(data stored in ACNUC9543 zone)

EMBL: CP000311

ID   CP000311; SV 1; circular; genomic DNA; STD; PRO; 70299 BP.
XX
AC   CP000311;
XX
PR   Project:PRJNA16645;
XX
DT   10-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Yersinia pestis Antiqua plasmid pCD, complete sequence.
XX
KW   .
XX
OS   Yersinia pestis Antiqua
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
OG   Plasmid pCD
XX
RN   [1]
RP   1-70299
RX   DOI; 10.1128/JB.00124-06.
RX   PUBMED; 16740952.
RA   Chain P.S., Hu P., Malfatti S.A., Radnedge L., Larimer F., Vergez L.M.,
RA   Worsham P., Chu M.C., Andersen G.L.;
RT   "Complete genome sequence of Yersinia pestis strains Antiqua and Nepal516:
RT   evidence of gene reduction in an emerging pathogen";
RL   J. Bacteriol. 188(12):4453-4463(2006).
XX
RN   [2]
RP   1-70299
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   "Complete sequence of Plasmid pCD of Yersinia pestis Antiqua";
RL   Unpublished.
XX
RN   [3]
RP   1-70299
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Chain P.,
RA   Hu P., Malfatti S.A., Radnedge L., Vergez L.M., Larimer F., Land M.,
RA   Hauser L., Worsham P., Chu M.C., Andersen G.L., Richardson P.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fa55fbd12b6be4fba6fc082f3abe7632.
DR   BioSample; SAMN02598369.
DR   EnsemblGenomes-Gn; EBG00001242684.
DR   EnsemblGenomes-Gn; EBG00001242685.
DR   EnsemblGenomes-Tr; EBT00001588068.
DR   EnsemblGenomes-Tr; EBT00001588069.
DR   EuropePMC; PMC1482938; 16740952.
DR   EuropePMC; PMC2818281; 19835996.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF01396; isrN.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773254
CC   Source DNA and bacteria available from Gary Andersen
CC   (glandersen@lbl.gov)
CC   Contacts: Gary Andersen (glandersen@lbl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..70299
FT                   /organism="Yersinia pestis Antiqua"
FT                   /plasmid="pCD"
FT                   /strain="Antiqua"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:360102"
FT   gene            88..1110
FT                   /locus_tag="YPA_CD0001"
FT   CDS_pept        88..1110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0001"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16245"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG16245.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            1110..1889
FT                   /locus_tag="YPA_CD0002"
FT   CDS_pept        1110..1889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0002"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16246"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG16246.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(1899..2174)
FT                   /locus_tag="YPA_CD0080"
FT   CDS_pept        complement(1899..2174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0080"
FT                   /product="transposase ORFA"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16324"
FT                   /db_xref="GOA:A0A0E1NLB9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLB9"
FT                   /protein_id="ABG16324.1"
FT                   /translation="MKKARFTETQILRVLKEVEGGRHVKDVCRENGGSEASYYNWKSKY
FT                   GGMESSDIKRMKEREEENRRLKQMYASLCQRRMKSDPLISPPTAQY"
FT   gene            complement(2722..3069)
FT                   /locus_tag="YPA_CD0003"
FT   CDS_pept        complement(2722..3069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0003"
FT                   /product="type III secretion regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16247"
FT                   /db_xref="GOA:A0A0E1NL83"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL83"
FT                   /protein_id="ABG16247.1"
FT                   /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEKA
FT                   FANEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLLLE
FT                   AAMRQDTAADG"
FT   gene            complement(3294..3926)
FT                   /locus_tag="YPA_CD0004"
FT   CDS_pept        complement(3294..3926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0004"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16248"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMX8"
FT                   /protein_id="ABG16248.1"
FT                   /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEK
FT                   ILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVR
FT                   KILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKVHKDFPEISYLE
FT                   VTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTE"
FT   gene            complement(3905..4534)
FT                   /locus_tag="YPA_CD0005"
FT   CDS_pept        complement(3905..4534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0005"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16249"
FT                   /db_xref="GOA:A0A0H2YEN9"
FT                   /db_xref="InterPro:IPR009510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEN9"
FT                   /protein_id="ABG16249.1"
FT                   /translation="MMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHLN
FT                   AALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQLL
FT                   TLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQAWC
FT                   KRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVTPTCSHLFK"
FT   gene            complement(4534..5268)
FT                   /locus_tag="YPA_CD0006"
FT   CDS_pept        complement(4534..5268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0006"
FT                   /product="type III secretion lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16250"
FT                   /db_xref="GOA:A0A0H2YCU8"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCU8"
FT                   /protein_id="ABG16250.1"
FT                   /translation="MKVKTSLSTLILILFLTGCKVDLYTGISQKEGNEMLALLRQEGLS
FT                   ADKEPDKDGKIKLLVEESDVAQAIDILKRKGYPHESFSTLQDVFPKDGLISSPIEELAR
FT                   LNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNNKGKKGVAASASVFIKHAADIQFDTY
FT                   IPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSHLPRNTSILSIQVSEESKGHLIGLL
FT                   SLLILLLPVTNLAQYFWLQRKK"
FT   sig_peptide     complement(5203..5268)
FT                   /locus_tag="YPA_CD0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.651) with cleavage site probability 0.316 at
FT                   residue 22"
FT   gene            complement(5275..5622)
FT                   /locus_tag="YPA_CD0007"
FT   CDS_pept        complement(5275..5622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0007"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16251"
FT                   /db_xref="GOA:A0A0E1NLB1"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLB1"
FT                   /protein_id="ABG16251.1"
FT                   /translation="MPNIEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGLG
FT                   HSLLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRM
FT                   SQNVETLSKGG"
FT   gene            complement(5623..6120)
FT                   /locus_tag="YPA_CD0008"
FT   CDS_pept        complement(5623..6120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0008"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16252"
FT                   /db_xref="GOA:A0A0E1NLA3"
FT                   /db_xref="InterPro:IPR013349"
FT                   /db_xref="InterPro:IPR041814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLA3"
FT                   /protein_id="ABG16252.1"
FT                   /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAEK
FT                   TREVLWQQYYASNPPDHAVLEVLATPVREALLARFGQHQGSVVPAIDLPELRSVLQQFD
FT                   SFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQIDM
FT                   DT"
FT   sig_peptide     complement(6061..6120)
FT                   /locus_tag="YPA_CD0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.591 at
FT                   residue 20"
FT   gene            complement(6117..6464)
FT                   /locus_tag="YPA_CD0009"
FT   CDS_pept        complement(6117..6464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0009"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16253"
FT                   /db_xref="GOA:A0A0E1NN62"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013348"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN62"
FT                   /protein_id="ABG16253.1"
FT                   /translation="MKYKLNVLLAEIALIGTGNHYHEEANCIAEWLHLKGEEEAVQLIR
FT                   LSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQT
FT                   FVNGMREQLKT"
FT   gene            complement(6466..6729)
FT                   /locus_tag="YPA_CD0010"
FT   CDS_pept        complement(6466..6729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0010"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16254"
FT                   /db_xref="GOA:A0A0E1NLA9"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLA9"
FT                   /protein_id="ABG16254.1"
FT                   /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKP
FT                   DNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
FT   gene            complement(6730..6930)
FT                   /locus_tag="YPA_CD0081"
FT   CDS_pept        complement(6730..6930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0081"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16325"
FT                   /db_xref="GOA:A0A0E1NL88"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL88"
FT                   /protein_id="ABG16325.1"
FT                   /translation="MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQ
FT                   RESKALESAIAIIHYVAGDLK"
FT   gene            complement(6927..8186)
FT                   /locus_tag="YPA_CD0011"
FT   CDS_pept        complement(6927..8186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0011"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16255"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN85"
FT                   /protein_id="ABG16255.1"
FT                   /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAPV
FT                   HLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPETL
FT                   QVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEVRRL
FT                   LATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQ
FT                   GAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVESKVR
FT                   IAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFRQEFGNR
FT                   PKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRILAIRRDA
FT                   VIVSKGKREFVIQLNGGKPR"
FT   gene            complement(8183..10006)
FT                   /locus_tag="YPA_CD0012"
FT   CDS_pept        complement(8183..10006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0012"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16256"
FT                   /db_xref="GOA:A0A0E1NMZ5"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMZ5"
FT                   /protein_id="ABG16256.1"
FT                   /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGESL
FT                   RDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIF
FT                   KNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQ
FT                   TAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDA
FT                   TIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSAR
FT                   IEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLIDARG
FT                   LDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAELKGITYG
FT                   TMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVARVGHGQSL
FT                   IIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHL
FT                   ALGNGRDLRTGILAVDEISNQSTTLNKLLGGFQCQPLNKAQEVQKWLSQNNKSSYLTQC
FT                   KMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
FT   sig_peptide     complement(9926..10006)
FT                   /locus_tag="YPA_CD0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(10012..10425)
FT                   /locus_tag="YPA_CD0013"
FT   CDS_pept        complement(10012..10425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16257"
FT                   /db_xref="GOA:A0A0E1NL84"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="InterPro:IPR013353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL84"
FT                   /protein_id="ABG16257.1"
FT                   /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVL
FT                   RTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDT
FT                   HGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
FT   gene            complement(10828..11643)
FT                   /locus_tag="YPA_CD0014"
FT   CDS_pept        complement(10828..11643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0014"
FT                   /product="thermoregulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16258"
FT                   /db_xref="GOA:A0A0H2YDJ6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDJ6"
FT                   /protein_id="ABG16258.1"
FT                   /translation="MASLEIIKLEWVTPIFKVVEHSQDGLYILLQGQISWQSSGQTYDL
FT                   DEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIGRDNSTPKPL
FT                   LIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRHLGN
FT                   RPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAH
FT                   QLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
FT   gene            complement(12738..13802)
FT                   /locus_tag="YPA_CD0015"
FT   CDS_pept        complement(12738..13802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0015"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16259"
FT                   /db_xref="GOA:A0A0E1NN91"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN91"
FT                   /protein_id="ABG16259.1"
FT                   /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGL
FT                   SDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVV
FT                   QYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLV
FT                   TLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIK
FT                   REYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLP
FT                   LVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRW
FT                   LERQNIEKQHSEML"
FT   gene            complement(13802..14587)
FT                   /locus_tag="YPA_CD0016"
FT   CDS_pept        complement(13802..14587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0016"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16260"
FT                   /db_xref="GOA:A0A0E1NL98"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL98"
FT                   /protein_id="ABG16260.1"
FT                   /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIV
FT                   CSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVDNQ
FT                   RGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVASFFP
FT                   AVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIK
FT                   SAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
FT   gene            complement(14584..14850)
FT                   /locus_tag="YPA_CD0017"
FT   CDS_pept        complement(14584..14850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0017"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16261"
FT                   /db_xref="GOA:A0A0E1NR03"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR03"
FT                   /protein_id="ABG16261.1"
FT                   /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQ
FT                   EQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
FT   sig_peptide     complement(14764..14850)
FT                   /locus_tag="YPA_CD0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.753 at
FT                   residue 29"
FT   gene            complement(14852..15505)
FT                   /locus_tag="YPA_CD0018"
FT   CDS_pept        complement(14852..15505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0018"
FT                   /product="Yop secretion membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16262"
FT                   /db_xref="GOA:A0A0E1NN36"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN36"
FT                   /protein_id="ABG16262.1"
FT                   /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALG
FT                   VQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRM
FT                   FLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYL
FT                   PFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
FT   gene            complement(15502..16425)
FT                   /locus_tag="YPA_CD0019"
FT   CDS_pept        complement(15502..16425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0019"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16263"
FT                   /db_xref="GOA:A0A0E1NLH9"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLH9"
FT                   /protein_id="ABG16263.1"
FT                   /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSSL
FT                   NCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKLVC
FT                   NDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILISLRW
FT                   HKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES
FT                   DELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRL
FT                   LGHGRLVEIQGRLGVRIERLTEVTIS"
FT   gene            complement(16422..17789)
FT                   /locus_tag="YPA_CD0020"
FT   CDS_pept        complement(16422..17789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0020"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16264"
FT                   /db_xref="GOA:A0A0E1NLE6"
FT                   /db_xref="InterPro:IPR013354"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLE6"
FT                   /protein_id="ABG16264.1"
FT                   /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHPK
FT                   EESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLSPL
FT                   AEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHDELF
FT                   VQQSPIDSAQPVQLNSKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQKRLAE
FT                   EPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSEQLDMT
FT                   ELADRSQHLTDGVDSSKDTIEPPRPEKLLLPREETLPEMYSLSFTAPVVTPGDHLLATM
FT                   RATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEIPGKLHVE
FT                   LIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEEWEAEE"
FT   gene            complement(17789..18253)
FT                   /locus_tag="YPA_CD0021"
FT   CDS_pept        complement(17789..18253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0021"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16265"
FT                   /db_xref="InterPro:IPR009929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLG3"
FT                   /protein_id="ABG16265.1"
FT                   /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDYH
FT                   LWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERL
FT                   TLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
FT   gene            complement(18250..19569)
FT                   /locus_tag="YPA_CD0022"
FT   CDS_pept        complement(18250..19569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0022"
FT                   /product="type III secretion system ATPase, FliI/YscN"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16266"
FT                   /db_xref="GOA:A0A0E1NMX4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMX4"
FT                   /protein_id="ABG16266.1"
