(data stored in ACNUC9543 zone)

EMBL: CP000310

ID   CP000310; SV 1; circular; genomic DNA; STD; PRO; 10777 BP.
XX
AC   CP000310;
XX
PR   Project:PRJNA16645;
XX
DT   10-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Yersinia pestis Antiqua plasmid pPCP, complete sequence.
XX
KW   .
XX
OS   Yersinia pestis Antiqua
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
OG   Plasmid pPCP
XX
RN   [1]
RP   1-10777
RX   DOI; 10.1128/JB.00124-06.
RX   PUBMED; 16740952.
RA   Chain P.S., Hu P., Malfatti S.A., Radnedge L., Larimer F., Vergez L.M.,
RA   Worsham P., Chu M.C., Andersen G.L.;
RT   "Complete genome sequence of Yersinia pestis strains Antiqua and Nepal516:
RT   evidence of gene reduction in an emerging pathogen";
RL   J. Bacteriol. 188(12):4453-4463(2006).
XX
RN   [2]
RP   1-10777
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   "Complete sequence of Plasmid pPCP of Yersinia pestis Antiqua";
RL   Unpublished.
XX
RN   [3]
RP   1-10777
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 5880477686aeec051b641d419bd3130e.
DR   BioSample; SAMN02598369.
DR   EnsemblGenomes-Gn; EBG00001242687.
DR   EnsemblGenomes-Tr; EBT00001588071.
DR   EuropePMC; PMC1482938; 16740952.
DR   EuropePMC; PMC4991868; 27602258.
DR   RFAM; RF00106; RNAI.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773254
CC   Source DNA and bacteria available from Gary Andersen
CC   (glandersen@lbl.gov)
CC   Contacts: Gary Andersen (glandersen@lbl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10777
FT                   /organism="Yersinia pestis Antiqua"
FT                   /plasmid="pPCP"
FT                   /strain="Antiqua"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:360102"
FT   gene            93..1115
FT                   /locus_tag="YPA_PCP0001"
FT   CDS_pept        93..1115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0001"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16236"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG16236.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            1115..1894
FT                   /locus_tag="YPA_PCP0002"
FT   CDS_pept        1115..1894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0002"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16237"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG16237.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            2931..3125
FT                   /locus_tag="YPA_PCP0008"
FT   CDS_pept        2931..3125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0008"
FT                   /product="replication regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16243"
FT                   /db_xref="InterPro:IPR000769"
FT                   /db_xref="InterPro:IPR035962"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZY3"
FT                   /protein_id="ABG16243.1"
FT                   /translation="MNKQQQTALNMARFIRSQSLILLEKLDALDADEQAAMCERLHELA
FT                   EELQNSIQARFEAESETGT"
FT   gene            4098..4292
FT                   /locus_tag="YPA_PCP0009"
FT   CDS_pept        4098..4292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0009"
FT                   /product="replication regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16244"
FT                   /db_xref="InterPro:IPR000769"
FT                   /db_xref="InterPro:IPR035962"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZY3"
FT                   /protein_id="ABG16244.1"
FT                   /translation="MNKQQQTALNMARFIRSQSLILLEKLDALDADEQAAMCERLHELA
FT                   EELQNSIQARFEAESETGT"
FT   gene            complement(5988..7061)
FT                   /locus_tag="YPA_PCP0003"
FT   CDS_pept        complement(5988..7061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0003"
FT                   /product="pesticin"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16238"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031922"
FT                   /db_xref="InterPro:IPR033791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMK9"
FT                   /protein_id="ABG16238.1"
FT                   /translation="MSDTMVVNGSGGVPAFLFSGSTLSSYRPNFEANSITIALPHYVDL
FT                   PGRSNFKLMYIMGFPIDTEMEKDSEYSNKIRQESKISKTEGTVSYEQKITVETGQEKDG
FT                   VKVYRVMVLEGTIAESIEHLDKKENEDILNNNRNRIVLADNTVINFDNISQLKEFLRRS
FT                   VNIVDHDIFSSNGFEGFNPTSHFPSNPSSDYFNSTGVTFGSGVDLGQRSKQDLLNDGVP
FT                   QYIADRLDGYYMLRGKEAYDKVRTAPLTLSDNEAHLLSNIYIDKFSHKIEGLFNDANIG
FT                   LRFSDLPLRTRTALVSIGYQKGFKLSRTAPTVWNKVIAKDWNGLVNAFNNIVDGMSDRR
FT                   KREGALVQKDIDSGLLK"
FT   gene            7290..7595
FT                   /locus_tag="YPA_PCP0004"
FT   CDS_pept        7290..7595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16239"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKY1"
FT                   /protein_id="ABG16239.1"
FT                   /translation="MSKTKSGRHRLSKTDKRLLAALVVAGYEERTARDLIQKHVYTLTQ
FT                   ADLRHLVSEISNGVGQSQAYDAIYQARRIRLARKYLSGKKPEGVEPREGQEREDLP"
FT   gene            7838..8776
FT                   /locus_tag="YPA_PCP0005"
FT   CDS_pept        7838..8776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0005"
FT                   /product="plasminogen activator Pla. Aspartic peptidase.
