggata gtgaagtcga taatcaccac tttactcact     46320
     acagtggata ccggatgcca cggcagccgt tttactcact acagtggtta tgacccagat     46380
     acgcgcgcgg tgagctggct actcaccgca gtggttggtg ttatcagtgg attttcttca     46440
     gcagacccca gagcgttccg gccttcgtcg tgagcttacc tgtttccgga tcgtacatgc     46500
     gccactcgcg acgctggtgg ataatgacac cgtcctcacg ttccagtcgc tccagcacgc     46560
     cgggctgttt aaaccctttg gcacgccagt agccgcttgt tttttcgatt tcaagacctg     46620
     ccattgtaac cgccatcaac caacctcctt gcagtcatcg aaaaggtagc tggcgttctt     46680
     cgcgtgaacg ccgtaaacat cacctgattt gtcgtaaacg aacttatctt cacccacgcc     46740
     agacagtttg ccgttacgtc tggtgagata gggtgaagac aggacgcgat catcgcgcac     46800
     gacataaaac tgttcgccgc tgtccacaat catcgcgccg tagttagctt tgacgacgtt     46860
     gcagatctcg tcgtttttca cttcggccac agacatttca cactcataga catgtgtgtt     46920
     cgcgtagaca gggagagtga acagtgccag agccagggct gttttcttca tgccacgact     46980
     ccttggataa cgccgaatgc tgagtcgaat aacagcacta cggccagcgc attaatcatc     47040
     gcgctattaa caggcgccag cgctttatgg attactccgg tgaagatgca atcgagcaca     47100
     aaagctatcg agataataag taataaggtg tctaatacgg ttttcatgat aggtaaatac     47160
     taacttatat attatttgct gtaaatatca ctcaaaagtg ctgatgccta aaatacgctc     47220
     aaggtgagca gcgtcttcat cgcttaccgg cgtcgtgtcg tctacatacc aacaactacc     47280
     attgctccaa caaacaccgt catcatcgac atgcacagaa tccgcatcca taccagtata     47340
     ctcaacgaga ttgcgctcaa ttgccgcttg gatttcttca tcgttcagac cgtcgcactt     47400
     gaccatgaac aacggataaa cgtcatagtc ggtgcttgat gaaatgcgaa ccaaaatctt     47460
     catgtgcttc tccttgttgg taagtactta tttatactaa tgtgcgccat gcggtacaca     47520
     atcattgtgt tcaggctggt ggaaagaact tctccagcgt gcggtcgaca gccttatcaa     47580
     tgtgcatcag atgccagacg accatatctt tacttcccag atcgcgggtg tagatcacgt     47640
     cgaacttacg ccaggcggcg tgaaaccagt gcggtgtgtc atcaaccggc agattctccc     47700
     cagcctcctt gaagtacttg agcagcatgg cctgttcagc ggttggcgtc gggccaatct     47760
     cttccgcgta cattctgatg aaacgctgcc agtcggcttc atcttctgaa ggttccggtg     47820
     cgttcatctc tgcaatcgcc tcacgcagct gcgtcgccca ttctggctcc gggaagccct     47880
     gggcaatttc ggtatccact acatccagcg cagcgttgtg taacgaacgg tgcaatagtg     47940
     atccacaccc aacgcctgaa atcagatcca gggggtaatc tgctctcctg attcaggaga     48000
     gtttatggtc acttttgaga cagttatgga aattaaaatc ctgcacaagc agggaatgag     48060
     tagccgggcg attgccagag aactggggat ctcccgcaat accgttaaac gttatttgca     48120
     ggcaaaatct gagccgccaa aatatacgcc gcgacctgct gttgcttcac tcctggatga     48180
     ataccgggat tatattcgtc aacgcatcgc cgatgctcat ccttacaaaa tcccggcaac     48240
     ggtaatcgct cgcgagatca gagaccaggg atatcgtggc ggaatgacca ttctcagggc     48300
     attcattcgt tctctctcgg ttcctcagga gcaggagcct gccgttcggt tcgaaactga     48360
     acccggacga cagatgcagg ttgactgggg cactatgcgt aatggtcgct caccgcttca     48420
     cgtgttcgtt gctgttctcg gatacagccg aatgctgtac atcgaattca ctgacaatat     48480
     gcgttatgac acgctggaga cctgccatcg taatgcgttc cgcttctttg gtggtgtgcc     48540
     gcgcgaagtg ttgtatgaca atatgaaaac tgtggttctg caacgtgacg catatcagac     48600
     cggtcagcac cggttccatc cttcgctgtg gcagttcggc aaggagatgg gcttctctcc     48660
     ccgactgtgt cgccccttca gggcacagac taaaggtaag gtggaacgga tggtgcagta     48720
     cacccgtaac agtttttaca tcccactaat gactcgcctg cgcccgatgg ggatcactgt     48780
     cgatgttgaa acagccaacc gccacggtct gcgctggctg cacgatgtcg ctaaccaacg     48840
     aaagcatgaa acaatccagg cccgtccctg cgatcgctgg ctcgaagagc agcagtccat     48900
     gctggcactg cctccggaga aaaaagagta tgacgtgcat cttgatgaaa atctggtgaa     48960
     cttcgacaaa caccccctgc atcatccact ctccatctac gactcattct gcagaggagt     49020
     ggcgtgatga tggaactgca acatcacgac tgatggcgcc gccgggcagt tgcaactgga     49080
     aagccttata agcgcagcgc ctgcgctgtc acaacaggca gacaggaatg gagttatatg     49140
     gacttcctgg agcatctgct tcatgaagaa aaactggcac gtcatcaacg taaacaggcg     49200
     atgtataccc gaatggcagc cttcccggcg gtgaaaacgt tcgaagagta tgacttcaca     49260
     ttcgccaccg gagcaccgca gaagcaactc cagtcgttac gctcactcag cttcatagaa     49320
     cgtaatgaaa atatcgtatt actggggcca tcaggtgtgg ggaaaaccca tctggcaata     49380
     gcgatgggct atgaagcagt ccgtgcaggt atcaaagttc gcttcacaac agcagcagat     49440
     ctgttacttc agttatctac ggcacaacgt cagggccgtt ataaaacgac gcttcagcgt     49500
     ggagtaatgg ccccccgcct gctcatcatt gatgaaatag gctatctgcc gttcagtcag     49560
     gaagaagcaa agctgttctt ccaggtcatc gctaaacgtt acgaaaagag cgcaatgatc     49620
     ctgacatcca atctgccgtt cgggcagtgg gatcaaacgt tcgccggtga tgcagcactg     49680
     acctcagcga tgctggaccg tatcttacac cactcacatg tcgttcaaat caaaggagaa     49740
     agctatcgac tcagacagaa acgaaaggcc ggggttatag cagaagctaa tcctgagtaa     49800
     aacggtggat caatattggg ccgttggtgg agatataagt ggatcacttt tcatccgtcg     49860
     ttgacacgtt ggccgcgtca tacagttttt tcacgttttt tctcctgcat caaaagaaac     49920
     acgatcattg ccgctctgaa agggttaggg ttctggatca gatgttgtgg tgttgagcta     49980
     tccaccagcc tgtgggccgc tctccactcg ccagcctgtc tggctggaat gatgccgatt     50040
     ctgtttctgg aaatgatgtc ccaggcatct accggattgt tgcaccagtc gaaagaaccc     50100
     gctccgtttg gcccaatcgc aatcactttt gtgtaatctc caacttgtga gcctttccag     50160
     ccatattgtg agatgagggg gcgatggccg gttgcttccg cgaccaggca gttaatctca     50220
     aagtccgtca tttcagcgta gtttttcatt catcatctcc ttctttcaga aattgcgtgg     50280
     cgttgtcact ttttacttca acggaagtta attccgtatt agtaaccaat ttgttttctt     50340
     gttggtgata atacggaaat aaaaaaggcg tccaagtgga cgccgtatct ttgaaaaggg     50400
     tgttacttca acgcgataaa cggagtatta gccccttcag tcatgtactg aggcaactgg     50460
     ccattccatt tgttgatggc ttccagctcc atgacgttcg ggttctgacg taatgcttca     50520
     ccgcgcaact tgatggcgtc agcttctgct tgagcacgtt tgcggatagc gtcggcttca     50580
     ccttcggctt gttcacgcag catgttcgct tctgccttgc gctgctcaac ttcctgctgg     50640
     cgctggagcg ttttctggtt cgcggtcact ttggcattga tagattcgat gaccgtgtcc     50700
     gggtagtctg gtttgcccac ccatgacagg ctaataacct caatacctac cggtgacatt     50760
     tctgcctgaa tgtctttcaa cgcattgtcg agcagagacg ccttgccacc gtcgatgaac     50820
     gtgtcggtag tcatgcggct ggccagacgg ttcagtgaat ccgcaatctt ctggcgcaga     50880
     tcagtgtcgg taatgtcgtc aacacctttg cgataggtct ggaatacggt agttactttg     50940
     ttgcgattaa ccagatatgc cacaccaatt ttgtggccga tggctgtacc gtcgctcatc     51000
     tggaatgtga acggctcatc gtaggttttc atctgtttga aagtggggaa ggtgtacagc     51060
     tcggtattca gaccagtcca ctgacggcca acgccgacaa cttcaccgat acctttgtct     51120
     tcacccaatt tgtttacctt aatgccaacg tatcccggtt ccacgcgatc gcagccggtc     51180
     agacccattg tgcaaatagc agccaaagtc accgccagta aacctttctt cattacttac     51240
     ttctccttag ttttattgag tgagttgata tacctgcggc cagcttttaa caaggcaacc     51300
     gggaagacta cagcgatggc aagtccgata aagaaggcca gatcgctttt agctgagata     51360
     agcgatggaa ccagtaaacc gtagataaag cagactgaca ccaccgctga aacagccatg     51420
     agataaccct taatcatgtg tttccttttg tcgttttggt gcagaaataa taagtaagta     51480
     cttatatatt ttcaagtata aaaaggcgcc caatgggcgc cttgtgatta cgcttcttct     51540
     gtctctgctg gggacgactc tttcgctcgc cgttcgtcta tcgcctggag tgctgcgatg     51600
     atttccggga gtggcttctc gcggtacatc tcgacgatct gcgatttggt atatctctta     51660
     tcgccaattt ccacacgccc gctggcgttc tttggcaggt atccttcttc cagcatgtac     51720
     tcaaccagag attcgatgac gtccagcccg cgagtcgggt cgaagtagaa tttccatgag     51780
     catttaccaa acggaggcgc gactttgttt ttaatgcact cggcgccaac gtcctgtccg     51840
     atcttctctt tgccatcctt catgacggat gctcccagac ggatgcgcac cgacgcgtag     51900
     aacttcggag agtcgccgcc cggagacgta gtcggatcgc caaacatcac gccaattttg     51960
     gtacgcacct ggtttaagaa gataatgcac gcgttgtact tacgcgccca aagcgccaga     52020
     gtagggaagt tcgcactcgt cgcgcgcgcc agcgccgtgt tgtcgttcat gttcagctga     52080
     tctttgtcct tcgcagtgcc ttctgccatc ttgtcgaact tctcagcttt cgagttcggt     52140
     accatcgacg ccagagagtc ggcaacgatg cagatagggg ctgtttccgg gataagctct     52200
     tcgtcgcgca ccagcttgag gattgtgccg atcagctcaa cggagtcttc gaaggtatcc     52260
     ggctgtttgt agacccactg accgtcgtct tcgtcggcgt tcaagccatt cgccaccgca     52320
     agaccaacgt cgaagctgtt ttcgtggtca aggaatacgg ccagaccatc ctgtttctgt     52380
     gctgatacca tcgcagccgt cgccaaaaag gttttaccgg cgcttggtgg cccgaagact     52440
     tcaacgatac gcccacacgg aaaaccaccg tcgtaacgtc cggaaatggc tttgttcagt     52500
     ggagggaaac cggagtcaat ccagtgggag accttctgaa tctcgtcatt gctgccgatt     52560