FT                   /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRIG
FT                   ELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEHLL
FT                   GQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCGEGQ
FT                   RMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLV
FT                   VATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTR
FT                   RGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSR
FT                   KLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQIGEYQKGQ
FT                   DKEADQAIERMGAIRGWLCQGTHELSHFNETLNLLETLTQ"
FT   gene            19767..20648
FT                   /locus_tag="YPA_CD0023"
FT   CDS_pept        19767..20648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0023"
FT                   /product="type III secretion outer membrane protein PopN"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16267"
FT                   /db_xref="GOA:A0A0E1NL80"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL80"
FT                   /protein_id="ABG16267.1"
FT                   /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSGT
FT                   LQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQNVS
FT                   ELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVEQAL
FT                   VSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSDLQKR
FT                   FPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVISDLQKLKEFGSVSDQVKGFWQF
FT                   FSEGKTNGVRPF"
FT   gene            20629..20907
FT                   /locus_tag="YPA_CD0024"
FT   CDS_pept        20629..20907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0024"
FT                   /product="Yop secretion and targeting protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16268"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="InterPro:IPR015144"
FT                   /db_xref="InterPro:IPR038347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL17"
FT                   /protein_id="ABG16268.1"
FT                   /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFY
FT                   QDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
FT   gene            20894..21265
FT                   /locus_tag="YPA_CD0025"
FT   CDS_pept        20894..21265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0025"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16269"
FT                   /db_xref="GOA:A0A0E1NR14"
FT                   /db_xref="InterPro:IPR012673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR14"
FT                   /protein_id="ABG16269.1"
FT                   /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGAT
FT                   LTLWLARSLAWHRCEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLTLP
FT                   LLHQAFEQLLRLQQEVLAP"
FT   gene            21262..21630
FT                   /locus_tag="YPA_CD0026"
FT   CDS_pept        21262..21630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0026"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16270"
FT                   /db_xref="InterPro:IPR012672"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL21"
FT                   /protein_id="ABG16270.1"
FT                   /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHLE
FT                   RLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALLKC
FT                   QQDDDRLLQIILNLLHKV"
FT   gene            21627..21971
FT                   /locus_tag="YPA_CD0027"
FT   CDS_pept        21627..21971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0027"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16271"
FT                   /db_xref="GOA:A0A0E1NQU0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQU0"
FT                   /protein_id="ABG16271.1"
FT                   /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHLA
FT                   GRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQHY
FT                   LELKDHNESP"
FT   gene            21958..24072
FT                   /locus_tag="YPA_CD0028"
FT   CDS_pept        21958..24072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0028"
FT                   /product="membrane-bound Yop protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16272"
FT                   /db_xref="GOA:A0A0E1NQZ0"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQZ0"
FT                   /protein_id="ABG16272.1"
FT                   /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIA
FT                   VNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYT
FT                   FGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMR
FT                   AGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQK
FT                   GLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQ
FT                   PKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSILTS
FT                   GSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRR
FT                   ALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESVSQLELLGI
FT                   PYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQE
FT                   TRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKE
FT                   KDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALEP
FT                   AVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQI
FT                   NIQPLGRICL"
FT   gene            24069..24509
FT                   /locus_tag="YPA_CD0029"
FT   CDS_pept        24069..24509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0029"
FT                   /product="low calcium response locus protein R"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16273"
FT                   /db_xref="InterPro:IPR013405"
FT                   /db_xref="InterPro:IPR022797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN51"
FT                   /protein_id="ABG16273.1"
FT                   /translation="MMADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRVE
FT                   IEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLSTQ
FT                   RLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
FT   gene            24551..24838
FT                   /locus_tag="YPA_CD0079"
FT   CDS_pept        24551..24838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0079"
FT                   /product="Yop regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16323"
FT                   /db_xref="InterPro:IPR009863"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL89"
FT                   /protein_id="ABG16323.1"
FT                   /translation="MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVM
FT                   KIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII"
FT   gene            24840..25820
FT                   /locus_tag="YPA_CD0030"
FT   CDS_pept        24840..25820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0030"
FT                   /product="V antigen, antihost protein/regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16274"
FT                   /db_xref="GOA:A0A0E1NQZ9"
FT                   /db_xref="InterPro:IPR005413"
FT                   /db_xref="InterPro:IPR036139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQZ9"
FT                   /protein_id="ABG16274.1"
FT                   /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNID
FT                   ISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF
FT                   LESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAE
FT                   LKIYSVIQAEINKHLSSSGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMPQT
FT                   TIQVDGSEKKIVSIKDFLGSENKRTGALGNLKNSYSYNKDNNELSHFATTCSDKSRPLN
FT                   DLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK"
FT   gene            25833..26339
FT                   /locus_tag="YPA_CD0031"
FT   CDS_pept        25833..26339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0031"
FT                   /product="yopB/yopD chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16275"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL85"
FT                   /protein_id="ABG16275.1"
FT                   /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFN
FT                   QYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIKEP
FT                   RFPFHAAECLLQKGELAEAESGLFLAQELIADKTEFKELSTRVSSMLEAIKLKKEMEHE
FT                   CVDNP"
FT   gene            26317..27522
FT                   /locus_tag="YPA_CD0032"
FT   CDS_pept        26317..27522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0032"
FT                   /product="Yop targeting protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16276"
FT                   /db_xref="GOA:A0A0E1NMY9"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMY9"
FT                   /protein_id="ABG16276.1"
FT                   /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGV
FT                   SSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPD
FT                   TFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIA
FT                   SKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLISQEAM
FT                   KILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLVAKGAEFSAKVAQI
FT                   STGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQH
FT                   NNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPH
FT                   TV"
FT   gene            27541..28461
FT                   /locus_tag="YPA_CD0033"
FT   CDS_pept        27541..28461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0033"
FT                   /product="Yop negative regulation/targeting component"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16277"
FT                   /db_xref="InterPro:IPR008898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLB2"
FT                   /protein_id="ABG16277.1"
FT                   /translation="MTINIKTDSPIITTGSQLDAITTETVKQSGEIKKTEDTRHEAQAI
FT                   KSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQQR
FT                   DIENKATITAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQEQI
FT                   LNSNIAGREQLIDTKMQQMSNIGDKAVSREDIGRIWKPEQVADQNKLALLDKEFRMTDS
FT                   KANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNFM
FT                   KDVLRLIEQYVSSHTHAMKAAFGVV"
FT   gene            complement(28929..29060)
FT                   /locus_tag="YPA_CD0034"
FT   CDS_pept        complement(28929..29060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDM4"
FT                   /protein_id="ABG16278.1"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLQRLNKGQFDIWLRRDEPEY"
FT   gene            complement(29095..29418)
FT                   /locus_tag="YPA_CD0035"
FT   CDS_pept        complement(29095..29418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0035"
FT                   /product="transposase"
FT                   /note="putative pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16279"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YER9"
FT                   /protein_id="ABG16279.1"
FT                   /translation="MKRYQFTDADSSWQLDEIYIRVNGKWFYLYRAINKHGTTLDFYFS
FT                   PKRNKNTAYPFIKRVLKPYSVERQPKILNTDKHSSYGYAITRLMKEGKDTGCCKAAASQ
FT                   IPE"
FT   gene            complement(29444..29566)
FT                   /locus_tag="YPA_CD0082"
FT   CDS_pept        complement(29444..29566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEM6"
FT                   /protein_id="ABG16326.1"
FT                   /translation="MAPGDFKWEHFAPDELCQCQRYAVRAWDFRLSLYHLPLVY"
FT   gene            29587..29796
FT                   /locus_tag="YPA_CD0036"
FT   CDS_pept        29587..29796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCX7"
FT                   /protein_id="ABG16280.1"
FT                   /translation="MNSLSFHDNSIFCNKPKYSDAEVAQTLDTAQKHTLTVSKGVLDTA
FT                   KQYTNTVSSNTLDSANTYTNNKAD"
FT   gene            30367..31419
FT                   /locus_tag="YPA_CD0037"
FT   CDS_pept        30367..31419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0037"
FT                   /product="targeted effector protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16281"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEG7"
FT                   /protein_id="ABG16281.1"
FT                   /translation="MAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLT
FT                   ELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNN
FT                   SLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVA
FT                   GNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTF
FT                   LDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLE
FT                   RLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHET
FT                   TDKLEDDVFE"
FT   gene            complement(31462..31761)
FT                   /locus_tag="YPA_CD0038"
FT   CDS_pept        complement(31462..31761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0038"
FT                   /product="protein 25"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16282"
FT                   /db_xref="GOA:A0A0H2YCN5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCN5"
FT                   /protein_id="ABG16282.1"
FT                   /translation="MVLQSWRKKWANLSCYFRYPTTIRKVIYMTNAIESVHRLFRKLTK
FT                   TKGIFPNENSLLKSLYLGLMNAQERWTMPIQSWNLALSQLAIYFEGRLDKVITL"
FT   gene            31936..32127
FT                   /locus_tag="YPA_CD0039"
FT   CDS_pept        31936..32127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16283"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDM9"
FT                   /protein_id="ABG16283.1"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRDEPEYRV
FT                   REGSTFMNRLFNIEVVLA"
FT   gene            complement(33092..33214)
FT                   /locus_tag="YPA_CD0040"
FT   CDS_pept        complement(33092..33214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YES5"
FT                   /protein_id="ABG16284.1"
FT                   /translation="MRRLNKGQFDIWLRRDEPKYRVREGSTFMNRLFNIEVVLA"
FT   gene            complement(33779..34177)
FT                   /locus_tag="YPA_CD0041"
FT   CDS_pept        complement(33779..34177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0041"
FT                   /product="yopT chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16285"
FT                   /db_xref="GOA:A0A0E1NLE1"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLE1"
FT                   /protein_id="ABG16285.1"
FT                   /translation="MQTTFTELMQQLFLKLGLNHQVNENDVYTFTFEVDGHIQVLIACY
FT                   HQQWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLE
FT                   RFIDDIEQRKEPQNTKFQPNSTSPILFI"
FT   gene            complement(34177..35145)
FT                   /locus_tag="YPA_CD0042"
FT   CDS_pept        complement(34177..35145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0042"
FT                   /product="YopT peptidase. Cysteine peptidase. MEROPS family
FT                   C58"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16286"
FT                   /db_xref="GOA:A0A0E1NMW8"
FT                   /db_xref="InterPro:IPR003951"
FT                   /db_xref="InterPro:IPR006473"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMW8"
FT                   /protein_id="ABG16286.1"
FT                   /translation="MNSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSHS
FT                   NLQKKLSATIKHNQSGRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAVRE
FT                   SVANYGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRSHAQGQSLFDQLYVG
FT                   GRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPVDVTG
FT                   TTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPNFGEFH
FT                   FSDKEKFRKWFTNSFWGNSMYHYPLGVGQRFRVLTFDSKEV"
FT   gene            36337..36576
FT                   /locus_tag="YPA_CD0043"
FT   CDS_pept        36337..36576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCP1"
FT                   /protein_id="ABG16287.1"
FT                   /translation="MKEIAKRVHRIYCLLKLNIRRKGKQRLPACNPSPLAVPERLNLSG
FT                   SVDFMHNAQCTERWVSFQYVIMSWMITIVKHWRL"
FT   gene            36803..37420
FT                   /locus_tag="YPA_CD0044"
FT   CDS_pept        36803..37420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0044"
FT                   /product="conjugative transfer surface exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16288"
FT                   /db_xref="GOA:A0A0E1NLF1"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF1"
FT                   /protein_id="ABG16288.1"
FT                   /translation="MSETIWLEPSSQKTVYLQIKNISDKNMLGLAPQITKAVQDKGYTV
FT                   TSSPEDAHYWIQANVLKADKMDLREAEGFLSQGYQGAALGAALGAGITGYNSNSAGATL
FT                   GIGLAAGLVGMAANAMVEDINYTMVTDVQISEKTDTTLQTDNVAALKQGTSGYKVQTST
FT                   QTGNKHQYQTRVVSSANKVNLKFEEARPVLEDQLAKSIANIL"
FT   gene            37527..37844
FT                   /locus_tag="YPA_CD0045"
FT   CDS_pept        37527..37844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16289"
FT                   /db_xref="GOA:A0A0E1NLF3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF3"
FT                   /protein_id="ABG16289.1"
FT                   /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLR
FT                   KWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSL
FT                   R"
FT   gene            37868..38326
FT                   /locus_tag="YPA_CD0046"
FT   CDS_pept        37868..38326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16290"
FT                   /db_xref="GOA:A0A0E1NLH3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLH3"
FT                   /protein_id="ABG16290.1"
FT                   /translation="MVELCRLLKITRSVYSASLNFRVDVKRLQLRELHQQSRGAAGSRT
FT                   LSLLMRQSGYNVVRWLARRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPSEP
FT                   NRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRA"
FT   gene            38438..38632
FT                   /locus_tag="YPA_CD0047"
FT   CDS_pept        38438..38632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0047"
FT                   /product="transposase remnant"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16291"
FT                   /db_xref="GOA:A0A0E1NLB5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLB5"
FT                   /protein_id="ABG16291.1"
FT                   /translation="MQSMSRRGNCLDNSPMERVFRSLKSEWLLVGGYMDVHHAVRDIGE
FT                   WIQSYYNTPPSAQWWITAL"
FT   gene            complement(38770..38883)
FT                   /locus_tag="YPA_CD0083"
FT   CDS_pept        complement(38770..38883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16327"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCU5"
FT                   /protein_id="ABG16327.1"
FT                   /translation="MPKSLNAAKWVSIARIMAEGTAYEVEPDLCFTALGTV"
FT   gene            39390..40598
FT                   /locus_tag="YPA_CD0048"
FT   CDS_pept        39390..40598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0048"
FT                   /product="plasmid partitioning transcription repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16292"
FT                   /db_xref="GOA:A0A0H2YCP8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCP8"
FT                   /protein_id="ABG16292.1"
FT                   /translation="MFYYKDANFIEIIHMDLKSTLDRCIERGQFMTQEIAKSQFGNDSP
FT                   AARTITRRWRITEAAELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDM
FT                   RDVFKTRLSKPKGENPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQAT
FT                   ASLYHGYVPDLHIHEEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIY
FT                   GLHDQGKLPVAPHLLLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAE
FT                   LYDYVSTLQFFTMLRDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGM
FT                   VLKEVVRVTDEVGKGQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRW
FT                   ENA"
FT   gene            40595..41560
FT                   /locus_tag="YPA_CD0049"
FT   CDS_pept        40595..41560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0049"
FT                   /product="plasmid partitioning control protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16293"
FT                   /db_xref="GOA:A0A0E1NQT4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQT4"
FT                   /protein_id="ABG16293.1"
FT                   /translation="MMKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGM
FT                   KGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTSG
FT                   QQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYRPTS
FT                   AYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPNELSA
FT                   RSGEALSKAYENNVDTLKRVTHKIMKQKQEGRQFTTEELIVLLMPERKQPENIHKKSFG
FT                   KNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
FT   gene            complement(42105..42278)
FT                   /locus_tag="YPA_CD0084"
FT   CDS_pept        complement(42105..42278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0084"
FT                   /product="unknown protein"
FT                   /note="putative pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDU0"
FT                   /protein_id="ABG16328.1"
FT                   /translation="MKSPYPTWRDGYRYQKADIMLNDVGSRPGQIDMFDETPPHANSKH
FT                   LMQVVDASIALG"
FT   gene            42822..43064
FT                   /locus_tag="YPA_CD0050"
FT   CDS_pept        42822..43064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16294"
FT                   /db_xref="GOA:A0A0E1NQY6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQY6"
FT                   /protein_id="ABG16294.1"
FT                   /translation="MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQ
FT                   RVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSV"
FT   gene            43057..43356
FT                   /locus_tag="YPA_CD0085"
FT   CDS_pept        43057..43356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16329"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMY3"
FT                   /protein_id="ABG16329.1"
FT                   /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKN
FT                   PELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
FT   gene            complement(43496..44155)
FT                   /locus_tag="YPA_CD0051"
FT   CDS_pept        complement(43496..44155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0051"
FT                   /product="outer membrane virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16295"
FT                   /db_xref="GOA:A0A0H2YCZ0"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="InterPro:IPR015110"
FT                   /db_xref="InterPro:IPR037168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCZ0"
FT                   /protein_id="ABG16295.1"
FT                   /translation="MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLAG
FT                   RTESPQGSSLASRIIERLSSVAHSVIGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSFSD
FT                   SIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQA
FT                   EASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM"
FT   sig_peptide     complement(44084..44155)
FT                   /locus_tag="YPA_CD0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.396 at
FT                   residue 24"
FT   gene            44349..44741
FT                   /locus_tag="YPA_CD0052"
FT   CDS_pept        44349..44741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0052"
FT                   /product="yopE chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16296"
FT                   /db_xref="GOA:A0A0E1NLF8"
FT                   /db_xref="InterPro:IPR005416"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF8"
FT                   /protein_id="ABG16296.1"
FT                   /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQ
FT                   ILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLY
FT                   TQLEMLVQGAERLQTSSLISPPRSFS"
FT   gene            complement(44804..45418)
FT                   /locus_tag="YPA_CD0053"
FT   CDS_pept        complement(44804..45418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16297"
FT                   /db_xref="GOA:A0A0H2YCQ5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCQ5"
FT                   /protein_id="ABG16297.1"
FT                   /translation="MYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMD
FT                   ALATGRRIKCLTCVDDYTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPE
FT                   FTCRALDQWVFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDVSHARKTIS
FT                   EWRQDYNECRPHSTLNYQTPSEFAAAWRKGNSDSEGSDITK"
FT   gene            45551..46723
FT                   /locus_tag="YPA_CD0054"
FT   CDS_pept        45551..46723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0054"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16298"
FT                   /db_xref="GOA:A0A0H2YDQ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDQ1"
FT                   /protein_id="ABG16298.1"
FT                   /translation="MLSREDFYMIKQMRQQGAYIIDIATQVGCSERTVRRYLKYPEPPA
FT                   RKTRHKMVKLKPFMDYIDMRLAENVWNSEVILAEIKAMGYTGGRSMLRYYIQPKRKMRP
FT                   SKRTVRVETQPGYQLQHDWGEVELEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDAEHT
FT                   YESLVRAFRYFGGSVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLAEHYDFLPRACRPRR
FT                   ARTKGKVERMVKYLKDNVFVRYRRFDSFTHVNQQLEQWMADVADKRELRQFRQTPEQRF
FT                   ALEQEHLQPLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRISLDDEL
FT                   RSYSNEQQVASHRLCSASSGWQTVPEHHAPLWQQVSMVEHRPLSAYEELL"
FT   gene            46723..47079
FT                   /locus_tag="YPA_CD0055"
FT   CDS_pept        46723..47079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0055"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16299"
FT                   /db_xref="GOA:A0A0H2YEU7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEU7"
FT                   /protein_id="ABG16299.1"
FT                   /translation="MHELEALLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQE
FT                   WNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERCENVILLG
FT                   PPGVGKPIWPLLSA"
FT   gene            47496..47921
FT                   /locus_tag="YPA_CD0056"
FT   CDS_pept        47496..47921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0056"
FT                   /product="yopH targeting protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16300"
FT                   /db_xref="GOA:A0A0E1NN56"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN56"
FT                   /protein_id="ABG16300.1"
FT                   /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINE
FT                   KELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQ
FT                   LASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
FT   gene            complement(48069..48824)
FT                   /locus_tag="YPA_CD0057"
FT   CDS_pept        complement(48069..48824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0057"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16301"
FT                   /db_xref="GOA:A0A0H2YEJ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEJ6"
FT                   /protein_id="ABG16301.1"
FT                   /translation="MMQSRTVYNYRSHRDDRAITQRIREIAETRIRYGCPRIHILLRRE
FT                   GWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKHRHARPEVTALEQCWSMDFVADNLFNG
FT                   RRVRALTIVDNFSRECLAIEVGQGLRGDDVVAVMDRLKHSLGRIPQRLQTDNGSEFISK
FT                   SMDRWAYENRVTMDCSRPGKPTDNAFIESFNGSLRDECLNVHGFLSLEDAQEKIEQWRQ
FT                   EYNHFHPHSSLNNLTPAEFARSHQKGPDL"
FT   gene            complement(48902..49168)
FT                   /locus_tag="YPA_CD0058"
FT   CDS_pept        complement(48902..49168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0058"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16302"
FT                   /db_xref="GOA:Q1BZR3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZR3"
FT                   /protein_id="ABG16302.1"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKKF
FT                   GGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
FT   gene            complement(50219..50770)
FT                   /locus_tag="YPA_CD0059"
FT   CDS_pept        complement(50219..50770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0059"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16303"
FT                   /db_xref="GOA:A0A0E1NL92"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL92"
FT                   /protein_id="ABG16303.1"
FT                   /translation="MRLFGYARVSTSQQSLDIQIKTLKDAGVKANRIFTDKASGSSADR
FT                   EGLDLLRMKVEEGDVILVKKLDRLGRDTVDMIQLIKEFDAQGVSIQFIDDGISTDGEMG
FT                   KMVVTILSAVAQAERQRILERTNEGREEAKLKGVKFGRKRRINRKELLELHEQGMGATE
FT                   IAKKMNIARSTIYKVINESQ"
FT   gene            50934..53249
FT                   /locus_tag="YPA_CD0061"
FT   CDS_pept        50934..53249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0061"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16305"
FT                   /db_xref="GOA:A0A0E1NLA4"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLA4"
FT                   /protein_id="ABG16305.1"
FT                   /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRRG
FT                   KHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTRRE
FT                   HTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILLPGA
FT                   TTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLVYDAE
FT                   GRIQRAGYSLCLLERLQDALRCRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVCRALGH
FT                   PTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEEPLSLLR
FT                   LNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVLMAEACNI
FT                   GLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRWGGGEVASV
FT                   DGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLRDSIFVLEGL
FT                   LEQQTGLNPVEIMTDTAGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRVDKSANYGALD
FT                   ELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSGLAQAIMAVGRV
FT                   NKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKRYREGQEDQLGAL
FT                   GLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHINMLGHYTFTLSDDI
FT                   LNGELRALNFNLNNELSP"
FT   gene            complement(53246..53626)
FT                   /locus_tag="YPA_CD0060"
FT   CDS_pept        complement(53246..53626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLA0"
FT                   /protein_id="ABG16304.1"
FT                   /translation="MVERYPRDGFFKVFQILRRWGYVWNHKRVHRIYCLLKLNIRRKGK
FT                   QRLPARTPSPLAVPERLNLSGAVDFMHDALICVDDYNREKLAIEIDLNLPTQHVIRVLD
FT                   RIVVNRGYPVMGFEVQWDENVR"
FT   gene            54615..55535
FT                   /locus_tag="YPA_CD0062"
FT   CDS_pept        54615..55535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16306"
FT                   /db_xref="GOA:A0A0H2YEK2"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008126"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEK2"
FT                   /protein_id="ABG16306.1"
FT                   /translation="MATGVDSVAIGPLSKALGDSAVTYGVSSTAQKDGVAIGAKASASD
FT                   TGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDHSKTDRENSVSIGHESLNRQLT
FT                   HLAAGTEDTDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKHSNSVARTTLETAE
FT                   EHANKKSAETLVSAKVYADSNSSQTLKTANSYTDVTVSNSTKKATRESNQYTDHKFSQL
FT                   DNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIGSGYRVNES
FT                   VAFKAGVAYAGSSNVMYNASFNIEW"
FT   gene            55658..55864
FT                   /locus_tag="YPA_CD0086"
FT   CDS_pept        55658..55864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YD17"
FT                   /protein_id="ABG16330.1"
FT                   /translation="MGNYMVSDEINRRNNLSDICYGHPIYVGCACINPNYINPQIQRSR
FT                   VNTARYFEQAAQFDHWPFCFQPC"
FT   gene            complement(55861..56049)
FT                   /locus_tag="YPA_CD0063"
FT   CDS_pept        complement(55861..56049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16307"
FT                   /db_xref="GOA:A0A0H2YCR9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCR9"
FT                   /protein_id="ABG16307.1"
FT                   /translation="MRKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEI
FT                   LKQAAVLMSEFPIKSLR"
FT   gene            56199..56657
FT                   /locus_tag="YPA_CD0064"
FT   CDS_pept        56199..56657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16308"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDR6"
FT                   /protein_id="ABG16308.1"
FT                   /translation="MGGMAAHWFTYQYAVPFCGRAKTLVTLSNAEGESVLISPQQNTAQ
FT                   DISLFMPRELTVSQGDRVRFTRSDTDRGYVANSLWEVAGFTEDGAVRFRQGDQEKIVDP
FT                   QKATEDRHIDLAYTLTAYGVQGASERFVIALFGAEGGRKRMATLHLFT"
FT   gene            56829..57146
FT                   /locus_tag="YPA_CD0065"
FT   CDS_pept        56829..57146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16309"
FT                   /db_xref="GOA:A0A0H2YEV8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEV8"
FT                   /protein_id="ABG16309.1"
FT                   /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLR
FT                   KWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSL
FT                   R"
FT   gene            57170..57577
FT                   /locus_tag="YPA_CD0066"
FT   CDS_pept        57170..57577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16310"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQY0"
FT                   /protein_id="ABG16310.1"
FT                   /translation="MVELCRLLKITRSVYSASLNFRVDVKRLQLRELHQQSRGAAGSRT
FT                   LSLLMRQSGYNVVRWLARRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPSEP
FT                   NRVWSGYISYIKVNGGWCYLALVIDLYSFHW"
FT   gene            57839..57934
FT                   /locus_tag="YPA_CD0087"
FT   CDS_pept        57839..57934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0087"
FT                   /product="transposase remnant"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEN3"
FT                   /protein_id="ABG16331.1"
FT                   /translation="MDVHHAVRDIGEWIQSYYNTPPSAQWWITAL"
FT   gene            57994..58242
FT                   /locus_tag="YPA_CD0067"
FT   CDS_pept        57994..58242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0067"
FT                   /product="Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16311"
FT                   /db_xref="GOA:A0A0H2YEL0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEL0"
FT                   /protein_id="ABG16311.1"
FT                   /translation="MDLLVNAGIPVRTVNSFKALHDKVIIVDGKNTQMGSFNFSQAAVQ
FT                   SNSENVLIIWGDFTVVQAYLQYWQSRWNKGTDWRSSY"
FT   gene            58380..58634
FT                   /locus_tag="YPA_CD0068"
FT   CDS_pept        58380..58634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0068"
FT                   /product="replication transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16312"
FT                   /db_xref="GOA:A0A0E1NQS9"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQS9"
FT                   /protein_id="ABG16312.1"
FT                   /translation="MSQIENAVTSSSKRAYRKGNPLTGAEKQRMSVSRKKETHKAINVF
FT                   IQNDLKNELLQLCEDSGLTQTEMIERWIQREKAARTNAA"
FT   gene            58943..59809
FT                   /locus_tag="YPA_CD0069"
FT   CDS_pept        58943..59809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0069"
FT                   /product="replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16313"
FT                   /db_xref="GOA:A0A0E1NLB8"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLB8"
FT                   /protein_id="ABG16313.1"
FT                   /translation="MTNHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGFT
FT                   SRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNLAIEC
FT                   GLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFSALDV
FT                   SDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAHGLKR
FT                   ARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSRNNNYT
FT                   RLATGAT"
FT   gene            61393..61671
FT                   /locus_tag="YPA_CD0070"
FT   CDS_pept        61393..61671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0070"
FT                   /product="transposase remnant"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16314"
FT                   /db_xref="GOA:A0A0H2YEW5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEW5"
FT                   /protein_id="ABG16314.1"
FT                   /translation="MKRLLFHSDQGGQYRSKKSRQLLWRTGVMQSMSRRGNCLDNSPME
FT                   RVFRSLKSEWLPVGGYMDVHHAVRDIGEWIQSYYNTPPSAQWWITAL"
FT   gene            61967..62416
FT                   /locus_tag="YPA_CD0088"
FT   CDS_pept        61967..62416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLE7"
FT                   /protein_id="ABG16332.1"
FT                   /translation="MINTTFTELLPKIASHFGLDKLSQDEYGLCELILNDRVVIMLRAD
FT                   EILNRLTLLGPILGFSGPEARSAASQLFFCYSINALNKDGPCFAWSEELGLIAFKHLSL
FT                   DELNVENVSKEIANFYDWLSLVSLPAETQQELPLHTQSTQSVKWG"
FT   gene            62424..64622
FT                   /locus_tag="YPA_CD0071"
FT   CDS_pept        62424..64622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0071"
FT                   /product="targeted effector protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16315"
FT                   /db_xref="GOA:A0A0E1NL73"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003547"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR019093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NL73"
FT                   /protein_id="ABG16315.1"
FT                   /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRIID
FT                   NQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPNAL
FT                   SNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRLVAK
FT                   IERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVDGWRC
FT                   SDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNVVFDRA
FT                   SGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLHCIEGFE
FT                   KNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVSADSRPDS
FT                   NEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSDLLRTHLSS
FT                   AATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGREG
FT                   DTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVL
FT                   VTLSQQGQPVSSETYGFLNRLTEAKITLSQQLNTLQQQQESAKAQLSILINRSGSWADV
FT                   ARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDDMRNFTVDSIPLL
FT                   IQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
FT   gene            65018..65884
FT                   /locus_tag="YPA_CD0072"
FT   CDS_pept        65018..65884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0072"
FT                   /product="YopJ peptidase. Cysteine peptidase. MEROPS family
FT                   C55"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16316"