FT                   MEROPS family A26"
FT                   /EC_number="3.4.23.48"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16240"
FT                   /db_xref="GOA:A0A0E1NMK5"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020079"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMK5"
FT                   /protein_id="ABG16240.1"
FT                   /translation="MKKSSIVATIITILSGSANAASSQLIPNISPDSFTVAASTGMLSG
FT                   KSHEMLYDAETGRKISQLDWKIKNVAILKGDISWDPYSFLTLNARGWTSLASGSGNMDD
FT                   YDWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWLLQDENYKAGITAGYQETRFSWTA
FT                   TGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLAGQYRINDFELNALFKFSDWVRA
FT                   HDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGGTQTID
FT                   KNSGDSVSIGGDAAGISNKNYTVTAGLQYRF"
FT   sig_peptide     7838..7900
FT                   /locus_tag="YPA_PCP0005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            complement(8963..9262)
FT                   /locus_tag="YPA_PCP0006"
FT   CDS_pept        complement(8963..9262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0006"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16241"
FT                   /db_xref="GOA:A0A0E1NKN4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NKN4"
FT                   /protein_id="ABG16241.1"
FT                   /translation="MRTLDEVIASRSPESQTRIKEMADEMILEVGLQMMREELQLSQKQ
FT                   VAEAMGISQPAVTKLEQRGNDLKLATLKRYVEAMGGKLSLDVELPTGRRVAFHV"
FT   gene            complement(9262..9609)
FT                   /locus_tag="YPA_PCP0007"
FT   CDS_pept        complement(9262..9609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_PCP0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_PCP0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16242"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCI6"
FT                   /protein_id="ABG16242.1"
FT                   /translation="MWMVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYAD
FT                   TVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAIVLCAGDKSNDKRFYEKLVRIAEDE
FT                   FTAHLNTLESK"
XX
SQ   Sequence 10777 BP; 3131 A; 2531 C; 2366 G; 2749 T; 0 other;
     cccctgtgta acgaacggtg caatagtgat ccacacccaa cgcctgaaat cagatccagg        60
     gggtaatctg ctctcctgat tcaggagagt ttatggtcac ttttgagaca gttatggaaa       120
     ttaaaatcct gcacaagcag ggaatgagta gccgggcgat tgccagagaa ctggggatct       180
     cccgcaatac cgttaaacgt tatttgcagg caaaatctga gccgccaaaa tatacgccgc       240
     gacctgctgt tgcttcactc ctggatgaat accgggatta tattcgtcaa cgcatcgccg       300
     atgctcatcc ttacaaaatc ccggcaacgg taatcgctcg cgagatcaga gaccagggat       360
     atcgtggcgg aatgaccatt ctcagggcat tcattcgttc tctctcggtt cctcaggagc       420