     ttctttttca gcgccagtgc cagtgcggat ttgccttttg ccatgattag gctccttttg     52620
     attcgttgat tcgcttcgaa gctgcggctt cgtcaaactt gattgcgtcg tggttcaggt     52680
     gtttggcgac gcgagcgatg atcttcacga cctgctcgct gaccagcgcg aactcacgct     52740
     cagtagcaga aatgccagca gcgcccagaa tgttcggcag cgccaccaca gcgtgttcgc     52800
     cgtggcagaa gacaatctct ttagccagca tggttggcgt agttgccccg ccattaatga     52860
     tggatttcag catcagcagt acctctcaaa tggcagaaca aacacttcca gatcttccag     52920
     aaacgaccgg aaattcagct cgcaacacat ctgttcgaag gcgttcatgt cgcgtgcgcc     52980
     tttaatcgac tcgatttcgc tgggtgggaa ttttgtgtcg ataaggttca tcagcatcat     53040
     gttgcgctta aaggcttcga gcatccggca gcctgtcttc tcgttgaagg cgttctttgc     53100
     cagcttgttg aatgccgtct tatagcgacc tttgttgatg acaatggagc cgtcgttaat     53160
     gccgcgtacc attgcggcca cacttcccca ttcatgaagc agctctttcg cgccaccatc     53220
     accaatgcca cctacgcctt tgatgttgtc cgaggtatcg ccctgcaacg ctttcgcttc     53280
     cagaaacgcg cgtggcgtcg gcagaccggt cagctctgcg aactgttcga agttcacctg     53340
     cttgtgcttg gcatcttcac gcaggcttac ccagctcaca ttctcgcgaa ccagctgaag     53400
     ccagtcgcca tcgccagtca gcaggtagat atgatcaacg gtcggctgcg gagccaggcg     53460
     agagaccagc attcctgcca ggtcgtccgc ttctgcatcc tttgcaatga gttggttaac     53520
     gcccagcgcg gtcatcattt tcaagatgta cggcttctgg atggcaaaac cttctttcat     53580
     cttcttcata tccgggtcgt catcgcgatt cgctttgtac tccgggtaga agtcgcgacg     53640
     tttgtcgctg aatccatccc acaagatcat tgggcgggca tggagaattg aggcgtaacg     53700
     acgaacgttc ttcacgaagc caaaagccgc ctgaacttcc atctcgccgt tgtgtaattt     53760
     gtcggattgc tggtggtaat agcccaggct gttaccgtcc acaaagagat aattcaccgg     53820
     tacactcctt ccaaaaagta aggcgtccgt agacgcctta ctggtcacgt tatgggatta     53880
     cagagcgtcc agttcagcca gcaggtcatc gagaccttcg tcagctggta cagatgcagc     53940
     ggcagcagat gcggaagcac ttgcagctgc ggcggcttcc ggagctttaa ccttttccgg     54000
     tttagtttcc ggtttgaact cagcttcagc ggcacgcagg atctcttcat caaccaggct     54060
     ggtggactct ggagccggtg tgtgtgctgt agcgacagca gctgcgcctt ccgtatgacc     54120
     agtgatagag ccaaagcctg gcagttcagc agcagctgat tttgcagcgg aagaaatggc     54180
     cggagaggac attgttgctg ccggagccgc aataccaatc agacgaccca tagtgcgagc     54240
     cgtagacagc agacgggttt cgtcagcctg gttcgcgtat gcgatcagat cgtgttgggt     54300
     agtccagagc ttctcaggaa tgtcgccttt gtagacttta cgtttcgggg atacgtcata     54360
     cttggtgtca cgaccggaac cggtacgctt aatcaggaac gcatagcctt cttctttgct     54420
     cagtgggttg ccgatatcat cagcaatatc ttcggacatc actttgcaga tatcgtcgaa     54480
     gaccgtagac ggcagctcaa tcaactggca tttctctgcg tctgcaaagt cttctcgcgc     54540
     agacagaaca ccattgacca gataacgcgg tgtagcacgc atactgttaa tgcgctcttc     54600
     catcgctttg ttgcccttaa agcgagcacg accttccata accatctcac acagctggca     54660
     agcgtggccg tgggtgtgct gttcgcagat gtaggcggtg gttacatctt tgccttcctc     54720
     attctgatgc ttaacgtagt gcataccgaa agtctggaag aacacaccat tcgggtcgtc     54780
     cttgttcgga aaaatgcgca gatagttatt gccgtctttc agacgggtca aatcaacgtt     54840
     attgccacgt ttagaagcaa tatcgccacg ggtcttgtta agcagatcaa gtaatgactt     54900
     agacatgtat ttctcctttt tgtgattgtg gccattggcg ctatgcgcgt tgggcattcg     54960
     tttattcgtg gctctttcga gcgagaagga taatagatca gtacttactt atcatctagg     55020
     ataaattaac ggggcgagtg gaaacgttcg gcgcccaagc gttcaatctc cacgatagcc     55080
     attttggacg cctggacaat catgtcacgg cggtgagaga aggcggttac agcgtgcttg     55140
     tatagatctg caatgtgccg ggcatcatcg agtttctggc gctttgcgag gtattgcggg     55200
     ttggttctaa ccttcgcctc cagtacggat tcattgaact taatgccgtt catactcagg     55260
     ttcttacgct cattgtcgta gatttttgcc tcaatcgcat cgagggagag ttttgcatct     55320
     gcgacctcgc gttctgcccg cgccagctta gagccgtact ccatcaacag gcgcggttgc     55380
     tgacgccaga cttcctcaag attgtcgcgg tcgaactcca gatcggacat gattttttcg     55440
     tagatatctg cactcatttt gataggttcc agcttatttc tatatatcaa ttttaccatg     55500
     aaagaaatga aggatggagc ttatagaagg aagaagttag ggggtggggt cggtaagttg     55560
     atgaaaacag ggagtgttct gataatctat agccgttttc tgcggccgta gacgtcagaa     55620
     aatagacagt gttgacacgc gctcacacta tacctatcat aatgacatcg gaggaaaatg     55680
     aaatcacatc cgaataagca tattcaagag gccattgaat acgcgttgag taaaggctgg     55740
     gtttgggttc cagcaggtaa gtcagcacat tgcttctgca agctgcgctg cggcgataaa     55800
     tcaggtgaac atacaagtca ccacagaagt gtatggtcga ctccagatgt accggagcac     55860
     catgccacgc aaatcaggca agcggtcgac cagtgtggtc gcatcaaaaa ccagatgagc     55920
     aaaaaatagt agttagtggc ggttttggcc gccatttgtt ccaaaggtac attaatactt     55980
     cactttagat aaagaggttt tatggcgctt tataacttca ctctgactct ctcaggcgta     56040
     acctatgaga ccgaaggatt ggaagatgcg ctgtacgaaa gcggctgtgg cgatgcgatt     56100
     gtttgcgcat atggaaactc cgtctatgtt gagttcgacc gcgaagccaa atcgctggat     56160
     gcagccattg catcagcggt cgacaatatc gaatctgccg gtatcggcgc gattgtagaa     56220
     tcagtcgact cggccttagt tggcctgagc gatgtagctg aaatgacggg catgtcccga     56280
     caagcaatta ccatgcttaa agatgggctt cgtggtggtg gcgacttccc ttgccctatc     56340
     cagagaatcc agggacagtc cccgctatgg gattgggctg atgtggcgaa ctggcttgaa     56400
     gccaatggac gccttaaaga aaacgcagag ctggcacaca atgctcgcgt attaagtaag     56460
     tggaatttgg cccttcgcaa tagcgtctca aaagactttg ttgagattga acatatcgct     56520
     tcttcactta tcgcacgtcg acgtcatcac gccgaatgcg catgaaaaaa cccgccgatt     56580
     ggcgggtttt tgctttatgc gactttctta ccaaaaatgt tggatagcgt gactctggtc     56640
     tggcgtttca gcctgtactg tctcacatcg ccaatcttgt tcacttccat aaactctttg     56700
     gccaccttca gcaccagccg attgcggaac actttgaacg cctccagctg ttcctctggg     56760
     ttatccgatt cgtaaatctc cagcagatac tggcacgcct tcggatcttg cgttttaagc     56820
     gccagcgctc tggcacattt acgcagacga ctgactttat cggcaccatc cagcccggcg     56880
     aacgccagcg ccagatctaa cgtgaccggg cagtcgatga tttcccagaa ctgcgaccgc     56940
     atggtggctg caactgcttt atcctgaaaa tccgctggga tagccgccag cgcttgtgca     57000
     atcttctgtg cttcgttcat ggtgttctct ttattcattt gctaattgtc tccgctacct     57060
     ctgccagaat tgcttccagc ttttcgcctt cctctgggcg aaagtacaaa atgttcgggt     57120
     taaatccgta gaaaacggtc acatccagct ctggcagata ctctttgcgt ccaaccaggt     57180
     cggatggttt gctcttgttg ttgaagagtg acgtcgcccg gctgccacac gtcagcacat     57240
     aggtcggacg caccagattg atctcttcac gcataaagtc ggtgaactgg cctatctcgt     57300
     ctttggtgta gtccttctct ttgtccttca cctttttgca cacgccggtg acgtagagat     57360
     ctcccatgcg caaatcgcct gcagtaagca acttcgcctt aaagtcgtcg tagccgttct     57420
     ccatgaagta gccagtacgc ccatcattgc cgttcgcgtt gtccagaatg accatgattt     57480
     tcggcttaat gccaatgctt gggcgtatca ggtcgtctcc cagacccatt tcagccgcca     57540
     tgcgtgtcat cagtacattc acttcggcag agcgtttagg gttcatctcg aacggtcgag     57600
     aggcttttac agcgtcgatc accagattgc ccatcaattc agcctggtcg cgcagccgtt     57660
     ccggatctgt cgctggcaga ctgccaggct caatcgatgc gaacgcacct actttttgca     57720
     gtgactcgcg tacccggctg ttacacgcac acgcacgctt ctcgaccgct tcctcaaatt     57780
     gctcaagtga ctcgaatttg ccgccaactt tctcacgcgc tctcatgatg gcctggcaac     57840
     cattctcaga gcagcctttt acagcagaga atggcgcata cagaacctgg ctgccgtctt     57900
     ccagcgtgcg gatctcaatt cggttagatg acacgttaac gtctggtggc aatacgtgaa     57960
     tgccataggt cagcgcatcc ttaaccagcc cctggtgctt atcctcgccc agaatggtga     58020
     gcgcagcagc gaaaaactca gcagggtaat gtgtctttaa ccacatagac tgatagctga     58080
     tcagcgagta ggcaacggga tgtgatttgt tgaactgata cgcaccgttc ttctcgaagg     58140
     catcccagat ctccttagct ttcgtctcag acaagcccgg ttgtgaccct gtaacgcgta     58200
     cagcagccat cggcaatttc acacctgcct ccagcgcttc ttcgaccgtc cgcagtgcgc     58260
     cgtcctcaca tttgaagtgt tccgcgcggt gaatacgctg cgtggtgccg tcttccatct     58320
     caacgtcgat ccaaccagct tgagcctgaa cgacgaactt ctcgcccatg ctcttcatct     58380
     tttccatatc ctttttaccg atcgctttac gtacaccatc tgcttcggcc atcgtgaaac     58440
     cggccagcaa tcgtgtcgcg ttcatcgtct gttcctgata cagaatcacg ccgttggttt     58500
     ccgcggtaag ctcgtccagt accgggtgca gcgactgtgg agccatgaag cctttggcca     58560
     cggagacata gtcgtccaac atgccggatt gaatcgggcc aggtcggaag agtgcggtcg     58620
     tggcgacaac ggttttgaag ctcattggct cgatgccacc gcccagatct ttaagcagct     58680
     tgcgcatggg accggactcc agctggaata cgccctgcgt gtaccctgca gcgaacccat     58740
     ccagaacctt acgatcgtcc agtgggatag catcgagatt gatgtcttcc ccggtactct     58800
     ctttgatgta gcgtttcgcg ctatccaaca gatcgagcgt tgccagaccg agaacgtcca     58860