FT                   /db_xref="InterPro:IPR005083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YEL5"
FT                   /protein_id="ABG16316.1"
FT                   /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWF
FT                   HKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMG
FT                   EGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEM
FT                   DIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGKNPLPHDKLDPYLPVTF
FT                   YKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAE
FT                   YKTLLKV"
FT   gene            66165..66257
FT                   /locus_tag="YPA_CD0089"
FT   CDS_pept        66165..66257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDU6"
FT                   /protein_id="ABG16333.1"
FT                   /translation="MQNAQIRLLDIIAYERVVFSEIQLLNNCAK"
FT   gene            complement(66470..67117)
FT                   /locus_tag="YPA_CD0073"
FT   CDS_pept        complement(66470..67117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16317"
FT                   /db_xref="GOA:A0A0H2YCT1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCT1"
FT                   /protein_id="ABG16317.1"
FT                   /translation="MTLRTTSSCGLRPPDGCSFPCDYLEGLNLRSKRPRRHVTTRHRHA
FT                   RPEVTALDQCWSMDFVADNLFNGHRVRALTIVDNFSRECLALEVGQGLRGDDVVAVMDR
FT                   LKHSLGRIPQRLQTDNGSEFISKSMDRWAYENRVTMDCSRPGKPTDNAFIESFNGSLRD
FT                   ECLNVHGFLSLEDAQEKIEQWRQEYNHFRPHSSLNNLTPAEFARSHQKGPDL"
FT   gene            67078..67284
FT                   /locus_tag="YPA_CD0074"
FT   CDS_pept        67078..67284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16318"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YDS8"
FT                   /protein_id="ABG16318.1"
FT                   /translation="MAVGRKNWLFAGSLRAGQRMASILSLLETAKLNGHDPYVWLRDVL
FT                   TRLPTWPNSQLNALLPYAENRFS"
FT   gene            67567..68973
FT                   /locus_tag="YPA_CD0075"
FT   CDS_pept        67567..68973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0075"
FT                   /product="protein-tyrosine phosphatase Yop effector"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16319"
FT                   /db_xref="GOA:A0A0E1NQS1"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003546"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQS1"
FT                   /protein_id="ABG16319.1"
FT                   /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIA
FT                   SGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLR
FT                   SDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPPLPP
FT                   RERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACG
FT                   GEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPV
FT                   LAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAG
FT                   QKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRP
FT                   VIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLA
FT                   EGQGRPLLNS"
FT   gene            complement(69194..69373)
FT                   /locus_tag="YPA_CD0076"
FT   CDS_pept        complement(69194..69373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16320"
FT                   /db_xref="GOA:A0A0H2YD07"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YD07"
FT                   /protein_id="ABG16320.1"
FT                   /translation="MIRQAIKKCKVFPTDDSVRKVIYLAIRDASKKWSMPIQNWRLAMS
FT                   RFIIEFGDRLNDHL"
FT   gene            complement(69485..69793)
FT                   /locus_tag="YPA_CD0077"
FT   CDS_pept        complement(69485..69793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0077"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16321"
FT                   /db_xref="GOA:A0A0E1NQU5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQU5"
FT                   /protein_id="ABG16321.1"
FT                   /translation="MNIPVHRVVRILERLSTERGYPAFIRSDNGPEFIAAALVEWAEHH
FT                   GVILDMYLFRSLSEVRTLTEDWRTEYNEERPHSSLGNMPPVIYARQKLDGDPHWRWY"
FT   gene            complement(69790..70170)
FT                   /locus_tag="YPA_CD0078"
FT   CDS_pept        complement(69790..70170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_CD0078"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_CD0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG16322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YCT6"
FT                   /protein_id="ABG16322.1"
FT                   /translation="MGISRSLLHYCPNTARDIPVVEVLQKLAHQYPAYGFGLMFNKLRQ
FT                   SGLPWNVKRVYRVYRLLKLNFRRKGKKRLPNRHPQPLAIPLKMNHCWSVDFMSDALTDG
FT                   RRFRLFNVVEILTGKHWQLKLT"
XX
SQ   Sequence 70299 BP; 19718 A; 15661 C; 15856 G; 19064 T; 0 other;
     gtgtaacgaa cggtgcaata gtgatccaca cccaacgcct gaaatcagat ccagggggta        60
     atctgctctc ctgattcagg agagtttatg gtcacttttg agacagttat ggaaattaaa       120
     atcctgcaca agcagggaat gagtagccgg gcgattgcca gagaactggg gatctcccgc       180
     aataccgtta aacgttattt gcaggcaaaa tctgagccgc caaaatatac gccgcgacct       240
     gctgttgctt cactcctgga tgaataccgg gattatattc gtcaacgcat cgccgatgct       300
     catccttaca aaatcccggc aacggtaatc gctcgcgaga tcagagacca gggatatcgt       360
     ggcggaatga ccattctcag ggcattcatt cgttctctct cggttcctca ggagcaggag       420
     cctgccgttc ggttcgaaac tgaacccgga cgacagatgc aggttgactg gggcactatg       480
     cgtaatggtc gctcaccgct tcacgtgttc gttgctgttc tcggatacag ccgaatgctg       540
     tacatcgaat tcactgacaa tatgcgttat gacacgctgg agacctgcca tcgtaatgcg       600
     ttccgcttct ttggtggtgt gccgcgcgaa gtgttgtatg acaatatgaa aactgtggtt       660
     ctgcaacgtg acgcatatca gaccggtcag caccggttcc atccttcgct gtggcagttc       720
     ggcaaggaga tgggcttctc tccccgactg tgtcgcccct tcagggcaca gactaaaggt       780
     aaggtggaac ggatggtgca gtacacccgt aacagttttt acatcccact aatgactcgc       840
     ctgcgcccga tggggatcac tgtcgatgtt gaaacagcca accgccacgg tctgcgctgg       900
     ctgcacgatg tcgctaacca acgaaagcat gaaacaatcc aggcccgtcc ctgcgatcgc       960
     tggctcgaag agcagcagtc catgctggca ctgcctccgg agaaaaaaga gtatgacgtg      1020
     catcttgatg aaaatctggt gaacttcgac aaacaccccc tgcatcatcc actctccatc      1080
     tacgactcat tctgcagagg agtggcgtga tgatggaact gcaacatcaa cgactgatgg      1140
     cgctcgccgg gcagttgcaa ctggaaagcc ttataagcgc agcgcctgcg ctgtcacaac      1200
     aggcagtaga ccaggaatgg agttatatgg acttcctgga gcatctgctt catgaagaaa      1260
     aactggcacg tcatcaacgt aaacaggcga tgtatacccg aatggcagcc ttcccggcgg      1320
     tgaaaacgtt cgaagagtat gacttcacat tcgccaccgg agcaccgcag aagcaactcc      1380
     agtcgttacg ctcactcagc ttcatagaac gtaatgaaaa tatcgtatta ctggggccat      1440
     caggtgtggg gaaaacccat ctggcaatag cgatgggcta tgaagcagtc cgtgcaggta      1500
     tcaaagttcg cttcacaaca gcagcagatc tgttacttca gttatctacg gcacaacgtc      1560
     agggccgtta taaaacgacg cttcagcgtg gagtaatggc cccccgcctg ctcatcattg      1620
     atgaaatagg ctatctgccg ttcagtcagg aagaagcaaa gctgttcttc caggtcatcg      1680
     ctaaacgtta cgaaaagagc gcaatgatcc tgacatccaa tctgccgttc gggcagtggg      1740
     atcaaacgtt cgccggtgat gcagcactga cctcagcgat gctggaccgt atcttacacc      1800
     actcacatgt cgttcaaatc aaaggagaaa gctatcgact cagacagaaa cgaaaggccg      1860
     gggttatagc agaagctaat cctgagtaaa acggtggatc aatattgggc cgttggtgga      1920
     gatataagtg gatcactttt catccgtcgt tgacacagag aggcatacat ctgctttaat      1980
     cgtcggtttt cctcttcccg ctctttcatt cgctttatat cagaggactc catgccacca      2040
     tatttggatt tccagttgta gtaactggct tcagatccgc cgttctcgcg acagacatcc      2100
     ttcacatgcc ggccaccttc aacttctttt agaacccgca ggatctgagt ttcagtaaaa      2160
     cgtgctttct tcataatgac ctccgctgat tatatattaa ccagagaact ccattaaacg      2220
     ataagactaa attcaggggg gactacaaga taacggggag tggacaatac gttaataatg      2280
     cgttattcat ttcaatacgc aaatgtaatt taaactaatt atcatttaga taaatacgtt      2340
     tttaattcca atgccccgcc ggcatggcgt aaaaatataa agtatccatc cccccaaacc      2400
     ctatttatta gcaataaggt cagctagccc actggtaatg caggaatacc agagatagca      2460
     acgaatattg actgggatga catcaaaata accataaccc ggcagtcgct acaatgtgat      2520
     ctttcatcct aattctctca atttatatga ggagcagact ctactgataa atacccccac      2580
     ttcaggggat caccgaagga ggcgtattat tattctaaat tggctcaggg gaaagaattg      2640
     atacatgact ccttgaaaaa tggttacgta aatcaacctg ggggatatta ttgcctcaat      2700
     atacagtaga tatatattat ctcagccgtc agccgccgta tcctggcgca tggcggcttc      2760
     tagcaataat ttagcatcgc taagcgagag ttgttcagta cgcaagccgg tcactatcac      2820
     ttcccctgcc ttgccctgct ttagttccaa attagaaacg cgtggtaata agcaggcaat      2880
     atcgtgacga ctgagagccg tatttttcac atgttccagc acctcattgg caaaggcttt      2940
     ttcggcggta gatatctgat gactattctc tgtgagtggg ttagtttcag tgagacgacc      3000
     ggcctgcccc ccgtgtccca cttgggtaat ttgttgattt attaacgatt gaagagtatt      3060
     gattttcatc gagtctcctg tcgctataat tgtctctacg atattctaag ttatttattt      3120
     ttgctaaact actgtcgtag acgatttatt tttttaatcg gcttttaaac agaaaatcac      3180
     aataaaaaat tatttttggg aatcattctc ataaaacgag gatgaaaaat ccaatttagg      3240
     tagataactc aatcttataa tagataacac taaacatata tcgatagtta ttcctattct      3300
     gtaactttca tttgtcctaa agtggtagat attgcccgag aaagtgcttc aatttgccca      3360
     tcaatactcg cgtcaataat acctacctca gtctctaata tacagccccc ttgatccaaa      3420
     cgcgcatcgg cagtcacctc taaatagctt atttccggga agtctttatg tactttagct      3480
     atttgttcac gaatagctcc tgcctgatca gggttgaccc tgaccacgac ttgcttctga      3540
     ttactcacca aggctaaagc ctcccgcaca acttgcagtg tcatagccac ttgatcatag      3600
     tcattgagga ttttacgtac cgccaaaagt acaacttcac tcatctgttg ttcgacgtgg      3660
     cgataaaatt gctgacattg taactgtgtt tcatgaatca aagtcgcctg taaggtacgc      3720
     gcctcatcca tgccagcctg ccatcctaac tgcttttgtt gctcataaac ctcttgggcg      3780
     tcagccagga tcttttcagc atcctgtttt gcggcactaa tcaactcttc ggttgttaaa      3840
     ctggattggt aatcttcggc gcgcaaaata cgcagaccgc aagcgagcga gagattactt      3900
     ggtattattt gaacaaatgg ctgcatgtag gcgtaacctg tttgacaagt ttgtgacata      3960
     aagtttgggc cagtgggcgt tgtgactcgg ccactaacca aggttctgac ggcgtagcta      4020
     atgggaggcg taaactgagc cgtttacacc atgcctgagg ttggggttcc attgctgcta      4080
     accaaaaagc cagccccgac tggatcatgg tacggctctc tatttctgtc ggcagcgggc      4140
     gctgccagtg agtgggccaa ggcccgatta gcagctcatg ctgtacaata atttgcctta      4200
     atgtttcttg attaaccaat gtcaataatt gttgtaatgg ggaggccagt acacaacggc      4260
     gaatcgcctc cccatgcaga actaatccaa ggcgacaaag taacagttcg agctgtgatt      4320
     gaggctgcaa aggcagcgcc cccagcccat ggggctcttc atagtcggta tcaagagaaa      4380
     attcatccaa taaagcagca ttgagatgag cactatcgcg ccactgaggt aagtagggca      4440
     atattgaacg ccataatgat ggtaactgtt ccaagtgcaa ataagccgcg gggcagaagc      4500
     gcaattgaaa agaggtaata taattttcca tcatcacttc ttgcgttgta accaaaaata      4560
     ttgagcaaga ttggtcactg gcaaaagcaa aataagcaac gacaacaagc caataagatg      4620
     cccttttgac tcttcactca cttgaattga cagtatgctc gtgttacgag gtaaatgaga      4680
     gctttgacga acatctaccg atggcaccaa aatgacactg atgcgatcat aggccagccc      4740
     ctcaatacta ttattcacta attgtttaat ctgaggtatg taggtatcaa actgaatatc      4800
     tgctgcatgc ttgataaaaa ccgaagcgga tgctgctaca cccttcttac ctttgttatt      4860
     ttgctcttca ggcaatacga catgcactcg agccactaat accccgtcaa tttcagataa      4920
     agtgcgggag atctcttgcg ccttggcata attaagcctc gccaactctt ctatcggtga      4980
     agatatcaac ccatctttgg ggaacacatc ctgtaacgtg gagaaactct cgtgtggata      5040
     gcccttccgt ttgagaatat caatagcctg agcgacatct gactcctcaa ccaagagctt      5100
     aatcttccca tctttgtctg gctctttgtc tgcggaaagg ccttcttggc gcaacagcgc      5160
     aagcatttcg ttcccttcct tctgactaat tccggtataa agatcaactt tgcaaccagt      5220
     taaaaacaag attaatatca atgttgacag tgaagtctta actttcacta gttttcaccc      5280
     ccccttcgac aaggtttcaa cattttggct cattcgcccg gcagtcttgg cgataagttc      5340
     ttcttggatt gttatacgga taagtgacca ttgcattagc atcaggtcgt tgggattatc      5400
     aactgaaaca gccagcttag tgtgtaagtc acttttaacc gtcttaaaag acttctgaat      5460
     atcactaacc tccttgagga gtgaatggcc cagtccctgc gtatcttctg acattgccgc      5520
     atcaaagcgc attatttggt cagttgttgg ctctgccggc cctaattcct ccagcgtggt      5580
     tatgatcacc tcatcggcct gagctatttc tatgttcggc atttatgtat ccatatcaat      5640
     ttgatggctg ttatgaagta ggctatctac aatcgagtta gacggtaata ggatcattaa      5700
     ttctttattt attaactctg ataaataagg taatccaacc tggctctcat tgggttttat      5760
     accctctaat acttggagca atattgcttc ccaccgctta ccaaacgagt caaactgctg      5820
     caatacacta cgcaattcag gtaaatctat agccggtaca acagaccctt gatgttgacc      5880
     gaaacgcgcc agtaacgcct cacgtactgg cgtcgccaaa acctcaagaa cggcatggtc      5940
     aggagggtta ctggcataat attgctgcca cagaacttcc cgtgtctttt cagcggattc      6000
     actttttagc ttattctcca gttgtgtttt cagctcagat gctaccggtt gtagcgtaga      6060
     gactgcctga gacgaagaca tcaacgatgt aatggaacct ctattaaggg taaccgtcat      6120
     gtttttagtt gctccctcat tccattcaca aatgtctgta ttctaggatc ctgactcctt      6180
     gcgagacgat ttaaacgtga ctctaaggcg ctccccaacc cgaggcgata ttcacataag      6240
     gctaaccaag gttccaaatc aggataagct aatttatttc cttgttgcaa ggcgcttgcg      6300
     tagtccccac ggttcatcaa agaggaaagg cgaatcaatt gaaccgcctc ttcttcacct      6360
     ttcaaatgta accattcagc aatgcaattc gcttcttcgt ggtagtggtt gccggttcca      6420
     atcagagcaa tctctgctaa cagtacgttg agtttatatt tcatattatg ggaacttctg      6480
     taggatgcct tgcattaagt ctttcatgct acgaactatg gttgagttta tattgtaaat      6540
     taccgaccat ttattaattg aatgttgtaa gtcagcaagt agcgccgggt tgtcaggctt      6600
     atctttcaat gctgctatcg agtcattaac cgctttgttt gcatcgtctg ctggcttctt      6660
     gagcgtttga gccaccgcat ctaagtctgc gatatcggtt cctttcgtaa atccagagaa      6720
     gttactcatt tattttaggt ctcctgctac ataatgaata atggctatag ctgactcaag      6780
     agctttagat tctctctgcc aaacctgata ctgcttggca tcaccaccgc gcatcatatc      6840
     ttttttgagc ttagttagtg ccatttctag ttgcatggtg atagagcgca ctgtctccac      6900
     gttatgcagt tgctcctcta attgtgtcat cgaggtttac ctccattgag ttggatcaca      6960
     aattcccgtt ttcctttact cacaatcacc gcatcgcgtc gaatagccag aatacgaacg      7020
     ccattgttaa gtatggcacc ttctggatag cgttgatgat tgtcgagtac cacataaggc      7080
     actttcccta acgagatagc ttgcacctcg aaattcaatt catcatgctg gggttgcccc      7140
     ccgacattga ccagttctaa tttaggtcga ttgccaaact cttggcgaaa agtttgttgt      7200
     agttgattaa atgaattcaa tttttcatca ttgacttgcc cgcgtaattc aatcagctca      7260
     cctttaacat ttacagtgaa atctgaatcc agaccaaatt gttcaagtaa tgcatcaagc      7320
     cgcttgcgtt gattaccggc aatccgcact ttactttcta caccgagcag ccctggcact      7380
     tcagcttgca gcaggctatc aattttttgc ttttgtattt cctctgacac ttccccattc      7440
     aattgtagcc atcccgcttg cggtgctaaa gaaacctcaa ttccatggta tcccaaccgt      7500
     tgcaggatga attctgcccc ctgacgcagt tcttccatgc tgcgcagttc aagccggaat      7560
     ggaatgccat ggctctcaag aaaattttgc agtgacaagc gggcatgatt atcctggata      7620
     taaccagtta ataaccaagg ttcaccctct tttttgggcg atgttaaaac gacatccttg      7680
     taagcagcag ttgccagcaa gcgccgtact tcttgctcaa caagttgtcc atcctggtta      7740
     tactcgcgcc acaatccgtg ccctagcagc cccaaaaaag tcaaaagcaa caataaagaa      7800
     agaactccaa gcccaatccc aagtcgtgaa cgaggtaacc tgtcggttgg ctcttttctc      7860
     tgcgtgggaa cctgtaacgt ctctggcaaa ggttgcccta cggcgacaaa tgtccacagt      7920
     aaaaaaccta cttccagaca agagcccgcg cgaagaagag tccccaacgg cacgggaagc      7980
     ccttcttgta gtagaggttc tgcagaatca gttaggcgaa taccttcttc atcgaccatc      8040
     agcactaaat gcacgggtgc tatttcgctg tcagaaagaa caatatctga ctgcaacggg      8100
     tctgaaccaa aaacacagcg cccatgagga agctcaactt caacaccacg gtgcttccct      8160
     tgataaaaac gacagaccca actcacaata cgccacgctt aggcgctgaa acacaccatg      8220
     attccgcggg agtacaagca ccttcaacca cgcgccatcc caaacttttg tccatcttgc      8280
     actgagtaag ataggatgat ttattgtttt gactcagcca tttctgcact tcttgcgctt      8340
     tgtttaaagg ctgacactgg aagccaccta ataacttatt caaggtagtg ctttgattag      8400
     atatttcatc aacagctaag ataccagtac gtagatcccg accattacct aacgctaaat      8460
     gatgcgcaat accttcgtca ataatccgtg gttcgatgat aaacagccgt accgtacggc      8520
     gagttaactc acttttacgg cggaaaagtg cgccaagata aggaatatca ccaagcaaag      8580
     gcaccttact aagagcaaca ctcaattcgt cacgataaat accaccaata atcaaactct      8640
     ggccatgtcc cacgcgagcg acagtatcaa cgaccgtacg actgatagtg gggattccgt      8700
     caatccctga actattcggt ttttggttcc catcctcaat gtgtagattg agactgattt      8760
     ctgacttatc tccttgagtc agcacccttg gtgtcatacg cagcatagtg ccgtaggtga      8820
     tccctttcag ttcagccact tctttacctg tcactttgac gtaataggtt tcatggtgat      8880
     caatcaccgc ttgggcattt tcttgtgtta gcagggtcgg acgtgaaaca acttgagccg      8940
     aaccttcatt ttcaagtaaa ttgactcttg ctaataggta gtcaagcccg cgagcatcaa      9000
     tcaaactacc caatgcaccg tttgaagcga tgttactttg atccccggtt gtttttatta      9060
     ccacctgatg attgttgcca gtacgaatgc caactcgcca gtccacacct aattcagtaa      9120
     gttggtcggc atttatatcg acaatggata acgccacttc aatacgagcg ctaggtttat      9180
     caagcgcatg aattaaccgt tgatacattg gcatacgctc aggagaatcg cgcactatta      9240
     tcgcattgag cgatggatcc gcttcaacct tggcttgagc tgaagcccgg gtagcggcct      9300
     gcggtattct ctgattatcc actgtcactt gttggattgt ggcatcgctt aacacgcgtt      9360
     gaagtatcgt tgcaacccca ggagcagcca cttcgtcatc acggtaatga atagttcgat      9420
     cgctcgctga tgcatatttg agagggaaaa tctcaatcgc taatgcccct gttttttcac      9480
     tgcgaatttg cgtctgttgt tccaatgcgg ctgcggtctg ttcaaccaat tcaagataac      9540
     gaggaggacc agagacgtaa acaaggcggt tgctagcatc agggcgccag ccaaaacgag      9600
     gctcccatat accagaacgt tgtaatgcca gctttaactc tgcggcctca ctttcctgta      9660
     aacgaatgag acgagacgct acctcactat ttttaaaaat gtagagcaca ttgccatcat      9720
     agtaccaaac caaattgtaa agggaggcaa tatgctgtag gaaatcctga gggttatcat      9780
     gctcaaactg gccggaaact ttgtcattaa tcttatcgct tactaccact gtagcatcat      9840
     aattagcgct gaaatcaatt aataaatcgc gtaaactttc ccccttcgcc acataaacat      9900
     aaggtatagg caaccaatca agttcttgcg cccagctata gttagaaagt aacagtaacg      9960
     tcccggtgag tacgcgcttg aaaaaagaat gtagcggaaa agccatatta cttaattcca     10020
     ccccacgcga gacgctacag aaaatggtgt taactgagga attaaatgtt ctagcagagc     10080
     cagttgttta tttattactt cttgcaatcc gtgagtatca agctcttgta gacgtaaacg     10140
     cgcctccagt accaattgac cacaatcatc caatactaaa gtttgagggt aacgtttagc     10200
     ccatgccaac gcttgttgca ttagggagcg aagcaatgtg acgttaacgt tatttccttc     10260
     acgtaacatt ggtgcgtcaa taggagtgcg taataccagt tctgaaccat gcggagccag     10320
     catgacaaga tgcttatcta tagttaaacg gtaaacacct tgtttatcgg caacaaacgg     10380
     ttttcttcct aaactggctg ccaagttttt tagtaaattt tgcattattt ctcggatggt     10440
     tatatataaa ctaagtaatc ctgcgccaaa taaataacct acttcatgtc atcgtgacat     10500
     aaggtttcgc ggttcagctc aaacttccag atattcaaaa aaatgttcat gataattatc     10560
     aaccacctgt atagcaatag atgatattac gttaatcgaa ctaatgagac ttgctctatt     10620
     tgatggaggt cgtttcttgc gccaccgcac ttaataaacc agataagcta tattgattat     10680
     taaacaacat attattgcca tccagcggcg aaacaatact gttctatgtt tcgttgaaat     10740
     ttggctcatc ccattgaatc ttcacaatct aatcccgtat tttactttat agtccaaaag     10800
     tgtcttttaa aaaaaacaca gataatttta gcctgtggtt gctattttag taagacgggc     10860
     ttggcttgga gtgcatccga agcgacgtcg ataactttga gtgaaataag actgactcga     10920
     gaaccccgct tccatggcaa tatcaacaat actcatctta ccattaagaa gtaattggtg     10980
     agcatagaga atacgtcgct cgcttatcca ggcgcgtggt gaaatgccat aaactgtacc     11040
     aaacagttct ttgaatgtgg ttaatcccat gccgaattct cgcgcaaatt tgcttagctt     11100
     ccacccttgt agataatttt cctccataaa tttttgcaac cgttcttctg ggcggttgcc     11160