     aggagcctgc cgttcggttc gaaactgaac ccggacgaca gatgcaggtt gactggggca       480
     ctatgcgtaa tggtcgctca ccgcttcacg tgttcgttgc tgttctcgga tacagccgaa       540
     tgctgtacat cgaattcact gacaatatgc gttatgacac gctggagacc tgccatcgta       600
     atgcgttccg cttctttggt ggtgtgccgc gcgaagtgtt gtatgacaat atgaaaactg       660
     tggttctgca acgtgacgca tatcagaccg gtcagcaccg gttccatcct tcgctgtggc       720
     agttcggcaa ggagatgggc ttctctcccc gactgtgtcg ccccttcagg gcacagacta       780
     aaggtaaggt ggaacggatg gtgcagtaca cccgtaacag tttttacatc ccactaatga       840
     ctcgcctgcg cccgatgggg atcactgtcg atgttgaaac agccaaccgc cacggtctgc       900
     gctggctgca cgatgtcgct aaccaacgaa agcatgaaac aatccaggcc cgtccctgcg       960
     atcgctggct cgaagagcag cagtccatgc tggcactgcc tccggagaaa aaagagtatg      1020
     acgtgcatct tgatgaaaat ctggtgaact tcgacaaaca ccccctgcat catccactct      1080
     ccatctacga ctcattctgc agaggagtgg cgtgatgatg gaactgcaac atcaacgact      1140
     gatggcgctc gccgggcagt tgcaactgga aagccttata agcgcagcgc ctgcgctgtc      1200
     acaacaggca gtagaccagg aatggagtta tatggacttc ctggagcatc tgcttcatga      1260
     agaaaaactg gcacgtcatc aacgtaaaca ggcgatgtat acccgaatgg cagccttccc      1320
     ggcggtgaaa acgttcgaag agtatgactt cacattcgcc accggagcac cgcagaagca      1380
     actccagtcg ttacgctcac tcagcttcat agaacgtaat gaaaatatcg tattactggg      1440
     gccatcaggt gtggggaaaa cccatctggc aatagcgatg ggctatgaag cagtccgtgc      1500
     aggtatcaaa gttcgcttca caacagcagc agatctgtta cttcagttat ctacggcaca      1560
     acgtcagggc cgttataaaa cgacgcttca gcgtggagta atggcccccc gcctgctcat      1620
     cattgatgaa ataggctatc tgccgttcag tcaggaagaa gcaaagctgt tcttccaggt      1680
     catcgctaaa cgttacgaaa agagcgcaat gatcctgaca tccaatctgc cgttcgggca      1740
     gtgggatcaa acgttcgccg gtgatgcagc actgacctca gcgatgctgg accgtatctt      1800
     acaccactca catgtcgttc aaatcaaagg agaaagctat cgactcagac agaaacgaaa      1860
     ggccggggtt atagcagaag ctaatcctga gtaaaacggt ggatcaatat tgggccgttg      1920
     gtggagatat aagtggatca cttttcatcc gtcgttgaca ccctgatgaa ttcacgtgtt      1980
     cacgcctgaa taacaagaat gccggagata cgcagtcata ttttttacac aattctctaa      2040
     tcccgacaag gtcgtaggtc gttataggaa aattcttagc accattccgg aacaatcaga      2100
     acagcaggcc atgaacgact gacaacatta cgaatataaa aaacgcaccc gggccagaca      2160
     ttccccctac tgattaaacc agccggactt gtccacggaa cggtcttttt aaaccgacac      2220
     acagtctgag tacagataca tgtcacgatg atgcaggatt agcggaagag tgtgagcacg      2280
     tttccgggaa ctgtggtgaa ccatagctca atattcgagt gagggcatac cggaaacgcg      2340
     ctcagattcg ttgtaacgcg attttccgta ccgggcaatt ttttcagttg ttttttcgtt      2400
     tcatgtcgtc agaaacgttc tgagcgcgtt tccggcatct gatgctacgc aaaccatccc      2460
     catggtcagt tgacagccgg aaacacgcgg gtgtcgtttt agcgtatcga cgggacggcg      2520