     gcttaatcag ccccatcgcc tcgcagtaac gtttatcgaa tgcaatacag cgagcattgc     58920
     cacgcagctc gacgggcgtg cgctctacca gtggaacgcc agcgacgatc atccccgcag     58980
     cgtggcgacc aaaaccacgc atcaggcttt gcagcttaca cgccgctttg aacgcttccg     59040
     ggtatttcgt ggcgtatttg tccaggctgg ccagttgctc gcgcagctct tccagcgaca     59100
     ggctatcgtc ctccagattc ttgaactctt tggataccgc catatccgca gcatcgacac     59160
     cgtaaatacg tgcggtgtca cgcagcgcag aagccgcgcc cagataggtg aagttcggaa     59220
     taccggcaac gtaatcttcg ccatagcgtt cattcagata ctcgatcacc tcatggcgac     59280
     gtgcctggct gaagtccaga tccgcatccg gtaagtcgag acgttcaggg ttgatgaaac     59340
     gctcaaacag aagaccgtga cggataggat cgacgttggt tatgccgatg caccacgcca     59400
     ccagagaacc ggcagaggaa ccacgacctg gcccgacagg aatgccagtt tcacggctgt     59460
     gattcatcag gtcgcgcacc atcaggaagt agccacagaa gcccagacgg gtcagcgtgt     59520
     ccatttcgta cttcagacga tcaacataca cgcggtgctc agaagccggt ggtgtgtagc     59580
     caaactcttt ggtagtaaga cgcttgcgca gccccgcgac agccagcttc atcagcgttg     59640
     caggctcgtc gtctgccatc ttgggcagtg ctggtggcaa ttcatgccag cgccatgtgc     59700
     aggcttcgat aatggtgtcc tgcgttgttg aggccattgc agctgttacc ggtacatcca     59760
     tgcgaacgga gaaggctttc agcgcttcaa ggagatggcg gcgaccatta acggcgttat     59820
     ctcgctggtg gggaatacgc agacgatgcg gctggtcgat tttgatgttg ttcgtaacca     59880
     tgtgcgcaat gtctttaatg tcagcgtcgt cgaccgcttc gtaataagcg ggatagaacg     59940
     ccactggctc tattttcagt gcgctcgcta ctttcatcgc ccggacgtta atctggtcgt     60000
     agaatggggt agggtgcgga taaaccacgc tgtagaagtt atcgcgtcct ccagctgtga     60060
     ccagcgtccc gataatcttt gcgaagtccc ggcgctggaa tacactgcca atgtcggacg     60120
     tcagcaggat gatgttgcct ttggcatacg cggccgccag ttggtcgagc gccagacgcg     60180
     ggacaaagta gaattgctcg cgcttgttcg ctaaggtcat cagttcgcac acgtcgcgat     60240
     aaccttgctc attctttatc agtgccgtga agcagtagct gcgatcacgc accaatgatt     60300
     ccatacatct ctctgattct ttcgcaaggc gggcgcggtg ctcgtatgtc ggatcgtcga     60360
     ccacattcag cttaacacca caaataaccg ccatatcgtc gccagcggca cgctgcaggg     60420
     gaatcacact ggcaatgttc atgctgtcag cggaaatgac agcagtgtag ccagcgtctc     60480
     tcgcgatttt caccgcgttt tctgctttta gagctgactc tcccagggag aagtcagttc     60540
     tgaccatcag agccttcatg tgtttttacc tttctggttt tcttgatttt gtcattgggg     60600
     aagccaacga acttcccata catcgaaatc gcaacctctt tggctgactg gtggcactcg     60660
     gacctatccg gacacgccag acaagcccgg ccagtttcag acgctgcgat aagagagccg     60720
     aaacatcctt tacgcacgat taaccgaaga tcttctgaac cacttcacgc gctgcctgtg     60780
     cagacgtgga tggaagttta ttgataaatg acttttcgat gccggcagag aaatcaccgc     60840
     gcatcattcc gatttttgcg gatagcagca gctcgcgagg accgattggc tggctgatca     60900
     gatgctgctc ataaccttca cggacaaggt tcgcgaattt caccatcttc tcggcgtatt     60960
     cgcggatgac gccagcctca gccagcatgt tgacttcagc cttagtgctc atgtacttca     61020
     cgttcgaaac aatgccgaag cgcgagaagt tcgccgcgtt ctggatgttc gtaccttgat     61080
     agagacccgt ttcgtcgcca gagccgttag tgttgccagt gccaatgaag gcaaagcgtt     61140
     tatgcggagt gatacggcgc cagtccggag ttgcctcttt gatgatcagc ggttctcctt     61200
     caagaactgg ctggtacaca cccagaatct gcgggaacgc gaagtcatat tcatcagcta     61260
     ggtacaccca gccatttttc atcgccagcg ccagcaaacc cggctcgaag taggtggagc     61320
     catcgcgagc gaggatctgg cctgtaacgt gtgcttcttc catagacgcc gtatgctggg     61380
     cgcggatcaa tggtcgattc agcagggcgc atagctgcgt aggaagagaa gatttaccgg     61440
     ttcctgcatg accccagaga tagcctggga ttccgatttc cagcatcatg aagatgtctt     61500
     taatcaggtc aaagtcgcca tacacatagt tcttcttcgc ttcaggcacg aactccggat     61560
     agggtgtgtt gacgttaacc gtcacctgta gtggttttcc gcgtggcgtt cccagctctt     61620
     tgatcgttac gccaagcagc tcgtgcgcgg ccaccagttc ggtcttgtat tcgaccgttc     61680
     ctgcgtagcc cggatgtgcg ctaatctccg ctacttttcc ttctcctgaa tgtctttcgg     61740
     cacgcttctc attgagtttg accagtgccg tgcgagagat cgttggttca tctggaaacg     61800
     cagaggtgta cattttcacc acttcgtcca cgtccagacc cttcgcggac tcaggaatgt     61860
     tctcgcaacg gcccatagag atatgggatt tcaggtaatg aaaagatttg ccacaccact     61920
     tgcagacgat ggcttccggc aaatgttctt cttgctgtag tgcagtagcg gtcatgtgtt     61980
     tttccttact gtttgtcgtt cgtggggtat atcttatata aatatattag actgtatagt     62040
     aagtaattac ttatttttaa gggtgaagtt cttacccaag aatgatacga gatagctcag     62100
     tgacgactga cggccctaac tcttctacgc tgttaaccag tgcgtaattt ttgtagtagc     62160
     gtcgtggtgc gtcagtcaga acaccgatag ccatcaaatc gatgtcactt aacgtctcaa     62220
     tttctttggt gacggttcgc aaatgctcat ggaacccatc gcctgcagca catggtgccc     62280
     cgtcgctcat aaccagcatg atttttttgt cctccattcg ccctgcaaac agagtggcca     62340
     gctgcgcgac gctctcacca tcgacgttat tgagcagggg gaacgtctca catacgcagc     62400
     ccatgcgggc gcggatctct ggtgagttag ctttctcatt ccagtttttg ataatgggca     62460
     gcatgagcgc ctcgaaacgt gtaaacccgc gcttcgacat ggtttcataa tctgggctac     62520
     caaacgttgt aaagccggtg atgatgttag gcacattgat acgatccaga gcatccgcaa     62580
     tggtgtaggc gctggcgagt gccagttgaa tcttcctgcc gcccattgag ccggacaagt     62640
     cgatcacctg ctggacgcac gcgttcaccg ctctgtggtc ttctttcttg cggaacacgc     62700
     ggtcgtcgtt cattgccaga cgatacaggt tcgcgccatg tatccgccca cgtctctgac     62760
     ccggtatgaa ctgaactcgg ttgcggctgg cgatagctcg ctccaggtct ttggccagag     62820
     tcgaagaaac gccggcagac agatgttttt cgattttcag ttcaaagagt tttctgcctt     62880
     ccggaaccat gcggtagcga tcgacaggtg agtgcattgg gattgcgccg aatgtctttc     62940
     tggtgcgttt tacatgctct tcagcctcat caatcaaccc gataaagtcg tatgaacgat     63000
     cgtatgggcg atactcagaa agtgaggcgc tcataagctc tttgctgatg gtggccgaca     63060
     gtgcgtcttc ggtcatttcg tctgttcctt cttccatctc gtcgagcgcc ttgagtgcgt     63120
     cctccagagt catttcatcc ggcgcaggaa caaagcctga ctcactgtct tcaggcgctt     63180
     ccgcggcatc ctcattttcc ttgccttcgc cgtcagtgtg atcggcgacg tcctcttcgc     63240
     cttcgtcttc tccttcggac tcctcacgac cggcatcgga gtcttcgccg ttatcactat     63300
     ccccatcgcc agcggcgcca gagccataac catcggagtc atcggcgtct tcgcgaatgc     63360
     catcaccagg cgttggagcg ccagtgccat cactaccacc ttcgtcgtca gaatcacctg     63420
     attccatgcc ggcatcatcg gattctgggg tgtctcctga ctcatcttcg cctgcttctg     63480
     tatatttact ttctgtatca ctaatttctt tatcatgtat aggtaagtcc ttatctaatg     63540
     aatcaggcaa atcagaatcc ccagaatctt cctcttctga ggcatcatct tcttgctctt     63600
     ccttgtcgtc gtcttcgcct ttggttcgct ttggtgcaga ttcactatga gacggatcgt     63660
     cgcctgactc tggtgtttcc tcggactcgt ctttgctctt agacggcttt ttggcagatg     63720
     atttaagctc aggtaatttg ccctctggct tgtctttcat atcctgcatg atttgggcga     63780
     tagcagctgc gacctttacg cagtcctctg tgttcgacat attgcgaacg gccacgtcga     63840
     taccatgctc tttgagcaag gctacaggct tatcgatgag gtgccagtgt tcttccataa     63900
     agtcgatgaa agggctttgg ccatcccagg tgtcaacgac ggatgaaaag tgatccactt     63960
     atatctccac caacggccca atattgatcc accgttttac tcaggattag cttctgctat     64020
     aaccccggcc tttcgtttct gtctgagtcg atagctttct cctttgattt gaacgacatg     64080
     tgagtggtgt aagatacggt ccagcatcgc tgaggtcagt gctgcatcac cggcgaacgt     64140
     ttgatcccac tgcccgaacg gcagattgga tgtcaggatc attgcgctct tttcgtaacg     64200
     tttagcgatg acctggaaga acagctttgc ttcttcctga ctgaacggca gatagcctat     64260
     ttcatcaatg atgagcaggc ggggggccat tactccacgc tgaagcgtcg ttttataacg     64320
     gccctgacgt tgtgccgtag ataactgaag taacagatct gctgctgttg tgaagcgaac     64380
     tttgatacct gcacggactg cttcatagcc catcgctatt gccagatggg ttttccccac     64440
     acctgatggc cccagtaata cgatattttc attacgttct atgaagctga gtgagcgtaa     64500
     cgactggagt tgcttctgcg gtgctccggt ggcgaatgtg aagtcatact cttcgaacgt     64560
     tttcaccgcc gggaaggctg ccattcgggt atacatcgcc tgtttacgtt gatgacgtgc     64620
     cagtttttct tcatgaagca gatgctccag gaagtccata taactccatt cctggtctac     64680
     tgcctgttgt gacagcgcag gcgctgcgct tataaggctt tccagttgca actgcccggc     64740
     gagcgccatc agtcgttgat gttgcagttc catcatcacg ccactcctct gcagaatgag     64800
     tcgtagatgg agagtggatg atgcaggggg tgtttgtcga agttcaccag attttcatca     64860
     agatgcacgt catactcttt tttctccgga ggcagtgcca gcatggactg ctgctcttcg     64920
     agccagcgat cgcagggacg ggcctggatt gtttcatgct ttcgttggtt agcgacatcg     64980
     tgcagccagc gcagaccgtg gcggttggct gtttcaacat cgacagtgat ccccatcggg     65040
     cgcaggcgag tcattagtgg gatgtaaaaa ctgttacggg tgtactgcac catccgttcc     65100