     taaatggcgc agagccgaga gaaataaagt cccttgcgag ctaaaggcaa gcaaaagcag     11220
     taattcctca atacgcagtt gcgttaatac tgacggaaaa tcactccgtt ccaatatggc     11280
     acatagattt tgaatggatt gtgataatat tggtgaaata ttaaaaatta acaatggttt     11340
     gggtgtggag ttgtctcgtc caatttcact aagcaaagaa ccaaagcgat gcaaaaaagt     11400
     actcaaaaaa ctgccgggta atggaatcca aagtaattgg cagggttctt ttgtaccaca     11460
     tcgaacagca tagctgccac gacgcaaaaa cagcatattc ccctcatcta aatcatatgt     11520
     ctgaccgctg ctctgccatg aaatctgacc ttgcaaaaga atatataggc catcttgtga     11580
     atgctcaaca accttaaata taggtgtgac ccattctaat ttaataatct ctagtgatgc     11640
     cataaatgtt atactgtcct aaaaatctaa aacttgtata tatttatcta atgaggtgta     11700
     ttgagttatt atgcgtgcga tgtacaacca tcgattaatg caaccaaaac caatataata     11760
     aatcacctat ctggtattag gtaactggca atttggataa catgttttag gtatcatttg     11820
     taaaacgact ttgtttttac cagtaagctt ttgctgagcc accgcctgaa ctcctcgctc     11880
     tggaaaagag agggttgacc gtaggtaaag ttcaccttcc ccgcgttgag ctggattcag     11940
     ttttatagaa aagaataaag gtaggttacc tgtttcgaaa tgagtgcgct gaacctctcg     12000
     aactttcccc tcatacaacc caaacatact aacatcaatg tgtgctatgc gagataatgg     12060
     tcgtgacata cgcacctccc ccacaatacg ctgagctggc attggggggg tagcgcaccc     12120
     cactaataga aaagaaatga tgagtgctat aatacgactc acgccagtcc ctcccttgag     12180
     ttcacacaaa gaagatagct agatgatagc aatccgagtt cgcgcaatat gtggtgaaat     12240
     ttattattgt aaaataacaa cccattccca attatctcaa cgggtccacc acgaactcat     12300
     ttaatttagc tactgcaata tcacaccttg cgcatataaa gccaaacatc ctttctttca     12360
     taaaaaaagg atgtttggtt agaatcggaa tcagcaaaca aacacatgta atagtaatga     12420
     caatactgta ttatttgtat tcaacaaaaa aaagtcaaga gattaatcct aattagtgct     12480
     agttatgttt aattgtaaaa tgcacaggag aaatacaatt accatactgt atatatggtt     12540
     ttaaatcgca tcatatattc ctaatataag tgaacctctt gttggttaac catatcgaat     12600
     aaattacata ttcccaatag ccggtgttaa tcaccccatt tttccgataa aaacatagac     12660
     tagaaagtag agaaaatagt atagaccaac aaaaatgtca tctgttttaa ccatattcct     12720
     agttacattg cagcctatta taacatttcg gaatgttgtt tctcgatatt ttgcctttct     12780
     agccatcgta gcacttcagc tgtggcctct atttgctcag ccggaatata gtgatcgacg     12840
     agcgcatccc aataaagagc acgggctaat gggatacgtt gtaaaatagg caccccttct     12900
     tcttctgcta ttttgcgcac agtctgaact tgggcatcgg tatatttgaa tgttaccaac     12960
     ggtagtggtg tttcccctcg cttgtaaaga ataccaatag caatatgggt cggattagct     13020
     accaccactg atgagcgttt aacattttcc cgcatgttcc tcgattggat ctcttgatga     13080
     aactgacgac gcttgctttt gatttctggg ctaccctcca tttctttgta ctcgcgtttg     13140
     atctcatcct tgctcatttt aagttcctta atatattgat agtattcaaa ggcatagtcg     13200
     gctatggaga tgaccacaaa gccaacagta cagataacca tcaactgccg gagtatttgc     13260
     cccaataaag gggtaataca ttcaattcca caggttggca actgcaagag tgtgactaga     13320
     tttcccttaa tgattatcca gatgagtata ctgagcaaaa caaccttgag aatggatttg     13380
     agaaactcca ctaaactttt gatggaaaag atacgcttgg caccctctat tggattgatt     13440
     tttttaatat ccggtttaat tgcttcacca cttataagaa aaccatactg cacaacatga     13500
     gatgcgatcg ccattaatgc cgccactgtt aacaaaggaa aacagagata aaaaaactcg     13560
     agcaacacat tgtcaaccac atagctaagc gcctgcgaga aaggaagata gctctgctct     13620
     gcggggatta gcatcagctt actaaaatgc tcgaaatagt agtcagaaag ccccattaac     13680
     atcgcactca gcgcgacgat aagcgcagta gagaccactt ccttactttt cgctacctgt     13740
     ccctttttgc gcgcatcacg gattttcttc ggggtgggtt gctctgtctt ttctccgctc     13800
     attacttctc caaaacaggg atcagtaaac ttataggatc cataaccaac agcattgctt     13860
     tactggcatg actcatcatt tgcatacagt agataaccaa caacaggctt gctatcgcgc     13920
     tttttatcgg catagccagc acaaagacgt ttaaagaagg cgcaaaacga ctgatgagtg     13980
     caagtccaaa ttcagctaaa aacatagcga tgagtaaagg agcagccaat acagcggcga     14040
     ttaatagtat ctggctgaat tggttataaa agaaatcaac ccactgttca ctaactgcag     14100
     ggaaaaagct ggccaccggc caatttacat agctgtgaaa gagggctgaa agcaaagaga     14160
     ggaaagcccc tccgctgaag aaaattgtta ttaacgtttg agtcaaaagt aaaccagtcg     14220
     gactagtttg actatcaagt ccaggattga gtagagatgc catcgcggca cctctttggt     14280
     tatctacaat aaatcctgcg gattctaagg cccagaaagg aatggtggcc acaaacccaa     14340
     tcaataaccc cagtatgatc tctttgccga taagcagcat caacgtaaac gcatcaacct     14400
     caatataagg ttggttagcg acggcaggat agacataaag agccaatgaa cagacaatac     14460
     cattacgcag caatactcca ccgaggagct gtttacttaa cactggcaat ataacaaaac     14520
     aagccataaa acgaggcaac agcagggtat aagtgagcaa tggtctttgg attaaatccg     14580
     ctatcatctt atgccttgta tcttcatcat ggtcatttct gcaaaactgt gcaattcatt     14640
     accaagccac gaggcggtag caaacagtgt gaccaccaca gcgatcaatt tgataacgaa     14700
     gcccagagtt tgctcttgga tttgcgttaa agcttgtact aaagatacca aagttcctac     14760
     caccgcagcc actaacaccg gcggcattga aaggactagc accagccata atgcctgact     14820
     ggtgaagtga attatgtcac cttgactcat gtcaccctcc gtagctaatc accagcccat     14880
     gcgtgagtcg tgtccagcca tcaagtaaaa caaatagcag caatttaaat ggcagtgaaa     14940
     tagtcatggg ggaaaccatc atcatcccca ttgccaacaa gatattggaa ataaccaggt     15000
     caatgacgat aaatggtaaa tagatgagaa agcctatctc aaatgctcga gtcaactcac     15060
     tcaccgtaaa cgcaggcaat aaaatgaaca ggctgtctga ctctaaccgg tcagcatact     15120
     gcttgggcca taactgttta gtgctgtcaa caaaaaaaga gtattcttgc gcttgaatat     15180
     gctgcttaag gaacatgcga tagggggcaa gcccttcatc aaagaatttc tcaacagatt     15240
     ctatgttcgt gaggctaacc tcattagctt gtaaatagtc ttgcgtcgcg aagccaacgg     15300
     gtgccattac ataaagacta aggatgattg ctaagccata cattgccatg ttggggggga     15360
     tttgctgtac cccaagggca ttgcggagta gtgaaaagac caccgcaaat ttgacaaacg     15420
     atgtagccat taccgaaatc aatggaagca gagtcagcaa agataaaacg atgatgagat     15480
     taatttcatc cggtaactgg atcatgaaat cgtaacctct gtcaggcgtt caattcgaac     15540
     cccgaggcgc ccttggatct cgaccaatcg accatgtcca agcaaccggc cgttagccag     15600
     caagcgcact tcaccatcaa caggtgttgt aagatcaata agagaacccg gctccaggct     15660
     agtgagtgtg tgccaatcta agatttgccg ccccacttca aagctaactt gaaccggaag     15720
     ttggttcaaa tcggtcaatg gttcggggtt aagttcgtca gattcatgac tcataccgat     15780
     aaactccaat ttatttgatt gtaattgaaa gtagccccaa gggttctcac caacataggc     15840
     gagtactggc gaattaggcc cactcccctc aggggccaac aacacatcac ctaatcgaag     15900
     ggaatcaacc tcatctagag tcaggtatac tttatgccaa cgcaaagaaa taaggatagg     15960
     caaaggtatg cgctcagaat tgggtcgtgc gggtaacaga gcgaacagag cctcagctga     16020
     ggttagccag aaggagatat gcgcattatc tcgggacagc cgcaaactca acagaggttg     16080
     cgtgacagaa agagacgctg tcgctatatc attacagacc agtttcggca ggaaaactgt     16140
     ctggcgttcc aacagcgcaa gttgcaactc tttcggcaga gtaaagaatg gagcccctag     16200
     taagtcggcg gttaaccagt tagccagatc attgccaaaa cagtagagcg tgaagtgcgt     16260
     tcccttccat tgtaactgta atatacagtt caaagacgaa ggaggctcag agacggtaag     16320
     ttcgagtttt ccctcttccc acaagtagtt ttgttgataa tggctgagcc gttgacgtag     16380
     cgacagttca cttaatttgg cctgtggcaa ggttaacaaa ctcattcttc agcctcccac     16440
     tcctcataga cgtggcgttt ctgacgtgac tcctgttcac tgtcatcgct agcttgaaaa     16500
     tcaagttgtg ttggctcaat gcgttgtaat cgctcaagaa gatcataact tccctgcgct     16560
     aaaattctta aagcttcccg actggcgatc agttctacat gcagttttcc cggaatctca     16620
     gcaatacgaa ccataatagc ccccaattca ggtaagttaa ggtgtaattg ggttacttgg     16680
     gatgagccgc cgcgcagttc tagttctacc gctagtcgct gtgctaactg tataagttgc     16740
     tctgagactg atgccagcct ggtcgcgcgc attgttgcta ataggtgatc acccggcgtg     16800
     acaaccggtg ctgtaaaaga caaggaatac atctccggca aggtttcttc gcgcggaagt     16860
     aacagttttt ctggtcgcgg tggttcgatg gtatctttgc tgctatcaac gccatcagta     16920
     agatgttggg accgatccgc cagctcggtc atgtccagtt gctctgactg cactgtcgct     16980
     ttgtacggaa aacgagcaga tttttctgct acctcagtca caggagtagc acaccatctt     17040
     gctaccaaat gatcatccgg tgtggcacta actgccgggg gacatatctc tggcaatgct     17100
     ttttgatgaa gagctaacgg ttcttctgca aggcgttttt gcctgctatc gcgctggttt     17160
     tttgctatac tggccggagt ttccctaccg acagaccata caataacctc tgcgccgtca     17220
     gcagccggat tcaatggctg aacagtcggc ttgctattca attgaactgg ttgagcggaa     17280
     tcgataggcg attgctgaac aaataactca tcatgtccag acggctcgca gggggattca     17340
     cttgatgtcc ccgtttcaca agtcaccccc tctaaaaagg gcgccaatgg catgagagca     17400
     ttaataatac tctctacgcg gtcatcaaaa cggctatcct gctggtataa gtgcgctcta     17460
     ttggtagcac cttcggcaag cggagataag ttgaaatcat gattattctg atggttgtgt     17520
     tgaggtttta atcctacctc tttccttccg ggttgagacg tcgccgctaa tggcgcatgc     17580
     gcacgcaagc catctccttt ctgaccttct tttttgccaa ggtcatgcgg acgtacaggt     17640
     ttaagcgact cttctttggg atgacaattc cccttattat tatgcaacag cgcttgctca     17700
     aaatcgacac atgcttgcaa agcatgatgc ggcttcccca gaggttgata ctcaggttct     17760
     aatggggaac gagtggtgat tttattcatt aggcgttcct gtgatgctgt agaaactctt     17820
     cttgttcttg ttcttcctga taatgttgtt gatttagctc atcttcatct tctcgtcgca     17880
     ctagctcgag aaacttattt tccttatgac gagcctgttg cagcatcttt tggcataacg     17940
     taaggcgctc acgctcattg gctaaacgtt ccaataattt ggcgcactcc agttcataat     18000
     tggcctcctt ttcacgtagc gacgctattt gtcgctgcca tttctccaaa tctttacaat     18060
     tcagtgtggt gttttttcgc tgatcaaata gacgttgctc ctcatcaata cgccacaaat     18120
     ggtaatcctg actggtttgc accgcctctt gatgacgtcg atgagctgcc tgcaagcaag     18180
     cttgctgagt cttgatggct ttctccgcac gttcaacgcg taaaacttta acccggtgca     18240
     ggcggcgtat cattgggtca gcgtctccaa taagttcagc gtctcattga aatggcttaa     18300
     ctcgtgcgtc ccctggcaga gccatcctcg aatcgccccc atgcgttcaa tcgcttgatc     18360
     ggcctctttg tcttgccctt tctggtactc cccgatttgc aacagcaatt ccacttcttc     18420
     atatttggcc aataaacggc gtaagtcccc cgcccaggtt ttgtgctcct tgctgacaat     18480
     ttgattcatc accctgctcg ctgaacgtaa tacgtcaatg gcaggataat gattagctgc     18540
     cgctaatttc cgtgacagaa taatatgacc atcaagtatc gaacgtgttt cgtcggccac     18600
     gggttcggtc atatcgtccc cttcgaccag tacggtatag agagccgtaa ttgacccttt     18660
     gctggactga ccagcccttt ccatcaaacg gggtaaagcg gcaaatactg acggaggata     18720
     accgcggcga gtcggtggtt ctcccgcagc taagcctatt tcacgctgag cacgagcaaa     18780
     ccgtgttaca gagtccataa gtaacaatac gcgtttccct tgatcgcgaa aatattcagc     18840
     aatagatgtc gccacgaatc cagctttggc tctttccatt gagggccgat ccgaggtggc     18900
     caccacgaga accgctttgc gtaacccctc ttcgcctaaa tcagactcaa taaactcacg     18960
     cacttcgcgt ccacgctcac caataagcgc cagcacggtt acgtctactt cagcactacg     19020
     aataagcgaa gcaagcagtg tacttttccc ccccccggcg gccgcgaaga tgcccattct     19080
     ttgcccctcg ccacaggtaa gcaaaccgtc aataacccgg atccccaaag aaagtggtgt     19140
     ggtaataagt tttcggctca tcggcgctgg ggcatcctga taaactgggt accaagccgc     19200
     cggttcaggg agatgccccc catcgaaagg ctgccctaaa ccatccaaca cctgtcccag     19260
     cagatgttca cccaccccaa cctgatgcat tgtccctgtc gggctaactt cagtattaga     19320
     agatatcccg tacatttcac caagtggaat aagtaatgct tgatgttggg caaaacctat     19380
     gacttcagcc tgtaaagaca ggctgttgtc agggttacgt aagtaacata actcaccgat     19440
     gcgcacacct ggcactaccg cttttaataa cgttcctgtc acttgagtga cacgtcctct     19500
     aatttggatt aggcggctac ctacaatgcc atgacgaata tgatgaggta tctgatctag     19560
     tgagagcata aatccataat ggttgaaata ttaaccacta ttttagtgac taaaaacgct     19620
     aaaaaattgt agcgggagcc gcgagttttt agaaaaatag ccaagcagca ctaaaatttc     19680
     tcggctgatt ttggcatcga taagcaagaa ctatttttat aatcgcggta attgtaatta     19740
     taaactgttc atctcaggga gtagttatga cgacgcttca taacctatct tatggcaata     19800
     ccccgctgca taatgagcgt ccagagattg ccagtagtca gatcgtaaat cagactctgg     19860
     gtcaatttcg gggagaatct gtgcagatag tcagcggcac tctgcagtct atagctgata     19920
     tggcagaaga ggtaacattt gtcttctccg agcgtaagga gctctccctc gacaaacgca     19980
     aattaagtga cagccaggct cgagttagcg acgttgagga gcaggttaat caatacctta     20040
     gcaaagttcc agagttggaa caaaaacaga atgtgagtga gctgctcagt ctgttgagta     20100
     acagccccaa tataagcttg tcccagttaa aggcttatct ggaggggaaa tcagaagaac     20160
     cgagtgagca attcaaaatg ctctgcggct tgcgtgatgc cctgaaaggg cgccctgaat     20220
     tagcacatct ttcgcatttg gttgaacaag ctctggtcag catggctgaa gagcaaggag     20280
     aaaccattgt attgggtgcc aggataaccc cggaagcgta cagagaatcc cagtcgggtg     20340
     ttaatccact gcagccgctc cgtgatacct accgcgatgc agtgatgggt tatcaaggaa     20400
     tttatgcgat ctggagtgat ttacaaaaac gttttcctaa tggggatata gactcggtga     20460
     tattattcct gcaaaaggcg cttagtgcag atctacaaag tcaacaaagc gggtctggac     20520
     gggaaaaatt aggaatagtt attagtgact tacagaagct aaaggagttt ggtagcgtga     20580
     gtgaccaagt taaaggattt tggcaatttt tttcagaggg taaaactaat ggcgtacgac     20640
     ctttctgagt ttatgggaga tattgtcgca ctggttgaca agcgctgggc ggggattcat     20700
     gacattgaac atcttgccaa cgccttttcc cttcctacgc ctgaaatcaa agtgcgtttc     20760
     tatcaagatt taaaaagaat gtttcgtctt ttccctctgg gggtatttag cgatgaggag     20820
     caacggcaaa atttattgca aatgtgtcaa aatgcgatcg atatggctat tgagagtgaa     20880
     gaggaagaat tgagtgagtt ggattgaacc catcatttcc catttctgcc aggatctggg     20940
     agtgccaaca tctagccccc tttcgcctct tattcaatta gagatggctc aatctggcac     21000
     gctgcaactg gaacaacatg gtgcgacact gacattgtgg ttagcgcgtt ctcttgcctg     21060
     gcaccggtgc gaagatgcta tggtcaaagc gctaacgctc acggcggccc aaaagagtgg     21120
     cgctttaccg ctgcgagcgg ggtggttagg ggaaagtcag ctggtgttat ttgtctcgct     21180
     tgatgagcgt tccttaacct tgcccctttt acatcaagct ttcgaacagt tactgcgatt     21240
     gcagcaagag gtgcttgcgc cgtgagtcgc ataataactg ccccccatat tggcatcgaa     21300
     aaactgtcgg cgattagcct ggaagagcta tcctgtggct tgcctgaacg ttatgccttg     21360
     ccgcctgatg ggcatccagt cgaaccacat ttagagcgcc tttaccctac agcacaaagc     21420
     aagcgtagcc tatgggactt tgcttctccc ggctatacat ttcatggatt acatcgagct     21480
     caagattatc ggcgcgaact ggataccttg cagtcactgc taaccaccag tcagtcctca     21540
     gagctacaag ctgccgcggc gctgcttaaa tgccaacaag atgatgatcg gttactgcaa     21600
     ataatcctta acctgttgca caaagtatga atattacttt aaccaaacga caacaggagt     21660
     tcttgctgct caacggttgg ttacaactac aatgtggcca tgcagagcgc gcatgtattc     21720
     tattggacgc cttgctgacg ttaaatcctg agcatttagc cggtcggcgt tgccgattag     21780
     tcgcgctact taataataac cagggagaac gtgccgaaaa agaagcgcaa tggctaatat     21840
     cacatgaccc tttacaggct gggaattggc tctgtttgag ccgcgcccaa caactgaacg     21900
     gcgatcttga taaggctcgc catgcttatc aacattattt ggagttgaaa gatcataatg     21960
     aatccccatg atcttgagtg gctaaatcgt attggcgagc gtaaagatat catgctggca     22020
     gtgctgctgt tagctgtggt attcatgatg gtcttaccac tcccccccct tgtgttggac     22080
     attctgattg ctgttaacat gaccatttca gtggtgttgt taatgatagc gatctatatc     22140
     aactctcctt tacaattttc agctttccct gcggtgctac tcgttaccac gttatttcgt     22200
     ctcgcacttt cagttagcac cacccgcatg atcctgctac aagctgatgc ggggcagatt     22260
     gtttacacct ttggtaattt cgtcgttggc ggtaacctca tcgtcgggat tgtcatcttc     22320
     ctgatcatca ctattgtgca atttttagtg ataacgaaag gctcagaacg tgtagcagaa     22380
     gttagtgcca gattctctct tgatgcgatg ccgggtaaac agatgagtat cgatggcgat     22440
     atgcgagccg gggtgatcga tgtcaatgaa gcgcgtgagc gacgcgcgac gatagaaaaa     22500
     gaaagccaaa tgttcggttc tatggacggc gccatgaagt tcgtcaaagg ggatgcaata     22560
     gccggcctca ttattatctt tgtcaatata ttaggcggcg tcaccattgg tgttacccaa     22620
     aaaggattag cggccgctga ggcactgcaa ctctattcca tcctcactgt cggggatggg     22680
     atggtttctc aggtacctgc cctgctgata gctattaccg cgggtattat cgtcacccgc     22740
     gtctcttcag aagattcatc agatctgggt agcgatattg gcaaacaggt tgtcgctcag     22800
     cctaaagcca tgctaattgg tggcgtactg ctgttgctct ttggtcttat ccccggcttc     22860
     ccaacagtca cctttctgat tttggcgcta ttggtaggct gtggtggtta tatgctcagc     22920
     cgtaagcaga gtcgtaatga cgaggctaat caagacctgc aatccatact gacgagcggt     22980
     tctggcgccc cggctgctcg aaccaaagcc aaaacaagtg gggcaaacaa gggccgacta     23040
     ggggaacaag aagcatttgc tatgacggtt cccttgctga ttgatgtaga ttcaagccaa     23100
     caggaagcac tggaagcgat agcactaaat gatgagctgg ttcgagtgcg ccgtgctctt     23160
     tatcttgatc ttggcgtacc tttccctggg atccatctgc gttttaatga ggggatgggt     23220
     gaaggcgaat atattatttc cttgcaagaa gttccagtgg cgcgaggtga gcttaaggca     23280
     ggttatttac tcgtgcgtga atccgtcagc caactcgaat tactgggtat accctatgaa     23340
     aaaggggaac atttgctacc cgatcaggaa gctttctggg tatcggttga atatgaggag     23400
     cgcctggaaa agtctcaact ggaatttttc tctcattccc aagttctaac ctggcatctt     23460
     tctcatgtcc tacgtgaata tgccgaagat ttcattggta tccaagaaac ccgctatctg     23520
     ctcgaacaga tggaaggagg ctatggcgaa ttaattaaag aagtacaaag aatcgttccc     23580
     ttacaacgaa tgaccgaaat attacaacga ttagttggag aagatatttc tatccgtaat     23640
     atgcgatcta ttcttgaagc tatggtggaa tggggacaaa aagagaaaga cgtcgttcaa     23700
     ctcacagaat atatccgcag tagtctaaaa cgttatatct gctacaaata cgctaatggc     23760
     aacaatatat tgccggctta tcttttcgat caagaagtag aagaaaaaat tcgtagcggt     23820
     gtgcgccaaa ccagtgcagg gagttatttg gcattggagc ctgctgttac cgagagttta     23880
     cttgaacaag ttcgcaagac tattggcgat ctatcgcaaa tccagagtaa accggtgctg     23940
     attgtttcta tggatattcg tcgctatgtg cgcaaactga ttgagagcga atactatggc     24000
     ttgccggtac tttcatacca agagctgact cagcagatta atatccaacc acttggacga     24060
     atttgcttat gatggcagat cctttaattc cgtggcttac cgaacatggc ttggtttgcc     24120
     accctcatac tttgtctggc acccccattt ctttaggttc ggcctttcaa ttagctggcc     24180
     tcaagcttgc ctggcgcgta gaaattgaac aaaggcgggt ttggatcgtg cttatccaac     24240
     gagtggaaca acgtcgaggg ctgaaaaatc ccttcgcggc actttatatg ttagctaatg     24300
     cagcgcgggc cgttcttggc cctgactatt atctgtatgg caatgtcgat gtactggcgg     24360
     ggagttctct cagtacgcaa cggctcgctc atttttatcg gcgttggacc ggggccaaag     24420
     aattaagcac cgggtggttc tcactaaaag tatcacaagt catcacctta tctaatatga     24480
     aaaagcgaca aaacaacggc tttgcctgac aagctaaata aaaataacgt aatagaatag     24540
     gaggtagatt atgaagtctt cccattttga tgaatatgac aaaacgctta aacaggcaga     24600
     actggcaata gccgacagcg atcaccgcgc aaaattattg caagaaatgt gtgctgatat     24660
     cggcttaacg cctgaagccg taatgaagat atttgcgggc cgttccgccg aagagataaa     24720
     gccagcggag cgcgagttgc ttgatgaaat taagcgtcag agggagaggc agcctcaaca     24780
     tccctacgat gggaagagac caagaaaacc aacgatgatg cgagggcaaa ttatttaata     24840
     tgattagagc ctacgaacaa aacccacaac attttattga ggatctagaa aaagttaggg     24900
     tggaacaact tactggtcat ggttcttcag ttttagaaga attggttcag ttagtcaaag     24960
     ataaaaatat agatatttcc attaaatatg atcccagaaa agattcggag gtttttgcca     25020
     atagagtaat tactgatgat atcgaattgc tcaagaaaat cctagcttat tttctacccg     25080
     aggatgccat tcttaaaggc ggtcattatg acaaccaact gcaaaatggc atcaagcgag     25140
     taaaagagtt ccttgaatca tcgccgaata cacaatggga attgcgggcg ttcatggcag     25200
     taatgcattt ctctttaacc gccgatcgta tcgatgatga tattttgaaa gtgattgttg     25260
     attcaatgaa tcatcatggt gatgcccgta gcaagttgcg tgaagaatta gctgagctta     25320
     ccgccgaatt aaagatttat tcagttattc aagccgaaat taataagcat ctgtctagta     25380
     gtggcaccat aaatatccat gataaatcca ttaatctcat ggataaaaat ttatatggtt     25440
     atacagatga agagattttt aaagccagcg cagagtacaa aattctcgag aaaatgcctc     25500
     aaaccaccat tcaggtggat gggagcgaga aaaaaatagt ctcgataaag gactttcttg     25560
     gaagtgagaa taaaagaacc ggggcgttgg gtaatctgaa aaactcatac tcttataata     25620
     aagataataa tgaattatct cactttgcca ccacctgctc ggataagtcc aggccgctca     25680
     acgacttggt tagccaaaaa acaactcagc tgtctgatat tacatcacgt tttaattcag     25740
     ctattgaagc actgaaccgt ttcattcaga aatatgattc agtgatgcaa cgtctgctag     25800
     atgacacgtc tggtaaatga cacgaggtaa ttatgcaaca agagacgaca gacactcaag     25860
     aataccagct ggcaatggaa tccttcctaa aaggaggggg aactatcgcc atgctcaacg     25920
     aaatttcaag tgacacttta gagcaactct actctcttgc atttaaccaa taccagtcag     25980