     tcgagaagca caaaaaacag atgttgtact cagtcagttg ttttacagac agcactgcgg      2580
     cagattgaaa aagtaccgta ctttcaggaa tgtccagaaa ccatgtgtca gacttcgttc      2640
     tcccccttcc gggtgaattt ttttgtcatc cgttcaggaa tctctttata acgattactc      2700
     catttcagga ttttttatgt ggcgtttact acaggcagga tattcaaagg caaaaaaatc      2760
     ccccggaaca ggcggaaccc ggacaggggg agaacgaatc gctaaataat tttcgtagtt      2820
     gtatttccca tcgttgctac tgcaacggga tgaatttgcc gcagtttatc ctgtaaaaca      2880
     atcctgattt actcacactc cacatatcac tgacggagca caacggaata gtgaacaaac      2940
     aacaacaaac tgcgctgaat atggcgcgat ttatcagaag ccagagcctg atactgcttg      3000
     aaaaactgga tgctctggat gccgacgagc aggcggccat gtgtgaacga ctgcacgaac      3060
     tcgcggaaga actccagaac agcatccagg ctcgctttga agccgaaagt gaaacaggaa      3120
     cataacgacc tgatgaattc acgtgttcac gcctgaataa caagaatgcc ggagatacgc      3180
     agtcatattt tttacacaat tctctaatcc cgacaaggtc gtaggtcgtt ataggaaaat      3240
     tcttagcacc attccggaac aatcagaaca gcaggccatg aacgactgac aacattacga      3300
     atataaaaaa cgcacccggg ccagacattc cccctactga ttaaaccagc cggacttgtc      3360
     cacggaacgg tctttttaaa ccgacacaca gtctgagtac agatacatgt cacgatgatg      3420
     caggattagc ggaagagtgt gagcacgttt ccgggaactg tggtgaacca tagctcaata      3480
     ttcgagtgag ggcataccgg aaacgcgctc agattcgttg taacgcgatt ttccgtaccg      3540
     ggcaattttt tcagttgttt tttcgtttca tgtcgtcaga aacgttctga gcgcgtttcc      3600
     ggcatctgat gctacgcaaa ccatccccat ggtcagttga cagccggaaa cacgcgggtg      3660
     tcgttttagc gtatcgacgg gacggcgtcg agaagcacaa aaaacagatg ttgtactcag      3720
     tcagttgttt tacagacagc actgcggcag attgaaaaag taccgtactt tcaggaatgt      3780
     ccagaaacca tgtgtcagac ttcgttctcc cccttccggg tgaatttttt tgtcatccgt      3840
     tcaggaatct ctttataacg attactccat ttcaggattt tttatgtggc gtttactaca      3900
     ggcaggatat tcaaaggcaa aaaaatcccc cggaacaggc ggaacccgga cagggggaga      3960
     acgaatcgct aaataatttt cgtagttgta tttcccatcg ttgctactgc aacgggatga      4020
     atttgccgca gtttatcctg taaaacaatc ctgatttact cacactccac atatcactga      4080
     cggagcacaa cggaatagtg aacaaacaac aacaaactgc gctgaatatg gcgcgattta      4140
     tcagaagcca gagcctgata ctgcttgaaa aactggatgc tctggatgcc gacgagcagg      4200
     cggccatgtg tgaacgactg cacgaactcg cggaagaact ccagaacagc atccaggctc      4260
     gctttgaagc cgaaagtgaa acaggaacat aacgaagctc ccggagacgg tcacagcttg      4320
     tctgtgaacg gatgccggga gcagacaagc ccgtcagggc gcgtcagcgg gttttagcgg      4380
     gtgtcggggc gcagccatga cccagtcacg tagcgatagc ggagtgtata ctggcttagt      4440
     catgcggcat cagtgcggat tgtatgaaaa gtgcaccatg tacggtgtga aatgccgcac      4500
     agatgcgtaa ggagaacatg cagatgccga tgctcttccg cttcctcgct cactgactcg      4560
     ctgcgctcgg tcgttcggct gcggcgagcg gtgtctgctc actcaaaagc ggtgatactg      4620