     accttacctt tagtctgtgc cctgaagggg cgacacagtc ggggagagaa gcccatctcc     65160
     ttgccgaact gccacagcga aggatggaac cggtgctgac cggtctgata tgcgtcacgt     65220
     tgcagaacca cagttttcat attgtcatac aacacttcgc gcggcacacc accaaagaag     65280
     cggaacgcat tacgatggca ggtctccagc gtgtcataac gcatattgtc agtgaattcg     65340
     atgtacagca ttcggctgta tccgagaaca gcaacgaaca cgtgaagcgg tgagcgacca     65400
     ttacgcatag tgccccagtc aacctgcatc tgtcgtccgg gttcagtttc gaaccgaacg     65460
     gcaggctcct gctcctgagg aaccgagaga gaacgaatga atgccctgag aatggtcatt     65520
     ccgccacgat atccctggtc tctgatctcg cgagcgatta ccgttgccgg gattttgtaa     65580
     ggatgagcat cggcgatgcg ttgacgaata taatcccggt attcatccag gagtgaagca     65640
     acagcaggtc gcggcgtata ttttggcggc tcagattttg cctgcaaata acgtttaacg     65700
     gtattgcggg agatccccag ttctctggca atcgcccggc tactcattcc ctgcttgtgc     65760
     aggattttaa tttccataac tgtctcaaaa gtgaccataa actctcctga atcaggagag     65820
     cagattaccc cctggatctg atttcaggcg ttgggtgtgg atcactattg caccgttcgt     65880
     tacaccaggc gcggacgacc gggcaaagga agaatttcag gaacaattca cgctggttgc     65940
     cgtggcagat tgaaaccgcc tctgacactt tgcccttgaa gtatttgtcg atcaccaggt     66000
     tctgtgtggc tagcaaatta cgacgggttc cgttgaatac ctgtcccatt ctgcgttcaa     66060
     taaaaacgtc ttccagcgcg ttccaaagcc cggtagacgg agcctttcct ctctcgcgca     66120
     tcttcatcgc gactttcgga tcagtaaaga ggatatgggc tacttcatgg tcgagaaaac     66180
     cacgtactgc gttcatgagg gttggtgatg cgtcgtccgg tatagatggg atgtttacca     66240
     gcactggttc gccgcgccgg ttgtagcgga catacgcttc attgcctcgt tctgcaacag     66300
     gtatctgttt gcctgaaagc atcgctacaa ctcgttttac gcagtcgcgg aagtcctgta     66360
     cctctttcag cacagctctg gtcatggctt tggacatgag aatttccttg ttattaaaac     66420
     aatttgtttt ctaatgtgtg taattttatg ctgtacgaac aggtggccaa gctgttcgta     66480
     caggtttcaa taggtaggat ttgcagttaa tgggttctta cggcaagtga gccgcagcca     66540
     gtattgatga gagtgaaatg tttgttgctg agttcgaaag tgaagacagt cgtgtcgctc     66600
     atgtctatcg gaagttcttc agtattaagt tctgtaagta tcgttgccac gccatccatc     66660
     ccgagcgcat atgcatgtcc aacctcaagg gcgttcaaat tagaagttat atttttcatc     66720
     tcatatcata tcatccaact caacacgttc gaaagttcgg aaatactact acctattgta     66780
     tcaatacgga atacatctat atcagatttg tctgacaaac catgcaagct gataatgaca     66840
     atttgccgct taatagatgt ataatgcgca taggtaaagg gttttgatgc ctatcgaaag     66900
     aaatagataa gtctttacaa ccctcacctt taatgtaata tcagtaagca cttaccagag     66960
     acaaattaaa cacgcaaggt tattacatgg ctaccaacga aacagatagc aaacaaggtc     67020
     gctacgcggc ttatattgat tccctgatca ctatctcacc gaaaagtcag gctactattg     67080
     ccaaggaagt agggtataaa aacgccaaca acctgtctct catcaaaagc ggaaagatcc     67140
     ctctccccgt tgataaggta agagcgctgg ccgtagctct ggacgctgac cctgttcggc     67200
     taatgctgat ggtcctggaa gagcgtcacc cggagttgct tgagttcttc cgcgaagaag     67260
     gaacggctcc cctttccgca gacgaaaaaa gagtattaga agcgtttcgc aaccgtttcg     67320
     gtgatcaacg cggcgcatca gatcaggttg ttgaagcaat caagaaacta tgagaaattt     67380
     acacgaataa gctcagttgc tagacgatct cccttaaatt tgtggtcaat ttcgtctaaa     67440
     tcttgttgct ctacgatgga tgcgatgtac gctgagaatc tatccaaggc gtctcgcatc     67500
     tcatccatat agtcgtgccg gtcgtacacg cgatctatgc cttccaaact gtgattcatt     67560
     attttacgag ccacttcttg attgatcccc agggctggaa aataactacg agcggtacgt     67620
     ctcaggtctc gtggtgtgaa aggttccaaa tccatcagct ctgggcgctc cagaattctt     67680
     ctcaacgctt gtgcaatggc caccttcgac attggtgtat caacgccctt cttcttattt     67740
     gacggaacaa gccactggct ggccctttcc gtattcgaac aactcttcca cgcatttgcg     67800
     cattaatgga cttagcggca gcgcgtgctg tctggccgat ttgtttcgcg taccttgatt     67860
     ccatacatca cgttgaaggt tgaactcatc ctttctggcc cggagcactt catctggacg     67920
     cctggcagca acaagacata gccttgccgc ccactttgta ccttcacata cgttgaaata     67980
     atcccagata ttccagaata cccagacttc agcgtcggtc agcttacgtt cgcgcggtac     68040
     tggctttgcg ccaccggcaa ctttgttgag cgacatatca ttcaaaggtg aagtatcaat     68100
     caatccctga aaggcacacc agctcaggaa ctgtttcatc agggagaaca cgcgtctgcc     68160
     ctggacgatc ttgccttcca gtatcagtgg gttcaccagc tggttgacca agaccctact     68220
     tatatcactt acctttactt cagagatatg cggcatcaca tgtatcaaaa cacaatgaac     68280
     ggcaatttca ggtcgacgtc tcgttatcag taaggataag cgggtgaaca acatgaaggc     68340
     ggaagaaaac gacatgtctc cgtcgaaatt ggcggtcgac actgccgaca aaccggaagc     68400
     gcgttcgagg tactcgatgg cttcccgaga ggtattttct gctgcgcgtg ctttatcaaa     68460
     ggtgtttttc atcgtccact cactgagtga agccctttta actgtatgca tgaacagtat     68520
     attaggcata agtttttgta tgatcaacca taaaatagcc tgttttgtac aatgattcca     68580
     tacttaatag gtatggaatc atttttaccg gctatgaagg ttttgagggc tgcaggacgt     68640
     gggttgctac caaataaaaa aaccccgggg tgagggcaaa ggctgctttg ttgaagttgc     68700
     atggatgatg gatacccctc ttgctctcct caagagggtg agggcgcctg aaagaaatga     68760
     cgcaaaaggg agggtgatta taaatttcgg attatttcgc taataaaaaa caaaatccct     68820
     aacaacaaga tttccattaa aataattgcc acacctaaaa caataattct tcccgcagtt     68880
     aggcggatat gttgaaatcg cttttggaac accatatcct cgcttaggag aaaaaaattc     68940
     ccaccagata atatactcaa tggtattgca agtgcatatt aaggtgagag ttataaatat     69000
     gagcctatta tattgcttcg cgctctctat tcttagctaa tagtgtatta tgtgaaatct     69060
     attgagggcg tggctttctg cattagttcc taacattgat cttcacataa atttgtcagt     69120
     cttgctatca atgccgtgat taagaaaagc gagggttagg ctcaaagtag gataattcat     69180
     aaatattaaa ggagggcata atagccctcc tttatctatt atctatatgg attattggtt     69240
     agatacggtt acggttacag catcagtgta tttacctgct gcaagtttac cgcctttgga     69300
     accaattgag cgaacaaaga aatcctggct gcccgtagcc aagacgacgt catcccccac     69360
     aaggttctca ccgtttacct taggagagat atcaaaatct ctagaatcct tgccaatcac     69420
     ttttgtagtg aattggtggt tatttccatc ctgagaagta aatgttaagt acatgggatc     69480
     acccgcggca tctgtaaagt taacagatgt gctagtggtt cctgttttat agccgccaag     69540
     agtaagcgta ccaacaagta attctgtatc gatgtttcca ttgtccataa ttgtaattgg     69600
     agcgccttcc ttatatgtaa gagtgatgcg ggctggttca acaagagttg ccgttgcagt     69660
     ggtgcttgca gttaaatctg ccgcattagc agttgcaata gttccaaata atgcaatggc     69720
     gataacggaa ctgatttttt tcatatatta cctctatcga ataatccaat ccacgaacaa     69780
     attcgtagag agggcttgtg tcctgtttga aataaacatc cgtttcagtt atttaagatg     69840
     caggttgtgg ataacctata agcaccagaa atatccgttt tttctggtag aactacatta     69900
     gatgaacatg attgattttt atctctcccc cacttaacaa gtatttttga ttttttaggt     69960
     agtccagtca aatagacacc gctattatct ccgacaatgc cagagctgga tgattgccct     70020
     tcaatggtaa ctatagaacc aaatggaaca ggtttattgt cagagcgttt taaatgtaaa     70080
     aacaatcgtc caccaatcct tgcgttaaat tttgctaata ctacagctcc ctttgtcggg     70140
     atcacgctaa caatattatt tgttatctct gcatcattgg gtaaagtaac tgggttaatt     70200
     tctaccttat tctctctgta aggggttaag taaccataat tggtgtaccc cctaaagtct     70260
     gttttcatgc ctggccagta tcccactgaa gcaccgctta tatcaggggc ttgtactaat     70320
     gcaatagtat ctccagtttt ttggccagcc gttataccgt actgagttat taccatattg     70380
     ccatttacac ctataccaag ttggctttgg gtttgatcgt agctgtagtt accactgatc     70440
     tccccataag ttcctcgata attcaaattc agtgcattgg aggtatattt tctgcccttt     70500
     tcattaaaac gttcgcgaac gtcccagtat aattggcgat caaaggcttc accgtacaca     70560
     cctacctcat gggtagtgtt accatgagaa tctgatgtca tttggtaatt tgaatttatt     70620
     gagttattac ctagccagcg actgagagga aaactcaacc agatattaga taatagctca     70680
     ctagtttttt ctccatactt attgatattc tgtgtcttcg ataaatttaa agtcaatgac     70740
     ataccattcc taaaaaaatg gttatagcct acagaaaaag aagttgtgct cctactgtca     70800
     cgccaatagt tttttctgta gccactgaaa ttaagcgtcc ccgaaccagg tatgctttga     70860
     cttaaattga attgcacttt gtttttgggt ttagcataat caaaacggca atcgtttcta     70920
     gtattaggtt tacaataagt atttaacgtg tcagcgagtt tgttaaatcc ttctgtggcg     70980
     tattcctcgc tagcaatgtt taacgatgtt ccactctgca agtacttatt atatcgaacg     71040
     cgccaacgtt ggccgctttc ttttttttgt ttatttttct ggctgtctgc ttgagtaaca     71100
     tctgtagata tggcaccaaa atcacccaac atagcaccga tacccagagc tgcggcatga     71160
     taattttggg acccttgtag tccaccatat aacgtaagat tccttggcaa accatatttc     71220
     atcccaagag cgccaacata cgatgtttgt gtaagatcat tagctggacg atattctccc     71280
     cccatcattg aatattcgaa atagcccttc cgtaatgcca ctgctggtgt gtcatatgga     71340
     actgtaaaaa cttgctttgt tccatcactt tcatgaatga tgactttcag ctcaccactc     71400