     gaaaatacga ggatgctcac aaggtctttc aagctctctg tgtgctagac cactatgatt     26040
     cacgtttctt tttagggcta ggcgcttgtc gtcaagccat ggggcaatac gacttagcga     26100
     ttcatagcta cagctatggc gccataatgg atataaaaga acctcgtttt ccgtttcatg     26160
     cggccgaatg tttactgcaa aagggagagc ttgctgaagc agaaagtggc ttgttcttgg     26220
     ctcaagagct tatcgcagac aaaactgagt ttaaggagct ttccacccga gttagctcaa     26280
     tgttagaagc aattaaattg aaaaaggaga tggaacatga gtgcgttgat aacccatgac     26340
     cgctcaacgc cagtaactgg aagtctactt ccctacgtcg agacaccagc gcccgccccc     26400
     cttcagaccc aacaagtcgc gggagaactg aaggataaaa atggcggggt gagttctcag     26460
     ggcgtacagc tccctgcacc actagcagtg gttgccagcc aagttactga aggacaacag     26520
     caagaagtca ctaaattatt ggagtcggtc acccgcggcg cggcaggatc tcaactgata     26580
     tcaaattatg tttcagtgct aacgaagttt acgcttgctt cacctgatac atttgagatt     26640
     gagttaggta agctagtttc taatttagaa gaagtacgca aagacataaa aatcgctgat     26700
     attcagcgtc ttcatgaaca aaacatgaag aaaattgaag agaatcaaga gaaaatcaaa     26760
     gaaacagaag agaatgccaa gcaagtcaag aaatccggca tcgcatcaaa gatttttggc     26820
     tggctcagcg ccatagcctc agtgattgtc ggtgccatca tggtggcctc aggggtagga     26880
     gccgttgccg gtgcaatgat ggttgcctca ggcgtaattg ggatggcgaa tatggcagtg     26940
     aaacaagcgg cggaagatgg cctgatatcc caagaggcaa tgaaaatatt agggccgata     27000
     ctcactgcga ttgaagtcgc attgactgta gtttcaaccg taatgacctt tggcggttcg     27060
     gcactaaaat gcctggctaa tattggcgca aaactcggtg ctaacaccgc aagtcttgtg     27120
     gctaaaggag ccgagttttc ggccaaagtt gcccaaattt cgacaggcat atcaaacact     27180
     gtcgggagtg cagtgactaa attagggggc agttttgctg gtttaacaat gagccatgca     27240
     atccgtacag gatcacaggc aacacaagtc gccgttggtg tgggcagcgg aataactcag     27300
     accatcaata ataaaaagca agctgattta caacataata acgctgattt ggccttgaac     27360
     aaggcagaca tggcagcgtt acaaagtatt attgaccgac tcaaagaaga gttatcccat     27420
     ttgtcagagt cacatcaaca agtgatggaa ctgattttcc agatgattaa tgcaaaaggt     27480
     gacatgctgc ataatttggc cggcagaccc catactgttt aagtttaagg aggaataacc     27540
     atgacaataa atatcaagac agacagccca attatcacga ccggttcaca gcttgatgcc     27600
     atcactacag agacagtcaa gcaaagcggt gagattaaaa aaacagaaga cacccgtcat     27660
     gaagcacaag caataaagag tagcgaggca agcttatctc ggtcacaggt gccagaattg     27720
     atcaaaccga gccagggaat caatgttgca ttactgagta aaagccaggg tgatcttaat     27780
     ggtactttaa gtatcttgtt gttgctgttg gaactggcac gtaaagcgcg agaaatgggt     27840
     ttgcaacaaa gggatataga aaataaagct actattactg cccaaaagga gcaggtagcg     27900
     gagatggtca gcggtgcaaa actgatgatc gccatggcgg tggtgtctgg catcatggct     27960
     gctacttcta cggttgctag tgctttttct atagcgaaag aggtgaaaat agttaaacag     28020
     gaacaaattc taaacagtaa tattgctggc cgcgaacaac ttattgatac aaaaatgcag     28080
     caaatgagta acattggtga taaagcggta agcagagagg atatcgggag aatatggaaa     28140
     ccagagcagg tagcggatca aaataagctg gcattattgg ataaagaatt cagaatgacc     28200
     gactcaaaag ccaatgcgtt taatgccgca acgcagccgt taggacaaat ggcaaacagt     28260
     gcgattcaag ttcatcaagg gtattctcaa gccgaggtca aagagaaaga agtcaatgca     28320
     agtattgctg ccaacgagaa gcaaaaagcc gaagaggcga tgaactataa tgataacttt     28380
     atgaaagatg tcctgcgctt gattgaacaa tatgttagca gtcatactca cgccatgaaa     28440
     gccgcttttg gtgttgtctg accattgatg accttggtta gttaattaac cgaaagtttt     28500
     attttacctt accccttatg gtgatagagc ttatctatat aaggtataag gtgctgaaaa     28560
     gccctggatt aacattagtt aatccagggt tgtgattatt aaattaaaaa taataagtta     28620
     ggatcatatg acaattaaaa taaaagatta tttacatgta gtagctcaag acctgagctg     28680
     acagttaccg gttgttgaac ggcaatacgc ggtcattgag cacgtcagcg gctgtgatcg     28740
     gcattttgct cgtatacagc gagagtgtta gaaatgctgt gtcattccag taatatgcaa     28800
     tcaaaaaaga atgacacata tcccaataat gagagtcggt gattttactc attgatgggg     28860
     gggaataatt aggctaaaac aacctcaatg ttaaagagcc gattcataaa ggtagatcct     28920
     tcccgcactc aatattcagg ttcgtcacgg cgtaaccaaa tatcaaattg acctttattc     28980
     agtcgttgca atgtttcaaa tccctgaagc gttgaccagg cacggtttgg ccgtttgaaa     29040
     tccccggccg cgtttaccaa ttttttgatg ggggcatggt cagactcgat acgattattc     29100
     aggtatttga cttgccgctg ctttgcagca tcccgtatct tttccttctt tcatcaaacg     29160
     agtgatagcg taaccgtatg acgaatgttt atcggtattg agtattttag gctgtctttc     29220
     aacagaatag ggttttaaca cccgtttaat gaatggatag gcggtatttt tatttcgttt     29280
     aggcgaaaaa taaaaatcta atgtagtgcc gtgcttattg atggcgcgat agagataaaa     29340
     ccattttccg ttgaccctga tatagatttc atcgagttgc catgaggagt cggcatccgt     29400
     aaattgatat cgtttcaatt tctgacgagg tataggtgca tattcaataa actaacggta     29460
     aatggtagag cgataaacgg aaatcccacg ctctgacagc atatcgctga cattggcata     29520
     actcatcggg ggcaaaatgt tcccacttga aatcacctgg ggccatgtgg attcactgaa     29580
     gaagggatga atagcctcag ttttcatgac aactccattt tttgcaacaa gcccaaatat     29640
     agtgatgctg aagtggcaca aacgctggat accgcgcaaa agcacaccct gacggtttca     29700
     aaaggggtac tggatacggc caaacagtat actaacaccg tcagcagtaa tacattggac     29760
     agtgccaata cctataccaa taataaagca gactaacatt gaaggatgct aataattata     29820
     ctgttcagaa ggtaaacaga gatgctataa gtggtgttat agatcaggaa ttatattgag     29880
     aaaccattga agaaactaaa gagcaaatgg ccggtattga aactactgcc ccaaaataca     29940
     ctgatttaaa gtttaatgat atttccggta aggttgactc tgcggccata caatacttct     30000
     gacatatttc ttctggttat ttatgcataa aaatggccaa aaactttcaa tggtagaaga     30060
     gctaaattcg gataaataac gcataaaaat tcccggcgaa aaactatata catatataaa     30120
     tttaatatgt atgtttttgt ttgcagtgaa aaactcgata ataaaaatat tttcagaaag     30180
     gcattcaata tgttcataaa tccaagaaat gtatctaata cttttttgca agaaccatta     30240
     cgtcattctt ctaatttaac tgagatgccg gttgaggcag aaaatgttaa atctaagact     30300
     gaatattata atgcatggtc ggaatgggaa cgaaatgccc ctccggggaa tggtgaacag     30360
     agggaaatgg cggtttcaag gttacgagat tgcctggacc gacaagccca tgagctagaa     30420
     ctaaataatc tggggctgag ttctttgccg gaattacctc cgcatttaga gagtttagtg     30480
     gcgtcatgta attctcttac agaattaccg gaattaccgc agagcctgaa atcacttcta     30540
     gttgataata acaatctgaa ggcattatcc gatttaccac ctttactgga atatttaggt     30600
     gtctctaata atcagctgga aaaattgcca gagttgcaaa actcgtcctt cttgaaaatt     30660
     attgatgttg ataacaattc actgaaaaaa ctacctgatt tacctccttc actggagttt     30720
     attgctgctg gtaataatca gctggaagaa ttgccagagt tgcaaaactt gcccttcttg     30780
     actgcgattt atgctgataa caattcactg aaaaaactac ctgatttacc tctttcactg     30840
     gaatctattg ttgctggtaa taatattctg gaagaattgc cagagttgca aaacttgccc     30900
     ttcttgacta cgatttatgc tgataacaat ttactgaaaa cattacccga tttaccccct     30960
     tccctggaag cacttaatgt cagagataat tatttaactg atctgccaga attaccgcag     31020
     agtttaacct tcttagatgt ttctgaaaat attttttctg gattatcgga attgccacca     31080
     aacttgtatt atctcaatgc atccagcaat gaaataagat ccttatgcga tttaccccct     31140
     tcactggaag aacttaatgt cagtaataat aagttgatcg aactgccagc gttacctcca     31200
     cgcttagaac gtttaatcgc ttcatttaat catcttgctg aagtacctga attgccgcaa     31260
     aacctgaaac agctccacgt agagtacaac cctctgagag agtttcccga tatacctgag     31320
     tcagtggaag atcttcggat gaactctgaa cgtgtagttg atccatatga atttgctcat     31380
     gagactacag acaaacttga agatgatgta tttgagtagt acgcaagagc gttcataatt     31440
     ctgcgtcacg ttaaaatatc attacaacgt aatcacttta tcgaggcgac cttcaaaata     31500
     aatcgccaac tgtgacaatg ccaaattcca gctctggatt ggcattgtcc atctttcctg     31560
     cgcattcatt aatcccagat acagtgattt caacagactg ttctcattag ggaaaatgcc     31620
     tttcgttttt gtcagctttc tgaacagccg atgtaccgat tcaatggcat ttgtcatgta     31680
     aatgaccttg cggatcgttg tcggataccg gaagtaacac gacaaattgg cccatttttt     31740
     ccgccacgac tggagtacca ctggatattg ttggccccat taccagttga ggctcaaaag     31800
     ttccattgcg atcacggggc gtggcgagtt caaacgtacc agtgggagtt ttgaccgttt     31860
     ttctggacga accatttttg cggttggctt cgatgtccag agccagatga gtctgaccat     31920
     gcccccatca aaaaattggt aaacgcggcc ggggatttca aacggccaaa ccgtgcctgg     31980
     tcaacgcttc agggatttga aacattgcga cgactgaata aaggtcaatt tgatatttgg     32040
     ttacgccgtg acgaacctga atatcgagtg cgggaaggat ctacctttat gaatcggctc     32100
     tttaacattg aggttgtttt agcctaatta ttccccccca tcaatgagta aaataccgac     32160
     tctcattatt tgcagcaaac ctatatattg cgctgaatca tagatcaccc atcataactg     32220
     gggataaaac cacttaatat gttgtaaccc cacggtttca tatgagtatt ctccgattac     32280
     atatatgtta gttgccatgg ataatccgta atgttaaata gagttatttt ctgtgtcaca     32340
     atcataaata acacaattgt tctttcagaa ctcaacattt taatatactg tagcaatggt     32400
     atcaatagtc atacttatta aaatgatatt ttcctcacag ttaattacac agcgtgaagt     32460
     aatgatatgg tgtttatttt gttattaaat gtcgtatctt gtttaatggt tttatttatg     32520
     tgtttaactg atttcaatgt aaaaaatatt ttttacattt agtaagtcat gtcaatgata     32580
     tttgataaag ataattactg cttaattgat ggatattttt tgttttttta atcaacggtg     32640
     gcgtcgctat cgtcttaacg ttcacagaag atatcattct gcatagctcc gccagcatcc     32700
     aggcaagcat ctactgtcag aaagtgctca actttcatac cagcataaaa agcagcgcac     32760
     aatgcggtgg ctatcactag tcgttttttc attgcatagt cctcgtaggt tagattatgc     32820
     cccatgagct gagaagagtg agctatcgtt gtcttgagct ttctgtccgg ggtatcatcg     32880
     aattttactt tatttacata gaatttatat tctatcatac cataattaaa ctttacttga     32940
     ataaaaacat cggtgtgctg accatattcc tgatatgaat ataataatat agccttaatg     33000
     ctcatggtaa taaagtgccc tacagcaatt tcggcgggtt tgctgcaaat aatgagagtc     33060
     gtgattttac tcattgatgg ggggggaata attaggctaa aacaacctca atgttaaaga     33120
     gccgattcat aaaggtagat ccttcccgca ctcgatattt aggttcgtca cggcgtaacc     33180
     aaatatcaaa ttgaccttta ttcagtcgtc gcaatgttta aaatccctga agcgttgacc     33240
     aggcacggtt tggccgtttg aaatccccgg ccgcgtttac caattttttg atgggggcat     33300
     ggtcagactc aatacgatta ttcaggtatt tgacttgccg ctgctttgca gcatcccgta     33360
     tcttttcctt ctttcagttt tcatgacaac tccatttttt gcaacaagcc catagtgggg     33420
     acaatgaaca ttaacgccga tcatgagaaa aacttaaaag tgagcattat atataaaatt     33480
     caactaattg gaggaatcac cgaaatactt aatggtgggg ttattaactg ggggatattt     33540
     aacttggtag gatatttcaa atcgtctata tcactaataa aaataataat tattgataac     33600
     actaatttgg tcatgttata tgtaaaaatt tggataaata atgaaaactt cttaatttat     33660
     agtgaattaa aaacaaatga gttattatat aaaccatatc tattaaattt aatagatatt     33720
     attgtaacta tgtagtgaaa taactttgta tggtaccgcg tatatgattg tttacatttc     33780
     agatgaataa tatgggtgat gtcgagttgg gctgaaactt agtattttgc ggttcttttc     33840
     tctgctcaat atcatcaatg aaacgttcta accaagcctg catttcatcg atatccaacc     33900
     ctaccagtga ttgttgagac cagagaatag gtttaccgtc cagtcttcct tgaacatggg     33960
     caggccaatg ttcgccaaac aaattatcgt tggttggcaa atcagcacct agctcactga     34020
     acaactgtac ccattgttga tgataacaag caatcagtac ttggatgtgc ccatccactt     34080
     caaatgtaaa tgtataaacg tcattttcat taacttgatg gttcaagcca agcttcagga     34140
     aaagctgttg cataagttct gtgaaggttg tctgcattaa acctccttgg agtcaaatgt     34200
     taacactcta aaacgctgcc ccacccccag aggataatga tacatagaat taccccagaa     34260
     tgagttagta aaccatttgc ggaacttttc cttatcagaa aagtggaatt caccgaaatt     34320
     gggatcgaag aaagtaacac cactcttttc gttgacatac gccgctatgg cgtgggctga     34380
     catttggcct gagagatgta tttttttata accgtaacct atcccatgag tatcaaggat     34440
     agcgtttaat aattgatcca gcccttctga ttccgtcgta ccagtaacat caactggacg     34500
     cagtaagcaa tgccgttcaa tcatacgttc tgatatgcca tttttcttga accaatctag     34560
     tgttacctca tcttgatcaa cgtctgcttt acaaccatct atttgcaact gtttaattga     34620
     gtaaagtgta tcgatctgga atttcccctt acgcccgcca acatagagct ggtcaaataa     34680
     gctttggcct tgtgcatggc tcctgatcca atgtgcacat aaagcctcac agacaccgct     34740
     agcagtgtct gaatgtttta ttattttatg aagaaaagcc cctttggtct gagcaaactt     34800
     gaaattgatg ttacctccgt aatttgcaac agactctctc accgcgggca cacgagtgct     34860
     gagtacaaaa tgtatcatgc gatacataat catactgaag gtaaagctgc tgcgttggtt     34920
     agctttgccg tcgctggtca actttctatc cagcatagaa cggcctgact ggttatgttt     34980
     tatggtggct gataactttt tctgcaggtt tgagtgtgac agtgctgttt ccactttcac     35040
     tcggtgtgcg ccaatcaccc cttcggtgag ggtagctgat tgaaggtttt caccggcaga     35100
     ataattcgat agttgaatat ggtagtgtcc gtgaatactg ttcatctgta taacctattt     35160
     atgttagcca ttattttgct ataccgataa attgaatata tctggatttt gacgtctggc     35220
     aatgaacgat agagcctaca ataaattata accaataggt gactcaggga ttttctctga     35280
     atcagagtac atgttgtaca ttcgattaaa tattttttca atagttaaaa gttacttttt     35340
     attataaaaa ttcaacttat ggggacagtg atgttatgtt gatagcgtcg gggcgtcgcg     35400
     gggagagttt ataataaact ctaatgtgat aaaaatccat tctaataatg atatattata     35460
     ctatatctgt agctttaaaa taaataatta tagagtggag gatgcttgaa atatttcgat     35520
     gcatgggaag ctcattgaga gtagatattc tatttttata aattacggag tgattttaat     35580
     tatacactcg tagtgacggt tattaaatag tgtagtttat aaagtaaatt tgggagtagt     35640
     aactatgttt attaaagata cttataacat gcgtgcttta tgtaccgctc ttgaacagtc     35700
     ggctcctgat acaataataa atacatctaa agaagaaaat aacagttact actgcgctac     35760
     tgctcattta ctgagaacgg atgtttgttc attggtcaat agagtaggga ttgaaccact     35820
     taaaagtgga tcaatattat ctactttaga agagttatgg caggctgttg gtatagtata     35880
     tcgcttatac gaatggcaac atgtcagcga tattgacacc aattttaaga aactacccaa     35940
     taattctgat tttggtcttg tgttttctgt attagattgt gatatagagt atgtgttcat     36000
     agggaaaaaa gacagtgaag ggaatataga attttatgat ccgaaaaact ctctacttat     36060
     agagaatgat gacataaaaa aatatttata tgatgaagat tttcatcgtt tttgtattat     36120
     gctgatcatc tctaaatctg agttggagga attgagtcgc gaatcctgcg atcaagaatg     36180
     tattatggga tgaagctata ttaaagagtt tgggatatgg tagttgatta tgttaaaggt     36240
     taattatctg taacatataa aaaacagtgg tatgtaatca tcctgcataa tcgtaccatt     36300
     catatttaga gatcttccgg catactgacc ttgccaatga aggagatcgc taaacgggta     36360
     caccgtatct attgcctcct gaaactcaat attcgccgca aagggaaaca acgcctgcca     36420
     gcctgtaacc catcaccgct ggcggtaccg gaacgactta acctgagcgg gtcggtcgat     36480
     tttatgcaca atgcacaatg cactgagcgg tgggtgtcat ttcagtacgt tataatgtca     36540
     tggatgatta caatcgtgaa gcactggcga ttgtaatcga tctgaacctg ccaacacagc     36600
     gccgtcatca gagtactgga tcgcattgtg gtcaaccgtg gctatgggag gtgccatgcc     36660
     ctgttttaaa tggaagatga tatgaagaaa aacatgaagt taatagcaat gactgccgta     36720
     ctgtcctcag tattagtcct ctccggctgt ggtgcgatga gcacagcaat caaaaaaacg     36780
     taatctggaa gtgaaaacgc agatgagtga aacgatctgg ttagagccgt cttcacagaa     36840
     aaccgtttat ctacagataa aaaatatctc agataaaaat atgcttggct tagcccccca     36900
     aatcacaaaa gctgtgcagg ataaggggta taccgtaaca tcttccccag aagatgcaca     36960
     ttactggatc caggctaatg tcctgaaagc cgataaaatg gatttgcgtg aagctgaagg     37020
     atttctgagt caggggtatc agggtgctgc gctgggggcc gcattagggg ctggtattac     37080
     aggctacaac tctaactcag cgggagccac gttaggaatt ggattggcgg ctggtcttgt     37140
     tgggatggcc gcgaatgcga tggtcgagga catcaattat actatggtga cggatgtcca     37200
     gatttccgag aaaacggaca ccaccctaca gactgacaat gtggcggcgc tgaagcaagg     37260
     cacctctggc tataaagttc agaccagcac acagacgggc aacaaacatc aataccagac     37320
     tcgcgtggtt tcttcggcta acaaggtcaa cctgaaattt gaagaagccc ggccggttct     37380
     ggaagaccag ctagcgaagt ctatcgctaa tatcctgtaa gccataagca tcctggtatg     37440
     aagatgtact gggatgtagt ggatcagtaa tactggacac ctcaatagcc tgttaattta     37500
     atgacagcca attgaggtaa ttgataatga ctcaacctaa acagaccaaa cgccgttttt     37560
     ctcctgaatt caaactggaa gctattgagc aggtcgttaa gtatcagcgg tcaaccatcg     37620
     aggttgcacg cgctctggag ctggatccca gccaattgcg taaatggata cgccagtaca     37680
     aagaagaagt cagcgggatg acgccggaca atcctgcact gacaccagag caacgtgaaa     37740
     tccagtcgct cagggcgcag attaaacggc tggaaatgga aaaagaaata ctaaagcagg     37800
     cagctgtgtt gatgagcgag ttccccatca aatctttgcg ttaacacggc tgaaaacaaa     37860
     atggccagtg gtcgaattgt gccgcctgct caaaataacg cgcagtgttt actctgcttc     37920
     gctgaatttt cgggttgatg taaaacgtct gcaactgcgt gaattgcatc aacagagccg     37980
     gggagcagcc ggcagcagaa cactgagtct gctgatgcgt cagtcgggtt ataacgtggt     38040
     gcgctggctg gcccgcaggc tgatgcggga atgtggtctg gcgagtcgcc aacccggaaa     38100
     acctcgttac cgtggcgaac gggaggtgtc actggcatcg ccagatttac tgaaaaggca     38160
     gtttaagccg tcggagccca atcgtgtgtg gagtggatat atcagctata tcaaagtcaa     38220
     tggtggctgg tgctacctgg cactggtgat tgacctttac tcccgtcgga tagtgggcag     38280
     tgccatatcg tcatccccgg atgctgagct ggtgtgtcga gcctagcgta atgcactgga     38340
     gacgcgccca agggaaaaga ggctgctgtt tcattcggat cagggagggc agtacaggag     38400
     taagaaatcc aggcagttac tgtggaggac cggagtgatg cagagtatga gccgcagggg     38460
     taactgcctg gataactcac caatggaaag agtgttccga agcctgaaaa gtgaatggct     38520
     gcttgtaggg ggctatatgg atgtccatca tgcggtacga gatatcggtg aatggataca     38580
     aagttattac aacacccccc catcggcaca atggtggatt accgccctgt gaatacgaag     38640
     agcggtggaa aaaggctacg aaggtgtcct gattttgtga tccactacac tacattcagg     38700
     agagttggac cagaaatcag gtaataaggt ccggtccact cgccttcaaa ttcaacatgt     38760
     aattcattgt caaacagtcc ccagagcagt aaaacagaga tccggttcaa cctcatacgc     38820
     cgtgccctcg gccatgatgc gggcaatcga tacccacttt gcggcgttca ggctcttggg     38880
     caaagcgaca gaactgctcc cagttgcacg tatcgcggat cccctcgggg gaacatttgt     38940
     cagccagtct tcctggctag aatgtgttta gattatccgt ggtgattcag tggttgcacg     39000
     gtatcaagca aaaaccaagg acactcttag tttgaaaagg caggtaatat acagcttcag     39060
     ttaacccatt ttactgactg atatttatcg ttttttgtag caagacgagt gttttcgatt     39120
     atgtacgtat aggataaatt tttagtacct atatattggc atgccctgct gttaccgacg     39180
     agcaaaaaga aaggtcatct acagcagatt aggtaactgt caaacttggg gtatttccca     39240
     tagtcgtcat atagacggaa atgtgaacgt gcccagttcg gcattgaggc tcttacgctt     39300
     catcgcgatg cttggtcact ggctgcggcg aacgttgata ttctatttat atatctttgc     39360
     gttatttggg ttgttttgcg tattttttga tgttttacta taaagacgca aatttcatag     39420
     agataataca tatggaccta aagtcaactc ttgaccgctg tattgaacgt ggacagttca     39480
     tgactcaaga aattgctaaa tcacaattcg gtaatgacag tccggctgct cgaacgatta     39540
     ctagacgctg gcgtattact gaagctgctg aacttgtcgg agtaacacca caaacgatcc     39600
     gtaactatga agactcaggc aaactgccac cgcctgatac agcaatgatt ggtcgtgttg     39660
     agcaacgaac tggatattcc atccagcaaa ttaatgatat gcgtgatgtg tttaaaacaa     39720
     gactatccaa accaaaaggc gaaaatcctg ttgttcttgc cattgcagct cataaaggtg     39780
     gtgcatacaa gacatcgaca tctgttcata ttgctcaatg gatggcgtta caagggttac     39840
     gggttttgtt gattgatgcg actgatcctc aagctacggc ctctttatat catggctatg     39900
     ttcccgatct gcatatacat gaagaagata ctttgttgcc ttattatctt ggtcaacgag     39960
     atgatgctgc ttatgcgata aaaccgactt gctggccaaa tcttgaagtc attccttctt     40020
     gtctggcagt gcatcgtatt gagtcggaaa tttatggctt gcatgatcag gggaaattac     40080
     ctgtagcccc tcatctttta ttacgtgctg ctattgagtc agtctgggat agttatgatg     40140
     ttgtggtgtt agatagtgca ccaaacttag gtattgggac tattaatgtc gtgtgcgctg     40200
     ctgatgtcat cgtagtgcct actccggcgg agctttatga ctatgtttcc acgttgcaat     40260
     ttttcaccat gcttagggat ttgatgtcaa atattgatct caacggtttt gaacctgatg     40320
     tgcgcgtttt aattactaaa tttagtaatg cgatcggtag tcagtctcag tggatggacg     40380
     atcagataag gaatgcatgg ggtggaatgg tgttgaaaga agttgttcgc gtgactgacg     40440
     aagtggggaa aggccaagta cgaatgcgta ctgtatttga acaggcagct aaccagcgtt     40500
     caacgccagc tgcttggcgt aacgctgttt cgatttggga gcctgtttgt gcagaaatat     40560
     tcaatcggct ggttaagcct cgttgggaga atgcatgatg aaaaggtcac cagtgttacg     40620
     taatgcgcct tcaattaatt ttgatgatgc taaacccgca atcagcaatg cagagccctc     40680
     ggtttctgct ccggcggtga gtcagcttgc ttctcgagtt agtggcatga aaggcaacac     40740
     aatcgtatta cctgtttgtg gaaggaacgt tgcttttacg cttaaagtga tagcagcacc     40800