     ttatccacac aatcagggga taacgccgga aagaacatgt gagcaaaaaa cgaagacccc      4680
     agaaaaggcc gcgccggagg cgctttttcc ataggctccg cccccctgac gagcatcaca      4740
     aaaatcgacg ctcaagtcag aggtggcgaa acccgacagg acttaaagat accaggcgtt      4800
     tccccccgga agctccctcg tgcgctctcc tgttccgacc ctgccgctta ccggatacct      4860
     ctccgccttt ctcccttcgg gaagcgtggc gctttctcat agctcacgct gttggtatct      4920
     cagttcggtg taggtcgttc gctccaagct gggctgtgtg cacgaacccc ccgttcagcc      4980
     cgaccactgc gccttatccg gtaactatcg tcttgagtcc aacccggtaa gacacgactt      5040
     tacgccactg gcagcagcca ttggtaactg aaaagtggat ttagatacgc agaactcttg      5100
     aagttgaagc cttatcgcgg ctacactgaa aggacagcat ttggtatctg tgctccactt      5160
     aagccagcta ccacaggtta gaaagcctga gaaacttcta accttcgaaa gaacccacgc      5220
     ctgagaacgt gggttttttc gtttacaggc agcagattac gcgcagaaaa aaaggatctc      5280
     aagaagatcc tttgatcttt tctactgaat tgcgctcccg atcagttcag cagaagatta      5340
     tgatggggtt ctatgggtat tgctgcggta acacccatgt tacttgaggt tgtatgtagt      5400
     ctgtgtagaa ttatacacat aaggcttaaa ctgctctttt ttttcaatat gcaattggaa      5460
     gttcattgac tacataaata gattattcca aataatttat ttatgtaaga acaggatggg      5520
     agggggaatg atctcaaagt tattttgctt ggctctcata tttttatcat caagtggcct      5580
     tgcagaaaaa aacacatata cagcaaaaga catcttgcaa aacctagaat taaatacctt      5640
     tggcaattca ttgtctcatg gcatctatgg gaaacagaca accttcaagc aaaccgagtt      5700
     tacaaatatt aaaagcaaca ccaaaaaaca cattgcactt atcaataaag acaactcatg      5760
     gatgatatca ttaaaaatac taggaattaa gagagatgag tatactgtct gttttgaaga      5820
     tttctctcta ataagaccgc caacatatgt agccatacat cctctactta taaaaaaagt      5880
     aaaatctgga aactttatag tagtgaaaga aataaagaaa tctatccctg gttgcactgt      5940
     atattatcat taatagcaag cccctcatta ttatgagggg ctcatggtta ttttaacaat      6000
     ccactatcga tatctttttg caccagagcg ccctctcgtt tacgtctgtc agacattcca      6060
     tcaacaatat tattaaaagc atttacaagg ccattccagt cttttgcgat aactttattc      6120
     catactgtgg gagcagttct ggataactta aacccttttt gatatccaat agacaccagt      6180
     gctgtacggg ttctcaacgg taaatcgctg aaccgaagac cgatattagc gtcattgaaa      6240
     agaccttcaa tcttatgtga gaatttatca atataaatat tagataagag atgagcttca      6300
     ttatcagaaa gcgtcagagg tgctgttctc actttatcat aagcctcctt ccctcgaagc      6360
     atataatacc catcaagtct atctgcaata tactgaggga caccgtcatt caataaatcc      6420
     tgtttgcttc gctgaccaag gtcaaccccg gaaccgaatg taacaccggt actgttaaaa      6480
     taatcgctac taggattaga cggaaaatga cttgtcggat taaacccttc aaaaccatta      6540
     ctggagaaaa tatcgtggtc aacaatattt accgaacgac gtaaaaattc cttcagttga      6600
     ctaatattgt caaagttaat gacagtgttg tccgctagga cgatgcgatt tcggttatta      6660