     cccccaccca gaggaagatt tgctaactca aatggtcccg agggcaccaa ctcattactt     71460
     acagtgtagc catctcttaa aacctctacc ctggcttgtg tacgtgcgat accgcgaaca     71520
     actggagcaa aattccattg gtaataagga accatcgatt catctgaagc aatttttatc     71580
     cccttaatcg ggatactgtc aaagatactg ctatcagaat aggtttcccc caatgtcaaa     71640
     cggctcttaa ttgtattcaa tcctcgctcg gcataaatat acgaacgctg ccatccttgt     71700
     tgtttccacc atgaggttga actacgaaag cgccaagccc ctatgtttaa tcccggttgc     71760
     aactgagcat aataagagtc cagagacttg cctccttctc tgaattttct tgtctgcatg     71820
     ttcgtattat aattcatgaa cagagcagga atgccgtcat cccacaattg cattggcata     71880
     atgccatcaa atctaggtaa aagtgcctgt ggtggcacaa ttaacgataa tttctgctga     71940
     ttaaaataaa actgcacatc tgaatgtggt attgctaata aatcaacaca ttgctctgta     72000
     ccagatttta ttaaatcagg atatttatct atatcaatgc catactttgt caattgtaag     72060
     gatgataggc atggccaaag aagttctttt ccattatgtt tttctagacg gaagtcgata     72120
     tttccagagt ctacctttcg accatttaca aaaacattaa caaaataatt acctggaagt     72180
     tgaagtcctt gattaaaaag agatacatct atactctctc cactattcgt atcaagcata     72240
     gtagagtcaa aagtatatgc gcgtccccaa caaggcaatg ttgccaaagt taaccctgca     72300
     cacaggaaca gctttgaata cctcattatt cccgtcccct ttaaacatca tcataaagtc     72360
     acatttttgg aatacaaacg atccaaccct ccctgatcat taattattct ccacgaaaca     72420
     ttacgtgctc ccgctagtcc ttttggcaaa tcaaaagccc acgtcgattt aggtggaata     72480
     tagtgagaag gaatactttt ccctccaaat gttaattcac ctatgttcat gtagaaaggt     72540
     gaggggtttt cagcaattag cttcccccca tcaactttcc agcttaagtt ttcagcaaac     72600
     tgtatagggg ttccttttaa ttcattcggt cgaaccaaaa gcttaatgca attattaatt     72660
     gcgaattgca cgaacactcc cacatctttg tctggattga atttttgctt atttgtcgca     72720
     tcatcaaccc atatatcttc atcctttggt ggaatccctt ttacgcataa ccactttagg     72780
     ctctctttat ctcgcgggaa aacacctcca gcctgagcta tacgcaaaga attttgttgc     72840
     ttagcatcca atcgaaacaa tggcggagtg accacgaaag gatcctctga ttctttttct     72900
     ttattctcgt cgtagatcct agactgaatg agaaccggat aatcttgggt gtttttcacc     72960
     gagaccataa cgccagcagc atctaacggg tatatgatcc tactctcacc tatagtcacg     73020
     ccatactctt tgcttgcgaa tttgatatct ggttgagcag agttcgcagc aaaactaagc     73080
     atgccgaaag taataattcc taacgtactt aatctattta aaatcatgag cttaacctcc     73140
     ttacggaatg gtgacaacac cttcccaccc cctccccatc atttcatatc gacgatatgc     73200
     gtaaaaaggt gggtaacaaa tgaaggggat ttttatatcc gtagcacagc ctcactgaga     73260
     acaattttat ttaaaaatgc acacaaagtt tagcttttcg cgcactccac ttgcttgttg     73320
     cgcaaatagc taattttgat attgatgcgc gtgcacaaat agctaagatt ggtgttgctg     73380
     ggtatgcgca aatagctaag tcccggcgcc ggcccactat ctagaatgct attattttga     73440
     tttgggttat attcatgcta aaacagatga ctgtaaattc aattattcaa tatatagaag     73500
     agaatctcga gtcgaaattc attaacattg actgtttggt tttgtattca ggattcagca     73560
     gaaggtattt gcaaatttcc tttaaggaat atgtcggaat gcctattgga acatatatta     73620
     gagttagaag ggctagtaga gctgctgcac tattacggct taccaggctg acaataatag     73680
     agatatcagc aaagcttttt tatgattcgc aacagacatt caccagagaa tttaagaaaa     73740
     tatttggtta taccccacgg cagtatagga tgatcccttt ttggtccttt aaaggtttgt     73800
     tgggtagaag ggaaattaac tgtgaatacc ttcaaccacg aatctgttac cttaaagaga     73860
     gaaatataat tggtcaatgc tttaatttta gggatttagt gttctactct gggatagatt     73920
     caaaatgtag attgggtaag ttatatgatt cgttgaagaa aaatacagct ataacagtat     73980
     caaacagaat cccctttcat gataaaacga atgacattat tgcaagaacg gttgtttggg     74040
     ataggaataa gcatttcagc gatagtgaaa taaaggtaga taaaggcctg tatgcttatt     74100
     ttttcttcaa tgatacatat gatcagtatg ttcatcacat gtacaacata tattataact     74160
     ctttgcctat ttataattta aataagcggg atggttacga tgtggaggtc ataaaaagac     74220
     gaaatgacaa tactattgat tgtcattatt ttctcccgat ttattgtgat gacatggagt     74280
     tttacaatga aatgcaggta tatcacaata atattgtgaa gccggaaatg tcagtaacat     74340
     taggattacc aaagagttaa ttattttgga tttcacagcg ttgaggccac tgaaccgatt     74400
     tatgttcgac ccaacatatt gatcagtcac tacagttctg tggaatcacc tgtatgatta     74460
     aaagaaaaaa cagtgacctc aacgttgtgc gctggctaac cgagccagcc gggttacgtc     74520
     gccgctttta acccaagatt aaacgacata agtaatggaa atgacgtaac aggatggacg     74580
     gtcagctggc tgaaaccggg atgatggaat ggaatgagga aaccaaccgc ccatcctgag     74640
     actgtaaaca atattgtgta attgcctgtt tttgatatct tcactccaac aacggagaca     74700
     ggcaaattat ggacgaaaag aaacttaaag cacttgcggc tgaactggct aaaggtctta     74760
     aaaacgaagc cgaccttaat gcattttctc gtatgctaac aaagcttacc gtcgaaacag     74820
     cgttaaatgc agagcttacc gaacacctcg ggcacgagaa aaatacccct aaatcaggct     74880
     cgaatacccg caacggctat tcgtccaaaa cactgctatg cgacgacggc gaaatcgagc     74940
     tgaatacgcc acgcgaccgc gaaaacacct ttgaaccgca gctgataaag aaaaatcaga     75000
     cgcgtatcac acagatggac agccagattt tgtccctgta cgccaaaggc atgaccaccc     75060
     gcgaaatcgt cgccaccttc aaagagatgt atgacgccga tgtgtctccc acgctgatat     75120
     ctaaagtcac cgatgccgta aaagagcagg ttgctgaatg gcaaaaccgc caactggatg     75180
     ctctgtatcc cattgtttat atggactgca ttgtcgtaaa agtccgccag aacggtagcg     75240
     tgataaacaa agcagtgttc ctagcgctgg gcatcaacac tgaaggtcag aaagagctgc     75300
     tgggcatgtg gctggcagaa aatgaaggtg cgaagttctg gctaagtgtg ctgacagagc     75360
     tgaaaaatcg cggtcttcag gacattctga ttgcctgcgt ggatggcctg aaggggttcc     75420
     cggatgcgat aaacagtgtt tatccgcaga ctcacatcca gctgtgcatc atccatatgg     75480
     tacgcaacag cctgaaatat gtgtcatgga aggactataa agccgtcacc agcggtttga     75540
     aaatggtgta tcaggctccg acagaagagg cggcgctgat ggcgctggat aagtttgcgg     75600
     aggcctggga cgacaaatac ccgcaaatta gcaaaagttg gcgtacgcac tgggaaaatc     75660
     tcaatacatt cttcggctat ccgcccgata tccgcaaggc tatctacacc acgaatgcca     75720
     tcgaatcggt gaacagcgtg atccgtgcag ccattaaaaa gcgcaaagtg ttcccgacag     75780
     acgactcagt gcggaaggtt gtttatttgg cgatcaagga tgcatcaaaa aaatggagta     75840
     tgccgatcca gaactggcgg ttagcgatga gccgttttat tatcgagttc ggtgaccgcc     75900
     tgagcgatca cctttaatac ggtggcagtt acacagaatt atggacaggc tctgtttttt     75960
     gccacacgta aacgtgaaat tgaaaactat ctttgcccag atctaataag agatgagaca     76020
     ggggttcagg tttttttcac agacacatgc gacgcaaaaa aaccatagga agggcaacca     76080
     gcacgaaacc taacgacgta ctggacaggt tctggccctt aatgactgcc gaaaaaatca     76140
     taaaatgctc tacttataga gatgataata atgacaaaat tgagcttata gacattcttg     76200
     aaggcattgt ttcattagtc gattgatcgt gacctacgtt gcatagcggt gtgtcagtta     76260
     agcctctgtg taacgttatt gtgctcaaaa aatgagctta acgaatggaa gggacttccc     76320
     ctgattatga acctgattaa ctcttgtgca atcatgggat aaatatcact ccggagggat     76380
     tcgttatgac catcactact gtcggtatcg atcttgctaa aaacgtgttc gctgttcact     76440
     gcgttgatca gaatggtaaa acggttctgg ttaagcccaa agtatcgcgt gctgcacttc     76500
     ctgagctgat tgcaggttta cctccctgtg ttatcgggat ggaggcatgc tccggggcgc     76560
     actactgggc gaggctgttt cgagagtatg gtcatgaacc gcgcctgatg gctgcaaagt     76620
     ttgtatcgcc ttaccacatg gccggtaaat caggaaagaa tgatgctgcc gatgctcagg     76680
     ctatctgtga ggctgtccgt cgtccgcata tgcggtttgt gccagtgaag gacgaaagcc     76740
     agcaggctat gcagtgttta catcgtaccc gacagggttt tatcgaagag aaaacagcaa     76800
     cgtataatcg cctgagagga ttgatctctg aatttggcgt catcgccccg cagagtactg     76860
     atgccttacg ccgcatggtt tctgagcaga agaattcttt accgttccag gttcagcaat     76920
     gtattgatga tttgctggag cacgttgatc gcattgaagc caacattgct gactatgacc     76980
     gaattttgtc ccgcatggcc aaaacagatc accgcagtca gcgactgatg gagctgaagg     77040
     gagttggccc cacaacggcc tgtgcgctgg tcgccagtat cggtaatgca catgatttta     77100
     agaatgggcg tcaactggcc gcctggctgg ggctcacgcc ttcacagtac agcagcggcg     77160
     gaaaatcaaa gcttggcagg ataacgaaag ctggcgattc gtatctgcga acactgctgg     77220
     ttcagggggc ccgttcagtt ctgattggcg ctgataaaag gactgattct ttcagtcgtt     77280
     gggtttgtac gctggttgaa cgcagaggat actggcgtgc tgttgttgcc atcgccgcca     77340
     aaaacgcaag gctgtgctgg gcatcattgc attacggtga tgatttccgg ctgtactcag     77400
     ccagctaaag cactaagtag tataaccatc tgacctgcaa ctcgttgatg ataaagggtt     77460
     agaccccgtg aggcctatct ggctattgta caggatatac gtatccgctt aacgaacaag     77520
     aacctcacgc gcgtctttca tcagggcccg aatcgatgac gattcatcat ggccgtttat     77580
     agtaccgcag tctctcccct ttatttttac tgaagagcag acagaaacct tgaataccga     77640
     cgttgacatg ccggggaagc ccttatagta caataatttt cgatatccaa actgacccca     77700