     tgatgttgaa tctaaaacaa tcgtttttag tggtaatgag cgaaaccaag cattattaag     40860
     tgagacgtcg ttagatgact tgatcccttc atttttaacg tcagggcagc agatccccgc     40920
     ctttgcacgt gaacataacg ggaacatcga ggttgctgat ggaagtcgcc gacgtaaagc     40980
     cgcgatactc accggaagtg actataaggt tctggttggt aacttgaatg atgagcagat     41040
     gctatggctg tcccaaattg ctaatgagta tcgtccgacg agtgcttatg aacgaggcct     41100
     gcgttacgcc caacggctaa tatctgaatt tgaaggtaat attagtaaat tggcagaggc     41160
     cgagcatctc tctcgcaaaa ttattcagcg ttgtattaaa acggctgggc tgccccttaa     41220
     aactattcaa ctgtttgcta accctaatga attaagtgct cgtagtggcg aagcattaag     41280
     taaagcttat gaaaataatg ttgatacgct aaagcgagtt acgcataaaa ttatgaagca     41340
     aaaacaggaa ggtcgccagt ttactacgga agaattaatc gtattgctga tgcctgagag     41400
     aaaacagcca gagaacattc ataaaaaaag ctttggcaaa aatatagaag caaaatattc     41460
     aaaagacaat gtttctttct atctcaaatc tgtgccagag tccttggtta aacaaataga     41520
     agaactcttg aatacctatg caaaggaaca ttctttgtag tgcctgaata agatcagaac     41580
     aaggtgggtt gtctgcccgc ctttatttag tgtatatcta ttgttttagc tcatccttcg     41640
     tagaagatct ccttctttac aactcatttc ctaagctgaa ctgtggcccc aatcaccaac     41700
     gttagcattg gatatccagg tgggaccgtg gtcccaatta ctaacgttgg cattggatat     41760
     ccaggtggga ccgtggtccc aattaccaac gttggcattg gatatccagg tgggaccgtg     41820
     gtcccaatta ccaacgttga cattggatat ccaggtggga ccgtggtccc aattaccaac     41880
     gttggcattg gatatccaag tgggaccgtg gtcccaatta ctaacactgg cattgaacat     41940
     cctagtggaa atgtgattcg aattgaaagc gattaagtcg atgagcattt ttttagtgat     42000
     agctttaggg agattaaact agcggatatt tcattatgga gataataatt ttcgcttcat     42060
     ttatcacccc ttcgcaatac tctgttcacc aagtcatact attcttagcc cagagctatt     42120
     gatgcatcaa caacttgcat cagatgttta ctgttcgcgt gcggcggtgt ttcatcaaac     42180
     atatctatct gacctggtcg actgccgacg tcattaagca tgatgtcggc tttttgatag     42240
     cgatatccat cccgccaggt tggatacggc gatttcatgt tagtatcgat gtaacaatga     42300
     cggctctatt gcattaaggc acagtctggt aacatgctgt tttttttatg atattgcctg     42360
     cacatatctt taatcaaaaa atttttttgt cgcctgcatt accccatcga tgttatagct     42420
     cagtgtgttc actggtatct tggcgatgcc ctgagttttc taaatctaga ggaaatgatg     42480
     acgaaacacg gtatctctgt tgagcattac acactccaca gttgggttat tcgtgtggtg     42540
     ccattactgc ataaagcttt ttgccgttat aaatgtaccg tgggtcgccg gtggcgaatg     42600
     gatgaagcct caaaggtcag tggaaatacc tgtaccgggc ggttgatact cgcggttaga     42660
     ctatcgattt tctgctgacg gtaaagcagg atgcggcggc agcactgtgc cgactggtat     42720
     caggtctccc ggtaaattca tatattaaag taggcagggc tggctcatta cagattgttt     42780
     agctataatt gtattactca gtaatacata acggagggga tatggctcac gtaaccagcg     42840
     taacacttgg agagcatttg acaggttttg tgggggaaat gattcagtct ggtcgttatg     42900
     gcaatatatc agaagtgctt cgtgatgcct taaggctaat ggaagcacgt gaacagcgtg     42960
     ttcaacatgt acgcgatatg gtgcttgcag gaacaaatgt acctgtgagc catcgtttaa     43020
     tggatgagat tttttctgct gcggtgaaag atactagtgt ataaactgtc tgaactagct     43080
     gatgaggata tttataatat tgccagttat actatccggc atttcggtgt gactcaggct     43140
     aagttatacc atgagaactt ggcaaaggta ttcgagctat tagctaaaaa tccagagtta     43200
     ggggctgagt gtaactggat ttgctctgat attcgccgtt ttcagtataa aaagcacggt     43260
     atatactata taacgcttag caatgatatt ttgatttctc gagtgctgca tcaatccata     43320
     gatatagatg ttcaggattt tccagagcat gagtagtaat acagaagaga gataagtcag     43380
     aaattctaac aatgagcatg ctaaaaaacg attcgcccct gaaagatcag ggacgaagat     43440
     attcgcaata ttgatagaaa aagggggaaa cactatcccc ttgtttttat ccatatcaca     43500
     tcaatgacag taatttctgc atctgttgcg ccagcccttt gatctcattt gctgcctgcg     43560
     ttagatcaac gccactggcg acgtacgcgc tggccgcccc accaatagtt ccccactgcg     43620
     agaagggaat accacaaaca ggcgtgttta agatggcact ggcctcagct tgcaattccc     43680
     caccacaaaa ctgcatcagc ccttggcatt gagtgatact gccacgaaga gggccgctgc     43740
     ccgtagcgaa ctgatcatga tttttctgca gcatctctgc atccaagcta ttcaactgct     43800
     gcatgtattt tggcagcgtc tcagcagcaa gttgcttgat actgtcactg aaagacgtag     43860
     gacttggcat ttgtgcaggt gtgggtgctg gtgtcaccac cggtttatgg ctcccctccg     43920
     agaacatgcg ttggataaac ccaatcacag agtgggccac tgatgataac ctctcaatga     43980
     tacggctggc taagctggaa ccctgagggc tttcagtgcg cccggccaga ttgtttgcat     44040
     attgatcact tgtttgctgt gagactgagc gcccagacat ttctcctacg ctgctagatc     44100
     ctgacacaga tgtcggcagg ggcagtgatg tagaaataaa tgatgatatt ttcatgacta     44160
     tttattacct tggctattaa aacaaggtta tcttagtggg aaaatagccg atggctatat     44220
     aaaaaatcgc tgctgttttt gttgttatat tagacaaaac aaaaactaaa aattataggc     44280
     taaaattgat ggtctgccga gagtgctttg gttaagttga tattttatct aactattatg     44340
     agatcataat gtattcattt gaacaagcta tcactcaatt atttcaacaa ctttcgttgt     44400
     ctattccaga tactattgaa ccggttatcg gtgtcaaagt tggggaattc gcctgccata     44460
     taacagagca tcctgtcggg caaatattaa tgtttaccct accttctctt gacaataatg     44520
     atgaaaagga aaccttactt agccataata tattcagtca agatatatta aaacccatct     44580
     tatcctggga cgaggttggg gggcacccag tgttatggaa tcgacaacca ttgaacagcc     44640
     tggataataa ctcactatat actcagcttg agatgctggt gcagggggct gaacggctac     44700
     aaacctcatc actaatctca ccaccacggt catttagttg agtagatttt tggttgttgc     44760
     cttattatac ggaatgacct gcccccagga ttagatacaa cgctcactta gtaatgtcgg     44820
     atccttcact atcagaatta ccctttctcc aggccgccgc aaattcagac ggcgtctgat     44880
     aattcagcgt agagtgcggg cggcactcat tataatcctg acgccattca ctgatggttt     44940
     tcctggcatg actgacgtca ctgaaccagt gctcattcag gcattcatcg cgaaagcgtc     45000
     cgttaaaact ctcaataaat ccgttctgtg tcggcttgcc gggctggata agtcgcagtt     45060
     ccacgccatg ctcaaagacc cattgatcga gcgcgcggca ggtaaattcc gggccctgat     45120
     cagttcttat cgtcgccgga tagccgcgaa acagcgcaat gctgtccaga atacgcgtga     45180
     cctgcacgcc tgaaatccca aaggcaacag tgaccgtcag gcattccttc gtgtagtcgt     45240
     ccacgcaggt aaggcacttt atcctgcgac cggtggccaa tgcgtccatg acgaaatcca     45300
     tcgaccaggt cagattgggc gccgccggac ggagcagcgg cagacgttct gttgccagcc     45360
     ctttccgacg ccttctgcgt tttacgccca ggccactgag gtgataaagc cggtacacgc     45420
     gcttatgatt aacatgaagc ccttcacggt gttagcgcca gtgatataag acggtaattc     45480
     accattagta ttgtccgctc cacccaacat gttgtttcct tgaggttctc acaccagaaa     45540
     ggacatcaac atgctgagca gagaggactt ttacatgata aagcaaatgc gccagcaggg     45600
     ggcgtacatt atcgatattg cgactcaggt gggttgctct gaacgaactg tcagacgcta     45660
     cctcaaatac cctgaaccgc cagccagaaa gactcgccac aaaatggtta agctgaaacc     45720
     gtttatggac tacatcgaca tgcgcctggc agagaatgtc tggaatagcg aggtcatcct     45780
     cgcggaaatt aaggcgatgg gctataccgg cgggcgttcc atgctgcgtt actacatcca     45840
     gcccaaacgt aaaatgcggc catcaaaaag aacggttcgc gtcgaaaccc agccgggata     45900
     tcagctccag cacgactggg gcgaagtcga gctagaggtt gctgggcaac ggtgtaaagt     45960
     taacttcgcg gttaatacgc tggggttctc ccgacgcttc catgtcttcg ctgcgccaaa     46020
     gcaggatgct gaacacacct atgagtcgct ggtccgtgcc ttccgttact tcggcggcag     46080
     tgtgaaaacc gtgctggttg ataaccagaa agccgcggtg ctgaaaaata acaacggaaa     46140
     agtggtgttc aactccgggt tcctcttgtt ggccgaacat tatgacttcc tgccacgggc     46200
     ctgccgcccg cgcagggcca gaaccaaagg taaggtggag cggatggtga aatatcttaa     46260
     ggataacgtc ttcgtccggt accgcaggtt cgacagcttc acccatgtta accaacagct     46320
     ggagcagtgg atggcggatg ttgctgataa acgcgagctt cgccagttca gacaaacacc     46380
     ggaacagcgc ttcgcgctgg aacaggagca tctgcagccg ttgccggata cggacttcga     46440
     taccagctac ttcgacatcc gccatgtgtc ctgggacagc tatatcgagg ttggcggcaa     46500
     tcgttacagt gttcccgagg ctctgtgcgg gcaaccagtc tcgatacgta tatcgctgga     46560
     tgacgagctg cggagctaca gtaatgagca gcaggtggcc tcacatcgac tctgttcagc     46620
     atcgtctggc tggcagactg tgccggagca ccacgccccg ctctggcaac aggtcagcat     46680
     ggtagaacat cgcccactga gtgcttatga ggagttgctg tgatgcatga acttgaagcg     46740
     ctgctgagtc gcctgaaaat ggagcacctg agctatcacg ttgaaagtct gctggagcag     46800
     gcggctaaaa aagagctgaa ctaccgggag ttcctgtgca tggcgctgca acaggagtgg     46860
     aacggcagac atcagcgcgg catggagtcc cgactgaagc aggcgcgtct gccgtgggtc     46920
     aaaacgctgg agcagttcga cttcaccttc cagccgggca tcgatcgtaa ggttgtccgg     46980
     gagctggccg gtctggcgtt tgtggagcgc tgcgagaatg tgatcctgct gggtcctcca     47040
     ggtgtcggga aacccatctg gccgttgctc tcggcgtgaa agcagcggat gcagggcatc     47100
     gggtactgtt catgccactt tatgaagaca ttactaacat cggggtgtac taatcaacga     47160
     ggagcaggtc aggaaatagc gataacctat aaatttgtgg tgccagtaat atcagatttc     47220
     gctcagtaaa agttaacacc aagttggagt gttgactttt atctcctgtt ttttttaatt     47280
     tttaatgtaa aagacttgta ttaagtccat tcacttggtg gcgtcgccgc ctcctcattg     47340
     gtaatgagga gtaccggaag agttctcaat gtgaatggtt gagctgtata agtttgttat     47400
     actttatatc cacggtgata caacgttggg gtagcatctg ggaaggagag aaataaaaaa     47460
     attctatatt tttctaattt taaagggtca gttatatgcg cacttacagt tcattacttg     47520
     aagaatttgc tacagagcta ggtcttgaag aaatagaaac aaatgagtta gggcatgggg     47580
     ctgttaccat tgataaaata tgggtagtac atctggcacc tatcaatgag aaggagttag     47640
     tggcttttat gcgggcaggg atcttgactg gtcagtctca actttatgat attttgcgga     47700
     aaaacctctt tagcccacta tctggtgtaa ttcgttgtgc gcttgataaa gatgatcact     47760
     ggctattgtg gagtcagtta aacattaatg acaccagtgg gacgcaactg gcgagcgtat     47820
     tgacgtcgct ggttgataaa gctgttactc tttcttgtga acccacaatg aagaaagagg     47880
     aggatgatca tcgtccttca tcatctcatt tactggttta attctataaa agaaaaacgt     47940
     acgatatcca ttaatgggtt tggttgagac tgtaaacaag attgtataat tgcctgtttt     48000
     tgatatcttt actccaacaa cggagacagg caaatttgat ccctccccaa tatccgtacc     48060
     aggctaaatc agagatccgg acctttttga tgacttcggg caaattctgc cggagtcagg     48120
     ttatttaacg aagaatgcgg atgaaaatga ttatattctt gccgccattg ttcaattttc     48180
     tcctgagcat cttccagaga aaggaacccg tgcacgttca gacattcatc cctcagactg     48240
     ccattaaatg actcgataaa ggcattatct gtaggctttc cggggcgtga acagtccatc     48300
     gtgaccctgt tttcatacgc ccatcggtcc atcgacttcg agatgaattc gctgccgtta     48360
     tctgtctgca gcctttgtgg aatacgcccc agcgaatgtt ttaatctgtc catgacagcc     48420
     acaacatcat ctccacgtaa cccctgaccg acctcgatcg ccagacattc acgactaaaa     48480
     ttatccacta tagttagcgc cctgacccga cgcccgttga acagattatc agcaacgaaa     48540
     tccatgctcc agcactgctc taacgcggtc acttctggac gtgcgtgcct gtgcttcgct     48600
     gtcacatgcc gccgtggacg tttcgaacgt agattgagac cctcaagaca gtaaatacgg     48660
     tgcgttttct tatggttaac aagccagcct tctctccgca gcaggatatg aatgcgcgga     48720
     cagccataac ggatgcgcgt ctccgcaatt tcccgtattc gctgagtaat agcccgatcg     48780
     tcacgatggc tacgatagtt gtatacagtg cggctctgca tcatcagcct gcaccctctg     48840
     cgtactccga tacggtacgc cgccagcaga tattccacgg catcacgctt ctgcagcggc     48900
     ctcagaactt ttttcggatg acatcctgca gcatttcctt atccagactc agatcggcca     48960
     ccagacgttt gaggcgctga ttctcatcct caagctgccg aagacggcgc aattccgtga     49020
     cacccattcc cccaaacttc ttcttccagt tgtaaaatgt cgcttccgaa atgcccatct     49080
     tcctacagac ttcttccact cgagtacccg tttcagcctg tttgagtgca aaagcgattt     49140
     gttcttcggt ataacgcgtc tttttcataa cgaatgaccc ctttttggac ggaaaagaag     49200
     ggccgaaaac tctactttac agcggtactg aactaagggg gaagatcaag caatccttgt     49260
     ttgtcgatta ttttaaattt gttttgactc ctccaatctt tgattcaata gacacgcatt     49320
     caatggtttt tattatatca tcaatgccgg cccagagatt ttcattatta ttgttcttgt     49380
     aatttgtttt taattgagta ttcaaactcc tctcaattcg catcacttca tcaatatgtt     49440
     caagcttaca ctttattaag tcatccctaa gagaaatatt ttccttctca agtttagata     49500
     ttcttttctc tagccgagtt gttatttctt tttcctttct atttttctct ttgttgaaaa     49560
     ataaatcaaa gtagtatttt gcaaaaaatg ttaacattac actgagtgtg taaaccagaa     49620
     attgaatatt tgatggtcat gtggatttag gaatataaaa cccaaccgaa gccataaaaa     49680
     tagcgggaat tgcatatgat aaaaatgtat aaatagtcat ttttatttat ctgctttagt     49740
     ttacatagtt gtgttctatc cctttgtctt taaagctatt acttagcttt ttaggggcaa     49800
     ttctaagaag tcccatagat gtttctagtt cattggaaaa atttggaata ccctttgagg     49860
     catcaaacac catgctatat gtaaactgaa ccgtaagttc ttttctttca acgtctagcg     49920
     aatttaaact tgccttaatt ccgagacata ctgagttaaa ggaatttgtt gctttatata     49980
     ctgaaacttc atttggcttt ccattgctga aaaagtcaaa gttctcgaaa gtaaaaagat     50040
     atttaatttc ataaatgttt aaactgtcag ttgtgaggtc tgaaaaataa taatcacctt     50100
     caatataggt aaactcacca ttatttttat caagcatttt tatattctta agagattcca     50160
     ctttttctaa aatagagtat aaattattct gcaaattcat tttacgcccc ttagctgttt     50220
     attgtgattc attgatgact ttataaatag ttgaacgagc tatattcatt tttttggcta     50280
     tttctgtcgc gcccatcccc tgttcatgca attcgagtag ttcctttctg ttgattctgc     50340
     gctttcgtcc gaatttaacc ccctttagct tagcctcttc tctcccttca tttgtacgct     50400
     ccagtattct ctgtcgttcg gcttgagcca ctgctgatag aatagtgaca accattttac     50460
     ccatttcccc atcggtactg attccgtcat caataaactg gatggacaca ccctgggcgt     50520
     caaactcttt tatcaactgg atcatgtcga cggtgtcgcg gccaagacgg tcgagcttct     50580
     tcactagaat gacgtcacct tcttccacct tcatacgcag cagatccagc ccctccctgt     50640
     cggcagagct gccggatgcc ttatcagtaa atatacgatt tgctttcacg cccgcgtctt     50700
     tgagtgtttt gatctgaata tcgagggatt gctgactggt tgatacccgc gcgtaaccaa     50760
     aaagtcgcat aaaaatgtat cctaaatcaa atatcggaca actggtgtct attataacaa     50820
     aaaatcgatt aaatagacac acaaaccgca ccatttcagt gtgtccgaca acttataata     50880
     tttcggacgg ttaaaaagtt gttaacaaat aaccgtcagg cagggaggcc tgtatgccag     50940
     tcgattttct gaccactgag caagaacaga attacggttg ttacgttgca gaacccaatg     51000
     acgtgcaact ggtgcgctat tttcatcttg acgagcggga tcttgctttc atttaccagc     51060
     ggcggggaaa gcataaccgc ctgggaatag cacttcagct cacaacggcc cgttttctgg     51120
     gaacctttat tacggattta acccaagttc tgccaggtgt tcagcatttt gtcgccgtac     51180
     agcttaatat acgccgtccg gaagtcctct cccgctatgc cgagcgtgat accactcgca     51240
     gggaacatac cgcgcagata aaggaatatt acggctatca tgaatttggt gattttccgt     51300
     ggtctttccg cctgaaacgt ctgctgtaca cccgtgcatg gctcagcaat gaacgccccg     51360
     gtctgatgtt tgattttgcc actgcgtggc tgcttcagaa taagattctg ttgcccggag     51420
     caaccacact tgtacgtctc gtcagtgaaa tacgcgaaag ggcaaatcag cggctctgga     51480
     aaaagctggc cgccattcat tatctgaccg aactaaacgg cacgaaaaaa cgcctcctgg     51540
     atgatgctcc tgaacatatt attaccggcc cctggaaacg cctggtgtac gatgcggagg     51600
     gccggataca acgtgccggt tactcgcttt gtctgctgga gcgccttcag gatgcattga     51660
     gatgccggga catctggctg aaaaatagcg atcgctgggg agatctccgc gagaagttgt     51720
     tgcaggggga agagtggcag gctcagcggg tcctcgtctg ccgggcgttg ggacatccca     51780
     ccgatggaca taaaggcgta caacagttgg cggtccaact ggatgaaacc tggagagcag     51840
     ttgcatcccg ctttgaagga aatacggaag tccatatctg caatgacggt aaatatcctt     51900
     ccctgactat cagcagtctg gagaaattgg aggagccact gtcgttgctt cgtctaaaca     51960
     atcgggtcag gcaactgcta ccgccggtag atttgacgga actgttgctt gaaatagatg     52020
     ccagaacggg atttacacgt gagtttacac atgtcagtga atccggggct cgagcgcaag     52080
     atctgcacat cagcctgtgc gcggtactga tggctgaagc ctgcaatatc gggctggaac     52140
     cgctgataaa gcacaatata ccggcactga cgcgccaccg gctcagttgg atgaaacaga     52200
     attaccttca ggcagaaacg ctggtcagcg ccaatgcccg gttagttgat tttcagtcca     52260
     cgctggagct tgctcgccgc tggggtggcg gcgaggtggc ttcagttgac ggtatgcgct     52320
     ttgtcacgcc agtgaaaacg gtcaattccg ggccgaacag aaaatatttt ggctccgggc     52380
     gtggcatcac ctggtacaac ttcgtctctg atcagtactc tggattccac ggcatcgttg     52440
     tccccggcac attacgggat tccatttttg tgctggaagg ccttctggaa cagcagacag     52500
     ggctgaatcc ggttgagatc atgacagaca cagccggtac cagcgacatt atatttggcc     52560
     tgttctggct acttgggtat cagttttccc cccgtctggc tgatgccggt gaagctgtat     52620
     tctggcgagt ggataaatcg gcaaattacg gagcacttga tgagcttgct cgtgggtgtg     52680
     cagatctgtc gaaggcagaa aatcagtggg atgagatgat gcgaactgcg ggttcgctca     52740
     agctgggcac cattcatgct tcagaactca ttcgctcact actgaaaagc tcacggccgt     52800
     cagggctggc tcaggccatc atggcggtgg ggcgtgtaaa caagacgctg tatcttctta     52860
     attatattga tgatgaagat tatcgtcgcc ggatcctgac gcaactcaat cggggagaga     52920
     gccgccatgc cgtggcacgt gcaatttgtt acgggcagcg cggtgagatc agaaaacgct     52980
     accgtgaggg gcaggaagat caactgggcg cattggggct ggtcactaac gcagtggtac     53040
     tgtggaacac gctttatatg caggaagcac tgagctggat gcgcagtaat ggagaagaaa     53100
     ccagggatga ggatatcgcc cggttatctc cactgatgca cgggcatatc aatatgctgg     53160
     ggcattatac gttcacgcta tcggatgata ttttaaacgg agaactgaga gcattaaatt     53220
     tcaatttaaa caatgaatta tctccttaac gtacgttttc gtcccattgg acctcaaaac     53280
     ccatcaccgg gtagccacgg ttgaccacaa tgcgatccag tactctgatg acgtgctgtg     53340
     ttggcaggtt cagatcgatt tcaatcgcca gcttttcacg attgtaatca tccacacaga     53400
     tcagtgcatc gtgcataaaa tcgaccgccc cgctcaggtt aagtcgttcc ggcaccgcca     53460
     gcggtgatgg ggtacgagct ggcaggcgtt gtttcccttt gcggcgaata ttgagtttca     53520
     ggagacaata gatacggtgt acccgtttat ggttccagac atatccccat cgcctcagga     53580
     tttgaaaaac cttaaagaaa ccgtcgcgtg gataacgctc gaccactgat ctggtgttca     53640
     gtgaatcagt ttttttcgca tggtgaactc ctcaaaatac atattcagta tgtcggaaat     53700
     tctctaaaag agaatggtta tttttgatgg tcattacagt acagattatt ttatataatt     53760
     tattacccac tttttttata ttttttgata gagggaggat aataaataaa aaaattataa     53820
     agtaatggtt tcttgctgtt ttctggtgtt tttctctata tttatgtttt tttggtgaaa     53880
     ataagtgtgt tgtcaggtaa tttcaaagga ttatacaaaa tatccggttt gaggtgaggg     53940
     attttttttt atattatctg cataacactt ttcgtgttat ctgaaagtat tttgtagtgg     54000
     gctgactccg acgattcgat tagagattac aaacgatgca tatattcagt agttaatcga     54060
     tatcttttta agatcgatta gtgctgtttt ttgcatgatt atcagaaaat aagtcataga     54120
     taatcctatc cctcttctat gggaggcgtt cgctttaatt aatatatttc tcagatgtta     54180
     taactgagct tttattcacg ggaaattaaa gaaatataaa aggtgcttac aatgactaaa     54240
     gattttaaga tcagtgtctc tgcggcatta atatctgcgt tgttctcatc tccatatgca     54300
     tttgccgagg agcccgagga tggcagcgat ggtattcctc gtttgtcagc agttcaaata     54360
     agcccaaatg ttgatcctaa attgggtgtg ggattatatc cagcaaaacc aatattacgt     54420
     caagaaaacc caaaattacc tccacgaggt ccacaaggtc cagaaaaaaa agagctagat     54480
     tagcagaagc aatacaacca caagtactag gcgcaggcgg gctcaatgct cgcgctaagg     54540
     atccctatag cattgcgatt ggtgctactg ctgaagcagc aaaaccagca gcaattgctg     54600
     tgggctctgg ttcaatggca acaggcgttg attctgttgc aattggtcct ttaagtaagg     54660
     cattgggaga ttcggcagtt acttatgggg taagtagtac cgcccagaaa gatggagtag     54720
     ctatcggtgc gaaagcatca gcttcggata ctggtgtcgc tgtcggtttt aactcgaaag     54780
     ttgatgcaca aaactctgtt gccattggac actctagtca cgttgcggca gatcatggtt     54840
     attcaattgc aattggggat cattctaaaa ctgaccgaga gaatagtgta tccattggtc     54900
     atgaaagcct taatcgccaa ttaacacatc ttgcggctgg cactgaagac actgatgcag     54960
     tgaatgtcgc gcaattaaag aaagaaatgg ctgaaacatt ggaaaatgca cgtaaagaga     55020
     ctttggctca gtctaacgat gttttggatg cggccaaaaa acactcaaat agtgttgcca     55080
     gaacaacttt agaaactgct gaagaacatg caaataaaaa atcagctgaa acgttagtaa     55140
     gcgctaaagt gtatgcagac agcaattctt ctcaaacact aaaaactgca aatagctata     55200
     ccgatgtgac tgtaagtaat tcgactaaga aagcaacccg tgaatctaat caatacacag     55260
     atcataaatt cagtcaactt gacaaccgtt tagataaact tgacaaacga gttgacaaag     55320
     gtttagccag ttcagccgct ttaaacagct tgttccagcc atatggtgta gggaaagtaa     55380
     actttactgc aggtgtcggg ggatatcgtt ctagtcaggc attagcaatt ggttctggct     55440
     atcgtgtaaa tgagagtgtc gcatttaaag ccggtgtggc ttatgccggt tcctcgaatg     55500
     tcatgtacaa cgcatcattt aatatcgagt ggtaatatca tttagaaatt aacaagtcta     55560