     ttcagaatgt cttcgttctc tttcttatcg agatgttcaa tagattcggc aatcgttccc      6720
     tcaagaacca tgacacggta gactttcaca ccgtcttttt cctgacctgt ttcaacagtt      6780
     attttctgtt cgtaagacac ggtcccttca gtttttgaaa ttttactttc ctggcggatc      6840
     ttatttgaat attcactgtc tttctccatc tccgtatcaa tcggaaaccc cataatgtac      6900
     atcagtttaa aattactccg gccaggcaga tccacataat gtggtaatgc aattgtaatc      6960
     gaattagctt caaaatttgg tctgtaactg cttaatgtac ttccggaaaa gagaaaagcc      7020
     ggaacaccac ctgaaccatt cactaccatt gtatctgaca taaaaattcc tctttaacac      7080
     ataaaaaaaa caataagtta aaaaaaatac tgtacataaa accactgttt ttatgtacag      7140
     taataaaatt acgccgcttt attttctctg tcaataatat gaaatttcat ttttgtgatc      7200
     tgaatcactc ttataaaaat caggaaggga agattcgcag cagaaaaaca gcaccgggta      7260
     acatcagaaa aaaacagaaa ggagataacg tgagcaaaac aaaatctggt cgccaccgac      7320
     tgagcaaaac agacaaacgc ctgctggctg cacttgtcgt tgccggatac gaagaacgga      7380
     cagcccgtga cctcatccag aaacacgttt acacactgac acaggccgac ctgcgccatc      7440
     tggtcagtga aatcagtaac ggtgtgggac agtcacaggc ctacgatgcg atttaccagg      7500
     cgagacgcat tcgtctcgcc cgtaaatacc tgagcggaaa aaaaccggaa ggggtggaac      7560
     cccgggaagg gcaggaacgg gaagatttac cataactccc gttatcagta ccatcggctc      7620
     aacgctcgtt gtcggatctg aaaaattcgc tcaaaagatc atatttccct ggatattttc      7680
     caccgtttct tatgtgagca aagtcacata attctgtcag acgacgagaa aacggatatc      7740
     gattattgtt taatattttt acattattaa aaatgaaatt agataatcag atacaaataa      7800
     tatgttttcg ttcatgcaga gagattaagg gtgtctaatg aagaaaagtt ctattgtggc      7860
     aaccattata actattctgt ccgggagtgc taatgcagca tcatctcagt taataccaaa      7920
     tatatcccct gacagcttta cagttgcagc ctccaccggg atgctgagtg gaaagtctca      7980
     tgaaatgctt tatgacgcag aaacaggaag aaagatcagc cagttagact ggaagatcaa      8040
     aaatgtcgct atcctgaaag gtgatatatc ctgggatcca tactcatttc tgaccctgaa      8100
     tgccaggggg tggacgtctc tggcttccgg gtcaggtaat atggatgact acgactggat      8160
     gaatgaaaat caatctgagt ggacagatca ctcatctcat cctgctacaa atgttaatca      8220
     tgccaatgaa tatgacctca atgtgaaagg ctggttactc caggatgaga attataaagc      8280
     aggtataaca gcaggatatc aggaaacacg tttcagttgg acagctacag gtggttcata      8340
     tagttataat aatggagctt ataccggaaa cttcccgaaa ggagtgcggg taataggtta      8400
     taaccagcgc ttttctatgc catatattgg acttgcaggc cagtatcgca ttaatgattt      8460
     tgagttaaat gcattattta aattcagcga ctgggttcgg gcacatgata atgatgagca      8520
     ctatatgaga gatcttactt tccgtgagaa gacatccggc tcacgttatt atggtaccgt      8580
     aattaacgct ggatattatg tcacacctaa tgccaaagtc tttgcggaat ttacatacag      8640
     taaatatgat gagggcaaag gaggtactca gaccattgat aagaatagtg gagattctgt      8700
     ctctattggc ggagatgctg ccggtatttc caataaaaat tatactgtga cggcgggtct      8760