     acttcaagtt tgcctttctg ttcaccgagt tgaattcctt tctcgatgcc cttctcgata     77760
     cctttctgtt caagctgttg tgcgatggtc atgagtgcgt ctccatgctg cggcacacgc     77820
     tgtgccagtt cgcgaacaaa ggcttcggag tcagcagact cgccggcctg taataaatag     77880
     tgtatcagcg ccattacctg cggtgaagac agataatctg ccatcagcaa cgtagccagt     77940
     ctgtccgtca gggtggctat atcacgttaa gaaggtttgc tctgccgcca gcggcaggcc     78000
     tatagggtca ccaccaaagc acgccagagt gctgaagtat cgcctaacct attgaatcag     78060
     aattttaatc cactgggaat taaccaggtg tgggtgagcg atatcaccta tcgtgtgccc     78120
     ggagttcagg gcgagcatgg acgctcaaat gaaccacgag tctgtctgga atattgaacc     78180
     ggtaactcac gatgagaaac ccaacaatcc taccgggtgt gacggtggag aacctgagcg     78240
     gcagtgacct gcggcatgcc cgcagggtga tgtaacccgc tgacaacggg gattgaggcg     78300
     agatcactaa gccgagatga tcctcaaggt taagtgctga aaggctgaag aacatgaacc     78360
     cgttaatccg cctctgtggg ttgaaaatgt caccacggcc tatgtgatct gacaggccgt     78420
     gcagaaggca ccgacattga tagatatgca gtgttggtcg aaagtgtttt gacatgtaag     78480
     cagaacaccg ggacagcaac gtctatcacg ctcgcgttgc tgacttctgc caacttgcgg     78540
     caagcaagga caaagagtgc gacgggcagc ctcctcagta tgtctgagtc caggcaggtg     78600
     aaccggggaa ggtcagcgac ggatgttaag ggggcatggc tccgatgacg cgctggctgg     78660
     cggagcttcc atagtagtcc gcgatgggga aagcccatta catggcgaag ggaagcagtt     78720
     taaatgtgtt tgcgacgtga attaactgac ctaatgaggt gaagaccttt gataatcagc     78780
     gaaatgcaac gcaagcttgc cacatgggca gccaccgacc cgccccgacg ggttgaacgg     78840
     ctgctgcgtc tgataacaca accagaatgg ctggctgaag cggcgcggat cacacttgca     78900
     tcaaaggggg cgcatacccc cggcgttgat ggtgtgaaca aaacaacgct acaggccaga     78960
     ctggctgctg agctacaaat actcagggat gaacttctct ctggttgtta ccaacctctg     79020
     ccagccagac gggtttatat ccccaaaagc aacggcaaac agcgaccgct gggtatcccc     79080
     acgctgcggg atcgtattgt tcagcgggcc atgctgatgg cgatggagcc tatatgggag     79140
     agtgattttc atactctgtc atatggcttc cggcctgaac gcagcgtcca tcatgcgatc     79200
     agctcaccga ttgtggggaa acacgagggc gctgggtaat tgaaggcgac ctgtcgttta     79260
     acttgaccag aacagtccag tatggtcgtt attagaaagt ccacttcgct aagaagactt     79320
     ggggcgcatg gcacatgcgt aaaatatctc ggacgctacc taaaacgacc accgatgtcg     79380
     gcgtcaaaac tgcgacgaaa cagagatgat aaccatcatg attattagca tgatggttta     79440
     tgtgatttat gactgattat tacttactag tgtattctag tcatcaattt gggcttaatt     79500
     ttggaaatgc atgtgggcta gaatatttcc acaatggttc ccagtaagat ttcattaatt     79560
     cattaactgc atcttttcct tcgactaaat agtcaaactc tgacagataa ccgggataaa     79620
     gattatctga tccaacaacg tacaactcat cgtcaataat cattaatttg gcgtgattac     79680
     caggtgcaac agggacttta ggatagaaaa gtccactacc tttaattgct gacattagtg     79740
     cactaccaat aataccttga tgcgggggtt tttccgaaag tggtttttgc ttaagtgttg     79800
     cagtataagc gctttgttct aaatcaggcc acttgtaggt ttcgccttca attgtatttt     79860
     catcaggtac tttatctgta aagaagaatg gtgcaatcaa tattcttttt aaggcatcag     79920
     cacggctacc atcaggatcg tctaatactt catcggtatc aatatcatgg gttaggtaat     79980
     acttaaataa ttcataggtc cgttctgctc cagaaccaaa tgagtactga tcaccagcag     80040
     ctccagctgc tgcatctaga gcagagacta caacatgaat atgaagatct ttattttcta     80100
     acaaagcctc aataatccaa ttacacgtaa agtggtcttt ccattttttt ttccaagcac     80160
     tcacgagatc ttgctgtgaa attctaatta tgcgcttagc attttttatc agttgctctt     80220
     tcattatttc agaccctctt tggtagtcat gctccatatt aggtcctgtc caatatttac     80280
     ctactgataa aactctgtct gcttttttat actcttccat gttttcgtat tcactaatac     80340
     gagtcgctac cttctgatta aagttttcat gcaagttgag taggtcctct tgccgttgct     80400
     tcatataatt catagcaact gagcttttaa gcggatcttc aggcttatca tagaactttg     80460
     ttccgaccgc ccacatcatg ctttcataat caaaatattc tttttttagt aaatctgaat     80520
     tacatgacca tagttcgtta agatatagct gggagccata agcagaagaa ccatgagtga     80580
     taattgatac atcatgaaca ggtggataat ttctaaatag atccatgttc atgttatgtc     80640
     caccaacaag agcttcagta ccatctgagg ccattatttt tgtgtgattc catgtcattc     80700
     ttgtatcgtt gattggtggg aaatcaggat acacgtttct cataaatgat gtagccaacc     80760
     cttcttctat tctaaagaaa cggcctagcc aaatttcagg cattttttcc caatattgtc     80820
     ctcgctcctt aattagctga attaactctg atttaaaagc aacaaagtca ggggagccat     80880
     ttgttgcagc agataaccca ttcataaata ctgttggaga ttggccgaaa agaaacctat     80940
     actgagttgg ctgagttcgc cccatttttt tcgataagga ttcatcaatg gccttaaaaa     81000
     tcacttttcg ccactctgca tcggggctat taagtgatga tatatcacag cgataacgcg     81060
     aattccgcag tacttcagtc attgcccctg caaactcctc ttgccgtaag taagattgct     81120
     gcatgatttc tttaccaaat ggggctcccc aagcatgggg ggtatccaga agtcgtatat     81180
     aattaatgtt acttagatga tgaaagtagt ttccaatatt attaatgaca ttatctattt     81240
     gaagcatatt ttatcctttg tttatcgatg tgttaataaa tatcgccgtt gcagcaatta     81300
     atagcgggga gatagcgggg tactttacgc ccatagtcgg ttaaactcaa cctgatattt     81360
     tcccgctatt tcaggcgcac cacgtatgac gagaacattt tctgcattgt gagtatcgcc     81420
     attggtggtg taattcattg accctgtttg tatcgtgtca ccatcagcta tcatcacctt     81480
     gttatgatga attgaatagt tgttatttaa ccttaccgga acatgttgtt gtgccagata     81540
     gtgaatggct gaatagttca gacggttagc tttggcatca gcaacaactc ggacgttaac     81600
     ccctcgcttt tgagccgaga caatggctgt cgagatctgc ttacttgtaa aagtataggc     81660
     ttcaacatcg agcgaggatt gagcattatt gaccacgctt aatacattct ctaatgcagt     81720
     gtgagaagga gagaatccaa cattaaagga cggggttgcg agcgccgaag cgctgaccag     81780
     tacaaaaatg atgactgaga gtttaaatct catgagttat gtccaaagtt tgtagttcat     81840
     ccattatgta aaaccgaaaa aaaacgccta tgtttggctt gctgtatcga gctttggctt     81900
     ttatgcttcg ctcggtttcc attgtggcga tccgtcggcc gttcggtaag gtaatcagcc     81960
     catcaggacg gtgcttgacc ttaaactgat ttaaaaagta ttacggtcac ttttaatcta     82020
     atttttagcc ccttcttggg cgaatatcaa gtgaaaacgc tgttgcgata aggtctgcta     82080
     aaaaacaggc ttaccgtaca ttttttgaat attaaacata atgtaggctg catcaccata     82140
     taagtccaca tacatagtaa tggtatgcga tgcctacatt ttgtgactaa ctttgcataa     82200
     tcatataagt tttatataaa agggtttgag gttcagtaga acggttttac atcttaatat     82260
     tttgtatgat aaatcatagt gttatagata acaaaaaaca ggtgcatagg ggcgtttttt     82320
     taggggtctg aagctaagtc aaacgaaaga ctcacgttag gcgagaaagg tcgtctgaaa     82380
     aatcgattaa tggacagcga tgtccgttaa atgctattta ccgattaaaa agacaccgtt     82440
     ttaggcgcat ttttcactgt ctataatgtt ttgatttatc ggacaaaaag cccttaacgt     82500
     gtgaaaccgt tccgttgagc gtcaaacccc tattaacgtg gaggacgtat caatgtcgcg     82560
     tcgtggttta cgtttatcac agctgccacc ggtacgttcg gaaaagccaa aaccggccaa     82620
     aacgtccgcg cagctcatgg cggaagatac gctgcgtgag ttaattgccg cccgctttgc     82680
     cgtgggaaaa ccggttatcc acattcatgc aaactggaat gatgcgctac tactgcgggt     82740
     attgaaagaa gcgatacacc aagctaaagg cccgccgttt gtggtggtac caccgcatct     82800
     aaatgaacat gagaaagaga acgactagcg agcgctagtc gtttaaatga ttagtggcgg     82860
     atttgcgcca aatcgtcttc agaaaggccg gttgcttctt ggaccgactc aatcggcatg     82920
     cccattttta acaaactgcg tgccacttcg agtttgcctt tctctatgcc acgttgttca     82980
     ccgagttgaa ttccttcagt acggccttcc atacgacctt tttctatgcc cttctgttca     83040
     agctgttgtg cgatggtcat aagtgcgtct ccgtgttgcg gcacacgctg tgccagttcg     83100
     cgaacaaagg cttccgagtc ggctgactcg cctgcctgta ataaatagtg tatcagcgcc     83160
     atcacctgcg gtgaagagag ataatctgcc atcagcaacg tcgccagtct gtccgtcagg     83220
     gtagcaatat cacgttgatg aatatgcttt tgcagcagcg tcagtgccgc catgctgcgg     83280
     tgctccataa tatcatcgtc tggaataacc gtcacatcaa ccagtggaaa tgcaccgcta     83340
     tagagtttat gtgccaactc agggtcgtca aactcatcta accaccgcgt ggagtacgga     83400
     taaggactgc gtttacccac gtaaaagagc accggtatca ccagcggcag cttagcatgg     83460
     cccgcttcaa ggtggcgttg catggcagcg atcgcgtaac gaattaagcg aaaagccata     83520
     tgcttatcgg gtgagctttg atgctcgatc aacacatgga cgtagccctc gccttccacg     83580
     gtatcgaggc tgtaaagcac atcgctgaag tactgacgca aatcatcttc aacaaaggag     83640
     cctgactcca gctttagcgt gctgaggtcg cagatagcgc gtagctcagc gggtagatgc     83700
     aactccataa agtcacgtgc aatctcgggc tgggtgagaa actgcctaaa tgtggcatca     83760
     tggggtgtgg gggtactgtt tttcttcttc atcagctcag actctgaaaa atgatgagtg     83820
     aatgctatca caatcaaagc aatacaagat gttaagttta cccctcagct tgctggcaga     83880
     cgcggatcac cgtcattttg gatacccctg cgagacgggc tgtttcacgc aatgacttac     83940