     taggaaaaca ccgattacat aatcgtaatt ggtgttttat taatatgcta atgaaaaatt     55620
     ttttagtaat tctgcttttt atcatggttt cagttacatg gggaactaca tggttagcga     55680
     tgaaattaac cgtcgaaaca atctctccga tatttgctac gggcatccga tttatgttgg     55740
     ctgcgcctgt attaatccta attacatcaa cccgcaaatt cagcgaagca gagtaaacac     55800
     tgcgcgttat tttgagcagg cggcacaatt cgaccactgg ccattttgtt ttcagccgtg     55860
     ttaacgcaaa gatttgatgg ggaactcgct catcaacacg gctgcctgct ttagtatttc     55920
     tttttccatt tccagccgtt taatctgcgc cctgagcgac tggatttcac gttgctctgg     55980
     tgtcagtgca ggattgtccg gcgtcacccc gctgacttct tctttgtact ggcgtatcca     56040
     tttacgcaat tggctgggat ccagctccag agcgcgtgca acctcgatgg ttgaccgctg     56100
     atacttaacg acctgctcaa tagcttccag tttgaattca ggagaaaaac ggcgttatcc     56160
     agaacgtgaa gcgatttacg cggcgctgga gtaaaccaat gggcggcatg gccgcccatt     56220
     ggtttactta tcagtacgca gtgccatttt gcggccgcgc gaaaaccctt gtcactctaa     56280
     gtaacgcgga gggtgagtcg gtactgattt ctccgcagca gaataccgcg caggatattt     56340
     ccctgttcat gccccgggaa ctgacggtca gtcaaggtga tcgggtgcga tttacccgct     56400
     cagacacaga ccggggttat gtggccaata gtctgtggga agtggcgggt tttactgaag     56460
     acggtgctgt gcgttttcgt cagggcgacc aggaaaagat tgtcgatcca caaaaggcca     56520
     ccgaagaccg ccatattgac ctggcctaca cgctgacagc ctatggtgtg caaggggcca     56580
     gtgagcggtt tgtcatcgcc ctgtttgggg ctgaaggtgg cagaaagagg atggccactc     56640
     tgcatctctt tacgtgacat tgtcacgcgc caaagagcat gtctaggtct atacggacaa     56700
     cgttgttaaa tggttgggtc ttgccgggca gtcaaatgcc ggaaaaaccg cgcattgtag     56760
     tggatcagta ataccggaca ccctcaatag cctgttaatt taatgacagc caattgaggt     56820
     aattgataat gactcaacct aaacagacca aacgccgttt ttctcctgaa ttcaaactgg     56880
     aagctattga gcaggtcgtt aagtatcagc ggtcaaccat cgaggttgca cgcgctctgg     56940
     agctggatcc cagccaattg cgtaaatgga tacgccagta caaagaagaa gtcagcgggg     57000
     tgacgccgga caatcctgca ctgacaccag agcaacgtga aatccagtcg ctcagggcgc     57060
     agattaaacg gctggaaatg gaaaaagaaa tactaaagca ggcagccgtg ttgatgagcg     57120
     agttccccat caaatctttg cgttaacacg gctgaaaaca aaatggccag tggtcgaatt     57180
     gtgccgcctg ctcaaaataa cgcgcagtgt ttactctgct tcgctgaatt ttcgggttga     57240
     tgtaaaacgt ctgcaactgc gtgaattgca tcaacagagc cggggagcag ccggcagcag     57300
     aacactgagt ctgctgatgc gtcagtcggg ttataacgtg gtgcgctggc tggcccgcag     57360
     gctgatgcgg gaatgtggtc tggcgagtcg ccaacccgga aaacctcgtt accgtggcga     57420
     acgggaggtg tcactggcat cgccagactt actgaaaagg cagtttaagc cgtcggagcc     57480
     caatcgtgtg tggagtggat atatcagcta tatcaaagtc aatggtggct ggtgctacct     57540
     ggcactggtg attgaccttt actctttcca ttggtgagtt atccaggcag ttacccctgc     57600
     ggctcatact ctgcatcact ccgttcctcc acagtaactg cctgtatttc ttactcctgt     57660
     actgccctcc ttgatccgaa tgaaacagca gcctcttttc ccttgggcgc gtctccagtg     57720
     cattacgcca ggctcgacac accagctcag catccgggga tgacgatatg gcactgccca     57780
     ctatccgacg ggagtaaacc gaagcctgaa aagtgaatgg ctgcctgtag ggggctatat     57840
     ggatgtccat catgcggtac gagatatcgg tgaatggata caaagttatt acaacacacc     57900
     cccatcggca caatggtgga ttaccgccct gtgaatacga agagcggtgg aaaaaggcta     57960
     cgaaggtgtc ctgattttgt gatccactac aggatggatc tgttggtcaa tgccggcatt     58020
     cctgtccgaa ctgtcaacag tttcaaagcg cttcacgaca aggtgattat cgttgatggc     58080
     aagaatacgc agatggggtc gttcaatttt agccaagcag ccgtacagtc caactcggag     58140
     aatgtgctga ttatatgggg ggacttcacg gtggtacagg cgtatctgca gtattggcag     58200
     tcacgctgga ataaaggaac tgactggcgt tcgtcgtact gatctcactc ttttcgctga     58260
     gtcattaatg tgatccgtgc gccaacacgg gttatgtctg caaaagttaa gtcgctgatt     58320
     tcataaatct gttgtattct ctgcgaaacg atccttgttt gatctttgag ggggctgata     58380
     tgtcgcagat cgaaaatgca gtaacttcct catcgaaacg tgcctacaga aaggggaacc     58440
     cgttaactgg agccgagaaa caacgtatgt ctgtttcccg gaaaaaagag acacataaag     58500
     ctataaatgt gttcattcag aacgatctca aaaacgaact tttacaactc tgtgaagatt     58560
     caggtttgac tcagacagaa atgattgagc gctggattca gagagaaaag gccgctagaa     58620
     ctaatgcagc ttgaatggca actaagttac tttcttgatc cttcaggcag tgagtgctag     58680
     attaccgatt gtttaaagaa tttttggctg gccacgccgt aaggtggcag ggaactggtt     58740
     ctgctaaggt gtttacttgg aaccagaaaa gcaaaaaccc cgataaactt cctcatcttt     58800
     ggcgaggcga gaaggttacc ggggcccact taaaactgta tagaagctgt tgctctatac     58860
     agggagtata tgtgcatgtt cagaaaagtt caataccttc tgcgcttgtt actccttccg     58920
     tgcaacataa gtgcgggaag gtgtgactaa ccaccaggcc ctgttcacac atcattatcg     58980
     acaggttaaa aacccgaatc cggaatttac gccgcgagag ggtaaaaaaa ccctgccgtt     59040
     ctgccgtaag ctgatggcga aagccgaagg cttcacatct cgttttgatt tctccatgca     59100
     cgtcgcattc gcgcgttctc tgagtttgcg tcatcgtatg ccgccgttac tacgtcggcg     59160
     tgctatcgat gcattactgc agggtatgtg tttccactac gacccactgg ccaaccgtat     59220
     ccagcgctcg attaccaatc tggccattga gtgtggtctg gcgacagagt caaagagtgg     59280
     caacctttcc atcacccgcg ccacgcgtgc gctgcgcttt ttatctgagc tggggctgat     59340
     tacctaccag accgaatatg atccacagat tggctgtaat attccgactg atatcacgtt     59400
     cacaccggcg ctgttttctg cgttggatgt gtcggacgtt gctgtcgcag cagcccgacg     59460
     cagccgcgtt gaatgggaaa atcagcaaag ggagaaacaa cgtctgccta gattggagat     59520
     ggatgagctg atagcaaagg catggcggtt cgtccgcgag cgtttccgta gctatcaaac     59580
     tgaacgtaag gctcatggat tgaaacgtgc ccgtgcgcgc cgtgatgttg accgtacgcg     59640
     ccgtgacatt gaagctatcg ttaaccggca gctgacgcgt gagatagctg aggggcggtt     59700
     tgtcggtaat ctggatgcgg tacgcaggga gaaagcccgt cgcgtgaagg aacgcatgct     59760
     gatgtccagg aacaataact acacccggtt ggccaccggc gctacctgac gtcgtattta     59820
     ctgaaaatcc ggttagcgcc ggaggatttc gctcgtctgc ctcctgtcag tgcttgttat     59880
     ttgagcgatg tgacggccgc tacatgacct atcttctctt tcccgccctg aaaatgccct     59940
     cgaattctcc caatatcgtc gcttgaatgt actgatttag gttatccaca gttaactgca     60000
     agggaacttc ccataaagtt acaaccgata tgttttttaa gcgccagccg aacttgtttt     60060
     aaagtgcgtg gtttctttta aaccactgat cagcacttct tttaaatacc ttttctttta     60120
     ttcctataaa taaataacct attcgtcgtc tgccttttgg acagactatg ataatgcccg     60180
     cccttgcagc gaacttacgt tcgcgccggt tcggaaacaa agaaatacct cctatcacga     60240
     tgctacgagc gcataaaccc ctattagtta caacattcac gattcgacca aaaaaatacc     60300
     agaccgcata catctgagac cactgcgcgc acccttaccc actaaaaagc cgccccgccc     60360
     cgggccaacg gcccggaaca gagtggcttt acaatgagtg ttgtaactaa aattttcgag     60420
     tcgctgcaag tcatgtcgct ggaagtcatt cgaacacgct cgtaagcggc cctaatggcc     60480
     cgctaacgcg gagatacgcc ccgcctgcgg caaagccttg tcgggaccac tccgaccgcg     60540
     taatgaagca cctacgctac ttttagtggg tttagctttg cagggaggag attgggattg     60600
     gtgaaaccta tcaaaccgga accggctacg ccgggctatc ggcgccaatt gtcaacagag     60660
     ttatagttaa tatccgctgg cgccttcatg ccgcgatgcg gcattgaaaa gaccggctgc     60720
     gcactgctcg cctgtccggt aaggacatga tataaacgtt tgtgtttata agcacttttg     60780
     tggatatcgt tatgcagctg agtgactaca ttgacagtgt atacggaaca gccgtaagcg     60840
     agcggcgatc tcatattgtt aactcacttc cgttatcaca ctctggtctc agtcaataca     60900
     acgaacctga ggtgaaatat gacgacacgg tattctcgta gtgaacggca gcaccatctc     60960
     gacgcctggc aatagagctg aatgtctaaa aaacactact gtcggctgca tgacttgaac     61020
     atcgccacct tttattactg gctcaaacat catcaagatg acaccaccgt tgccattccc     61080
     cctgcgttta tccccgctcg ccgggtaata ccagacaata acggtaccga ggcagtgacc     61140
     ctcaacctcc ccaatggctg ttcggtcagt tgtcttcctg ctcagttacg cgctgttatg     61200
     caggccttat ccctatgttg acgccacaac acatctggtt ggcacgcgag ccggtcgata     61260
     tgcgtcgcgg tatcgcaata cattaccgac catctgcatc agccctggca aggcgaagcc     61320
     gcctttgtct tttgcaacaa aggcgcgttc gcgtatcaaa gttctgcgtt ggaacaaaca     61380
     cggggtctgg ttgtgaagag gctgctgttt cattcggatc agggagggca gtacaggagt     61440
     aagaaatcca ggcagttact gtggaggacc ggagtgatgc agagtatgag ccgcaggggt     61500
     aactgcctgg ataactcacc aatggaaaga gtgttccgaa gcctgaaaag tgaatggctg     61560
     cctgtagggg gctatatgga tgtccatcat gcggtacgag atatcggtga atggatacaa     61620
     agttattaca acacaccccc atcggcacaa tggtggatta ccgccctgtg aatacgaaga     61680
     gcaggggaaa aaggctacga aggtgtcctg attttgtgat ccactacagc aacggaatag     61740
     ctccgctcag ttatctgacg gacagcttct tccttaaatt caggggtaaa acgtggtgtg     61800
     cccatagact cctcctatgc ttaagatata ggtcagattt gtctacaggt tcgggggctc     61860
     cccaaatatc tacaataact aaaaatcagt ggctggaagt gatatattct gggacgggtt     61920
     taatcaatga tagatatcac cgtaaatcag attaaagagc ttttgtgtga ttaacaccac     61980
     ctttactgag ttactcccaa aaatagcaag tcactttgga ttagataaat tgagccaaga     62040
     tgaatatggc ttgtgtgagc ttatcctcaa cgaccgagtc gttattatgc tgagggctga     62100
     tgaaatattg aatcgattga ctctgttggg gccaatctta ggattttctg gaccagaggc     62160
     gcgcagcgcc gctagtcagc tttttttctg ttatagcatc aatgccttga ataaggacgg     62220
     cccttgtttc gcttggagtg aagaactggg gctgatcgca ttcaagcacc tttctctcga     62280
     cgagctgaat gttgagaacg ttagcaagga gatagcgaac ttttacgact ggttgagctt     62340
     ggtcagttta ccagcagaaa ctcagcagga actgcccctt catactcaat ctactcaatc     62400
     ggttaaatgg ggatgagtaa agcatgaaaa gcgtgaaaat catgggaact atgccaccgt     62460
     cgatctccct cgccaaagct catgagcgca tcagccaaca ttggcaaaat cctgtcggtg     62520
     agctcaatat cggaggaaaa cggtatagaa ttatcgataa tcaagtgttg cgcttgaacc     62580
     cccacagtgg tttttctctc tttcgagaag gggttggtaa gatcttttcg gggaagatgt     62640
     ttaacttttc aattgctcgt aaccttactg acacactcca tgcggcccag aaaacgactt     62700
     cgcaggagct aaggtctgat atccccaatg ctctcagtaa tctctttgga gccaagccac     62760
     agaccgaact gccgctgggt tggaaagggg agcccttgtc aggagctccg gatcttgaag     62820
     ggatgcgagt ggctgaaacc gataagtttg ccgagggcga aagccatatt agtataatag     62880
     aaactaagga taagcagcgg ttggtagcta agattgaacg ctccattgcc gaggggcatt     62940
     tgttcgcaga actggaggct tataaacaca tctataaaac cgcgggcaaa catcctaatc     63000
     ttgccaatgt tcatggcatg gctgtggtgc catacggtaa ccgtaaggag gaagcattgc     63060
     tgatggatga ggtggatggt tggcgttgtt ctgacacact aagaaccctc gccgatagct     63120
     ggaagcaagg aaagatcaat agtgaagcct actggggaac gatcaagttt attgcccatc     63180
     ggctattaga tgtaaccaat caccttgcca aggcaggggt agtacataac gatatcaaac     63240
     ccggtaatgt ggtatttgac cgcgctagcg gagagcccgt tgttattgat ctaggattac     63300
     actctcgttc aggggaacaa cctaaggggt ttacagaatc cttcaaagcg ccggagcttg     63360
     gagtaggaaa cctaggcgca tcagaaaaga gcgatgtttt tctcgtagtg tcaacccttc     63420
     tacattgtat cgaaggtttt gagaaaaatc cggagataaa gcctaatcaa ggactgagat     63480
     tcattacctc agaaccagcg cacgtaatgg atgagaatgg ttatccaatc catcgacctg     63540
     gtatagctgg agtcgagaca gcctatacac gcttcatcac agacatcctt ggcgtttccg     63600
     ctgactcaag acctgattcc aacgaagcca gactccacga gttcttgagc gacggaacta     63660
     tcgacgagga gtcggccaag cagatcctaa aagataccct aaccggagaa atgagcccat     63720
     tatctactga tgtaaggcgg ataacaccca agaagcttcg ggagctatct gatttgctta     63780
     ggacgcattt gagcagtgca gcaactaagc aattggatat ggggggggtt ttgtcggatc     63840
     ttgataccat gttggtggca ctcgacaagg ccgaacgcga ggggggagta gacaaggatc     63900
     agttgaagag ttttaacagt ttgattctga agacttacag agtgattgaa gactatgtca     63960
     aaggcagaga aggggatacc aagaattcca gtacggaagt atccccctat catcgcagta     64020
     actttatgct atcgatcgtc gaaccttcac tgcagaggat ccagaagcat ctggaccaga     64080
     cacactcttt ttctgatatc ggttcactag tgcgcgcaca taagcacctg gaaacgcttt     64140
     tagaggtctt agtcaccttg tcacagcaag ggcagcccgt gtcctctgaa acctacggct     64200
     tcctgaatcg attaactgag gctaagatca ccttgtcgca gcaattgaat actctccagc     64260
     agcagcagga gagtgcgaaa gcgcaattat ctattctgat taatcgttca ggttcttggg     64320
     ccgatgttgc tcgtcagtcc ctgcagcgtt ttgacagtac ccggcctgta gtgaaattcg     64380
     gcactgagca gtataccgca attcaccgtc agatgatggc ggcccatgca gctattacgc     64440
     tacaggaggt atcggagttt actgatgata tgcgaaactt tacagtggac tctattccac     64500
     tactgattca acttggacga agcagtttaa tggatgagca tttggttgaa cagagagaaa     64560
     agttgcgaga gctgacgacc atcgccgagc gactgaaccg gttggagcgg gaatggatgt     64620
     gacaagtgcc ccctaagcct tgagttgata tatccgagaa taggttaaga tttggcaatt     64680
     gcttaacaat aattattttc ttattaaaaa tacctaacac aaaaaatacg ttatatatac     64740
     aaatgaaaat ttccagtatt aatctcaaca agtttctcta ccggagaata ttaatctgga     64800
     atgtgtaata gagaaaattt ttgatgctat caaattttcc tttttcgcag aaatatccaa     64860
     tgtataggta tgataggagt tattgggaat ttttgttcga gtgctgcccg tctgttccgg     64920
     gttcacccat caacgattga acgtcttatt gcaatgtacc gtttatctgg aatataaaat     64980
     tcataccgct gttaattccc tgaataagga taaataaatg atcggaccaa tatcacaaat     65040
     aaatatctcc ggtggcttat cagaaaaaga gaccagttct ttaatcagta atgaagagct     65100
     taaaaatatc ataacacagt tggaaactga tatatcggat ggatcctggt tccataaaaa     65160
     ttattcacgt atggatgtag aagtcatgcc cgcattggta atccaggcga acaataaata     65220
     tccggaaatg aatcttaatc ttgttacatc tccattggac ctttcaatag aaataaaaaa     65280
     cgtcatagaa aatggagtta gatcttcccg cttcataatt aacatggggg aaggtggaat     65340
     acatttcagt gtaattgatt acaaacatat aaatgggaaa acatctctga tattgtttga     65400
     accagcaaac tttaacagta tggggccagc gatgctggca ataaggacaa aaacggctat     65460
     tgaacgttat caattacctg attgccattt ctccatggtg gaaatggata ttcagcgaag     65520
     ctcatctgaa tgtggtattt ttagttttgc actggcaaaa aaactttaca tcgagagaga     65580
     tagcctgttg aaaatacatg aagataatat aaaaggtata ttaagtgatg gtaaaaatcc     65640
     tttaccccac gataagttgg acccgtatct cccggtaact ttttacaaac atactcaagg     65700
     taaaaaacgt cttaatgaat atttaaatac taacccgcag ggagttggta ctgttgttaa     65760
     caaaaaaaat gaaaccatcg ttaatagatt tgataacaat aaatccattg tagatggaaa     65820
     ggaattatca gtttcggtac ataaaaagag aatagctgaa tataaaacac ttctcaaagt     65880
     ataatgtatt ttggaaatct tgctccagta tgggaatacg gttcagttct ttctggctca     65940
     tggtcaccaa catagacgct tcggattgcc tgcctgtgaa gaaacagatt aactggggtt     66000
     ctacgccgga atcccagatt tttccgtcac cccagtttca gcgctgctag agtacgggtg     66060
     gtatgagccg ctagcagaag ctctaaatag taacttcttc caatggccga aaaagaaagc     66120
     gttaaaaaat cacagtacgg gcatttctcg ggtttacgtt atttgtgcag aacgcacaaa     66180
     tcaggttatt agatattatt gcttatgaac gggtagtatt cagcgaaata cagctcctaa     66240
     ataactgcgc caaatagtag atcactgagg gaactcaatc cggtttaagc gatctgatca     66300
     atcgctgaat atcccaaatc accacaaccg gactgagtta tgccgatcat agcaccgata     66360
     cccagaaata aacgacatca gatggaaaaa attgtccata aaacagcaga caaaaaccat     66420
     tccagacatc tcatcgctga tccctcccca atatccgtac caggctaaat cagagatccg     66480
     gacctttttg atgacttcgg gcaaattctg ccggagtcag gttatttaac gaagaatgcg     66540
     gacgaaaatg attatattct tgccgccatt gttcaatttt ctcctgagca tcttccagag     66600
     aaaggaaccc gtgcacgttc agacattcat ccctcagact gccattaaat gactcgataa     66660
     aggcattatc tgtaggcttt ccggggcgtg aacagtccat cgtgaccctg ttttcatacg     66720
     cccatcggtc catcgacttc gagatgaatt cgctgccgtt atctgtctgc agcctttgtg     66780
     gaatacgccc cagcgaatgt tttaatctgt ccatgacagc cacaacatca tctccacgta     66840
     acccctgacc gacctcgagc gccagacatt cacgactaaa attatccact atagttagcg     66900
     ccctgacccg atgcccgttg aacagattat cagcaacgaa atccatgctc cagcactgat     66960
     ctaacgcggt cacttctgga cgtgcgtgcc tgtgcctcgt tgtcacatgc cgccgtggac     67020
     gtttcgaacg tagattgaga ccctcaagat aatcgcacgg aaaactgcat ccgtccggtg     67080
     gccgtaggcc gcaagaactg gttgttcgca gggtcattgc gtgccgggca acggatggcg     67140
     tccatcctga gtctgctgga aaccgccaaa ctcaacggcc acgaccctta tgtctggctg     67200
     cgcgatgtac tgacccgctt gccgacctgg cccaacagcc agctcaacgc gctgctacct     67260
     tacgccgaaa accgcttcag ctaattaccc cgccagctta ttgcattatt ttaatcgagc     67320
     aacgcgagtt caccgttcgg ttacagtatt accatctgtt cccgcttaat tttttaaaaa     67380
     atttaaggta acaatgagta tatatcttat gggaaaagcc aaaaaactaa cgaacactat     67440
     aataattcga ttaacattaa tgaaaataca cggctcacct attattaaaa taatacgact     67500
     agcattataa gaaaaaatat tttttatgtt tatagtatag gcgtgtattt aattaaggag     67560
     ggaagcatga acttatcatt aagcgatctt catcgtcagg tatctcgatt ggtgcagcaa     67620
     gagagcggtg attgtaccgg gaaattaaga ggtaacgttg ctgccaataa agaaactacc     67680
     tttcaaggtt tgaccatagc cagtggagcc agagagtcag aaaaagtatt tgctcaaact     67740
     gtactaagcc acgtagcaaa tgttgttcta actcaagaag ataccgctaa gctattgcaa     67800
     agtacggtaa agcataattt gaataattat gacttaagaa gtgtcggcaa tggtaatagt     67860
     gtacttgtca gtttacgtag tgaccaaatg acactacaag acgccaaagt gctgttggag     67920
     gccgcattgc gacaagagtc gggagcgagg gggcatgtat catctcattc acattcagcc     67980
     cttcacgcac cgggaacccc ggtgcgtgaa ggactgcgtt cacatctaga ccccagaact     68040
     ccaccgttgc caccgcgtga acgaccacac acttctggcc atcacggggc tggcgaagcc     68100
     agagccaccg caccaagcac tgtttctcct tatggcccag aagcgcgcgc agaactcagc     68160
     agccgcctca ccacattgcg caatacgctg gcgccagcaa cgaatgatcc gcgttactta     68220
     caagcctgcg gcggtgaaaa gctaaaccga tttagagata ttcaatgctg tcggcaaacc     68280
     gcagtacgcg ccgatcttaa tgccaattac atccaggtcg gtaacactcg taccatagcg     68340
     tgccagtatc cgctacaatc tcaacttgaa agccatttcc gtatgctggc agaaaaccga     68400
     acgccagtgt tggctgtttt agcgtccagt tctgagatag ccaatcaaag attcggtatg     68460
     ccagattatt tccgccagag tggtacctat ggcagtatca ctgtagagtc taaaatgact     68520
     cagcaagttg gtctcggtga cgggattatg gcagatatgt atactttaac gattcgtgaa     68580
     gcgggtcaaa aaacaatctc tgttcctgtg gttcatgttg gcaattggcc cgatcagacc     68640
     gcagtcagct ctgaagttac caaggcactc gcttcactgg tagatcaaac agcagaaaca     68700
     aaacgcaata tgtatgaaag caaaggaagt tcagcggtag gagatgactc caaattacgg     68760
     ccggtaatac attgccgtgc gggtgttggc cgtactgcgc aactgattgg cgcaatgtgc     68820
     atgaatgata gtcgtaatag tcagttaagc gtagaagata tggtcagcca aatgcgagta     68880
     caaagaaatg gtattatggt acaaaaagat gagcaacttg atgttctgat taagttggct     68940
     gaaggacaag ggcgaccatt attaaatagc taatgtaaat atttattcct atgagtaaat     69000
     aaaattacta agagatatac accactttgc caatcaaaga aactttaaac ctcaactaaa     69060
     gtaagcaatt agttgaggtt tatctgctgt agaataattt ttaacaaaaa tataaacaac     69120
     aaaattaaaa gttatgtgtc tactttatgt aaccaaacga gcctgtccat aattctgtgt     69180
     aatcgccact gtattaaagg tgatcgttta gacggtcacc gaactcgata ataaaacgac     69240
     tcattgccaa ccgccagttt tgtattggca tgctccattt tttcgaagca tcccggatag     69300
     ccagataaat aaccttccgc accgagtcgt ccgtcgggaa tactttgcat ttctttatcg     69360
     cctgccggat cacactgttc agtgactcaa tggcattcgt ggtgtagatg gccttgcgga     69420
     tatcgggcgg atagccgaag aaggtattga gattttccca gtgtgtatgt agtccctcct     69480
     atttttagta ccaccgccag tgaggatctc catccagttt ttgtcttgca tagataacgg     69540
     gtggcatatt acccagtgag ctatgcgggc gttcttcgtt atattccgtt cgccagtctt     69600
     ctgtaagcgt acggacttcg gacagtgaac ggaacaaata catatcaagt atcactccgt     69660
     gatgttctgc ccattcaacc agtgctgcag caataaattc tggaccgtta tcactccgta     69720
     taaaagcagg atagcctctt tctgtactta atcgctccaa aatacggacc actcggtgta     69780
     ccggtatatt caagtcaatt tcaattgcca gtgcttcccg gttaaaatct ccactacatt     69840
     gaataatctg aacctccgac cgtctgtcag ggcatcactc ataaaatcga ctgaccagca     69900
     gtggttcatt ttaagtggaa tagccaaagg ttgtggatgc cgattgggca ggcgcttttt     69960
     accttttcgc cgaaagttaa gcttcagtaa gcgataaacg cgatataccc gttttacatt     70020
     ccacggtaat ccagactgcc gtaacttatt gaacataaga ccaaagccat atgccggata     70080
     ttgatgtgcc aatttttgta atacctcaac aaccggtata tccctcgcgg tgttaggaca     70140
     ataatgcagc aaacttcgac tgatacccat aatccggcac ccgcgccgtt cactggcctg     70200
     atattccgtc atcacgtaac gcaccagttc gcgcttttca ggtaccgtta aagttttttt     70260
     gccacgacat ccttaagaat ttcatgatct aaactcaga                            70299
//

If you have problems or comments...

PBIL Back to PBIL home page