     gcaatatcgc ttctgaaaaa tacagatcat atctctcttt tcatcctccc ctagcgggga      8820
     ggatgtctgt ggaaaggagg ttggtgtttg accaaccttc agatgtgtga aaaatcacct      8880
     ttttcaccat aatgacgggg cgctcattct gttgttttgc cttgacattc tccacgtctt      8940
     tcagggcatg gagaaggtca aattagacat ggaacgctac tctccttcct gtaggaagct      9000
     caacatccaa gcttaatttg cctcccattg cttcaacgta acgctttaac gtcgccagct      9060
     ttaaatcatt tccgcgctgc tccagctttg ttactgctgg ctggcttata cccatcgcct      9120
     cagcaacttg tttttgtgat aactggagtt cttcacgcat catctgcaag ccgacctcaa      9180
     gaatcatctc atctgccatt tctttaattc gtgtctggct ttcaggtgaa cgactggcaa      9240
     tcacctcatc taatgttctc attacttgct ctccagtgtg ttcagatgtg ctgtaaattc      9300
     atcctcagct atacgcacca gtttttcata aaaccgctta tcattacttt tatctcctgc      9360
     acaaagaacg atagcccgac gaatcggatc gaacgcataa aaggctctta tcggacggcc      9420
     agaaaactga acgcgaagct ctttcatatt tttgtaccga gaacctttca cggtatcggc      9480
     atatggcctg ggtaactcag gtccgtaaac ctgtagcttt ttcaaatcag ccaaaacctt      9540
     ttcctgaaga gcgtcttctt gctcatttag ccagtcgtca aatcgctggc taaaaagtac      9600
     catccacatg ctcaacccta taacctgtag cttaccccac taacaatata acctacgagt      9660
     tatattttca agaaaagctg gctatttaac ataacggcaa tttgtacgca ccactgaaat      9720
     gcgttcagcg cgatcacggc aacagacagg caaaaatagc aacaaacctc ccgaaaaacc      9780
     gccgcgatcg cgcctgataa attttaacct tatgcatatc tatgcagcca ggcgaatcac      9840
     gaacgaattg cctgcctgat gtaactgaaa cgggtgtttt ttcctgattt ggtgggcgtg      9900
     gaagacggaa catgaacggg aaaacagaat tcatgccaga tgagcgcgat ctggcaatta      9960
     aggcaaaaca cagcaacaaa gacacgccag aatcgcgccc ggatatgttt taacgcgatt     10020
     ttcagactca gacaaattca gcagaatgct actccattca ccgggctgat ggtgaataca     10080
     tgcgtatcca ggatgagtac atttctggct ctgccacagc tctgtctgtt ggcagctttc     10140
     gcctgtccgg aaacctgctt aaaacgctcc cgaaaggcct ctgaaccaga aagcaacaaa     10200
     acacaggcca ttaagtaaat cgcgttaaaa cacgtctgat ggattgctgc aaaaaaaagt     10260
     ccctaatgga gcagggactg ttaaacccag tgaatagcgt ctaaattaaa gtaagaatac     10320
     gaccaggtac tcttcagaaa agagattaat ccaccgcaca gaataatcaa cagtaaaaac     10380
     aaacaaccct gattttttat ttttcttttt ttcgataaaa acaaaattaa agaaataatt     10440
     aatcagaaca ttccttaact tcagggcatt gcctgtgttc cattttgtga ttagtctgaa     10500
     acttccgaag gtggataaca cccggtattt ttttgctcac ataaagcccc tccttcaggc     10560
     agaggggctt tttctttgcc accacataaa aaaggccctc acaggaggtg ttctgtgagg     10620
     gcgtatgata aggactgaat cgatggttaa tatgtctagt cctgactttt gcatctccga     10680
     atataaaacc ctgtttaacg gcatgcaaaa ccaaaaaata aaaatgtgac atcgcaatgc     10740
     cagataatat tgacgcatga gggaatgcgt accccga                              10777
//

If you have problems or comments...

PBIL Back to PBIL home page