     catgcaatag gcgtagcgtt cggatgagct cgtgtttttg tgcatcagcc accctgcccc     84000
     gatatttacc ttccgctttc gctttgctga tcccttccgc ctgacggcga cgtcgatcct     84060
     cataatcttt tctggatata gccgcgagca tatccagcat catgccatta acagctttga     84120
     gcatgctgcg agtgaattca tcgctaacgg cgttattgag cgccaaatga ctggttggta     84180
     aatcaagact cacgatagac agctgcttat ccgttatctg ctttcttagc gcttcccatc     84240
     ctacgtcgtc caatcgagaa agcctatcca cttgctcaat gagaataata tccccaggct     84300
     cagcctcttc caaaagttgc acgagttttg gacgtgtcat cgttgcgcca gagatattgt     84360
     cgacatacca gcctgcaatt cggtggccat gtaggcgagc aaaattcttc agtgcatttt     84420
     ttgcgcgagt ggcatcttgt tcagaggttg atgctcgcag ataaccaaaa atgagcattt     84480
     tttagccttg aggtaacgtt taagtagtca ttttgttaat ggtatcactt atgtggtcac     84540
     attgatatgg aataccatgt tttaatgcgg tatctcagaa gtatacccga atgtgacagg     84600
     ctgacgcgcc cgtagggctt atccaaccct tcgcctcaga tgcaagctct gaacagactc     84660
     acggttttcg tttctggtca aattctaatt aggcgtttaa agagaaggtt ttgtatatcc     84720
     tgcctgtggg atagtattgc gtgtgctgtt attacattat cctccactga gtacaatact     84780
     ctgtagccgt caggggtgtt gcactcacga tatttagcac aacctatctt gagtaactcc     84840
     gggcagacct gacacccaag tggaaaatca ctgactcgtt tttcgaagtg ctcaatgatg     84900
     ccgctgatca cttcctttgg ttctgactcg atatgacgta agtggctcgc aatatcatca     84960
     atgcaggttt tgacagttct ggtgtactga ataacaatcg ccattacaga cccgccagta     85020
     gttgttcttt actgaaaata ttgccgtctg ccttatcttg ctctgaaagc gtcagcaact     85080
     tcagtagtgc aatcgcgttc tgtcgctcct gttgcgcgtc gtatgactca ataacatatg     85140
     ccggaacccc attttgagta acaagaattg gttcttccag atcgagtgac gctgcgtttt     85200
     ttttcacata gctaatggtt tcaattttca taacaacctc acataacaaa gaggtttaaa     85260
     tatagtctat atttggtctt gttgcaacaa tttctggaca gaatgacctg aatgtcctag     85320
     ctgtgtagtg attacttgtt accaccatac cctccacccc ctcgcctgct cagaaacgat     85380
     gtctaactgc gcggtttgat gtgaatgatg gttggatacg tacaataatt taatgacaat     85440
     acaaaatatg ttgtacattt tttgtgtgta tgtacaatgt gattgaactt tataggcaat     85500
     atatgggcag ggaatctatc tcaggggaaa ctatgaaacg agattacggt agtgtcggta     85560
     ccatagcgct cagagcaagt gctctacttc aggcaatgag tcgggatatt gaggaacaaa     85620
     gaaaagaatt caatctgaca gaatatcatc aaacatatac tcgtaatgcg gtcgcaaaat     85680
     tgcctaagct gagccgacgc atcgtagagc tggccgttaa agaaatggaa gaaagcggct     85740
     atgaatttaa taaaaagcag gttggcaacg tcgagcaata tgcactaaca attcagaacg     85800
     ttattgatat atatgctcac cgacagatac ctaagtaccg tgatattcat aaagcacctt     85860
     acgtaatttt tgtcgtcaac ctaaaaggtg gggtatcaaa aacagtcagt acagtaacgc     85920
     tggcacatgc attacgtgta catcaggatt tgcttcgcca tgatcttcgt attttggtta     85980
     tagacctcga cccgcaggca tccagcacca tgtttctgga tcacacccac agcatcggca     86040
     cagtccttga aaccgccgct caggcaatgc tgaatgatct ggatgctgaa acgttgcgag     86100
     aagcggttat acggccgact attattccag gtgttgatgt tatacctgct tctattgatg     86160
     atggtttcgt ggcgagccag tgggagtctc tggtagcaga acatttacct ggtcttaaac     86220
     cttctgaagt tctcagaaaa acaatcattg accgtatcgc tggtgattat gattttgtct     86280
     ttattgatac tggccctcat cttgatccat tccttctgaa tggcttagct gcgagtgatt     86340
     tgcttttgac ccctacccct ccggcacagg ttgatttcca ttcaaccctt aagtatctga     86400
     ctcgtttgcc agaaatgctt gagcgtcttg aagaagaagg tgtagagcca cgcctgagtg     86460
     caagtattgg atttatgtca aaaatgacca gtaagcgcga tcacgaaacg tcccatagtc     86520
     tggctcgtga ggtgtatgcg agtaacatcc tagactcatc gctcccgagg ttggacggat     86580
     tcgaacgatg tggtgagtct tttgacacca tcattagtgc taaccctgtt tcgtacccgg     86640
     gaagtgcaga ggcattgaaa aaggcacgta ctgaagctga acggtttact aaggccgtat     86700
     ttgaccgaat tgaatatatc aggggagcgt caaaatgaaa caggttatag ctcgtggtcg     86760
     ggttctggga aatagtaatt cagagttcgc tagaatgctc gaaggcgacg gtgatgttaa     86820
     aacatttacc cttaaatcag gcgtgcaggc taggtttgtc aaaacagttg tgttaagcgg     86880
     agaagttgaa tcaaaaacgt tcgttgatgc ttcggttaat ggacgtgatc agacaatgct     86940
     tacgcgcgag tccgtcagtg atatttcccg gacgataaag ctgcagcagt tctttccggc     87000
     tattggtcgg gaggttaatg gactaattga gatattagat ggaacccgac gtcgtgctgc     87060
     ctgcatcttt aataacgtta aattcgaaat tctggtaaca aaagatgata tctcactcgc     87120
     cgatgcacgg cagttggcga aagatatcca gactgccaga gaacatagtc ttcgcgagct     87180
     ggggaagcga ctcgaagtta cctacggaac cagcatgacg aaagaagata ttgcgttgaa     87240
     agaaaatctc tctccggcga aagtgacacg tgcgtttcag gccgcagcag tgccagacga     87300
     aatggttgca gtgttcccgg tgataaatga tatttcgttg tcagattatc agtttttact     87360
     gaaactggcc gaagaagcaa acaacaagca aacatcggta acagagctga tggaaaaagt     87420
     tcagcatcgg ttgaagacca tgccagatta tccggcaatt gataaaagca aaattcttgc     87480
     ggttatccgg tcggagagca aattgctgac agccctccca actagaacgg ttcaaacaga     87540
     gaagctgaga gaattttcag atcgtaatca gtttgccaga aagaaaactg atccaaagaa     87600
     gcgacttgtt gtttatgagt tttcccgtat ttccgctgag gcacagtcgg agattgataa     87660
     ggcaataaaa cgtattctgg aaagacttcc agaatcaggt gagtaaggga taaggatgcc     87720
     gaagagcatc cttttttgta tgtttttcac cacgccaatt tcatggttat ttgtttgatt     87780
     ataaaggaaa attgaaaatt ctttcacact gaaatcacca cgcttttcaa cctcttcgtg     87840
     actcataatt tcgctattgg cagttcagac cagcgagttg tataggcagg cgaaagcatc     87900
     tcccgtttta tatgccattc agacgctacc ccttccagca aaccacactt ttcccagaca     87960
     tgaatatcca tgtatctcat ctgttccaac ttatgtaatt tactttctcc atttacactg     88020
     cgttgccatg cactcgcttt caggaaatca gtataatagc ccctaaatca tcttctcgga     88080
     gtgaatggac atggctattg caggttgcga tttaccaact tttgccaccc ggctcaatga     88140
     agtgcttact ctcagtgtgc cagtgcgtac acctgaaaag ctttttgggc gggataagca     88200
     gttggagacg atacaactgg cacttcattc accgggccga catgtgttca tttatggcga     88260
     tcgcggagta ggtaaaacct ccctcgccca cacagccgct tcgcttatcc agtcttcgga     88320
     taaccgtcct attaccgtca gttgtgacca tgactcgacc ctggaaacag tcatcgaatc     88380
     ggttattagc caaggaatga tgcgcatgcc ggtagaccgg tacaaaacgt ctgcaacttt     88440
     tggtctcaat attcctgttt taaaagccga agcccgtgtt gaagagcgtg aaacttctcg     88500
     cgttcgttca gtcgttaata tggccagtgc tgttgaagcc ctgaactatc tgacggaacg     88560
     ctattcggat aacacggtta ttgttattga tgaatttgac ctgatccgta gcgaggagca     88620
     gcgtgcccgc tttggtgttt tgctcaagca gttaagcgat ggggatgtac ccgttcgtat     88680
     catcttcacc gggattgggc agtcggtatc tgatttgatt ggcggacatc tgtccagtca     88740
     gagacagatt gagcaggttg atcttgaacg tctgcactgg acaggtcgtc agcgtatcgt     88800
     tgaaagtgca tttagatatt ttgatattaa tatccctgat gatatcgcag accgtatatg     88860
     cgcgttgagt gatggatttc cctactatgt ccatctcatg tgcagcaagc tccttcatga     88920
     gtgttacatg gcagatgaag tcgttagcac agttacacgt gatctatttc tagcttcgct     88980
     cgatgcagct gtattgtctg ctgaggaaac gctcagatca tgttatgagg cagctacctg     89040
     ccgagatgag catatgcatc acattctttg ggcgatggct gaaggtgcag acctcaacag     89100
     aatgaaagac cacatcatta cctcctatat ccaggtgatg aagtacctcg acattgaacc     89160
     tctgacgcag aaaaacttcg acagtcgttt tgctcggctt cgtaaagaga atcacggatc     89220
     tattctgtgc catgcgcttg tcgggaagga tggtgtccgg ccaggatggt ttcggttcag     89280
     ggaaaacatg atcagaggct ttgtcagaat gcaggcagag aagtgcggaa tagttctgga     89340
     ttttgatcgg cagtatagcg cccatacagc aagtaccaga acagctgcag ttagaggggt     89400
     atacaatccc ctcagcacgg tggaacgcag cgtagctcgc ctcagacgtg atgatgaaaa     89460
     ggaagctgaa gaaaacgaat aacgtatttg taaatgaatg gaatacccgc gaattatata     89520
     tgcaatactc gggtattcag cgtttgcatc atgtcgagtt acccgtacag cggagtcttg     89580
     ctcttctcct gtctcttgat caggcaatta ctcaattttc gaggctaaca tcttaatgct     89640
     gttttagtgt cgggggatgc tgctaacatc ttcttcaggc tgtggggcac gaccaggcgc     89700
     attgaacgtg atagtgatga tctttctggc cagcccctcc tctgaaaggg catcatccac     89760
     actgacatca cgaatcagtg gactttcctc ttctatatgt cgggcaatat cccgcagcca     89820
     ctctgccagc atttctctgt ccatctttct ccgctccggt tgtgtacatt cagcatcaac     89880
     ataccacacc agaaaaagtg aagtctgcgt agtgtggtta aaagatgacc gttttgtcag     89940
     gcgcgctgtc atccgtgctg gtagcgacct gcgcggaata ccctcatttt atacacagga     90000
     ttgcccaccg aaattgtgga cagcaacgat gaaaatacga tgtcgctgcg ctcctcattc     90060
     atatcgctct gctgtgaacg ccgtgccgct actgtagccg ggccgctgcg aatgcaaggg     90120
     ttcgctctgc cggtgtcctc acccggtcgc agtttatttc aaaggcttta cccgctgtct     90180
     tcccgtcgtt ttccgtctca attttcgccg tcaaaccgtc cagccagcgt gggctttttc     90240
     actgcgctgc ggcttgcggc accgcccctg cattctccgc ttttcgcccg gctgtcgtat     90300
     cggcacggcg taactggcgc cgcatttgag aaaggagaac taccatgtcc cgatttatcc     90360
     agggtaattg cgtccatatc atgtccggct ttccggataa tgctgtcgat ttcattctca     90420
     ccgacccgcc atatctcgtc ggttttcgtg accgtcaggg gcgtaccatc gccggcgata     90480
     aaaccgatga atggctgcaa cccgcctgcc atgagatgta tcgcgtgctg aaaaaagacg     90540
     cgctgatggt gagcttctac ggctggaacc gcgtcgatcg ctttatggcc gcctggaaaa     90600
     atgcgggatt cagcgttgtc ggccacctgg tgtttaccaa aacctacaca tcgaaggccg     90660
     catatgtggg ctatcgccac gaatgcgcct acatccttgc aaaaggccgt ccgcccctgc     90720
     cgcaaaaccc gttgaatgac gtaattgcgt ggaaatattc aggcaaccgg caccacccga     90780
     ccgaaaaacc cgtaaccagc ctgcaaccgc tgattgagtc cttcacacat cccggcgcga     90840
     ttgtgctcga cccctttgcc ggcagtggct ccacctgcgt ggccgccctc caggctggcc     90900
     gtcgttacat cggtattgaa ttgcttgagc agtatcaccg ggccggacag cagcgtctgg     90960
     ccgccgtccg gcgcgccatg cagtacccgg ccgctaacga cgagttcccg gaggccgcgt     91020
     aatgaactat gcaggacacg aaaaactccg cgcagaagtg gcggaagtag ccaacagcat     91080
     gtgtgacctg cgggcgacgc tgaacgggat ggagcaccgc tatcgctttg actctgatgt     91140
     gctggtcgaa cgcctgaccc gtcagaccct ttttcgcatc aatgccctgt ttatggcggc     91200
     atacaacgaa atgcttgagc tggatgcctg ctttaaggac taaggagaaa aacatgtacg     91260
     gaacctgtga aaccctctgc cgcttgttgc gtgagcagta tcccgcagaa accccgctga     91320
     acctcattgt ctggtccccg gcggatatcg aagcactggc cgacggaatg gaatatgccg     91380
     tttcggaaca ggacacaagg gcggtactgg cgcgtatgga cgccataccg gaagaacaac     91440
     agcttgagtc gggcgtgtct gccggtgcag tgatggatct gattgaacag gtgaaagagg     91500
     cagttccggc ggtgatggtg ccggcggatc tgcttgaaac cctgctaacc actgccgaac     91560
     aggcgttatg gcacagggaa tggaccgccc gtgacagcaa tcatccggtc ccggaaagcg     91620
     ttacccgccg cctggctgat gcggcgaaag ttcgcgcatt actgaaaaaa tgaaatcaac     91680
     acgccgcccg ggcggcgtgt actgaccccg ttcagaggaa cccattatgc aggaaaccac     91740
     cacgttaaac gcccttgtga tgcgccgtgc gcgcgatttg attgctgatt atggatggcc     91800
     tgaccatacc gatgttgatc agcgtgatcc ggtcaataaa ccgggatgga taagcattta     91860
     tgtccgtctg gatgcggcaa atattgttca tctgcttcct ttactttgta gcggtgacat     91920
     acccgcagag ctgcaaaatg ccatgacaaa aatagccggg acgtcagcgc agattatttt     91980
     atccggcagc cgctatgccg acgcgccgca gcttccggag gacggaacac agatagcgtt     92040
     cccctgggcc ggggaatggc tgacggagcc ggagattcag gctgtaacgg attgcctgtc     92100
     ccgcgccgtg cgggatgtat cccggcaggt atgggaggat gcgcgccgga taaaggcggc     92160
     gctgaccacg cgcggggaaa cgctgtttta tcgtcagacc cgaaatttcc gtctggttgt     92220
     gaaggaaaat gatatgccct gctggctgga cgatgatgac aatttgccgg tggtgctcga     92280
     tgccatcctg aacaaagggg cacgctacag cagcgtcgag ttctttgtta tcagcgacaa     92340
     agttgatcaa atcctggcat gtggccagat gtgcgatgtg ctgcgtattc cgggcgagcc     92400
     tccgcgccgg tggatggatt taaccctgtt acatgaggtc atggcagaag cgcgtgcaga     92460
     aatcagtctt gtccgcaatg ccctgtcagc aatccggcca gtgtagcgaa cagcaggggg     92520
     cggcggcccc ctgaatctac cacgaaggat gtcgccggct ccgcttttac ggctcttcct     92580
     ccacgttgtt ccggcttcgc ggtgagtaac gtcccgagcg gtctgcggct tacgccgtgc     92640
     ctctactcta gcccgaacgc tgcaaatgca agggttcact gacgtcgatg ctttcacccg     92700
     gtcgccgtat gtttaaatgc ctgtcgcggt tcttcccgtc gttatctcgc tcaatattcg     92760
     ctcgctaacc gtccagaccc tctccgctat ttaccggcgc tgcggcttca tgcatcgccc     92820
     ctgcattttt cgctccctgt cgggctgtcg tgtcggcacg gcgtaagccg taactcagac     92880
     aacatcgact atggaggatt ttttatgcgc actacgacca ccacaccggc tgtttatgtg     92940
     ggtacgtatc acaaatacaa ctgcggcagc atttttggca aatggtttga actgacggag     93000
     tttgacggca gggaggattt ttacgaggcc tgccaggcgc tgcacgccga tgaatgggac     93060
     gcagaattta tgttccagga ccaggaaggt atcccgtcgc agttcgtctc tgaaagcgcc     93120
     attgactggg attttatcgc cgcttacaaa cgcgccgaag aagagggcag ggaagccgct     93180
     tttatcgcct gggcggagta taccggcgag tgtgactatg acgcgtttga tgatgcatac     93240
     cgcggcgagg cggaaagtga ggaagactat gcgcaggaga tggttgacga taacggcctg     93300
     ttaaatgagg tgccggagcc gctgcgcagc tacttcgatt ttgaggcgta tgcccgggat     93360
     ttgttcagca gcggctatgt gttccatgac ggttatgtct tcggtaactg attttccccg     93420
     gcaggcggtt tagccgcctg tcagcccgcg cgcaaaaccc tggcaggctc tgcctgccgg     93480
     cgaagtacgc cgcgcctgcg gcgccgcgta tctccgccag tgcctgatgt cccggtggtg     93540
     tcagggtatg aataccggtt tgttgcagcg ggtcggtgtt atttctgttc cggtgttaat     93600
     acctgcgctg ccgtaggcaa tagtggccat accggtggcg tactggctga tatcgctgtc     93660
     ctgtcggctt ttcttcccgg gcgatatgac tgtgggcgac ttccctagcg ggaaccggcg     93720
     ctgtcgtaaa cggagccggt aaaccgtctc cgccctgtcg ggcttccatc gcactgtcgc     93780
     aggttcaaca tcacgcttgc ggcatccgta aacggatgcg ccgctctcac cagcccggcg     93840
     gtaatgctgc cgggcttctt cggggcaacg ccgtttcgcg cccgcgcgtt ccgtcgttgc     93900
     agcgggttcc tgctcatttt ctcctggtca tttcaccctt ttgagtcctt tcgccggggc     93960
     tgagacaagc acagccgctg tcagctgtcc agggtaaatg gcacgcggta aaccgcgccc     94020
     tggacatccg ccatcgcccg cgctggttta cgcccctgcg gcgaacggct ctcaaacggg     94080
     tgatggtttt taaaagcaaa acaggttcag aaggaggagc aacatgagcg aggcgctggc     94140
     ggttttaccc gacgacacct ttacccgcga acaggctgag gtcgttgcgg cgcagtacac     94200
     caacgtggca attgaggacg atcagggggc gcattttcgc ctggttgtcc gtcagaacgg     94260
     tgaaatggtc tggcgcacgt ggaactttga gccgggcggc acgtactggc tcaaccgtta     94320
     tatcgcggac tacggtatcc gcaagccgca gtaagaaaga ggtgccctgc cggagcgcga     94380
     actccgcagg gccagacaat catcaatatc cagtgaggta tcaactatgt cagtaaccga     94440
     tgttaaagca aaagccccca aaaaagcgag cagcaaaaaa atcacgaagg cgcaggaaga     94500
     agctctgaaa gccgcccttg aggccgctgt catcgagtat gttccgctgt ccagtctcgc     94560
     taaatccccg ctgaacgtgc gcactatccc gtattccgtg gacagcgttc gcggtctggc     94620
     tgactccatc gaggcgctcg gactgctgca gaacctgatt gttcacaccc tcgcggacgg     94680
     acaatccggc gtggccgcag gtggtcgccg actgactgcc ctgaatctgc tggcgcagga     94740
     agatcgtctt gcggctgatc ataccgtcat ggtgaagcga gtctcagacg acattgcggc     94800
     cctcgcctcg gttgccgaga acgagcagcg cgccgccatg catcccgccg agcaaatcgc     94860
     aggtttccgt acgctggcag agcagggcaa aactcccgca cagattggcg acgccctcgg     94920
     cttcggctcc cgccacgtgc agcgcatgct gaagctggca aacctcgccc cgtccctgat     94980
     ggagaagctc gcgcaggacg aactgaccgt tgagcagtgt caggcgctct gtctcgagga     95040
     cgatcctgcc cgtcaggtcg aggtattcga aaacgtgaag gccagctggt cgaacgcgcc     95100
     cgcacacctg attaaacgcg ctattaccga aaccgagatg cgcaccgaca acgccaaatt     95160
     tcgttttatc gggcgcgatg cctacgaggc agcagggggt tacgtccgtg aagatctgtt     95220
     cagccaggac gagggcgacg gcacggcaga cagcgtgctg gttgagcgtc tggtgcagga     95280
     gaagctggag cgtatcgcgc aggacattca gcagcgggag ggctgggcat ggagtcgcgg     95340
     acgcgcagcc cgcatctggt accacggcga agacggtaag gagttcgtgc agcctgttga     95400
     acccgatccg gtgtacaccc ctgagcagca gcagcgtctt gatgcgctgc gggagcagta     95460
     cgatacatat gacagcgttt gcgacgagtc agatgcgatc gaagcggaca tcctcgccat     95520
     tcaggaggcg gcagaagcca gcgcgtggac tgacgacatg aagtcaggcg cgggagtgat     95580
     ggtcagcctg tacgaagggc aggtgtacgt gcagcgcggt gtgcgcctga aagcggatat     95640
     gccggaagaa accgtaacca gcagcgtaac ggtgccattc acctcacgcc agcccgacgc     95700
     cgcagagggg atcagcgttc cgctgctcac taaaatgacc tccgagcgta cgctggcagt     95760
     acaggcggcg ctgatgcagc agcccgaaaa agcggtggcg ctgatggtct ggcgcatgtg     95820
     tacctgcgtc ttctcgggct gtctgaccac gacgcacccg ttccgtatca gtctgaccgt     95880
     gtcccacggc agcctgacgg agaacgcccc gtccggtaag gatggcgcag cgtttgagat     95940
     gctcatgacc gaacgggcaa ggctgaaagc cctgctgccg gaagggtggg agaaggactt     96000
     caccaccttc tttgcccttg acggcggggt gttgatgtcg ctgatggcct tctgcacggc     96060
     ctgttccgtg gacggggtac agacccgcga tatggggcac acctcccgaa gtccactcga     96120
     tacggtcgag gcggcaatcg gattccacct gcgcgactgg tggcagccga cgaaggacaa     96180
     ctatttcggt agcctgaaac atccgcagat tgtggcctcc ctgaaagagg cggggctgac     96240
     gggcgcggcg ggtgacgcgg agaagatgaa gaagggcgat gcagcagcgc atgcggagca     96300
     ctttatgcag cacacccgct gggttccggc atggctgaaa ggaccagagc cagcggctga     96360
     atccggtgct gacgacgcgg tttccgatac cgacagcact gacaacgaca ccaccaacac     96420
     ggcacacgcc gcctgataac ggagagccgc ccttgtgtga acagggcggc a              96471
//

If you have problems or comments...

PBIL Back to PBIL home page